F486764
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 957 | 313 | 1914 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100123738|Ga0068857_1001237382 |
| Length | 219 |
| Sequence | MHRSLGKSDPSIAAYIADMSTLATFIQLGFRHIVDVEAMDHILFLLALAAIYRLRDARDALWVITAFTVGHSITLALAVTGIVTLPSALIEFLIPITIVATGIENLVVSDRTRAPWGGRYRPVFAGVFGLVHGAGFANYLKALFVDHIALPLFGFNVGIELGQITVLLAAAVLLAAVDRMIGALPWRRIDWPALRVRVVAVSLVVVAVASRWAVERNPW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 223 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 292 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 294 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 298 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.54 |
| Rhizosphere | 93.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068857_100123738 | 3300005577 | Bacteria | 2330 |
| 2 | MBSR1b_contig_11714938 | 2162886012 | Bacteria | 1375 |
| 3 | Ga0065715_10177927 | 3300005293 | Bacteria | 1497 |
| 4 | Ga0065715_10200486 | 3300005293 | Bacteria | 1364 |
| 5 | Ga0070676_10005285 | 3300005328 | Bacteria | 6866 |
| 6 | Ga0070683_100003389 | 3300005329 | Bacteria | 12915 |
| 7 | Ga0070683_100014074 | 3300005329 | Bacteria | 6987 |
| 8 | Ga0070683_100024705 | 3300005329 | Bacteria | 5385 |
| 9 | Ga0070683_100073927 | 3300005329 | Bacteria | 3182 |
| 10 | Ga0070683_100085692 | 3300005329 | Bacteria | 2953 |
| 11 | Ga0070683_100145987 | 3300005329 | Unclassified | 2242 |
| 12 | Ga0070683_100169958 | 3300005329 | Bacteria | 2069 |
| 13 | Ga0070683_100176545 | 3300005329 | Bacteria | 2028 |
| 14 | Ga0070683_100298876 | 3300005329 | Unclassified | 1531 |
| 15 | Ga0070683_100366536 | 3300005329 | Bacteria | 1372 |
| 16 | Ga0070690_100192241 | 3300005330 | Bacteria | 1416 |
| 17 | Ga0070670_100020074 | 3300005331 | Bacteria | 5739 |
| 18 | Ga0070670_100032599 | 3300005331 | Unclassified | 4487 |
| 19 | Ga0070670_100047997 | 3300005331 | Bacteria | 3675 |
| 20 | Ga0070670_100298559 | 3300005331 | Archaea | 1409 |
| 21 | Ga0068869_100008951 | 3300005334 | Bacteria | 6481 |
| 22 | Ga0068869_100051097 | 3300005334 | Bacteria | 2998 |
| 23 | Ga0070666_10012446 | 3300005335 | Bacteria | 5367 |
| 24 | Ga0070666_10199661 | 3300005335 | Bacteria | 1407 |
| 25 | Ga0070666_10569915 | 3300005335 | Bacteria | 825 |
| 26 | Ga0070680_100003560 | 3300005336 | Bacteria | 11622 |
| 27 | Ga0070680_100019138 | 3300005336 | Bacteria | 5422 |
| 28 | Ga0070680_100354453 | 3300005336 | Unclassified | 1248 |
| 29 | Ga0070682_100125580 | 3300005337 | Bacteria | 1729 |
| 30 | Ga0070682_101015285 | 3300005337 | Bacteria | 689 |
| 31 | Ga0068868_100128892 | 3300005338 | Bacteria | 2069 |
| 32 | Ga0068868_100165379 | 3300005338 | Bacteria | 1829 |
| 33 | Ga0070660_100074773 | 3300005339 | Bacteria | 2651 |
| 34 | Ga0070660_100621979 | 3300005339 | Bacteria | 904 |
| 35 | Ga0070689_100036132 | 3300005340 | Bacteria | 3778 |
| 36 | Ga0070689_100057724 | 3300005340 | Unclassified | 3013 |
| 37 | Ga0070689_100148918 | 3300005340 | Bacteria | 1887 |
| 38 | Ga0070689_100865080 | 3300005340 | Bacteria | 798 |
| 39 | Ga0070687_100005149 | 3300005343 | Bacteria | 5275 |
| 40 | Ga0070687_100044408 | 3300005343 | Bacteria | 2263 |
| 41 | Ga0070687_100114474 | 3300005343 | Bacteria | 1532 |
| 42 | Ga0070687_100185976 | 3300005343 | Bacteria | 1248 |
| 43 | Ga0070661_100014670 | 3300005344 | Bacteria | 5525 |
| 44 | Ga0070661_101018328 | 3300005344 | Bacteria | 687 |
| 45 | Ga0070692_10025009 | 3300005345 | Bacteria | 2940 |
| 46 | Ga0070692_10069202 | 3300005345 | Bacteria | 1877 |
| 47 | Ga0070668_100004653 | 3300005347 | Bacteria | 10162 |
| 48 | Ga0070668_100006466 | 3300005347 | Bacteria | 8688 |
| 49 | Ga0070668_100010136 | 3300005347 | Bacteria | 6987 |
| 50 | Ga0070668_100085116 | 3300005347 | Bacteria | 2485 |
| 51 | Ga0070668_100604601 | 3300005347 | Unclassified | 960 |
| 52 | Ga0070668_100929962 | 3300005347 | Unclassified | 778 |
| 53 | Ga0070669_100010261 | 3300005353 | Bacteria | 6654 |
| 54 | Ga0070669_100017780 | 3300005353 | Bacteria | 5074 |
| 55 | Ga0070669_100106104 | 3300005353 | Bacteria | 2126 |
| 56 | Ga0070669_100131038 | 3300005353 | Bacteria | 1924 |
| 57 | Ga0070669_100237633 | 3300005353 | Unclassified | 1446 |
| 58 | Ga0070669_100258613 | 3300005353 | Bacteria | 1388 |
| 59 | Ga0070669_100317872 | 3300005353 | Bacteria | 1256 |
| 60 | Ga0070675_100002030 | 3300005354 | Bacteria | 15012 |
| 61 | Ga0070675_100022286 | 3300005354 | Bacteria | 5060 |
| 62 | Ga0070675_100029974 | 3300005354 | Bacteria | 4390 |
| 63 | Ga0070675_100047973 | 3300005354 | Bacteria | 3501 |
| 64 | Ga0070675_100199441 | 3300005354 | Bacteria | 1737 |
| 65 | Ga0070675_100456879 | 3300005354 | Unclassified | 1146 |
| 66 | Ga0070675_100590357 | 3300005354 | Bacteria | 1007 |
| 67 | Ga0070671_100019855 | 3300005355 | Bacteria | 5475 |
| 68 | Ga0070671_100047955 | 3300005355 | Bacteria | 3552 |
| 69 | Ga0070671_100299905 | 3300005355 | Bacteria | 1368 |
| 70 | Ga0070674_100000069 | 3300005356 | Bacteria | 47131 |
| 71 | Ga0070674_100618672 | 3300005356 | Bacteria | 917 |
| 72 | Ga0070674_100755096 | 3300005356 | Bacteria | 836 |
| 73 | Ga0070673_100038744 | 3300005364 | Bacteria | 3642 |
| 74 | Ga0070673_100049642 | 3300005364 | Unclassified | 3277 |
| 75 | Ga0070673_100115429 | 3300005364 | Bacteria | 2233 |
| 76 | Ga0070673_100136280 | 3300005364 | Unclassified | 2066 |
| 77 | Ga0070673_100445373 | 3300005364 | Bacteria | 1164 |
| 78 | Ga0070673_100993108 | 3300005364 | Unclassified | 781 |
| 79 | Ga0070688_100084598 | 3300005365 | Unclassified | 2061 |
| 80 | Ga0070688_100092570 | 3300005365 | Unclassified | 1978 |
| 81 | Ga0070688_100155538 | 3300005365 | Unclassified | 1566 |
| 82 | Ga0070659_100008580 | 3300005366 | Bacteria | 7471 |
| 83 | Ga0070659_100013958 | 3300005366 | Bacteria | 5996 |
| 84 | Ga0070659_100206745 | 3300005366 | Bacteria | 1617 |
| 85 | Ga0070659_100321649 | 3300005366 | Unclassified | 1293 |
| 86 | Ga0070667_100079559 | 3300005367 | Bacteria | 2802 |
| 87 | Ga0070667_100089162 | 3300005367 | Bacteria | 2649 |
| 88 | Ga0070667_100693451 | 3300005367 | Bacteria | 942 |
| 89 | Ga0070703_10031925 | 3300005406 | Bacteria | 1596 |
| 90 | Ga0070703_10181784 | 3300005406 | Unclassified | 813 |
| 91 | Ga0070709_10112565 | 3300005434 | Bacteria | 1832 |
| 92 | Ga0070709_10216278 | 3300005434 | Bacteria | 1364 |
| 93 | Ga0070714_100031119 | 3300005435 | Unclassified | 4449 |
| 94 | Ga0070713_100096868 | 3300005436 | Unclassified | 2548 |
| 95 | Ga0070713_100273872 | 3300005436 | Unclassified | 1546 |
| 96 | Ga0070713_100615105 | 3300005436 | Bacteria | 1033 |
| 97 | Ga0070710_10596859 | 3300005437 | Unclassified | 768 |
| 98 | Ga0070701_10095669 | 3300005438 | Unclassified | 1636 |
| 99 | Ga0070711_100000132 | 3300005439 | Bacteria | 39959 |
| 100 | Ga0070711_100054495 | 3300005439 | Bacteria | 2760 |
| 101 | Ga0070711_101003569 | 3300005439 | Bacteria | 716 |
| 102 | Ga0070705_100038355 | 3300005440 | Unclassified | 2710 |
| 103 | Ga0070705_100150348 | 3300005440 | Unclassified | 1544 |
| 104 | Ga0070705_100220670 | 3300005440 | Bacteria | 1312 |
| 105 | Ga0070705_100286393 | 3300005440 | Bacteria | 1174 |
| 106 | Ga0070705_100694781 | 3300005440 | Unclassified | 798 |
| 107 | Ga0070700_100129253 | 3300005441 | Bacteria | 1702 |
| 108 | Ga0070700_100147934 | 3300005441 | Bacteria | 1603 |
| 109 | Ga0070694_100012928 | 3300005444 | Bacteria | 5205 |
| 110 | Ga0070694_100015711 | 3300005444 | Bacteria | 4759 |
| 111 | Ga0070694_100045604 | 3300005444 | Bacteria | 2939 |
| 112 | Ga0070694_100100112 | 3300005444 | Bacteria | 2049 |
| 113 | Ga0070694_100119481 | 3300005444 | Bacteria | 1889 |
| 114 | Ga0070694_100142981 | 3300005444 | Unclassified | 1739 |
| 115 | Ga0070694_100189167 | 3300005444 | Bacteria | 1528 |
| 116 | Ga0070694_100246569 | 3300005444 | Bacteria | 1349 |
| 117 | Ga0070694_100254301 | 3300005444 | Bacteria | 1330 |
| 118 | Ga0070708_100000188 | 3300005445 | Bacteria | 44633 |
| 119 | Ga0070708_100002610 | 3300005445 | Bacteria | 13948 |
| 120 | Ga0070708_100017477 | 3300005445 | Bacteria | 5985 |
| 121 | Ga0070708_100024977 | 3300005445 | Bacteria | 5106 |
| 122 | Ga0070708_100107925 | 3300005445 | Bacteria | 2556 |
| 123 | Ga0070708_100120614 | 3300005445 | Bacteria | 2419 |
| 124 | Ga0070708_100133834 | 3300005445 | Bacteria | 2295 |
| 125 | Ga0070708_100171405 | 3300005445 | Unclassified | 2026 |
| 126 | Ga0070708_100216924 | 3300005445 | Unclassified | 1794 |
| 127 | Ga0070708_100323903 | 3300005445 | Bacteria | 1452 |
| 128 | Ga0070678_100114192 | 3300005456 | Bacteria | 2118 |
| 129 | Ga0070678_100308580 | 3300005456 | Bacteria | 1347 |
| 130 | Ga0070678_100615488 | 3300005456 | Unclassified | 971 |
| 131 | Ga0070662_100030680 | 3300005457 | Unclassified | 3765 |
| 132 | Ga0070662_100122725 | 3300005457 | Bacteria | 1993 |
| 133 | Ga0070681_10001675 | 3300005458 | Bacteria | 19788 |
| 134 | Ga0070681_10022137 | 3300005458 | Bacteria | 6379 |
| 135 | Ga0070681_10078107 | 3300005458 | Bacteria | 3267 |
| 136 | Ga0070681_10263354 | 3300005458 | Bacteria | 1636 |
| 137 | Ga0070681_10973979 | 3300005458 | Unclassified | 768 |
| 138 | Ga0068867_100002961 | 3300005459 | Bacteria | 11958 |
| 139 | Ga0068867_100122866 | 3300005459 | Bacteria | 2008 |
| 140 | Ga0068867_100210240 | 3300005459 | Bacteria | 1562 |
| 141 | Ga0068867_101018145 | 3300005459 | Bacteria | 752 |
| 142 | Ga0070685_10006186 | 3300005466 | Bacteria | 6092 |
| 143 | Ga0070685_10015845 | 3300005466 | Unclassified | 4008 |
| 144 | Ga0070685_10202271 | 3300005466 | Bacteria | 1292 |
| 145 | Ga0070706_100004664 | 3300005467 | Bacteria | 13147 |
| 146 | Ga0070706_100069962 | 3300005467 | Bacteria | 3245 |
| 147 | Ga0070706_100188398 | 3300005467 | Bacteria | 1928 |
| 148 | Ga0070706_100289524 | 3300005467 | Bacteria | 1528 |
| 149 | Ga0070706_100395065 | 3300005467 | Bacteria | 1287 |
| 150 | Ga0070707_100003729 | 3300005468 | Bacteria | 14376 |
| 151 | Ga0070707_100026185 | 3300005468 | Bacteria | 5536 |
| 152 | Ga0070707_100026489 | 3300005468 | Bacteria | 5505 |
| 153 | Ga0070707_100073463 | 3300005468 | Unclassified | 3297 |
| 154 | Ga0070707_100128430 | 3300005468 | Bacteria | 2464 |
| 155 | Ga0070707_100171540 | 3300005468 | Unclassified | 2114 |
| 156 | Ga0070707_100788852 | 3300005468 | Bacteria | 914 |
| 157 | Ga0070698_100000668 | 3300005471 | Bacteria | 36568 |
| 158 | Ga0070698_100001479 | 3300005471 | Bacteria | 26097 |
| 159 | Ga0070698_100300389 | 3300005471 | Bacteria | 1536 |
| 160 | Ga0070698_100386315 | 3300005471 | Bacteria | 1333 |
| 161 | Ga0070698_100609268 | 3300005471 | Bacteria | 1032 |
| 162 | Ga0070698_100949922 | 3300005471 | Unclassified | 806 |
| 163 | Ga0070699_100001479 | 3300005518 | Bacteria | 21520 |
| 164 | Ga0070699_100006406 | 3300005518 | Bacteria | 10250 |
| 165 | Ga0070699_100007572 | 3300005518 | Bacteria | 9441 |
| 166 | Ga0070699_100033855 | 3300005518 | Bacteria | 4414 |
| 167 | Ga0070699_100040293 | 3300005518 | Bacteria | 4045 |
| 168 | Ga0070699_100048237 | 3300005518 | Bacteria | 3685 |
| 169 | Ga0070699_100051965 | 3300005518 | Bacteria | 3548 |
| 170 | Ga0070699_100227814 | 3300005518 | Unclassified | 1662 |
| 171 | Ga0070699_100304521 | 3300005518 | Unclassified | 1430 |
| 172 | Ga0070699_100507755 | 3300005518 | Bacteria | 1095 |
| 173 | Ga0070679_100008772 | 3300005530 | Bacteria | 9537 |
| 174 | Ga0070679_100053773 | 3300005530 | Bacteria | 4008 |
| 175 | Ga0070679_100115061 | 3300005530 | Unclassified | 2675 |
| 176 | Ga0070684_100018722 | 3300005535 | Bacteria | 5712 |
| 177 | Ga0070684_100020863 | 3300005535 | Bacteria | 5439 |
| 178 | Ga0070684_100033927 | 3300005535 | Unclassified | 4360 |
| 179 | Ga0070684_100048534 | 3300005535 | Bacteria | 3683 |
| 180 | Ga0070684_100106194 | 3300005535 | Bacteria | 2513 |
| 181 | Ga0070684_100144800 | 3300005535 | Unclassified | 2150 |
| 182 | Ga0070684_100285996 | 3300005535 | Bacteria | 1511 |
| 183 | Ga0070684_100323866 | 3300005535 | Bacteria | 1416 |
| 184 | Ga0070684_100393338 | 3300005535 | Unclassified | 1278 |
| 185 | Ga0070684_100417628 | 3300005535 | Bacteria | 1238 |
| 186 | Ga0070684_100437105 | 3300005535 | Unclassified | 1209 |
| 187 | Ga0070697_100013007 | 3300005536 | Bacteria | 6523 |
| 188 | Ga0070697_100021746 | 3300005536 | Bacteria | 5084 |
| 189 | Ga0070697_100039493 | 3300005536 | Bacteria | 3816 |
| 190 | Ga0070697_100081738 | 3300005536 | Bacteria | 2662 |
| 191 | Ga0070697_100097438 | 3300005536 | Bacteria | 2440 |
| 192 | Ga0070697_100181817 | 3300005536 | Unclassified | 1782 |
| 193 | Ga0070697_100206066 | 3300005536 | Bacteria | 1673 |
| 194 | Ga0070697_100224661 | 3300005536 | Unclassified | 1601 |
| 195 | Ga0070697_100250867 | 3300005536 | Bacteria | 1513 |
| 196 | Ga0070697_100374622 | 3300005536 | Bacteria | 1232 |
| 197 | Ga0068853_100050521 | 3300005539 | Unclassified | 3577 |
| 198 | Ga0068853_100116338 | 3300005539 | Bacteria | 2380 |
| 199 | Ga0068853_100170151 | 3300005539 | Bacteria | 1971 |
| 200 | Ga0068853_100260109 | 3300005539 | Bacteria | 1595 |
| 201 | Ga0068853_100333140 | 3300005539 | Bacteria | 1409 |
| 202 | Ga0070672_100043316 | 3300005543 | Bacteria | 3469 |
| 203 | Ga0070672_100082084 | 3300005543 | Unclassified | 2586 |
| 204 | Ga0070672_100659162 | 3300005543 | Bacteria | 914 |
| 205 | Ga0070686_100000114 | 3300005544 | Bacteria | 56363 |
| 206 | Ga0070686_100066865 | 3300005544 | Bacteria | 2340 |
| 207 | Ga0070695_100002531 | 3300005545 | Bacteria | 10557 |
| 208 | Ga0070695_100004641 | 3300005545 | Bacteria | 8074 |
| 209 | Ga0070695_100048443 | 3300005545 | Bacteria | 2717 |
| 210 | Ga0070695_100109012 | 3300005545 | Bacteria | 1876 |
| 211 | Ga0070695_100158079 | 3300005545 | Bacteria | 1588 |
| 212 | Ga0070695_100253636 | 3300005545 | Bacteria | 1282 |
| 213 | Ga0070696_100000241 | 3300005546 | Bacteria | 32915 |
| 214 | Ga0070696_100009848 | 3300005546 | Bacteria | 6392 |
| 215 | Ga0070696_100019530 | 3300005546 | Bacteria | 4589 |
| 216 | Ga0070696_100040174 | 3300005546 | Bacteria | 3230 |
| 217 | Ga0070696_100148010 | 3300005546 | Bacteria | 1721 |
| 218 | Ga0070696_100158280 | 3300005546 | Unclassified | 1667 |
| 219 | Ga0070696_100226812 | 3300005546 | Unclassified | 1404 |
| 220 | Ga0070696_100361606 | 3300005546 | Unclassified | 1126 |
| 221 | Ga0070696_100619279 | 3300005546 | Bacteria | 874 |
| 222 | Ga0070693_100001077 | 3300005547 | Bacteria | 12211 |
| 223 | Ga0070665_100241285 | 3300005548 | Bacteria | 1808 |
| 224 | Ga0070704_100009110 | 3300005549 | Bacteria | 5990 |
| 225 | Ga0070704_100074055 | 3300005549 | Unclassified | 2483 |
| 226 | Ga0070704_100283144 | 3300005549 | Bacteria | 1374 |
| 227 | Ga0068855_100100024 | 3300005563 | Bacteria | 3339 |
| 228 | Ga0070664_100031879 | 3300005564 | Bacteria | 4407 |
| 229 | Ga0070664_100032017 | 3300005564 | Unclassified | 4398 |
| 230 | Ga0070664_100206275 | 3300005564 | Bacteria | 1755 |
| 231 | Ga0070664_100247244 | 3300005564 | Unclassified | 1602 |
| 232 | Ga0070664_100283058 | 3300005564 | Bacteria | 1495 |
| 233 | Ga0070664_100458478 | 3300005564 | Unclassified | 1171 |
| 234 | Ga0070664_100807487 | 3300005564 | Bacteria | 877 |
| 235 | Ga0068857_100004955 | 3300005577 | Bacteria | 11311 |
| 236 | Ga0068857_100007823 | 3300005577 | Bacteria | 9216 |
| 237 | Ga0068857_100011807 | 3300005577 | Bacteria | 7597 |
| 238 | Ga0068857_100115451 | 3300005577 | Unclassified | 2415 |
| 239 | Ga0068854_100003232 | 3300005578 | Bacteria | 10161 |
| 240 | Ga0068854_100081057 | 3300005578 | Bacteria | 2396 |
| 241 | Ga0068854_100746702 | 3300005578 | Bacteria | 848 |
| 242 | Ga0068856_100028535 | 3300005614 | Bacteria | 5449 |
| 243 | Ga0068856_100045653 | 3300005614 | Bacteria | 4315 |
| 244 | Ga0068856_100755481 | 3300005614 | Bacteria | 992 |
| 245 | Ga0068856_101110712 | 3300005614 | Bacteria | 808 |
| 246 | Ga0070702_100003782 | 3300005615 | Bacteria | 6837 |
| 247 | Ga0070702_100037858 | 3300005615 | Bacteria | 2681 |
| 248 | Ga0068852_100014555 | 3300005616 | Bacteria | 6061 |
| 249 | Ga0068852_100080929 | 3300005616 | Bacteria | 2882 |
| 250 | Ga0068852_100132849 | 3300005616 | Unclassified | 2294 |
| 251 | Ga0068852_100194517 | 3300005616 | Bacteria | 1916 |
| 252 | Ga0068852_100555471 | 3300005616 | Bacteria | 1149 |
| 253 | Ga0068859_100006533 | 3300005617 | Bacteria | 11838 |
| 254 | Ga0068859_100153091 | 3300005617 | Bacteria | 2382 |
| 255 | Ga0068859_100325500 | 3300005617 | Bacteria | 1631 |
| 256 | Ga0068859_101299583 | 3300005617 | Bacteria | 802 |
| 257 | Ga0068864_100000669 | 3300005618 | Bacteria | 28600 |
| 258 | Ga0068864_100007489 | 3300005618 | Bacteria | 8994 |
| 259 | Ga0068864_100018976 | 3300005618 | Bacteria | 5749 |
| 260 | Ga0068864_100095394 | 3300005618 | Unclassified | 2630 |
| 261 | Ga0068864_100363959 | 3300005618 | Bacteria | 1367 |
| 262 | Ga0068866_10000619 | 3300005718 | Bacteria | 16200 |
| 263 | Ga0068861_100004749 | 3300005719 | Bacteria | 9133 |
| 264 | Ga0068861_100021579 | 3300005719 | Bacteria | 4629 |
| 265 | Ga0068861_100114083 | 3300005719 | Bacteria | 2169 |
| 266 | Ga0068861_100523464 | 3300005719 | Bacteria | 1076 |
| 267 | Ga0068851_10023940 | 3300005834 | Unclassified | 2987 |
| 268 | Ga0068851_10029966 | 3300005834 | Bacteria | 2696 |
| 269 | Ga0068851_10282228 | 3300005834 | Bacteria | 950 |
| 270 | Ga0068870_10028183 | 3300005840 | Unclassified | 2817 |
| 271 | Ga0068870_10096015 | 3300005840 | Bacteria | 1666 |
| 272 | Ga0068863_100038000 | 3300005841 | Bacteria | 4581 |
| 273 | Ga0068863_100054592 | 3300005841 | Bacteria | 3785 |
| 274 | Ga0068863_100392811 | 3300005841 | Bacteria | 1356 |
| 275 | Ga0068863_100525076 | 3300005841 | Bacteria | 1167 |
| 276 | Ga0068858_100033195 | 3300005842 | Bacteria | 4792 |
| 277 | Ga0068858_100045418 | 3300005842 | Bacteria | 4071 |
| 278 | Ga0068858_100092628 | 3300005842 | Bacteria | 2813 |
| 279 | Ga0068860_100059238 | 3300005843 | Unclassified | 3641 |
| 280 | Ga0068862_100001715 | 3300005844 | Bacteria | 19837 |
| 281 | Ga0068862_100116238 | 3300005844 | Unclassified | 2353 |
| 282 | Ga0068862_100159984 | 3300005844 | Bacteria | 2009 |
| 283 | Ga0068862_100296858 | 3300005844 | Bacteria | 1485 |
| 284 | Ga0070717_10413876 | 3300006028 | Bacteria | 1212 |
| 285 | Ga0070716_100162156 | 3300006173 | Bacteria | 1450 |
| 286 | Ga0070712_100786490 | 3300006175 | Unclassified | 816 |
| 287 | Ga0097621_100025205 | 3300006237 | Bacteria | 4651 |
| 288 | Ga0068871_100010208 | 3300006358 | Bacteria | 6840 |
| 289 | Ga0068871_100047421 | 3300006358 | Unclassified | 3465 |
| 290 | Ga0075428_100009465 | 3300006844 | Bacteria | 10813 |
| 291 | Ga0075428_100072228 | 3300006844 | Bacteria | 3770 |
| 292 | Ga0075430_100001631 | 3300006846 | Bacteria | 18318 |
| 293 | Ga0075430_100019552 | 3300006846 | Bacteria | 5761 |
| 294 | Ga0075430_100209610 | 3300006846 | Bacteria | 1617 |
| 295 | Ga0075431_100003312 | 3300006847 | Bacteria | 15601 |
| 296 | Ga0075431_100029554 | 3300006847 | Bacteria | 5643 |
| 297 | Ga0075431_100031351 | 3300006847 | Bacteria | 5476 |
| 298 | Ga0075431_101275727 | 3300006847 | Unclassified | 696 |
| 299 | Ga0075433_10000784 | 3300006852 | Bacteria | 21949 |
| 300 | Ga0075433_10002805 | 3300006852 | Bacteria | 13352 |
| 301 | Ga0075433_10005515 | 3300006852 | Bacteria | 9934 |
| 302 | Ga0075433_10014997 | 3300006852 | Bacteria | 6345 |
| 303 | Ga0075433_10017886 | 3300006852 | Bacteria | 5880 |
| 304 | Ga0075433_10060199 | 3300006852 | Bacteria | 3324 |
| 305 | Ga0075433_10076834 | 3300006852 | Bacteria | 2941 |
| 306 | Ga0075433_10104484 | 3300006852 | Unclassified | 2510 |
| 307 | Ga0075433_10129053 | 3300006852 | Bacteria | 2246 |
| 308 | Ga0075433_10139652 | 3300006852 | Bacteria | 2153 |
| 309 | Ga0075433_10310518 | 3300006852 | Bacteria | 1396 |
| 310 | Ga0075433_10761740 | 3300006852 | Unclassified | 847 |
| 311 | Ga0075434_100001037 | 3300006871 | Bacteria | 22656 |
| 312 | Ga0075434_100003544 | 3300006871 | Bacteria | 13936 |
| 313 | Ga0075434_100030607 | 3300006871 | Bacteria | 5301 |
| 314 | Ga0075434_100044406 | 3300006871 | Bacteria | 4409 |
| 315 | Ga0075434_100051175 | 3300006871 | Bacteria | 4104 |
| 316 | Ga0075434_100168357 | 3300006871 | Unclassified | 2211 |
| 317 | Ga0075434_100183076 | 3300006871 | Unclassified | 2116 |
| 318 | Ga0075434_100188822 | 3300006871 | Bacteria | 2081 |
| 319 | Ga0075434_100241240 | 3300006871 | Bacteria | 1827 |
| 320 | Ga0075434_100341026 | 3300006871 | Bacteria | 1519 |
| 321 | Ga0075429_100018080 | 3300006880 | Bacteria | 6098 |
| 322 | Ga0075429_100029208 | 3300006880 | Bacteria | 4789 |
| 323 | Ga0075429_100138452 | 3300006880 | Bacteria | 2131 |
| 324 | Ga0068865_100008800 | 3300006881 | Bacteria | 6242 |
| 325 | Ga0068865_100056467 | 3300006881 | Unclassified | 2735 |
| 326 | Ga0068865_100163938 | 3300006881 | Bacteria | 1698 |
| 327 | Ga0075436_100025162 | 3300006914 | Bacteria | 4093 |
| 328 | Ga0075436_100044438 | 3300006914 | Bacteria | 3063 |
| 329 | Ga0075436_100150778 | 3300006914 | Bacteria | 1636 |
| 330 | Ga0097620_100006532 | 3300006931 | Bacteria | 11838 |
| 331 | Ga0097620_100153093 | 3300006931 | Bacteria | 2382 |
| 332 | Ga0097620_100325513 | 3300006931 | Bacteria | 1631 |
| 333 | Ga0097620_101299640 | 3300006931 | Bacteria | 802 |
| 334 | Ga0075435_100018185 | 3300007076 | Bacteria | 5337 |
| 335 | Ga0075435_100025282 | 3300007076 | Bacteria | 4621 |
| 336 | Ga0075435_100064339 | 3300007076 | Bacteria | 2980 |
| 337 | Ga0075435_100356081 | 3300007076 | Bacteria | 1255 |
| 338 | Ga0075435_100400844 | 3300007076 | Bacteria | 1180 |
| 339 | Ga0105240_10005769 | 3300009093 | Bacteria | 18361 |
| 340 | Ga0105240_10239835 | 3300009093 | Bacteria | 2102 |
| 341 | Ga0105240_10273584 | 3300009093 | Bacteria | 1943 |
| 342 | Ga0105240_10721767 | 3300009093 | Bacteria | 1086 |
| 343 | Ga0111539_10036569 | 3300009094 | Bacteria | 5934 |
| 344 | Ga0111539_10074930 | 3300009094 | Bacteria | 3988 |
| 345 | Ga0111539_10233074 | 3300009094 | Bacteria | 2143 |
| 346 | Ga0105245_10013096 | 3300009098 | Bacteria | 7226 |
| 347 | Ga0105245_10046580 | 3300009098 | Bacteria | 3875 |
| 348 | Ga0105245_10114320 | 3300009098 | Bacteria | 2514 |
| 349 | Ga0105245_10682031 | 3300009098 | Unclassified | 1060 |
| 350 | Ga0105245_10945025 | 3300009098 | Bacteria | 905 |
| 351 | Ga0114129_10012770 | 3300009147 | Bacteria | 11955 |
| 352 | Ga0114129_10133324 | 3300009147 | Bacteria | 3411 |
| 353 | Ga0114129_10214148 | 3300009147 | Bacteria | 2602 |
| 354 | Ga0114129_10249413 | 3300009147 | Bacteria | 2384 |
| 355 | Ga0114129_10382371 | 3300009147 | Bacteria | 1859 |
| 356 | Ga0114129_10669150 | 3300009147 | Bacteria | 1338 |
| 357 | Ga0114129_10676128 | 3300009147 | Bacteria | 1330 |
| 358 | Ga0114129_10930808 | 3300009147 | Bacteria | 1099 |
| 359 | Ga0114129_11242091 | 3300009147 | Unclassified | 926 |
| 360 | Ga0114129_11258135 | 3300009147 | Unclassified | 919 |
| 361 | Ga0105243_10003139 | 3300009148 | Bacteria | 13569 |
| 362 | Ga0105243_10684579 | 3300009148 | Bacteria | 998 |
| 363 | Ga0105241_10001507 | 3300009174 | Bacteria | 17870 |
| 364 | Ga0105241_10035622 | 3300009174 | Bacteria | 3743 |
| 365 | Ga0105241_10631330 | 3300009174 | Bacteria | 971 |
| 366 | Ga0105242_10002497 | 3300009176 | Bacteria | 14419 |
| 367 | Ga0105242_10086854 | 3300009176 | Bacteria | 2625 |
| 368 | Ga0105242_10345074 | 3300009176 | Bacteria | 1373 |
| 369 | Ga0105248_10004111 | 3300009177 | Bacteria | 16093 |
| 370 | Ga0105248_10014964 | 3300009177 | Bacteria | 8541 |
| 371 | Ga0105248_10068908 | 3300009177 | Bacteria | 3972 |
| 372 | Ga0105248_10151606 | 3300009177 | Bacteria | 2615 |
| 373 | Ga0105248_10153205 | 3300009177 | Unclassified | 2600 |
| 374 | Ga0105237_10021484 | 3300009545 | Bacteria | 6633 |
| 375 | Ga0105238_10000081 | 3300009551 | Bacteria | 107822 |
| 376 | Ga0105238_10180937 | 3300009551 | Bacteria | 2085 |
| 377 | Ga0105238_10191528 | 3300009551 | Bacteria | 2021 |
| 378 | Ga0105249_10000180 | 3300009553 | Bacteria | 74064 |
| 379 | Ga0105249_10000231 | 3300009553 | Bacteria | 63172 |
| 380 | Ga0105249_10005450 | 3300009553 | Bacteria | 10982 |
| 381 | Ga0105249_10045737 | 3300009553 | Bacteria | 3982 |
| 382 | Ga0105249_10111769 | 3300009553 | Bacteria | 2583 |
| 383 | Ga0105249_10146143 | 3300009553 | Bacteria | 2272 |
| 384 | Ga0105249_10299552 | 3300009553 | Bacteria | 1612 |
| 385 | Ga0105249_10476987 | 3300009553 | Unclassified | 1290 |
| 386 | Ga0105239_10005622 | 3300010375 | Bacteria | 14657 |
| 387 | Ga0105239_10011262 | 3300010375 | Bacteria | 9976 |
| 388 | Ga0105239_10016864 | 3300010375 | Bacteria | 8073 |
| 389 | Ga0105239_10097898 | 3300010375 | Unclassified | 3242 |
| 390 | Ga0105239_10181236 | 3300010375 | Bacteria | 2357 |
| 391 | Ga0105239_11299224 | 3300010375 | Bacteria | 839 |
| 392 | Ga0105246_10015254 | 3300011119 | Unclassified | 4848 |
| 393 | Ga0105246_10038682 | 3300011119 | Bacteria | 3209 |
| 394 | Ga0105246_10734562 | 3300011119 | Unclassified | 869 |
| 395 | Ga0105246_10934518 | 3300011119 | Bacteria | 780 |
| 396 | Ga0157373_10582972 | 3300013100 | Bacteria | 813 |
| 397 | Ga0157371_10008591 | 3300013102 | Bacteria | 8117 |
| 398 | Ga0157371_10014063 | 3300013102 | Bacteria | 6054 |
| 399 | Ga0157371_10619241 | 3300013102 | Unclassified | 806 |
| 400 | Ga0157370_10016812 | 3300013104 | Bacteria | 7395 |
| 401 | Ga0157370_10139685 | 3300013104 | Bacteria | 2257 |
| 402 | Ga0157369_10057814 | 3300013105 | Bacteria | 4183 |
| 403 | Ga0157369_10080591 | 3300013105 | Unclassified | 3485 |
| 404 | Ga0157369_10096501 | 3300013105 | Unclassified | 3154 |
| 405 | Ga0157369_10339297 | 3300013105 | Unclassified | 1561 |
| 406 | Ga0157369_10498752 | 3300013105 | Bacteria | 1260 |
| 407 | Ga0157369_10943840 | 3300013105 | Unclassified | 884 |
| 408 | Ga0157374_10004155 | 3300013296 | Bacteria | 12149 |
| 409 | Ga0157374_10112549 | 3300013296 | Bacteria | 2619 |
| 410 | Ga0157374_10131613 | 3300013296 | Unclassified | 2421 |
| 411 | Ga0157374_10639000 | 3300013296 | Unclassified | 1076 |
| 412 | Ga0157378_10000788 | 3300013297 | Bacteria | 29413 |
| 413 | Ga0157378_10093418 | 3300013297 | Bacteria | 2738 |
| 414 | Ga0157378_10721334 | 3300013297 | Bacteria | 1018 |
| 415 | Ga0163162_10020298 | 3300013306 | Bacteria | 6526 |
| 416 | Ga0163162_10071700 | 3300013306 | Bacteria | 3518 |
| 417 | Ga0163162_10525218 | 3300013306 | Bacteria | 1313 |
| 418 | Ga0157372_10002537 | 3300013307 | Bacteria | 19815 |
| 419 | Ga0157372_10012310 | 3300013307 | Bacteria | 9116 |
| 420 | Ga0157372_10103936 | 3300013307 | Bacteria | 3247 |
| 421 | Ga0157372_10279424 | 3300013307 | Bacteria | 1941 |
| 422 | Ga0157372_10344008 | 3300013307 | Unclassified | 1737 |
| 423 | Ga0157372_10589333 | 3300013307 | Unclassified | 1296 |
| 424 | Ga0157372_11237018 | 3300013307 | Bacteria | 862 |
| 425 | Ga0157375_10068436 | 3300013308 | Unclassified | 3553 |
| 426 | Ga0157375_10093743 | 3300013308 | Bacteria | 3069 |
| 427 | Ga0157375_10170810 | 3300013308 | Bacteria | 2322 |
| 428 | Ga0157375_10248462 | 3300013308 | Bacteria | 1939 |
| 429 | Ga0157375_10522745 | 3300013308 | Bacteria | 1350 |
| 430 | Ga0157375_10548755 | 3300013308 | Bacteria | 1317 |
| 431 | Ga0163163_10003217 | 3300014325 | Bacteria | 13838 |
| 432 | Ga0163163_10023684 | 3300014325 | Bacteria | 5830 |
| 433 | Ga0163163_10873856 | 3300014325 | Bacteria | 962 |
| 434 | Ga0157380_10006354 | 3300014326 | Bacteria | 8311 |
| 435 | Ga0157380_10020831 | 3300014326 | Unclassified | 4908 |
| 436 | Ga0182008_10011270 | 3300014497 | Bacteria | 4763 |
| 437 | Ga0157377_10009075 | 3300014745 | Bacteria | 4872 |
| 438 | Ga0157377_10051514 | 3300014745 | Bacteria | 2322 |
| 439 | Ga0157377_10414755 | 3300014745 | Unclassified | 920 |
| 440 | Ga0157377_10454447 | 3300014745 | Unclassified | 885 |
| 441 | Ga0157379_10061161 | 3300014968 | Bacteria | 3368 |
| 442 | Ga0157379_10347565 | 3300014968 | Bacteria | 1357 |
| 443 | Ga0157376_10808717 | 3300014969 | Bacteria | 950 |
| 444 | Ga0182005_1011205 | 3300015265 | Unclassified | 2562 |
| 445 | Ga0163161_10016469 | 3300017792 | Bacteria | 5161 |
| 446 | Ga0163161_10152900 | 3300017792 | Unclassified | 1755 |
| 447 | Ga0163161_10155767 | 3300017792 | Bacteria | 1739 |
| 448 | Ga0213876_10028493 | 3300021384 | Bacteria | 2945 |
| 449 | Ga0213875_10007636 | 3300021388 | Bacteria | 5573 |
| 450 | Ga0207673_1010238 | 3300025290 | Bacteria | 1204 |
| 451 | Ga0207697_10009061 | 3300025315 | Bacteria | 4314 |
| 452 | Ga0207656_10034765 | 3300025321 | Bacteria | 2106 |
| 453 | Ga0207656_10224112 | 3300025321 | Unclassified | 914 |
| 454 | Ga0207653_10007615 | 3300025885 | Unclassified | 3377 |
| 455 | Ga0207653_10085451 | 3300025885 | Bacteria | 1098 |
| 456 | Ga0207642_10001673 | 3300025899 | Bacteria | 6844 |
| 457 | Ga0207642_10105414 | 3300025899 | Bacteria | 1424 |
| 458 | Ga0207688_10343059 | 3300025901 | Bacteria | 919 |
| 459 | Ga0207680_10010734 | 3300025903 | Unclassified | 4595 |
| 460 | Ga0207680_10107976 | 3300025903 | Bacteria | 1800 |
| 461 | Ga0207680_10290158 | 3300025903 | Bacteria | 1138 |
| 462 | Ga0207699_10038118 | 3300025906 | Bacteria | 2752 |
| 463 | Ga0207699_10220286 | 3300025906 | Unclassified | 1295 |
| 464 | Ga0207645_10000366 | 3300025907 | Bacteria | 37447 |
| 465 | Ga0207645_10002871 | 3300025907 | Bacteria | 13343 |
| 466 | Ga0207645_10041771 | 3300025907 | Bacteria | 2935 |
| 467 | Ga0207643_10003297 | 3300025908 | Bacteria | 8717 |
| 468 | Ga0207643_10033389 | 3300025908 | Unclassified | 2879 |
| 469 | Ga0207643_10092590 | 3300025908 | Unclassified | 1764 |
| 470 | Ga0207684_10027076 | 3300025910 | Unclassified | 4889 |
| 471 | Ga0207684_10087275 | 3300025910 | Bacteria | 2658 |
| 472 | Ga0207684_10339186 | 3300025910 | Bacteria | 1294 |
| 473 | Ga0207684_10343602 | 3300025910 | Bacteria | 1285 |
| 474 | Ga0207654_10005096 | 3300025911 | Bacteria | 6629 |
| 475 | Ga0207654_10028056 | 3300025911 | Bacteria | 3066 |
| 476 | Ga0207654_10295777 | 3300025911 | Bacteria | 1099 |
| 477 | Ga0207707_10011939 | 3300025912 | Bacteria | 7556 |
| 478 | Ga0207707_10195726 | 3300025912 | Bacteria | 1763 |
| 479 | Ga0207707_10423211 | 3300025912 | Bacteria | 1142 |
| 480 | Ga0207707_10448020 | 3300025912 | Bacteria | 1105 |
| 481 | Ga0207695_10017698 | 3300025913 | Bacteria | 8278 |
| 482 | Ga0207695_10022752 | 3300025913 | Bacteria | 7102 |
| 483 | Ga0207695_10556097 | 3300025913 | Unclassified | 1029 |
| 484 | Ga0207671_10341591 | 3300025914 | Unclassified | 1186 |
| 485 | Ga0207693_10806467 | 3300025915 | Unclassified | 723 |
| 486 | Ga0207663_10000034 | 3300025916 | Bacteria | 88414 |
| 487 | Ga0207663_10179306 | 3300025916 | Bacteria | 1511 |
| 488 | Ga0207663_10238585 | 3300025916 | Bacteria | 1332 |
| 489 | Ga0207663_10691873 | 3300025916 | Bacteria | 807 |
| 490 | Ga0207660_10016237 | 3300025917 | Bacteria | 4927 |
| 491 | Ga0207660_10061249 | 3300025917 | Unclassified | 2708 |
| 492 | Ga0207660_10170680 | 3300025917 | Bacteria | 1683 |
| 493 | Ga0207660_10241142 | 3300025917 | Bacteria | 1424 |
| 494 | Ga0207662_10008225 | 3300025918 | Bacteria | 5706 |
| 495 | Ga0207662_10009229 | 3300025918 | Bacteria | 5421 |
| 496 | Ga0207662_10564248 | 3300025918 | Unclassified | 789 |
| 497 | Ga0207657_10018301 | 3300025919 | Bacteria | 6695 |
| 498 | Ga0207657_10084312 | 3300025919 | Bacteria | 2664 |
| 499 | Ga0207657_10794961 | 3300025919 | Bacteria | 731 |
| 500 | Ga0207649_10016029 | 3300025920 | Unclassified | 4219 |
| 501 | Ga0207649_10017697 | 3300025920 | Bacteria | 4039 |
| 502 | Ga0207649_10083340 | 3300025920 | Unclassified | 2075 |
| 503 | Ga0207652_10022318 | 3300025921 | Bacteria | 5235 |
| 504 | Ga0207652_10128865 | 3300025921 | Unclassified | 2255 |
| 505 | Ga0207646_10053111 | 3300025922 | Bacteria | 3625 |
| 506 | Ga0207646_10096751 | 3300025922 | Bacteria | 2645 |
| 507 | Ga0207646_10106431 | 3300025922 | Unclassified | 2516 |
| 508 | Ga0207646_10124035 | 3300025922 | Bacteria | 2322 |
| 509 | Ga0207646_10132132 | 3300025922 | Unclassified | 2247 |
| 510 | Ga0207646_10178399 | 3300025922 | Bacteria | 1918 |
| 511 | Ga0207646_10578391 | 3300025922 | Bacteria | 1009 |
| 512 | Ga0207646_10802620 | 3300025922 | Bacteria | 838 |
| 513 | Ga0207681_10001066 | 3300025923 | Bacteria | 17800 |
| 514 | Ga0207681_10013499 | 3300025923 | Bacteria | 5056 |
| 515 | Ga0207681_10019368 | 3300025923 | Bacteria | 4299 |
| 516 | Ga0207681_10021259 | 3300025923 | Bacteria | 4122 |
| 517 | Ga0207681_10022617 | 3300025923 | Bacteria | 4012 |
| 518 | Ga0207694_10000074 | 3300025924 | Bacteria | 118396 |
| 519 | Ga0207694_10043666 | 3300025924 | Unclassified | 3459 |
| 520 | Ga0207694_10521538 | 3300025924 | Bacteria | 996 |
| 521 | Ga0207650_10008725 | 3300025925 | Bacteria | 6923 |
| 522 | Ga0207650_10041391 | 3300025925 | Unclassified | 3375 |
| 523 | Ga0207650_10500869 | 3300025925 | Unclassified | 1015 |
| 524 | Ga0207659_10068878 | 3300025926 | Bacteria | 2575 |
| 525 | Ga0207659_10103415 | 3300025926 | Bacteria | 2152 |
| 526 | Ga0207659_10232413 | 3300025926 | Unclassified | 1488 |
| 527 | Ga0207659_10267355 | 3300025926 | Unclassified | 1394 |
| 528 | Ga0207659_10650143 | 3300025926 | Bacteria | 901 |
| 529 | Ga0207659_10839859 | 3300025926 | Unclassified | 789 |
| 530 | Ga0207687_10034655 | 3300025927 | Unclassified | 3428 |
| 531 | Ga0207687_10035240 | 3300025927 | Bacteria | 3403 |
| 532 | Ga0207700_10043962 | 3300025928 | Unclassified | 3285 |
| 533 | Ga0207700_10109275 | 3300025928 | Bacteria | 2222 |
| 534 | Ga0207700_10444661 | 3300025928 | Bacteria | 1142 |
| 535 | Ga0207700_10543669 | 3300025928 | Bacteria | 1030 |
| 536 | Ga0207664_10250681 | 3300025929 | Bacteria | 1545 |
| 537 | Ga0207644_10085889 | 3300025931 | Bacteria | 2335 |
| 538 | Ga0207644_10258629 | 3300025931 | Bacteria | 1391 |
| 539 | Ga0207644_10513514 | 3300025931 | Bacteria | 989 |
| 540 | Ga0207644_11082048 | 3300025931 | Archaea | 674 |
| 541 | Ga0207690_10017420 | 3300025932 | Unclassified | 4384 |
| 542 | Ga0207690_10045122 | 3300025932 | Bacteria | 2910 |
| 543 | Ga0207690_10110535 | 3300025932 | Bacteria | 1979 |
| 544 | Ga0207690_10167354 | 3300025932 | Unclassified | 1644 |
| 545 | Ga0207690_10274681 | 3300025932 | Unclassified | 1311 |
| 546 | Ga0207690_10282345 | 3300025932 | Unclassified | 1293 |
| 547 | Ga0207706_10000005 | 3300025933 | Bacteria | 224460 |
| 548 | Ga0207706_10000271 | 3300025933 | Bacteria | 56353 |
| 549 | Ga0207706_10006727 | 3300025933 | Bacteria | 10627 |
| 550 | Ga0207706_10017865 | 3300025933 | Bacteria | 6386 |
| 551 | Ga0207706_10115996 | 3300025933 | Unclassified | 2355 |
| 552 | Ga0207686_10000129 | 3300025934 | Bacteria | 61050 |
| 553 | Ga0207709_10004559 | 3300025935 | Bacteria | 7984 |
| 554 | Ga0207709_10233859 | 3300025935 | Unclassified | 1333 |
| 555 | Ga0207709_10782102 | 3300025935 | Bacteria | 769 |
| 556 | Ga0207670_10013922 | 3300025936 | Bacteria | 4761 |
| 557 | Ga0207670_10158764 | 3300025936 | Bacteria | 1686 |
| 558 | Ga0207669_10000371 | 3300025937 | Bacteria | 20157 |
| 559 | Ga0207669_10146546 | 3300025937 | Bacteria | 1647 |
| 560 | Ga0207669_10180188 | 3300025937 | Unclassified | 1514 |
| 561 | Ga0207704_10026219 | 3300025938 | Bacteria | 3194 |
| 562 | Ga0207704_10072406 | 3300025938 | Bacteria | 2190 |
| 563 | Ga0207704_10085915 | 3300025938 | Bacteria | 2050 |
| 564 | Ga0207665_10191816 | 3300025939 | Bacteria | 1485 |
| 565 | Ga0207665_10252139 | 3300025939 | Unclassified | 1304 |
| 566 | Ga0207691_10001502 | 3300025940 | Bacteria | 23219 |
| 567 | Ga0207691_10005026 | 3300025940 | Bacteria | 12757 |
| 568 | Ga0207691_10026767 | 3300025940 | Bacteria | 5411 |
| 569 | Ga0207691_10091238 | 3300025940 | Unclassified | 2730 |
| 570 | Ga0207691_10109295 | 3300025940 | Unclassified | 2460 |
| 571 | Ga0207691_10271493 | 3300025940 | Bacteria | 1460 |
| 572 | Ga0207691_10712472 | 3300025940 | Unclassified | 846 |
| 573 | Ga0207711_10000854 | 3300025941 | Bacteria | 29448 |
| 574 | Ga0207711_10033563 | 3300025941 | Unclassified | 4344 |
| 575 | Ga0207711_10958847 | 3300025941 | Unclassified | 794 |
| 576 | Ga0207689_10003784 | 3300025942 | Bacteria | 13788 |
| 577 | Ga0207689_10007240 | 3300025942 | Bacteria | 9745 |
| 578 | Ga0207689_10007761 | 3300025942 | Bacteria | 9389 |
| 579 | Ga0207661_10004655 | 3300025944 | Bacteria | 9609 |
| 580 | Ga0207661_10012577 | 3300025944 | Bacteria | 6156 |
| 581 | Ga0207661_10058283 | 3300025944 | Unclassified | 3108 |
| 582 | Ga0207661_10190974 | 3300025944 | Unclassified | 1795 |
| 583 | Ga0207661_10322385 | 3300025944 | Bacteria | 1389 |
| 584 | Ga0207679_10034047 | 3300025945 | Bacteria | 3591 |
| 585 | Ga0207679_10049494 | 3300025945 | Unclassified | 3066 |
| 586 | Ga0207679_10065497 | 3300025945 | Unclassified | 2719 |
| 587 | Ga0207679_10235036 | 3300025945 | Bacteria | 1550 |
| 588 | Ga0207679_10238746 | 3300025945 | Unclassified | 1539 |
| 589 | Ga0207679_10332643 | 3300025945 | Bacteria | 1319 |
| 590 | Ga0207679_10389163 | 3300025945 | Unclassified | 1224 |
| 591 | Ga0207679_10682550 | 3300025945 | Bacteria | 931 |
| 592 | Ga0207667_10150109 | 3300025949 | Unclassified | 2399 |
| 593 | Ga0207651_10051231 | 3300025960 | Unclassified | 2807 |
| 594 | Ga0207651_10101159 | 3300025960 | Unclassified | 2139 |
| 595 | Ga0207651_10264385 | 3300025960 | Bacteria | 1414 |
| 596 | Ga0207651_10435961 | 3300025960 | Unclassified | 1121 |
| 597 | Ga0207651_10508181 | 3300025960 | Unclassified | 1043 |
| 598 | Ga0207651_10883230 | 3300025960 | Unclassified | 795 |
| 599 | Ga0207712_10000391 | 3300025961 | Bacteria | 38113 |
| 600 | Ga0207712_10034240 | 3300025961 | Bacteria | 3441 |
| 601 | Ga0207712_10034593 | 3300025961 | Bacteria | 3425 |
| 602 | Ga0207712_10075146 | 3300025961 | Bacteria | 2442 |
| 603 | Ga0207712_10532805 | 3300025961 | Bacteria | 1008 |
| 604 | Ga0207668_10032194 | 3300025972 | Bacteria | 3462 |
| 605 | Ga0207668_10034326 | 3300025972 | Bacteria | 3368 |
| 606 | Ga0207668_10037336 | 3300025972 | Bacteria | 3250 |
| 607 | Ga0207668_10721138 | 3300025972 | Unclassified | 878 |
| 608 | Ga0207640_10002079 | 3300025981 | Bacteria | 10782 |
| 609 | Ga0207658_10132008 | 3300025986 | Bacteria | 2008 |
| 610 | Ga0207658_10188677 | 3300025986 | Unclassified | 1712 |
| 611 | Ga0207658_10935449 | 3300025986 | Unclassified | 790 |
| 612 | Ga0207677_10430153 | 3300026023 | Bacteria | 1126 |
| 613 | Ga0207703_10041262 | 3300026035 | Unclassified | 3695 |
| 614 | Ga0207703_10533123 | 3300026035 | Bacteria | 1105 |
| 615 | Ga0207639_10155908 | 3300026041 | Unclassified | 1918 |
| 616 | Ga0207639_10297223 | 3300026041 | Bacteria | 1426 |
| 617 | Ga0207639_10612206 | 3300026041 | Bacteria | 1005 |
| 618 | Ga0207639_10842083 | 3300026041 | Bacteria | 856 |
| 619 | Ga0207678_10008469 | 3300026067 | Bacteria | 9070 |
| 620 | Ga0207678_10255460 | 3300026067 | Bacteria | 1501 |
| 621 | Ga0207708_10006997 | 3300026075 | Bacteria | 8339 |
| 622 | Ga0207708_10062231 | 3300026075 | Unclassified | 2851 |
| 623 | Ga0207702_10102122 | 3300026078 | Bacteria | 2534 |
| 624 | Ga0207702_10305836 | 3300026078 | Unclassified | 1510 |
| 625 | Ga0207702_10354652 | 3300026078 | Bacteria | 1404 |
| 626 | Ga0207702_11286127 | 3300026078 | Bacteria | 725 |
| 627 | Ga0207641_10836830 | 3300026088 | Unclassified | 912 |
| 628 | Ga0207648_10000021 | 3300026089 | Bacteria | 139257 |
| 629 | Ga0207648_10038586 | 3300026089 | Bacteria | 4202 |
| 630 | Ga0207648_10053556 | 3300026089 | Unclassified | 3527 |
| 631 | Ga0207676_10001551 | 3300026095 | Bacteria | 16926 |
| 632 | Ga0207676_10012912 | 3300026095 | Bacteria | 5999 |
| 633 | Ga0207676_10066461 | 3300026095 | Unclassified | 2876 |
| 634 | Ga0207676_10545348 | 3300026095 | Bacteria | 1107 |
| 635 | Ga0207674_10001530 | 3300026116 | Bacteria | 29786 |
| 636 | Ga0207674_10001691 | 3300026116 | Bacteria | 28302 |
| 637 | Ga0207674_10007225 | 3300026116 | Bacteria | 12959 |
| 638 | Ga0207674_10015380 | 3300026116 | Bacteria | 8406 |
| 639 | Ga0207674_10047388 | 3300026116 | Bacteria | 4407 |
| 640 | Ga0207674_10130972 | 3300026116 | Bacteria | 2471 |
| 641 | Ga0207674_10522452 | 3300026116 | Bacteria | 1147 |
| 642 | Ga0207675_100000306 | 3300026118 | Bacteria | 47063 |
| 643 | Ga0207675_100252834 | 3300026118 | Bacteria | 1706 |
| 644 | Ga0207675_100556298 | 3300026118 | Bacteria | 1147 |
| 645 | Ga0207675_100754815 | 3300026118 | Bacteria | 984 |
| 646 | Ga0207683_10143670 | 3300026121 | Bacteria | 2151 |
| 647 | Ga0207683_10417510 | 3300026121 | Bacteria | 1235 |
| 648 | Ga0207683_10508015 | 3300026121 | Archaea | 1113 |
| 649 | Ga0207683_10646798 | 3300026121 | Unclassified | 979 |
| 650 | Ga0207683_10962243 | 3300026121 | Unclassified | 793 |
| 651 | Ga0207698_10012180 | 3300026142 | Bacteria | 5614 |
| 652 | Ga0207698_10021230 | 3300026142 | Bacteria | 4486 |
| 653 | Ga0207698_10053709 | 3300026142 | Bacteria | 3095 |
| 654 | Ga0207698_10097526 | 3300026142 | Bacteria | 2426 |
| 655 | Ga0207698_10834655 | 3300026142 | Bacteria | 926 |
| 656 | Ga0207428_10104240 | 3300027907 | Bacteria | 2189 |
| 657 | Ga0207428_10560357 | 3300027907 | Bacteria | 826 |
| 658 | Ga0268266_10119940 | 3300028379 | Bacteria | 2340 |
| 659 | Ga0268266_10319382 | 3300028379 | Unclassified | 1453 |
| 660 | Ga0268266_10905914 | 3300028379 | Bacteria | 853 |
| 661 | Ga0268265_10039587 | 3300028380 | Bacteria | 3475 |
| 662 | Ga0268265_10040656 | 3300028380 | Unclassified | 3435 |
| 663 | Ga0268265_10081756 | 3300028380 | Bacteria | 2552 |
| 664 | Ga0268265_10104408 | 3300028380 | Bacteria | 2296 |
| 665 | Ga0268265_10147550 | 3300028380 | Unclassified | 1979 |
| 666 | Ga0268265_10668369 | 3300028380 | Bacteria | 1000 |
| 667 | Ga0268264_10004704 | 3300028381 | Bacteria | 11598 |
| 668 | Ga0307408_100013542 | 3300031548 | Bacteria | 5414 |
| 669 | Ga0307408_100017112 | 3300031548 | Bacteria | 4850 |
| 670 | Ga0307408_100180834 | 3300031548 | Unclassified | 1691 |
| 671 | Ga0307408_101089072 | 3300031548 | Unclassified | 741 |
| 672 | Ga0307405_10001572 | 3300031731 | Bacteria | 9693 |
| 673 | Ga0307405_10257687 | 3300031731 | Unclassified | 1301 |
| 674 | Ga0307413_10003676 | 3300031824 | Bacteria | 6515 |
| 675 | Ga0307413_10021095 | 3300031824 | Bacteria | 3480 |
| 676 | Ga0307413_10065719 | 3300031824 | Bacteria | 2260 |
| 677 | Ga0307410_10000534 | 3300031852 | Bacteria | 15571 |
| 678 | Ga0307410_10053885 | 3300031852 | Bacteria | 2724 |
| 679 | Ga0307410_10129024 | 3300031852 | Unclassified | 1855 |
| 680 | Ga0307410_10428116 | 3300031852 | Unclassified | 1075 |
| 681 | Ga0307410_10718186 | 3300031852 | Unclassified | 844 |
| 682 | Ga0307406_10083947 | 3300031901 | Bacteria | 2125 |
| 683 | Ga0307406_10272661 | 3300031901 | Unclassified | 1286 |
| 684 | Ga0307407_10007291 | 3300031903 | Bacteria | 4998 |
| 685 | Ga0307407_10054020 | 3300031903 | Bacteria | 2314 |
| 686 | Ga0307407_10064745 | 3300031903 | Bacteria | 2150 |
| 687 | Ga0307412_10007612 | 3300031911 | Bacteria | 6149 |
| 688 | Ga0307409_100004304 | 3300031995 | Bacteria | 7967 |
| 689 | Ga0307409_100011136 | 3300031995 | Bacteria | 5648 |
| 690 | Ga0307409_100025765 | 3300031995 | Bacteria | 4133 |
| 691 | Ga0307409_100074623 | 3300031995 | Unclassified | 2711 |
| 692 | Ga0307409_100131770 | 3300031995 | Bacteria | 2138 |
| 693 | Ga0307409_100190806 | 3300031995 | Bacteria | 1824 |
| 694 | Ga0307409_100342199 | 3300031995 | Bacteria | 1408 |
| 695 | Ga0307409_100529244 | 3300031995 | Bacteria | 1153 |
| 696 | Ga0307416_100009861 | 3300032002 | Bacteria | 6279 |
| 697 | Ga0307416_100047608 | 3300032002 | Bacteria | 3395 |
| 698 | Ga0307416_100600870 | 3300032002 | Bacteria | 1180 |
| 699 | Ga0307416_101073591 | 3300032002 | Bacteria | 909 |
| 700 | Ga0307414_10004540 | 3300032004 | Bacteria | 7548 |
| 701 | Ga0307414_10031579 | 3300032004 | Unclassified | 3477 |
| 702 | Ga0307414_10119849 | 3300032004 | Bacteria | 2021 |
| 703 | Ga0307414_10245400 | 3300032004 | Unclassified | 1485 |
| 704 | Ga0307414_11412291 | 3300032004 | Unclassified | 647 |
| 705 | Ga0307411_10000572 | 3300032005 | Bacteria | 13140 |
| 706 | Ga0307411_10014487 | 3300032005 | Bacteria | 4390 |
| 707 | Ga0307411_10372585 | 3300032005 | Unclassified | 1172 |
| 708 | Ga0307411_10626945 | 3300032005 | Bacteria | 928 |
| 709 | Ga0307415_100003899 | 3300032126 | Bacteria | 7663 |
| 710 | Ga0307415_100052554 | 3300032126 | Bacteria | 2772 |
| 711 | Ga0307415_100120589 | 3300032126 | Bacteria | 1966 |
| 712 | Ga0307415_100166894 | 3300032126 | Unclassified | 1713 |
| 713 | Ga0307415_100855285 | 3300032126 | Bacteria | 835 |
| 714 | Ga0373959_0000044 | 3300034820 | Bacteria | 28049 |
| 715 | Ga0373934_0015010 | 3300035086 | Bacteria | 2938 |
| 716 | Ga0373934_0038274 | 3300035086 | Unclassified | 1888 |
| 717 | Ga0373932_0085013 | 3300035112 | Bacteria | 1006 |
| 718 | Ga0373939_0151128 | 3300035114 | Bacteria | 845 |
| 719 | Ga0373953_0124361 | 3300035117 | Unclassified | 1097 |
| 720 | Ga0373960_0022942 | 3300035121 | Bacteria | 1677 |
| 721 | Ga0373943_0195978 | 3300035170 | Unclassified | 1116 |
| 722 | Ga0373955_0080180 | 3300035172 | Bacteria | 1843 |
| 723 | Ga0373931_0081802 | 3300035691 | Bacteria | 1784 |
| 724 | Ga0373931_0091294 | 3300035691 | Bacteria | 1697 |
| 725 | Ga0373931_0216449 | 3300035691 | Unclassified | 1151 |
| 726 | Ga0373931_0250690 | 3300035691 | Bacteria | 1076 |
| 727 | Ga0373935_0326253 | 3300035692 | Unclassified | 1090 |
| 728 | Ga0373927_0020604 | 3300035695 | Bacteria | 4323 |
| 729 | Ga0373933_0031933 | 3300035724 | Bacteria | 3058 |
| 730 | Ga0373947_0188935 | 3300035725 | Unclassified | 1343 |
| 731 | Ga0373937_0004884 | 3300036401 | Bacteria | 11395 |
| 732 | Ga0373937_0056952 | 3300036401 | Unclassified | 3589 |
| 733 | Ga0373937_0528347 | 3300036401 | Unclassified | 1121 |
| 734 | Ga0373937_0782023 | 3300036401 | Unclassified | 902 |
| 735 | Ga0373925_0491443 | 3300037068 | Unclassified | 1007 |
| 736 | Ga0395905_0466708 | 3300037471 | Bacteria | 1161 |
| 737 | Ga0436364_0508766 | 3300037853 | Bacteria | 7460 |
| 738 | Ga0395901_0744964 | 3300038443 | Bacteria | 973 |
| 739 | Ga0242420_001555 | 3300038996 | Bacteria | 3084 |
| 740 | Ga0242420_008022 | 3300038996 | Bacteria | 1705 |
| 741 | Ga0242420_010963 | 3300038996 | Bacteria | 1514 |
| 742 | Ga0436365_1494207 | 3300039437 | Bacteria | 13030 |
| 743 | Ga0451791_0724933 | 3300041451 | Bacteria | 806 |
| 744 | Ga0451853_1697498 | 3300041512 | Unclassified | 877 |
| 745 | Ga0439445_0067733 | 3300042004 | Archaea | 984 |
| 746 | Ga0450914_023598 | 3300042118 | Unclassified | 701 |
| 747 | Ga0451577_0055150 | 3300042876 | Unclassified | 3547 |
| 748 | Ga0451577_0235024 | 3300042876 | Bacteria | 1658 |
| 749 | Ga0451577_0470669 | 3300042876 | Bacteria | 1141 |
| 750 | Ga0451577_0991343 | 3300042876 | Bacteria | 755 |
| 751 | Ga0453683_0012581 | 3300044673 | Bacteria | 5544 |
| 752 | Ga0453683_0082764 | 3300044673 | Bacteria | 2011 |
| 753 | Ga0453683_0276620 | 3300044673 | Bacteria | 1072 |
| 754 | Ga0453684_0697781 | 3300044712 | Bacteria | 1103 |
| 755 | Ga0451576_0016016 | 3300045051 | Bacteria | 8283 |
| 756 | Ga0451576_0078909 | 3300045051 | Bacteria | 3425 |
| 757 | Ga0451576_0202425 | 3300045051 | Bacteria | 2073 |
| 758 | Ga0451576_0751615 | 3300045051 | Unclassified | 1024 |
| 759 | Ga0451576_1023419 | 3300045051 | Bacteria | 865 |
| 760 | Ga0451576_1394388 | 3300045051 | Unclassified | 729 |
| 761 | Ga0495592_0442693 | 3300046454 | Unclassified | 815 |
| 762 | Ga0495603_0017157 | 3300046455 | Unclassified | 4383 |
| 763 | Ga0495629_0059822 | 3300046459 | Bacteria | 2663 |
| 764 | Ga0495651_0041381 | 3300046462 | Unclassified | 3580 |
| 765 | Ga0495651_0074121 | 3300046462 | Bacteria | 2583 |
| 766 | Ga0495653_0022688 | 3300046463 | Bacteria | 5077 |
| 767 | Ga0495580_0040218 | 3300046472 | Unclassified | 3342 |
| 768 | Ga0495580_0046474 | 3300046472 | Bacteria | 3080 |
| 769 | Ga0495580_0188503 | 3300046472 | Bacteria | 1423 |
| 770 | Ga0495582_0004174 | 3300046473 | Bacteria | 8120 |
| 771 | Ga0495639_0117495 | 3300046475 | Unclassified | 1266 |
| 772 | Ga0495639_0122188 | 3300046475 | Bacteria | 1243 |
| 773 | Ga0495662_0029737 | 3300046476 | Bacteria | 2637 |
| 774 | Ga0495664_0057823 | 3300046477 | Bacteria | 2307 |
| 775 | Ga0495594_0006581 | 3300046499 | Bacteria | 5980 |
| 776 | Ga0495594_0007624 | 3300046499 | Bacteria | 5569 |
| 777 | Ga0495608_0042062 | 3300046511 | Unclassified | 3055 |
| 778 | Ga0495608_0378382 | 3300046511 | Bacteria | 868 |
| 779 | Ga0495628_0032241 | 3300046516 | Bacteria | 4231 |
| 780 | Ga0495630_0017637 | 3300046517 | Bacteria | 5233 |
| 781 | Ga0495630_0073202 | 3300046517 | Unclassified | 2580 |
| 782 | Ga0495666_0246149 | 3300046526 | Unclassified | 815 |
| 783 | Ga0495652_0000889 | 3300046529 | Bacteria | 34387 |
| 784 | Ga0495652_0129667 | 3300046529 | Bacteria | 1998 |
| 785 | Ga0495652_0701601 | 3300046529 | Bacteria | 681 |
| 786 | Ga0495665_0000603 | 3300046531 | Bacteria | 18285 |
| 787 | Ga0495640_0098184 | 3300046533 | Unclassified | 1925 |
| 788 | Ga0495586_0025302 | 3300046535 | Bacteria | 3176 |
| 789 | Ga0495586_0044682 | 3300046535 | Unclassified | 2387 |
| 790 | Ga0495587_0000327 | 3300046536 | Bacteria | 33954 |
| 791 | Ga0495587_0006881 | 3300046536 | Bacteria | 7393 |
| 792 | Ga0495587_0054179 | 3300046536 | Bacteria | 2364 |
| 793 | Ga0495587_0111979 | 3300046536 | Unclassified | 1567 |
| 794 | Ga0495645_0000211 | 3300046543 | Bacteria | 41774 |
| 795 | Ga0495645_0118170 | 3300046543 | Bacteria | 1870 |
| 796 | Ga0495667_0002556 | 3300046559 | Bacteria | 12150 |
| 797 | Ga0495667_0022268 | 3300046559 | Bacteria | 4271 |
| 798 | Ga0495667_0100700 | 3300046559 | Bacteria | 1869 |
| 799 | Ga0495634_0102415 | 3300046642 | Bacteria | 1849 |
| 800 | Ga0495635_0190603 | 3300046663 | Bacteria | 1392 |
| 801 | Ga0495588_0144237 | 3300046674 | Unclassified | 1258 |
| 802 | Ga0495657_0089520 | 3300046675 | Unclassified | 1977 |
| 803 | Ga0495657_0131921 | 3300046675 | Bacteria | 1564 |
| 804 | Ga0495599_0003821 | 3300046678 | Bacteria | 8845 |
| 805 | Ga0495623_0023730 | 3300046679 | Unclassified | 3957 |
| 806 | Ga0495623_0033621 | 3300046679 | Unclassified | 3290 |
| 807 | Ga0495646_0040963 | 3300046680 | Unclassified | 2849 |
| 808 | Ga0495658_0078730 | 3300046683 | Bacteria | 1930 |
| 809 | Ga0495613_0048846 | 3300046689 | Unclassified | 3124 |
| 810 | Ga0495613_0513664 | 3300046689 | Bacteria | 805 |
| 811 | Ga0495600_0124676 | 3300046809 | Bacteria | 1675 |
| 812 | Ga0495600_0192085 | 3300046809 | Unclassified | 1313 |
| 813 | Ga0495600_0216519 | 3300046809 | Unclassified | 1226 |
| 814 | Ga0495581_0060251 | 3300047315 | Unclassified | 2193 |
| 815 | Ga0495581_0107779 | 3300047315 | Bacteria | 1619 |
| 816 | Ga0495604_0021625 | 3300047317 | Bacteria | 5136 |
| 817 | Ga0495674_0101491 | 3300047319 | Unclassified | 2447 |
| 818 | Ga0495676_0288699 | 3300047321 | Unclassified | 1109 |
| 819 | Ga0495680_0009874 | 3300047322 | Bacteria | 8555 |
| 820 | Ga0495675_0006376 | 3300047444 | Bacteria | 7220 |
| 821 | Ga0495675_0015827 | 3300047444 | Bacteria | 4770 |
| 822 | Ga0495675_0175291 | 3300047444 | Unclassified | 1315 |
| 823 | Ga0495684_0012476 | 3300047471 | Bacteria | 6549 |
| 824 | Ga0495684_0015174 | 3300047471 | Bacteria | 5932 |
| 825 | Ga0495684_0069282 | 3300047471 | Bacteria | 2682 |
| 826 | Ga0495684_0071837 | 3300047471 | Unclassified | 2630 |
| 827 | Ga0495684_0145995 | 3300047471 | Bacteria | 1772 |
| 828 | Ga0495593_0176561 | 3300047673 | Unclassified | 1076 |
| 829 | Ga0495602_0037854 | 3300048088 | Bacteria | 4468 |
| 830 | Ga0495602_0085788 | 3300048088 | Bacteria | 2630 |
| 831 | Ga0496100_0024473 | 3300048903 | Unclassified | 3684 |
| 832 | Ga0496100_0189906 | 3300048903 | Bacteria | 1491 |
| 833 | Ga0496101_0026539 | 3300048904 | Bacteria | 4028 |
| 834 | Ga0496101_0045293 | 3300048904 | Bacteria | 3151 |
| 835 | Ga0496101_0211183 | 3300048904 | Bacteria | 1504 |
| 836 | Ga0496102_0022191 | 3300048905 | Bacteria | 5622 |
| 837 | Ga0496102_0062843 | 3300048905 | Unclassified | 3400 |
| 838 | Ga0496102_0091620 | 3300048905 | Unclassified | 2814 |
| 839 | Ga0496102_0314585 | 3300048905 | Bacteria | 1475 |
| 840 | Ga0496102_0346059 | 3300048905 | Unclassified | 1400 |
| 841 | Ga0496104_0032287 | 3300048907 | Bacteria | 4873 |
| 842 | Ga0496104_0065511 | 3300048907 | Bacteria | 3448 |
| 843 | Ga0496104_0183389 | 3300048907 | Bacteria | 2003 |
| 844 | Ga0496104_0194163 | 3300048907 | Bacteria | 1942 |
| 845 | Ga0496104_0361418 | 3300048907 | Bacteria | 1364 |
| 846 | Ga0496105_0062553 | 3300048908 | Bacteria | 3072 |
| 847 | Ga0496106_0101096 | 3300048909 | Bacteria | 2236 |
| 848 | Ga0496106_0781336 | 3300048909 | Bacteria | 758 |
| 849 | Ga0496107_0039224 | 3300048910 | Bacteria | 3397 |
| 850 | Ga0496107_0239890 | 3300048910 | Bacteria | 1349 |
| 851 | Ga0496108_0002786 | 3300048911 | Bacteria | 14010 |
| 852 | Ga0496108_0005189 | 3300048911 | Bacteria | 10528 |
| 853 | Ga0496108_0011155 | 3300048911 | Bacteria | 7300 |
| 854 | Ga0496108_0067030 | 3300048911 | Bacteria | 3027 |
| 855 | Ga0496109_0020704 | 3300048912 | Bacteria | 5809 |
| 856 | Ga0496109_0038375 | 3300048912 | Bacteria | 4330 |
| 857 | Ga0496109_0069386 | 3300048912 | Unclassified | 3232 |
| 858 | Ga0496109_0156113 | 3300048912 | Bacteria | 2137 |
| 859 | Ga0496109_0233914 | 3300048912 | Unclassified | 1729 |
| 860 | Ga0496109_0239709 | 3300048912 | Bacteria | 1707 |
| 861 | Ga0496109_0521343 | 3300048912 | Bacteria | 1122 |
| 862 | Ga0496110_0027788 | 3300048913 | Bacteria | 4852 |
| 863 | Ga0496110_0029716 | 3300048913 | Unclassified | 4707 |
| 864 | Ga0496110_0102770 | 3300048913 | Bacteria | 2563 |
| 865 | Ga0496111_0044844 | 3300048914 | Bacteria | 3179 |
| 866 | Ga0496111_0046516 | 3300048914 | Bacteria | 3124 |
| 867 | Ga0496111_0087281 | 3300048914 | Bacteria | 2283 |
| 868 | Ga0496111_0404653 | 3300048914 | Bacteria | 1008 |
| 869 | Ga0496112_0000607 | 3300048915 | Bacteria | 24660 |
| 870 | Ga0496112_0005273 | 3300048915 | Bacteria | 11145 |
| 871 | Ga0496112_0013170 | 3300048915 | Bacteria | 7631 |
| 872 | Ga0496112_0129506 | 3300048915 | Unclassified | 2494 |
| 873 | Ga0496113_0000097 | 3300048916 | Bacteria | 36693 |
| 874 | Ga0496113_0005097 | 3300048916 | Bacteria | 8161 |
| 875 | Ga0496113_0029432 | 3300048916 | Bacteria | 3966 |
| 876 | Ga0496113_0206656 | 3300048916 | Bacteria | 1562 |
| 877 | Ga0496114_0020367 | 3300048917 | Bacteria | 5384 |
| 878 | Ga0496114_0030541 | 3300048917 | Bacteria | 4434 |
| 879 | Ga0496114_0376334 | 3300048917 | Unclassified | 1257 |
| 880 | Ga0496114_0410182 | 3300048917 | Unclassified | 1200 |
| 881 | Ga0496115_0010573 | 3300048918 | Bacteria | 6901 |
| 882 | Ga0496115_0084200 | 3300048918 | Bacteria | 2593 |
| 883 | Ga0501298_021128 | 3300049521 | Bacteria | 1218 |
| 884 | Ga0501038_0178283 | 3300049574 | Bacteria | 1716 |
| 885 | Ga0501040_0136322 | 3300049576 | Bacteria | 1728 |
| 886 | Ga0501048_0205867 | 3300049582 | Bacteria | 1395 |
| 887 | Ga0501067_0188037 | 3300049583 | Bacteria | 1150 |
| 888 | Ga0501074_0128831 | 3300049590 | Bacteria | 1811 |
| 889 | Ga0501077_0008022 | 3300049593 | Bacteria | 6528 |
| 890 | Ga0501216_014245 | 3300049660 | Bacteria | 1327 |
| 891 | Ga0501223_032661 | 3300049663 | Unclassified | 1012 |
| 892 | Ga0501230_031237 | 3300049667 | Unclassified | 992 |
| 893 | Ga0501233_059941 | 3300049668 | Unclassified | 942 |
| 894 | Ga0501242_005926 | 3300049674 | Unclassified | 1387 |
| 895 | Ga0501249_009886 | 3300049679 | Bacteria | 1987 |
| 896 | Ga0501257_019603 | 3300049686 | Bacteria | 1583 |
| 897 | Ga0501261_019797 | 3300049690 | Unclassified | 958 |
| 898 | Ga0501080_0456112 | 3300049742 | Unclassified | 1146 |
| 899 | Ga0501081_0016800 | 3300049743 | Bacteria | 4839 |
| 900 | nmdc:mga05p37_10437_c1 | 3300050507 | Bacteria | 11023 |
| 901 | nmdc:mga05p37_111342_c1 | 3300050507 | Bacteria | 3367 |
| 902 | nmdc:mga05p37_182363_c1 | 3300050507 | Bacteria | 2553 |
| 903 | nmdc:mga05p37_206331_c1 | 3300050507 | Bacteria | 2377 |
| 904 | nmdc:mga05p37_333005_c1 | 3300050507 | Bacteria | 1792 |
| 905 | nmdc:mga05p37_379155_c1 | 3300050507 | Unclassified | 1658 |
| 906 | nmdc:mga05p37_636333_c1 | 3300050507 | Bacteria | 1197 |
| 907 | nmdc:mga09592_13458_c1 | 3300050508 | Bacteria | 6678 |
| 908 | nmdc:mga09592_192077_c1 | 3300050508 | Bacteria | 1767 |
| 909 | nmdc:mga09592_214797_c1 | 3300050508 | Bacteria | 1667 |
| 910 | nmdc:mga09592_433761_c1 | 3300050508 | Unclassified | 1134 |
| 911 | nmdc:mga09592_476448_c1 | 3300050508 | Unclassified | 1076 |
| 912 | nmdc:mga0qj67_175880_c1 | 3300050509 | Bacteria | 1738 |
| 913 | nmdc:mga0qj67_17742_c1 | 3300050509 | Bacteria | 5414 |
| 914 | nmdc:mga0qj67_574414_c1 | 3300050509 | Bacteria | 903 |
| 915 | nmdc:mga0qj67_7214_c1 | 3300050509 | Bacteria | 8207 |
| 916 | nmdc:mga0qj67_911714_c1 | 3300050509 | Unclassified | 692 |
| 917 | nmdc:mga06r32_10526_c1 | 3300050510 | Bacteria | 8341 |
| 918 | nmdc:mga06r32_1166411_c1 | 3300050510 | Unclassified | 717 |
| 919 | nmdc:mga06r32_310168_c1 | 3300050510 | Bacteria | 1563 |
| 920 | nmdc:mga06r32_43755_c1 | 3300050510 | Bacteria | 4261 |
| 921 | nmdc:mga06r32_502690_c1 | 3300050510 | Bacteria | 1189 |
| 922 | nmdc:mga06r32_598684_c1 | 3300050510 | Unclassified | 1073 |
| 923 | nmdc:mga08y16_1110585_c1 | 3300050511 | Unclassified | 765 |
| 924 | nmdc:mga08y16_271091_c1 | 3300050511 | Bacteria | 1752 |
| 925 | nmdc:mga08y16_434844_c1 | 3300050511 | Unclassified | 1340 |
| 926 | nmdc:mga0n895_1189_c1 | 3300050512 | Bacteria | 19138 |
| 927 | nmdc:mga0n895_139096_c1 | 3300050512 | Bacteria | 2456 |
| 928 | nmdc:mga0n895_1418844_c1 | 3300050512 | Bacteria | 662 |
| 929 | nmdc:mga0n895_14212_c1 | 3300050512 | Bacteria | 7220 |
| 930 | nmdc:mga0n895_161485_c1 | 3300050512 | Bacteria | 2273 |
| 931 | nmdc:mga0n895_164547_c1 | 3300050512 | Unclassified | 2250 |
| 932 | nmdc:mga0n895_2925_c1 | 3300050512 | Bacteria | 13540 |
| 933 | nmdc:mga0n895_374301_c1 | 3300050512 | Bacteria | 1441 |
| 934 | nmdc:mga0n895_3949_c1 | 3300050512 | Bacteria | 12054 |
| 935 | nmdc:mga0n895_6534_c1 | 3300050512 | Bacteria | 9921 |
| 936 | nmdc:mga0n895_82112_c1 | 3300050512 | Bacteria | 3212 |
| 937 | nmdc:mga0rr50_114484_c1 | 3300050513 | Unclassified | 2139 |
| 938 | nmdc:mga0rr50_127850_c1 | 3300050513 | Bacteria | 2031 |
| 939 | nmdc:mga0rr50_81709_c1 | 3300050513 | Bacteria | 2495 |
| 940 | nmdc:mga08x19_391659_c1 | 3300050514 | Unclassified | 974 |
| 941 | nmdc:mga08x19_85536_c1 | 3300050514 | Unclassified | 2075 |
| 942 | nmdc:mga0a205_103294_c1 | 3300050515 | Bacteria | 2749 |
| 943 | nmdc:mga0a205_122582_c1 | 3300050515 | Bacteria | 2499 |
| 944 | nmdc:mga0a205_142981_c1 | 3300050515 | Bacteria | 2292 |
| 945 | nmdc:mga0a205_166148_c1 | 3300050515 | Unclassified | 2102 |
| 946 | nmdc:mga0a205_194505_c1 | 3300050515 | Bacteria | 1919 |
| 947 | nmdc:mga0a205_20757_c2 | 3300050515 | Bacteria | 5367 |
| 948 | nmdc:mga0a205_23848_c1 | 3300050515 | Bacteria | 5806 |
| 949 | nmdc:mga0a205_33456_c1 | 3300050515 | Bacteria | 4928 |
| 950 | nmdc:mga0a205_493_c1 | 3300050515 | Bacteria | 30906 |
| 951 | nmdc:mga0a205_8295_c1 | 3300050515 | Bacteria | 9447 |
| 952 | nmdc:mga0a205_966931_c1 | 3300050515 | Unclassified | 698 |
| 953 | nmdc:mga0a205_97586_c2 | 3300050515 | Unclassified | 2513 |
| 954 | Ga0495612_0016193 | 3300053078 | Unclassified | 2987 |
| 955 | Ga0495619_0053258 | 3300053085 | Unclassified | 2676 |
| 956 | Ga0501082_0044042 | 3300060353 | Bacteria | 3850 |
| 957 | Ga0530510_0138099 | 3300061734 | Bacteria | 1795 |
| 958 | Ga0068857_100123738 | |||
| 959 | MBSR1b_contig_11714938 | |||
| 960 | Ga0065715_10177927 | |||
| 961 | Ga0065715_10200486 | |||
| 962 | Ga0070676_10005285 | |||
| 963 | Ga0070683_100003389 | |||
| 964 | Ga0070683_100014074 | |||
| 965 | Ga0070683_100024705 | |||
| 966 | Ga0070683_100073927 | |||
| 967 | Ga0070683_100085692 | |||
| 968 | Ga0070683_100145987 | |||
| 969 | Ga0070683_100169958 | |||
| 970 | Ga0070683_100176545 | |||
| 971 | Ga0070683_100298876 | |||
| 972 | Ga0070683_100366536 | |||
| 973 | Ga0070690_100192241 | |||
| 974 | Ga0070670_100020074 | |||
| 975 | Ga0070670_100032599 | |||
| 976 | Ga0070670_100047997 | |||
| 977 | Ga0070670_100298559 | |||
| 978 | Ga0068869_100008951 | |||
| 979 | Ga0068869_100051097 | |||
| 980 | Ga0070666_10012446 | |||
| 981 | Ga0070666_10199661 | |||
| 982 | Ga0070666_10569915 | |||
| 983 | Ga0070680_100003560 | |||
| 984 | Ga0070680_100019138 | |||
| 985 | Ga0070680_100354453 | |||
| 986 | Ga0070682_100125580 | |||
| 987 | Ga0070682_101015285 | |||
| 988 | Ga0068868_100128892 | |||
| 989 | Ga0068868_100165379 | |||
| 990 | Ga0070660_100074773 | |||
| 991 | Ga0070660_100621979 | |||
| 992 | Ga0070689_100036132 | |||
| 993 | Ga0070689_100057724 | |||
| 994 | Ga0070689_100148918 | |||
| 995 | Ga0070689_100865080 | |||
| 996 | Ga0070687_100005149 | |||
| 997 | Ga0070687_100044408 | |||
| 998 | Ga0070687_100114474 | |||
| 999 | Ga0070687_100185976 | |||
| 1000 | Ga0070661_100014670 | |||
| 1001 | Ga0070661_101018328 | |||
| 1002 | Ga0070692_10025009 | |||
| 1003 | Ga0070692_10069202 | |||
| 1004 | Ga0070668_100004653 | |||
| 1005 | Ga0070668_100006466 | |||
| 1006 | Ga0070668_100010136 | |||
| 1007 | Ga0070668_100085116 | |||
| 1008 | Ga0070668_100604601 | |||
| 1009 | Ga0070668_100929962 | |||
| 1010 | Ga0070669_100010261 | |||
| 1011 | Ga0070669_100017780 | |||
| 1012 | Ga0070669_100106104 | |||
| 1013 | Ga0070669_100131038 | |||
| 1014 | Ga0070669_100237633 | |||
| 1015 | Ga0070669_100258613 | |||
| 1016 | Ga0070669_100317872 | |||
| 1017 | Ga0070675_100002030 | |||
| 1018 | Ga0070675_100022286 | |||
| 1019 | Ga0070675_100029974 | |||
| 1020 | Ga0070675_100047973 | |||
| 1021 | Ga0070675_100199441 | |||
| 1022 | Ga0070675_100456879 | |||
| 1023 | Ga0070675_100590357 | |||
| 1024 | Ga0070671_100019855 | |||
| 1025 | Ga0070671_100047955 | |||
| 1026 | Ga0070671_100299905 | |||
| 1027 | Ga0070674_100000069 | |||
| 1028 | Ga0070674_100618672 | |||
| 1029 | Ga0070674_100755096 | |||
| 1030 | Ga0070673_100038744 | |||
| 1031 | Ga0070673_100049642 | |||
| 1032 | Ga0070673_100115429 | |||
| 1033 | Ga0070673_100136280 | |||
| 1034 | Ga0070673_100445373 | |||
| 1035 | Ga0070673_100993108 | |||
| 1036 | Ga0070688_100084598 | |||
| 1037 | Ga0070688_100092570 | |||
| 1038 | Ga0070688_100155538 | |||
| 1039 | Ga0070659_100008580 | |||
| 1040 | Ga0070659_100013958 | |||
| 1041 | Ga0070659_100206745 | |||
| 1042 | Ga0070659_100321649 | |||
| 1043 | Ga0070667_100079559 | |||
| 1044 | Ga0070667_100089162 | |||
| 1045 | Ga0070667_100693451 | |||
| 1046 | Ga0070703_10031925 | |||
| 1047 | Ga0070703_10181784 | |||
| 1048 | Ga0070709_10112565 | |||
| 1049 | Ga0070709_10216278 | |||
| 1050 | Ga0070714_100031119 | |||
| 1051 | Ga0070713_100096868 | |||
| 1052 | Ga0070713_100273872 | |||
| 1053 | Ga0070713_100615105 | |||
| 1054 | Ga0070710_10596859 | |||
| 1055 | Ga0070701_10095669 | |||
| 1056 | Ga0070711_100000132 | |||
| 1057 | Ga0070711_100054495 | |||
| 1058 | Ga0070711_101003569 | |||
| 1059 | Ga0070705_100038355 | |||
| 1060 | Ga0070705_100150348 | |||
| 1061 | Ga0070705_100220670 | |||
| 1062 | Ga0070705_100286393 | |||
| 1063 | Ga0070705_100694781 | |||
| 1064 | Ga0070700_100129253 | |||
| 1065 | Ga0070700_100147934 | |||
| 1066 | Ga0070694_100012928 | |||
| 1067 | Ga0070694_100015711 | |||
| 1068 | Ga0070694_100045604 | |||
| 1069 | Ga0070694_100100112 | |||
| 1070 | Ga0070694_100119481 | |||
| 1071 | Ga0070694_100142981 | |||
| 1072 | Ga0070694_100189167 | |||
| 1073 | Ga0070694_100246569 | |||
| 1074 | Ga0070694_100254301 | |||
| 1075 | Ga0070708_100000188 | |||
| 1076 | Ga0070708_100002610 | |||
| 1077 | Ga0070708_100017477 | |||
| 1078 | Ga0070708_100024977 | |||
| 1079 | Ga0070708_100107925 | |||
| 1080 | Ga0070708_100120614 | |||
| 1081 | Ga0070708_100133834 | |||
| 1082 | Ga0070708_100171405 | |||
| 1083 | Ga0070708_100216924 | |||
| 1084 | Ga0070708_100323903 | |||
| 1085 | Ga0070678_100114192 | |||
| 1086 | Ga0070678_100308580 | |||
| 1087 | Ga0070678_100615488 | |||
| 1088 | Ga0070662_100030680 | |||
| 1089 | Ga0070662_100122725 | |||
| 1090 | Ga0070681_10001675 | |||
| 1091 | Ga0070681_10022137 | |||
| 1092 | Ga0070681_10078107 | |||
| 1093 | Ga0070681_10263354 | |||
| 1094 | Ga0070681_10973979 | |||
| 1095 | Ga0068867_100002961 | |||
| 1096 | Ga0068867_100122866 | |||
| 1097 | Ga0068867_100210240 | |||
| 1098 | Ga0068867_101018145 | |||
| 1099 | Ga0070685_10006186 | |||
| 1100 | Ga0070685_10015845 | |||
| 1101 | Ga0070685_10202271 | |||
| 1102 | Ga0070706_100004664 | |||
| 1103 | Ga0070706_100069962 | |||
| 1104 | Ga0070706_100188398 | |||
| 1105 | Ga0070706_100289524 | |||
| 1106 | Ga0070706_100395065 | |||
| 1107 | Ga0070707_100003729 | |||
| 1108 | Ga0070707_100026185 | |||
| 1109 | Ga0070707_100026489 | |||
| 1110 | Ga0070707_100073463 | |||
| 1111 | Ga0070707_100128430 | |||
| 1112 | Ga0070707_100171540 | |||
| 1113 | Ga0070707_100788852 | |||
| 1114 | Ga0070698_100000668 | |||
| 1115 | Ga0070698_100001479 | |||
| 1116 | Ga0070698_100300389 | |||
| 1117 | Ga0070698_100386315 | |||
| 1118 | Ga0070698_100609268 | |||
| 1119 | Ga0070698_100949922 | |||
| 1120 | Ga0070699_100001479 | |||
| 1121 | Ga0070699_100006406 | |||
| 1122 | Ga0070699_100007572 | |||
| 1123 | Ga0070699_100033855 | |||
| 1124 | Ga0070699_100040293 | |||
| 1125 | Ga0070699_100048237 | |||
| 1126 | Ga0070699_100051965 | |||
| 1127 | Ga0070699_100227814 | |||
| 1128 | Ga0070699_100304521 | |||
| 1129 | Ga0070699_100507755 | |||
| 1130 | Ga0070679_100008772 | |||
| 1131 | Ga0070679_100053773 | |||
| 1132 | Ga0070679_100115061 | |||
| 1133 | Ga0070684_100018722 | |||
| 1134 | Ga0070684_100020863 | |||
| 1135 | Ga0070684_100033927 | |||
| 1136 | Ga0070684_100048534 | |||
| 1137 | Ga0070684_100106194 | |||
| 1138 | Ga0070684_100144800 | |||
| 1139 | Ga0070684_100285996 | |||
| 1140 | Ga0070684_100323866 | |||
| 1141 | Ga0070684_100393338 | |||
| 1142 | Ga0070684_100417628 | |||
| 1143 | Ga0070684_100437105 | |||
| 1144 | Ga0070697_100013007 | |||
| 1145 | Ga0070697_100021746 | |||
| 1146 | Ga0070697_100039493 | |||
| 1147 | Ga0070697_100081738 | |||
| 1148 | Ga0070697_100097438 | |||
| 1149 | Ga0070697_100181817 | |||
| 1150 | Ga0070697_100206066 | |||
| 1151 | Ga0070697_100224661 | |||
| 1152 | Ga0070697_100250867 | |||
| 1153 | Ga0070697_100374622 | |||
| 1154 | Ga0068853_100050521 | |||
| 1155 | Ga0068853_100116338 | |||
| 1156 | Ga0068853_100170151 | |||
| 1157 | Ga0068853_100260109 | |||
| 1158 | Ga0068853_100333140 | |||
| 1159 | Ga0070672_100043316 | |||
| 1160 | Ga0070672_100082084 | |||
| 1161 | Ga0070672_100659162 | |||
| 1162 | Ga0070686_100000114 | |||
| 1163 | Ga0070686_100066865 | |||
| 1164 | Ga0070695_100002531 | |||
| 1165 | Ga0070695_100004641 | |||
| 1166 | Ga0070695_100048443 | |||
| 1167 | Ga0070695_100109012 | |||
| 1168 | Ga0070695_100158079 | |||
| 1169 | Ga0070695_100253636 | |||
| 1170 | Ga0070696_100000241 | |||
| 1171 | Ga0070696_100009848 | |||
| 1172 | Ga0070696_100019530 | |||
| 1173 | Ga0070696_100040174 | |||
| 1174 | Ga0070696_100148010 | |||
| 1175 | Ga0070696_100158280 | |||
| 1176 | Ga0070696_100226812 | |||
| 1177 | Ga0070696_100361606 | |||
| 1178 | Ga0070696_100619279 | |||
| 1179 | Ga0070693_100001077 | |||
| 1180 | Ga0070665_100241285 | |||
| 1181 | Ga0070704_100009110 | |||
| 1182 | Ga0070704_100074055 | |||
| 1183 | Ga0070704_100283144 | |||
| 1184 | Ga0068855_100100024 | |||
| 1185 | Ga0070664_100031879 | |||
| 1186 | Ga0070664_100032017 | |||
| 1187 | Ga0070664_100206275 | |||
| 1188 | Ga0070664_100247244 | |||
| 1189 | Ga0070664_100283058 | |||
| 1190 | Ga0070664_100458478 | |||
| 1191 | Ga0070664_100807487 | |||
| 1192 | Ga0068857_100004955 | |||
| 1193 | Ga0068857_100007823 | |||
| 1194 | Ga0068857_100011807 | |||
| 1195 | Ga0068857_100115451 | |||
| 1196 | Ga0068854_100003232 | |||
| 1197 | Ga0068854_100081057 | |||
| 1198 | Ga0068854_100746702 | |||
| 1199 | Ga0068856_100028535 | |||
| 1200 | Ga0068856_100045653 | |||
| 1201 | Ga0068856_100755481 | |||
| 1202 | Ga0068856_101110712 | |||
| 1203 | Ga0070702_100003782 | |||
| 1204 | Ga0070702_100037858 | |||
| 1205 | Ga0068852_100014555 | |||
| 1206 | Ga0068852_100080929 | |||
| 1207 | Ga0068852_100132849 | |||
| 1208 | Ga0068852_100194517 | |||
| 1209 | Ga0068852_100555471 | |||
| 1210 | Ga0068859_100006533 | |||
| 1211 | Ga0068859_100153091 | |||
| 1212 | Ga0068859_100325500 | |||
| 1213 | Ga0068859_101299583 | |||
| 1214 | Ga0068864_100000669 | |||
| 1215 | Ga0068864_100007489 | |||
| 1216 | Ga0068864_100018976 | |||
| 1217 | Ga0068864_100095394 | |||
| 1218 | Ga0068864_100363959 | |||
| 1219 | Ga0068866_10000619 | |||
| 1220 | Ga0068861_100004749 | |||
| 1221 | Ga0068861_100021579 | |||
| 1222 | Ga0068861_100114083 | |||
| 1223 | Ga0068861_100523464 | |||
| 1224 | Ga0068851_10023940 | |||
| 1225 | Ga0068851_10029966 | |||
| 1226 | Ga0068851_10282228 | |||
| 1227 | Ga0068870_10028183 | |||
| 1228 | Ga0068870_10096015 | |||
| 1229 | Ga0068863_100038000 | |||
| 1230 | Ga0068863_100054592 | |||
| 1231 | Ga0068863_100392811 | |||
| 1232 | Ga0068863_100525076 | |||
| 1233 | Ga0068858_100033195 | |||
| 1234 | Ga0068858_100045418 | |||
| 1235 | Ga0068858_100092628 | |||
| 1236 | Ga0068860_100059238 | |||
| 1237 | Ga0068862_100001715 | |||
| 1238 | Ga0068862_100116238 | |||
| 1239 | Ga0068862_100159984 | |||
| 1240 | Ga0068862_100296858 | |||
| 1241 | Ga0070717_10413876 | |||
| 1242 | Ga0070716_100162156 | |||
| 1243 | Ga0070712_100786490 | |||
| 1244 | Ga0097621_100025205 | |||
| 1245 | Ga0068871_100010208 | |||
| 1246 | Ga0068871_100047421 | |||
| 1247 | Ga0075428_100009465 | |||
| 1248 | Ga0075428_100072228 | |||
| 1249 | Ga0075430_100001631 | |||
| 1250 | Ga0075430_100019552 | |||
| 1251 | Ga0075430_100209610 | |||
| 1252 | Ga0075431_100003312 | |||
| 1253 | Ga0075431_100029554 | |||
| 1254 | Ga0075431_100031351 | |||
| 1255 | Ga0075431_101275727 | |||
| 1256 | Ga0075433_10000784 | |||
| 1257 | Ga0075433_10002805 | |||
| 1258 | Ga0075433_10005515 | |||
| 1259 | Ga0075433_10014997 | |||
| 1260 | Ga0075433_10017886 | |||
| 1261 | Ga0075433_10060199 | |||
| 1262 | Ga0075433_10076834 | |||
| 1263 | Ga0075433_10104484 | |||
| 1264 | Ga0075433_10129053 | |||
| 1265 | Ga0075433_10139652 | |||
| 1266 | Ga0075433_10310518 | |||
| 1267 | Ga0075433_10761740 | |||
| 1268 | Ga0075434_100001037 | |||
| 1269 | Ga0075434_100003544 | |||
| 1270 | Ga0075434_100030607 | |||
| 1271 | Ga0075434_100044406 | |||
| 1272 | Ga0075434_100051175 | |||
| 1273 | Ga0075434_100168357 | |||
| 1274 | Ga0075434_100183076 | |||
| 1275 | Ga0075434_100188822 | |||
| 1276 | Ga0075434_100241240 | |||
| 1277 | Ga0075434_100341026 | |||
| 1278 | Ga0075429_100018080 | |||
| 1279 | Ga0075429_100029208 | |||
| 1280 | Ga0075429_100138452 | |||
| 1281 | Ga0068865_100008800 | |||
| 1282 | Ga0068865_100056467 | |||
| 1283 | Ga0068865_100163938 | |||
| 1284 | Ga0075436_100025162 | |||
| 1285 | Ga0075436_100044438 | |||
| 1286 | Ga0075436_100150778 | |||
| 1287 | Ga0097620_100006532 | |||
| 1288 | Ga0097620_100153093 | |||
| 1289 | Ga0097620_100325513 | |||
| 1290 | Ga0097620_101299640 | |||
| 1291 | Ga0075435_100018185 | |||
| 1292 | Ga0075435_100025282 | |||
| 1293 | Ga0075435_100064339 | |||
| 1294 | Ga0075435_100356081 | |||
| 1295 | Ga0075435_100400844 | |||
| 1296 | Ga0105240_10005769 | |||
| 1297 | Ga0105240_10239835 | |||
| 1298 | Ga0105240_10273584 | |||
| 1299 | Ga0105240_10721767 | |||
| 1300 | Ga0111539_10036569 | |||
| 1301 | Ga0111539_10074930 | |||
| 1302 | Ga0111539_10233074 | |||
| 1303 | Ga0105245_10013096 | |||
| 1304 | Ga0105245_10046580 | |||
| 1305 | Ga0105245_10114320 | |||
| 1306 | Ga0105245_10682031 | |||
| 1307 | Ga0105245_10945025 | |||
| 1308 | Ga0114129_10012770 | |||
| 1309 | Ga0114129_10133324 | |||
| 1310 | Ga0114129_10214148 | |||
| 1311 | Ga0114129_10249413 | |||
| 1312 | Ga0114129_10382371 | |||
| 1313 | Ga0114129_10669150 | |||
| 1314 | Ga0114129_10676128 | |||
| 1315 | Ga0114129_10930808 | |||
| 1316 | Ga0114129_11242091 | |||
| 1317 | Ga0114129_11258135 | |||
| 1318 | Ga0105243_10003139 | |||
| 1319 | Ga0105243_10684579 | |||
| 1320 | Ga0105241_10001507 | |||
| 1321 | Ga0105241_10035622 | |||
| 1322 | Ga0105241_10631330 | |||
| 1323 | Ga0105242_10002497 | |||
| 1324 | Ga0105242_10086854 | |||
| 1325 | Ga0105242_10345074 | |||
| 1326 | Ga0105248_10004111 | |||
| 1327 | Ga0105248_10014964 | |||
| 1328 | Ga0105248_10068908 | |||
| 1329 | Ga0105248_10151606 | |||
| 1330 | Ga0105248_10153205 | |||
| 1331 | Ga0105237_10021484 | |||
| 1332 | Ga0105238_10000081 | |||
| 1333 | Ga0105238_10180937 | |||
| 1334 | Ga0105238_10191528 | |||
| 1335 | Ga0105249_10000180 | |||
| 1336 | Ga0105249_10000231 | |||
| 1337 | Ga0105249_10005450 | |||
| 1338 | Ga0105249_10045737 | |||
| 1339 | Ga0105249_10111769 | |||
| 1340 | Ga0105249_10146143 | |||
| 1341 | Ga0105249_10299552 | |||
| 1342 | Ga0105249_10476987 | |||
| 1343 | Ga0105239_10005622 | |||
| 1344 | Ga0105239_10011262 | |||
| 1345 | Ga0105239_10016864 | |||
| 1346 | Ga0105239_10097898 | |||
| 1347 | Ga0105239_10181236 | |||
| 1348 | Ga0105239_11299224 | |||
| 1349 | Ga0105246_10015254 | |||
| 1350 | Ga0105246_10038682 | |||
| 1351 | Ga0105246_10734562 | |||
| 1352 | Ga0105246_10934518 | |||
| 1353 | Ga0157373_10582972 | |||
| 1354 | Ga0157371_10008591 | |||
| 1355 | Ga0157371_10014063 | |||
| 1356 | Ga0157371_10619241 | |||
| 1357 | Ga0157370_10016812 | |||
| 1358 | Ga0157370_10139685 | |||
| 1359 | Ga0157369_10057814 | |||
| 1360 | Ga0157369_10080591 | |||
| 1361 | Ga0157369_10096501 | |||
| 1362 | Ga0157369_10339297 | |||
| 1363 | Ga0157369_10498752 | |||
| 1364 | Ga0157369_10943840 | |||
| 1365 | Ga0157374_10004155 | |||
| 1366 | Ga0157374_10112549 | |||
| 1367 | Ga0157374_10131613 | |||
| 1368 | Ga0157374_10639000 | |||
| 1369 | Ga0157378_10000788 | |||
| 1370 | Ga0157378_10093418 | |||
| 1371 | Ga0157378_10721334 | |||
| 1372 | Ga0163162_10020298 | |||
| 1373 | Ga0163162_10071700 | |||
| 1374 | Ga0163162_10525218 | |||
| 1375 | Ga0157372_10002537 | |||
| 1376 | Ga0157372_10012310 | |||
| 1377 | Ga0157372_10103936 | |||
| 1378 | Ga0157372_10279424 | |||
| 1379 | Ga0157372_10344008 | |||
| 1380 | Ga0157372_10589333 | |||
| 1381 | Ga0157372_11237018 | |||
| 1382 | Ga0157375_10068436 | |||
| 1383 | Ga0157375_10093743 | |||
| 1384 | Ga0157375_10170810 | |||
| 1385 | Ga0157375_10248462 | |||
| 1386 | Ga0157375_10522745 | |||
| 1387 | Ga0157375_10548755 | |||
| 1388 | Ga0163163_10003217 | |||
| 1389 | Ga0163163_10023684 | |||
| 1390 | Ga0163163_10873856 | |||
| 1391 | Ga0157380_10006354 | |||
| 1392 | Ga0157380_10020831 | |||
| 1393 | Ga0182008_10011270 | |||
| 1394 | Ga0157377_10009075 | |||
| 1395 | Ga0157377_10051514 | |||
| 1396 | Ga0157377_10414755 | |||
| 1397 | Ga0157377_10454447 | |||
| 1398 | Ga0157379_10061161 | |||
| 1399 | Ga0157379_10347565 | |||
| 1400 | Ga0157376_10808717 | |||
| 1401 | Ga0182005_1011205 | |||
| 1402 | Ga0163161_10016469 | |||
| 1403 | Ga0163161_10152900 | |||
| 1404 | Ga0163161_10155767 | |||
| 1405 | Ga0213876_10028493 | |||
| 1406 | Ga0213875_10007636 | |||
| 1407 | Ga0207673_1010238 | |||
| 1408 | Ga0207697_10009061 | |||
| 1409 | Ga0207656_10034765 | |||
| 1410 | Ga0207656_10224112 | |||
| 1411 | Ga0207653_10007615 | |||
| 1412 | Ga0207653_10085451 | |||
| 1413 | Ga0207642_10001673 | |||
| 1414 | Ga0207642_10105414 | |||
| 1415 | Ga0207688_10343059 | |||
| 1416 | Ga0207680_10010734 | |||
| 1417 | Ga0207680_10107976 | |||
| 1418 | Ga0207680_10290158 | |||
| 1419 | Ga0207699_10038118 | |||
| 1420 | Ga0207699_10220286 | |||
| 1421 | Ga0207645_10000366 | |||
| 1422 | Ga0207645_10002871 | |||
| 1423 | Ga0207645_10041771 | |||
| 1424 | Ga0207643_10003297 | |||
| 1425 | Ga0207643_10033389 | |||
| 1426 | Ga0207643_10092590 | |||
| 1427 | Ga0207684_10027076 | |||
| 1428 | Ga0207684_10087275 | |||
| 1429 | Ga0207684_10339186 | |||
| 1430 | Ga0207684_10343602 | |||
| 1431 | Ga0207654_10005096 | |||
| 1432 | Ga0207654_10028056 | |||
| 1433 | Ga0207654_10295777 | |||
| 1434 | Ga0207707_10011939 | |||
| 1435 | Ga0207707_10195726 | |||
| 1436 | Ga0207707_10423211 | |||
| 1437 | Ga0207707_10448020 | |||
| 1438 | Ga0207695_10017698 | |||
| 1439 | Ga0207695_10022752 | |||
| 1440 | Ga0207695_10556097 | |||
| 1441 | Ga0207671_10341591 | |||
| 1442 | Ga0207693_10806467 | |||
| 1443 | Ga0207663_10000034 | |||
| 1444 | Ga0207663_10179306 | |||
| 1445 | Ga0207663_10238585 | |||
| 1446 | Ga0207663_10691873 | |||
| 1447 | Ga0207660_10016237 | |||
| 1448 | Ga0207660_10061249 | |||
| 1449 | Ga0207660_10170680 | |||
| 1450 | Ga0207660_10241142 | |||
| 1451 | Ga0207662_10008225 | |||
| 1452 | Ga0207662_10009229 | |||
| 1453 | Ga0207662_10564248 | |||
| 1454 | Ga0207657_10018301 | |||
| 1455 | Ga0207657_10084312 | |||
| 1456 | Ga0207657_10794961 | |||
| 1457 | Ga0207649_10016029 | |||
| 1458 | Ga0207649_10017697 | |||
| 1459 | Ga0207649_10083340 | |||
| 1460 | Ga0207652_10022318 | |||
| 1461 | Ga0207652_10128865 | |||
| 1462 | Ga0207646_10053111 | |||
| 1463 | Ga0207646_10096751 | |||
| 1464 | Ga0207646_10106431 | |||
| 1465 | Ga0207646_10124035 | |||
| 1466 | Ga0207646_10132132 | |||
| 1467 | Ga0207646_10178399 | |||
| 1468 | Ga0207646_10578391 | |||
| 1469 | Ga0207646_10802620 | |||
| 1470 | Ga0207681_10001066 | |||
| 1471 | Ga0207681_10013499 | |||
| 1472 | Ga0207681_10019368 | |||
| 1473 | Ga0207681_10021259 | |||
| 1474 | Ga0207681_10022617 | |||
| 1475 | Ga0207694_10000074 | |||
| 1476 | Ga0207694_10043666 | |||
| 1477 | Ga0207694_10521538 | |||
| 1478 | Ga0207650_10008725 | |||
| 1479 | Ga0207650_10041391 | |||
| 1480 | Ga0207650_10500869 | |||
| 1481 | Ga0207659_10068878 | |||
| 1482 | Ga0207659_10103415 | |||
| 1483 | Ga0207659_10232413 | |||
| 1484 | Ga0207659_10267355 | |||
| 1485 | Ga0207659_10650143 | |||
| 1486 | Ga0207659_10839859 | |||
| 1487 | Ga0207687_10034655 | |||
| 1488 | Ga0207687_10035240 | |||
| 1489 | Ga0207700_10043962 | |||
| 1490 | Ga0207700_10109275 | |||
| 1491 | Ga0207700_10444661 | |||
| 1492 | Ga0207700_10543669 | |||
| 1493 | Ga0207664_10250681 | |||
| 1494 | Ga0207644_10085889 | |||
| 1495 | Ga0207644_10258629 | |||
| 1496 | Ga0207644_10513514 | |||
| 1497 | Ga0207644_11082048 | |||
| 1498 | Ga0207690_10017420 | |||
| 1499 | Ga0207690_10045122 | |||
| 1500 | Ga0207690_10110535 | |||
| 1501 | Ga0207690_10167354 | |||
| 1502 | Ga0207690_10274681 | |||
| 1503 | Ga0207690_10282345 | |||
| 1504 | Ga0207706_10000005 | |||
| 1505 | Ga0207706_10000271 | |||
| 1506 | Ga0207706_10006727 | |||
| 1507 | Ga0207706_10017865 | |||
| 1508 | Ga0207706_10115996 | |||
| 1509 | Ga0207686_10000129 | |||
| 1510 | Ga0207709_10004559 | |||
| 1511 | Ga0207709_10233859 | |||
| 1512 | Ga0207709_10782102 | |||
| 1513 | Ga0207670_10013922 | |||
| 1514 | Ga0207670_10158764 | |||
| 1515 | Ga0207669_10000371 | |||
| 1516 | Ga0207669_10146546 | |||
| 1517 | Ga0207669_10180188 | |||
| 1518 | Ga0207704_10026219 | |||
| 1519 | Ga0207704_10072406 | |||
| 1520 | Ga0207704_10085915 | |||
| 1521 | Ga0207665_10191816 | |||
| 1522 | Ga0207665_10252139 | |||
| 1523 | Ga0207691_10001502 | |||
| 1524 | Ga0207691_10005026 | |||
| 1525 | Ga0207691_10026767 | |||
| 1526 | Ga0207691_10091238 | |||
| 1527 | Ga0207691_10109295 | |||
| 1528 | Ga0207691_10271493 | |||
| 1529 | Ga0207691_10712472 | |||
| 1530 | Ga0207711_10000854 | |||
| 1531 | Ga0207711_10033563 | |||
| 1532 | Ga0207711_10958847 | |||
| 1533 | Ga0207689_10003784 | |||
| 1534 | Ga0207689_10007240 | |||
| 1535 | Ga0207689_10007761 | |||
| 1536 | Ga0207661_10004655 | |||
| 1537 | Ga0207661_10012577 | |||
| 1538 | Ga0207661_10058283 | |||
| 1539 | Ga0207661_10190974 | |||
| 1540 | Ga0207661_10322385 | |||
| 1541 | Ga0207679_10034047 | |||
| 1542 | Ga0207679_10049494 | |||
| 1543 | Ga0207679_10065497 | |||
| 1544 | Ga0207679_10235036 | |||
| 1545 | Ga0207679_10238746 | |||
| 1546 | Ga0207679_10332643 | |||
| 1547 | Ga0207679_10389163 | |||
| 1548 | Ga0207679_10682550 | |||
| 1549 | Ga0207667_10150109 | |||
| 1550 | Ga0207651_10051231 | |||
| 1551 | Ga0207651_10101159 | |||
| 1552 | Ga0207651_10264385 | |||
| 1553 | Ga0207651_10435961 | |||
| 1554 | Ga0207651_10508181 | |||
| 1555 | Ga0207651_10883230 | |||
| 1556 | Ga0207712_10000391 | |||
| 1557 | Ga0207712_10034240 | |||
| 1558 | Ga0207712_10034593 | |||
| 1559 | Ga0207712_10075146 | |||
| 1560 | Ga0207712_10532805 | |||
| 1561 | Ga0207668_10032194 | |||
| 1562 | Ga0207668_10034326 | |||
| 1563 | Ga0207668_10037336 | |||
| 1564 | Ga0207668_10721138 | |||
| 1565 | Ga0207640_10002079 | |||
| 1566 | Ga0207658_10132008 | |||
| 1567 | Ga0207658_10188677 | |||
| 1568 | Ga0207658_10935449 | |||
| 1569 | Ga0207677_10430153 | |||
| 1570 | Ga0207703_10041262 | |||
| 1571 | Ga0207703_10533123 | |||
| 1572 | Ga0207639_10155908 | |||
| 1573 | Ga0207639_10297223 | |||
| 1574 | Ga0207639_10612206 | |||
| 1575 | Ga0207639_10842083 | |||
| 1576 | Ga0207678_10008469 | |||
| 1577 | Ga0207678_10255460 | |||
| 1578 | Ga0207708_10006997 | |||
| 1579 | Ga0207708_10062231 | |||
| 1580 | Ga0207702_10102122 | |||
| 1581 | Ga0207702_10305836 | |||
| 1582 | Ga0207702_10354652 | |||
| 1583 | Ga0207702_11286127 | |||
| 1584 | Ga0207641_10836830 | |||
| 1585 | Ga0207648_10000021 | |||
| 1586 | Ga0207648_10038586 | |||
| 1587 | Ga0207648_10053556 | |||
| 1588 | Ga0207676_10001551 | |||
| 1589 | Ga0207676_10012912 | |||
| 1590 | Ga0207676_10066461 | |||
| 1591 | Ga0207676_10545348 | |||
| 1592 | Ga0207674_10001530 | |||
| 1593 | Ga0207674_10001691 | |||
| 1594 | Ga0207674_10007225 | |||
| 1595 | Ga0207674_10015380 | |||
| 1596 | Ga0207674_10047388 | |||
| 1597 | Ga0207674_10130972 | |||
| 1598 | Ga0207674_10522452 | |||
| 1599 | Ga0207675_100000306 | |||
| 1600 | Ga0207675_100252834 | |||
| 1601 | Ga0207675_100556298 | |||
| 1602 | Ga0207675_100754815 | |||
| 1603 | Ga0207683_10143670 | |||
| 1604 | Ga0207683_10417510 | |||
| 1605 | Ga0207683_10508015 | |||
| 1606 | Ga0207683_10646798 | |||
| 1607 | Ga0207683_10962243 | |||
| 1608 | Ga0207698_10012180 | |||
| 1609 | Ga0207698_10021230 | |||
| 1610 | Ga0207698_10053709 | |||
| 1611 | Ga0207698_10097526 | |||
| 1612 | Ga0207698_10834655 | |||
| 1613 | Ga0207428_10104240 | |||
| 1614 | Ga0207428_10560357 | |||
| 1615 | Ga0268266_10119940 | |||
| 1616 | Ga0268266_10319382 | |||
| 1617 | Ga0268266_10905914 | |||
| 1618 | Ga0268265_10039587 | |||
| 1619 | Ga0268265_10040656 | |||
| 1620 | Ga0268265_10081756 | |||
| 1621 | Ga0268265_10104408 | |||
| 1622 | Ga0268265_10147550 | |||
| 1623 | Ga0268265_10668369 | |||
| 1624 | Ga0268264_10004704 | |||
| 1625 | Ga0307408_100013542 | |||
| 1626 | Ga0307408_100017112 | |||
| 1627 | Ga0307408_100180834 | |||
| 1628 | Ga0307408_101089072 | |||
| 1629 | Ga0307405_10001572 | |||
| 1630 | Ga0307405_10257687 | |||
| 1631 | Ga0307413_10003676 | |||
| 1632 | Ga0307413_10021095 | |||
| 1633 | Ga0307413_10065719 | |||
| 1634 | Ga0307410_10000534 | |||
| 1635 | Ga0307410_10053885 | |||
| 1636 | Ga0307410_10129024 | |||
| 1637 | Ga0307410_10428116 | |||
| 1638 | Ga0307410_10718186 | |||
| 1639 | Ga0307406_10083947 | |||
| 1640 | Ga0307406_10272661 | |||
| 1641 | Ga0307407_10007291 | |||
| 1642 | Ga0307407_10054020 | |||
| 1643 | Ga0307407_10064745 | |||
| 1644 | Ga0307412_10007612 | |||
| 1645 | Ga0307409_100004304 | |||
| 1646 | Ga0307409_100011136 | |||
| 1647 | Ga0307409_100025765 | |||
| 1648 | Ga0307409_100074623 | |||
| 1649 | Ga0307409_100131770 | |||
| 1650 | Ga0307409_100190806 | |||
| 1651 | Ga0307409_100342199 | |||
| 1652 | Ga0307409_100529244 | |||
| 1653 | Ga0307416_100009861 | |||
| 1654 | Ga0307416_100047608 | |||
| 1655 | Ga0307416_100600870 | |||
| 1656 | Ga0307416_101073591 | |||
| 1657 | Ga0307414_10004540 | |||
| 1658 | Ga0307414_10031579 | |||
| 1659 | Ga0307414_10119849 | |||
| 1660 | Ga0307414_10245400 | |||
| 1661 | Ga0307414_11412291 | |||
| 1662 | Ga0307411_10000572 | |||
| 1663 | Ga0307411_10014487 | |||
| 1664 | Ga0307411_10372585 | |||
| 1665 | Ga0307411_10626945 | |||
| 1666 | Ga0307415_100003899 | |||
| 1667 | Ga0307415_100052554 | |||
| 1668 | Ga0307415_100120589 | |||
| 1669 | Ga0307415_100166894 | |||
| 1670 | Ga0307415_100855285 | |||
| 1671 | Ga0373959_0000044 | |||
| 1672 | Ga0373934_0015010 | |||
| 1673 | Ga0373934_0038274 | |||
| 1674 | Ga0373932_0085013 | |||
| 1675 | Ga0373939_0151128 | |||
| 1676 | Ga0373953_0124361 | |||
| 1677 | Ga0373960_0022942 | |||
| 1678 | Ga0373943_0195978 | |||
| 1679 | Ga0373955_0080180 | |||
| 1680 | Ga0373931_0081802 | |||
| 1681 | Ga0373931_0091294 | |||
| 1682 | Ga0373931_0216449 | |||
| 1683 | Ga0373931_0250690 | |||
| 1684 | Ga0373935_0326253 | |||
| 1685 | Ga0373927_0020604 | |||
| 1686 | Ga0373933_0031933 | |||
| 1687 | Ga0373947_0188935 | |||
| 1688 | Ga0373937_0004884 | |||
| 1689 | Ga0373937_0056952 | |||
| 1690 | Ga0373937_0528347 | |||
| 1691 | Ga0373937_0782023 | |||
| 1692 | Ga0373925_0491443 | |||
| 1693 | Ga0395905_0466708 | |||
| 1694 | Ga0436364_0508766 | |||
| 1695 | Ga0395901_0744964 | |||
| 1696 | Ga0242420_001555 | |||
| 1697 | Ga0242420_008022 | |||
| 1698 | Ga0242420_010963 | |||
| 1699 | Ga0436365_1494207 | |||
| 1700 | Ga0451791_0724933 | |||
| 1701 | Ga0451853_1697498 | |||
| 1702 | Ga0439445_0067733 | |||
| 1703 | Ga0450914_023598 | |||
| 1704 | Ga0451577_0055150 | |||
| 1705 | Ga0451577_0235024 | |||
| 1706 | Ga0451577_0470669 | |||
| 1707 | Ga0451577_0991343 | |||
| 1708 | Ga0453683_0012581 | |||
| 1709 | Ga0453683_0082764 | |||
| 1710 | Ga0453683_0276620 | |||
| 1711 | Ga0453684_0697781 | |||
| 1712 | Ga0451576_0016016 | |||
| 1713 | Ga0451576_0078909 | |||
| 1714 | Ga0451576_0202425 | |||
| 1715 | Ga0451576_0751615 | |||
| 1716 | Ga0451576_1023419 | |||
| 1717 | Ga0451576_1394388 | |||
| 1718 | Ga0495592_0442693 | |||
| 1719 | Ga0495603_0017157 | |||
| 1720 | Ga0495629_0059822 | |||
| 1721 | Ga0495651_0041381 | |||
| 1722 | Ga0495651_0074121 | |||
| 1723 | Ga0495653_0022688 | |||
| 1724 | Ga0495580_0040218 | |||
| 1725 | Ga0495580_0046474 | |||
| 1726 | Ga0495580_0188503 | |||
| 1727 | Ga0495582_0004174 | |||
| 1728 | Ga0495639_0117495 | |||
| 1729 | Ga0495639_0122188 | |||
| 1730 | Ga0495662_0029737 | |||
| 1731 | Ga0495664_0057823 | |||
| 1732 | Ga0495594_0006581 | |||
| 1733 | Ga0495594_0007624 | |||
| 1734 | Ga0495608_0042062 | |||
| 1735 | Ga0495608_0378382 | |||
| 1736 | Ga0495628_0032241 | |||
| 1737 | Ga0495630_0017637 | |||
| 1738 | Ga0495630_0073202 | |||
| 1739 | Ga0495666_0246149 | |||
| 1740 | Ga0495652_0000889 | |||
| 1741 | Ga0495652_0129667 | |||
| 1742 | Ga0495652_0701601 | |||
| 1743 | Ga0495665_0000603 | |||
| 1744 | Ga0495640_0098184 | |||
| 1745 | Ga0495586_0025302 | |||
| 1746 | Ga0495586_0044682 | |||
| 1747 | Ga0495587_0000327 | |||
| 1748 | Ga0495587_0006881 | |||
| 1749 | Ga0495587_0054179 | |||
| 1750 | Ga0495587_0111979 | |||
| 1751 | Ga0495645_0000211 | |||
| 1752 | Ga0495645_0118170 | |||
| 1753 | Ga0495667_0002556 | |||
| 1754 | Ga0495667_0022268 | |||
| 1755 | Ga0495667_0100700 | |||
| 1756 | Ga0495634_0102415 | |||
| 1757 | Ga0495635_0190603 | |||
| 1758 | Ga0495588_0144237 | |||
| 1759 | Ga0495657_0089520 | |||
| 1760 | Ga0495657_0131921 | |||
| 1761 | Ga0495599_0003821 | |||
| 1762 | Ga0495623_0023730 | |||
| 1763 | Ga0495623_0033621 | |||
| 1764 | Ga0495646_0040963 | |||
| 1765 | Ga0495658_0078730 | |||
| 1766 | Ga0495613_0048846 | |||
| 1767 | Ga0495613_0513664 | |||
| 1768 | Ga0495600_0124676 | |||
| 1769 | Ga0495600_0192085 | |||
| 1770 | Ga0495600_0216519 | |||
| 1771 | Ga0495581_0060251 | |||
| 1772 | Ga0495581_0107779 | |||
| 1773 | Ga0495604_0021625 | |||
| 1774 | Ga0495674_0101491 | |||
| 1775 | Ga0495676_0288699 | |||
| 1776 | Ga0495680_0009874 | |||
| 1777 | Ga0495675_0006376 | |||
| 1778 | Ga0495675_0015827 | |||
| 1779 | Ga0495675_0175291 | |||
| 1780 | Ga0495684_0012476 | |||
| 1781 | Ga0495684_0015174 | |||
| 1782 | Ga0495684_0069282 | |||
| 1783 | Ga0495684_0071837 | |||
| 1784 | Ga0495684_0145995 | |||
| 1785 | Ga0495593_0176561 | |||
| 1786 | Ga0495602_0037854 | |||
| 1787 | Ga0495602_0085788 | |||
| 1788 | Ga0496100_0024473 | |||
| 1789 | Ga0496100_0189906 | |||
| 1790 | Ga0496101_0026539 | |||
| 1791 | Ga0496101_0045293 | |||
| 1792 | Ga0496101_0211183 | |||
| 1793 | Ga0496102_0022191 | |||
| 1794 | Ga0496102_0062843 | |||
| 1795 | Ga0496102_0091620 | |||
| 1796 | Ga0496102_0314585 | |||
| 1797 | Ga0496102_0346059 | |||
| 1798 | Ga0496104_0032287 | |||
| 1799 | Ga0496104_0065511 | |||
| 1800 | Ga0496104_0183389 | |||
| 1801 | Ga0496104_0194163 | |||
| 1802 | Ga0496104_0361418 | |||
| 1803 | Ga0496105_0062553 | |||
| 1804 | Ga0496106_0101096 | |||
| 1805 | Ga0496106_0781336 | |||
| 1806 | Ga0496107_0039224 | |||
| 1807 | Ga0496107_0239890 | |||
| 1808 | Ga0496108_0002786 | |||
| 1809 | Ga0496108_0005189 | |||
| 1810 | Ga0496108_0011155 | |||
| 1811 | Ga0496108_0067030 | |||
| 1812 | Ga0496109_0020704 | |||
| 1813 | Ga0496109_0038375 | |||
| 1814 | Ga0496109_0069386 | |||
| 1815 | Ga0496109_0156113 | |||
| 1816 | Ga0496109_0233914 | |||
| 1817 | Ga0496109_0239709 | |||
| 1818 | Ga0496109_0521343 | |||
| 1819 | Ga0496110_0027788 | |||
| 1820 | Ga0496110_0029716 | |||
| 1821 | Ga0496110_0102770 | |||
| 1822 | Ga0496111_0044844 | |||
| 1823 | Ga0496111_0046516 | |||
| 1824 | Ga0496111_0087281 | |||
| 1825 | Ga0496111_0404653 | |||
| 1826 | Ga0496112_0000607 | |||
| 1827 | Ga0496112_0005273 | |||
| 1828 | Ga0496112_0013170 | |||
| 1829 | Ga0496112_0129506 | |||
| 1830 | Ga0496113_0000097 | |||
| 1831 | Ga0496113_0005097 | |||
| 1832 | Ga0496113_0029432 | |||
| 1833 | Ga0496113_0206656 | |||
| 1834 | Ga0496114_0020367 | |||
| 1835 | Ga0496114_0030541 | |||
| 1836 | Ga0496114_0376334 | |||
| 1837 | Ga0496114_0410182 | |||
| 1838 | Ga0496115_0010573 | |||
| 1839 | Ga0496115_0084200 | |||
| 1840 | Ga0501298_021128 | |||
| 1841 | Ga0501038_0178283 | |||
| 1842 | Ga0501040_0136322 | |||
| 1843 | Ga0501048_0205867 | |||
| 1844 | Ga0501067_0188037 | |||
| 1845 | Ga0501074_0128831 | |||
| 1846 | Ga0501077_0008022 | |||
| 1847 | Ga0501216_014245 | |||
| 1848 | Ga0501223_032661 | |||
| 1849 | Ga0501230_031237 | |||
| 1850 | Ga0501233_059941 | |||
| 1851 | Ga0501242_005926 | |||
| 1852 | Ga0501249_009886 | |||
| 1853 | Ga0501257_019603 | |||
| 1854 | Ga0501261_019797 | |||
| 1855 | Ga0501080_0456112 | |||
| 1856 | Ga0501081_0016800 | |||
| 1857 | nmdc:mga05p37_10437_c1 | |||
| 1858 | nmdc:mga05p37_111342_c1 | |||
| 1859 | nmdc:mga05p37_182363_c1 | |||
| 1860 | nmdc:mga05p37_206331_c1 | |||
| 1861 | nmdc:mga05p37_333005_c1 | |||
| 1862 | nmdc:mga05p37_379155_c1 | |||
| 1863 | nmdc:mga05p37_636333_c1 | |||
| 1864 | nmdc:mga09592_13458_c1 | |||
| 1865 | nmdc:mga09592_192077_c1 | |||
| 1866 | nmdc:mga09592_214797_c1 | |||
| 1867 | nmdc:mga09592_433761_c1 | |||
| 1868 | nmdc:mga09592_476448_c1 | |||
| 1869 | nmdc:mga0qj67_175880_c1 | |||
| 1870 | nmdc:mga0qj67_17742_c1 | |||
| 1871 | nmdc:mga0qj67_574414_c1 | |||
| 1872 | nmdc:mga0qj67_7214_c1 | |||
| 1873 | nmdc:mga0qj67_911714_c1 | |||
| 1874 | nmdc:mga06r32_10526_c1 | |||
| 1875 | nmdc:mga06r32_1166411_c1 | |||
| 1876 | nmdc:mga06r32_310168_c1 | |||
| 1877 | nmdc:mga06r32_43755_c1 | |||
| 1878 | nmdc:mga06r32_502690_c1 | |||
| 1879 | nmdc:mga06r32_598684_c1 | |||
| 1880 | nmdc:mga08y16_1110585_c1 | |||
| 1881 | nmdc:mga08y16_271091_c1 | |||
| 1882 | nmdc:mga08y16_434844_c1 | |||
| 1883 | nmdc:mga0n895_1189_c1 | |||
| 1884 | nmdc:mga0n895_139096_c1 | |||
| 1885 | nmdc:mga0n895_1418844_c1 | |||
| 1886 | nmdc:mga0n895_14212_c1 | |||
| 1887 | nmdc:mga0n895_161485_c1 | |||
| 1888 | nmdc:mga0n895_164547_c1 | |||
| 1889 | nmdc:mga0n895_2925_c1 | |||
| 1890 | nmdc:mga0n895_374301_c1 | |||
| 1891 | nmdc:mga0n895_3949_c1 | |||
| 1892 | nmdc:mga0n895_6534_c1 | |||
| 1893 | nmdc:mga0n895_82112_c1 | |||
| 1894 | nmdc:mga0rr50_114484_c1 | |||
| 1895 | nmdc:mga0rr50_127850_c1 | |||
| 1896 | nmdc:mga0rr50_81709_c1 | |||
| 1897 | nmdc:mga08x19_391659_c1 | |||
| 1898 | nmdc:mga08x19_85536_c1 | |||
| 1899 | nmdc:mga0a205_103294_c1 | |||
| 1900 | nmdc:mga0a205_122582_c1 | |||
| 1901 | nmdc:mga0a205_142981_c1 | |||
| 1902 | nmdc:mga0a205_166148_c1 | |||
| 1903 | nmdc:mga0a205_194505_c1 | |||
| 1904 | nmdc:mga0a205_20757_c2 | |||
| 1905 | nmdc:mga0a205_23848_c1 | |||
| 1906 | nmdc:mga0a205_33456_c1 | |||
| 1907 | nmdc:mga0a205_493_c1 | |||
| 1908 | nmdc:mga0a205_8295_c1 | |||
| 1909 | nmdc:mga0a205_966931_c1 | |||
| 1910 | nmdc:mga0a205_97586_c2 | |||
| 1911 | Ga0495612_0016193 | |||
| 1912 | Ga0495619_0053258 | |||
| 1913 | Ga0501082_0044042 | |||
| 1914 | Ga0530510_0138099 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tpj-assembly1.cif.gz_A | selectivity mechanism of a bacterial homologue of the human drug peptide transporters pept1 and pept2 | 0.5051 | 1 | 193 |
| 7ydq-assembly1.cif.gz_A | structure of pfnt1(y190a)-gfp in complex with gsk4 | 0.4917 | 21 | 195 |
| 8ex4-assembly1.cif.gz_A | human s1p transporter spns2 in an inward-facing open conformation (state 1) | 0.4902 | 4 | 195 |
| 8g92-assembly1.cif.gz_A | structure of inhibitor 16d-bound spns2 | 0.4881 | 4 | 193 |
| 7wn1-assembly1.cif.gz_A | structure of pfnt1(y190a) in complex with nanobody 48 and inosine | 0.4774 | 21 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q69S28_20_412_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5701 | 3 | 197 | 1.20.1250.20 |
| af_Q0D5J2_1_233_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5696 | 3 | 197 | 1.20.1250.20 |
| af_Q8I2A8_11_433_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5402 | 2 | 197 | 1.20.1250.20 |
| af_Q4DKD0_106_299_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5298 | 34 | 197 | 1.20.1250.20 |
| af_Q2FVL1_1_184_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5285 | 39 | 199 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7PNH0-F1-model_v4 | HupE / UreJ protein | 0.9551 | 1 | 150 |
GO:0016020
|
| AF-A0A6M4IQU1-F1-model_v4 | HupE/UreJ family protein | 0.9478 | 2 | 200 |
GO:0016020
|
| AF-A0A2V7PNH0-F1-model_v4 | HupE / UreJ protein | 0.9427 | 1 | 150 |
GO:0016020
|
| AF-A0A352CGM1-F1-model_v4 | HupE / UreJ protein | 0.9392 | 1 | 197 |
GO:0016020
|
| AF-A0A0R2RZC9-F1-model_v4 | HupE / UreJ protein | 0.9379 | 1 | 196 |
GO:0016020
|