F486764

General Info

Members Datasets Scaffolds Average Seq Length
957 313 1914 200

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100123738|Ga0068857_1001237382
Length 219
Sequence MHRSLGKSDPSIAAYIADMSTLATFIQLGFRHIVDVEAMDHILFLLALAAIYRLRDARDALWVITAFTVGHSITLALAVTGIVTLPSALIEFLIPITIVATGIENLVVSDRTRAPWGGRYRPVFAGVFGLVHGAGFANYLKALFVDHIALPLFGFNVGIELGQITVLLAAAVLLAAVDRMIGALPWRRIDWPALRVRVVAVSLVVVAVASRWAVERNPW

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
292 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
293 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
294 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
295 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
296 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
297 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
298 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.54
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 25.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100123738 3300005577 Bacteria 2330
2 MBSR1b_contig_11714938 2162886012 Bacteria 1375
3 Ga0065715_10177927 3300005293 Bacteria 1497
4 Ga0065715_10200486 3300005293 Bacteria 1364
5 Ga0070676_10005285 3300005328 Bacteria 6866
6 Ga0070683_100003389 3300005329 Bacteria 12915
7 Ga0070683_100014074 3300005329 Bacteria 6987
8 Ga0070683_100024705 3300005329 Bacteria 5385
9 Ga0070683_100073927 3300005329 Bacteria 3182
10 Ga0070683_100085692 3300005329 Bacteria 2953
11 Ga0070683_100145987 3300005329 Unclassified 2242
12 Ga0070683_100169958 3300005329 Bacteria 2069
13 Ga0070683_100176545 3300005329 Bacteria 2028
14 Ga0070683_100298876 3300005329 Unclassified 1531
15 Ga0070683_100366536 3300005329 Bacteria 1372
16 Ga0070690_100192241 3300005330 Bacteria 1416
17 Ga0070670_100020074 3300005331 Bacteria 5739
18 Ga0070670_100032599 3300005331 Unclassified 4487
19 Ga0070670_100047997 3300005331 Bacteria 3675
20 Ga0070670_100298559 3300005331 Archaea 1409
21 Ga0068869_100008951 3300005334 Bacteria 6481
22 Ga0068869_100051097 3300005334 Bacteria 2998
23 Ga0070666_10012446 3300005335 Bacteria 5367
24 Ga0070666_10199661 3300005335 Bacteria 1407
25 Ga0070666_10569915 3300005335 Bacteria 825
26 Ga0070680_100003560 3300005336 Bacteria 11622
27 Ga0070680_100019138 3300005336 Bacteria 5422
28 Ga0070680_100354453 3300005336 Unclassified 1248
29 Ga0070682_100125580 3300005337 Bacteria 1729
30 Ga0070682_101015285 3300005337 Bacteria 689
31 Ga0068868_100128892 3300005338 Bacteria 2069
32 Ga0068868_100165379 3300005338 Bacteria 1829
33 Ga0070660_100074773 3300005339 Bacteria 2651
34 Ga0070660_100621979 3300005339 Bacteria 904
35 Ga0070689_100036132 3300005340 Bacteria 3778
36 Ga0070689_100057724 3300005340 Unclassified 3013
37 Ga0070689_100148918 3300005340 Bacteria 1887
38 Ga0070689_100865080 3300005340 Bacteria 798
39 Ga0070687_100005149 3300005343 Bacteria 5275
40 Ga0070687_100044408 3300005343 Bacteria 2263
41 Ga0070687_100114474 3300005343 Bacteria 1532
42 Ga0070687_100185976 3300005343 Bacteria 1248
43 Ga0070661_100014670 3300005344 Bacteria 5525
44 Ga0070661_101018328 3300005344 Bacteria 687
45 Ga0070692_10025009 3300005345 Bacteria 2940
46 Ga0070692_10069202 3300005345 Bacteria 1877
47 Ga0070668_100004653 3300005347 Bacteria 10162
48 Ga0070668_100006466 3300005347 Bacteria 8688
49 Ga0070668_100010136 3300005347 Bacteria 6987
50 Ga0070668_100085116 3300005347 Bacteria 2485
51 Ga0070668_100604601 3300005347 Unclassified 960
52 Ga0070668_100929962 3300005347 Unclassified 778
53 Ga0070669_100010261 3300005353 Bacteria 6654
54 Ga0070669_100017780 3300005353 Bacteria 5074
55 Ga0070669_100106104 3300005353 Bacteria 2126
56 Ga0070669_100131038 3300005353 Bacteria 1924
57 Ga0070669_100237633 3300005353 Unclassified 1446
58 Ga0070669_100258613 3300005353 Bacteria 1388
59 Ga0070669_100317872 3300005353 Bacteria 1256
60 Ga0070675_100002030 3300005354 Bacteria 15012
61 Ga0070675_100022286 3300005354 Bacteria 5060
62 Ga0070675_100029974 3300005354 Bacteria 4390
63 Ga0070675_100047973 3300005354 Bacteria 3501
64 Ga0070675_100199441 3300005354 Bacteria 1737
65 Ga0070675_100456879 3300005354 Unclassified 1146
66 Ga0070675_100590357 3300005354 Bacteria 1007
67 Ga0070671_100019855 3300005355 Bacteria 5475
68 Ga0070671_100047955 3300005355 Bacteria 3552
69 Ga0070671_100299905 3300005355 Bacteria 1368
70 Ga0070674_100000069 3300005356 Bacteria 47131
71 Ga0070674_100618672 3300005356 Bacteria 917
72 Ga0070674_100755096 3300005356 Bacteria 836
73 Ga0070673_100038744 3300005364 Bacteria 3642
74 Ga0070673_100049642 3300005364 Unclassified 3277
75 Ga0070673_100115429 3300005364 Bacteria 2233
76 Ga0070673_100136280 3300005364 Unclassified 2066
77 Ga0070673_100445373 3300005364 Bacteria 1164
78 Ga0070673_100993108 3300005364 Unclassified 781
79 Ga0070688_100084598 3300005365 Unclassified 2061
80 Ga0070688_100092570 3300005365 Unclassified 1978
81 Ga0070688_100155538 3300005365 Unclassified 1566
82 Ga0070659_100008580 3300005366 Bacteria 7471
83 Ga0070659_100013958 3300005366 Bacteria 5996
84 Ga0070659_100206745 3300005366 Bacteria 1617
85 Ga0070659_100321649 3300005366 Unclassified 1293
86 Ga0070667_100079559 3300005367 Bacteria 2802
87 Ga0070667_100089162 3300005367 Bacteria 2649
88 Ga0070667_100693451 3300005367 Bacteria 942
89 Ga0070703_10031925 3300005406 Bacteria 1596
90 Ga0070703_10181784 3300005406 Unclassified 813
91 Ga0070709_10112565 3300005434 Bacteria 1832
92 Ga0070709_10216278 3300005434 Bacteria 1364
93 Ga0070714_100031119 3300005435 Unclassified 4449
94 Ga0070713_100096868 3300005436 Unclassified 2548
95 Ga0070713_100273872 3300005436 Unclassified 1546
96 Ga0070713_100615105 3300005436 Bacteria 1033
97 Ga0070710_10596859 3300005437 Unclassified 768
98 Ga0070701_10095669 3300005438 Unclassified 1636
99 Ga0070711_100000132 3300005439 Bacteria 39959
100 Ga0070711_100054495 3300005439 Bacteria 2760
101 Ga0070711_101003569 3300005439 Bacteria 716
102 Ga0070705_100038355 3300005440 Unclassified 2710
103 Ga0070705_100150348 3300005440 Unclassified 1544
104 Ga0070705_100220670 3300005440 Bacteria 1312
105 Ga0070705_100286393 3300005440 Bacteria 1174
106 Ga0070705_100694781 3300005440 Unclassified 798
107 Ga0070700_100129253 3300005441 Bacteria 1702
108 Ga0070700_100147934 3300005441 Bacteria 1603
109 Ga0070694_100012928 3300005444 Bacteria 5205
110 Ga0070694_100015711 3300005444 Bacteria 4759
111 Ga0070694_100045604 3300005444 Bacteria 2939
112 Ga0070694_100100112 3300005444 Bacteria 2049
113 Ga0070694_100119481 3300005444 Bacteria 1889
114 Ga0070694_100142981 3300005444 Unclassified 1739
115 Ga0070694_100189167 3300005444 Bacteria 1528
116 Ga0070694_100246569 3300005444 Bacteria 1349
117 Ga0070694_100254301 3300005444 Bacteria 1330
118 Ga0070708_100000188 3300005445 Bacteria 44633
119 Ga0070708_100002610 3300005445 Bacteria 13948
120 Ga0070708_100017477 3300005445 Bacteria 5985
121 Ga0070708_100024977 3300005445 Bacteria 5106
122 Ga0070708_100107925 3300005445 Bacteria 2556
123 Ga0070708_100120614 3300005445 Bacteria 2419
124 Ga0070708_100133834 3300005445 Bacteria 2295
125 Ga0070708_100171405 3300005445 Unclassified 2026
126 Ga0070708_100216924 3300005445 Unclassified 1794
127 Ga0070708_100323903 3300005445 Bacteria 1452
128 Ga0070678_100114192 3300005456 Bacteria 2118
129 Ga0070678_100308580 3300005456 Bacteria 1347
130 Ga0070678_100615488 3300005456 Unclassified 971
131 Ga0070662_100030680 3300005457 Unclassified 3765
132 Ga0070662_100122725 3300005457 Bacteria 1993
133 Ga0070681_10001675 3300005458 Bacteria 19788
134 Ga0070681_10022137 3300005458 Bacteria 6379
135 Ga0070681_10078107 3300005458 Bacteria 3267
136 Ga0070681_10263354 3300005458 Bacteria 1636
137 Ga0070681_10973979 3300005458 Unclassified 768
138 Ga0068867_100002961 3300005459 Bacteria 11958
139 Ga0068867_100122866 3300005459 Bacteria 2008
140 Ga0068867_100210240 3300005459 Bacteria 1562
141 Ga0068867_101018145 3300005459 Bacteria 752
142 Ga0070685_10006186 3300005466 Bacteria 6092
143 Ga0070685_10015845 3300005466 Unclassified 4008
144 Ga0070685_10202271 3300005466 Bacteria 1292
145 Ga0070706_100004664 3300005467 Bacteria 13147
146 Ga0070706_100069962 3300005467 Bacteria 3245
147 Ga0070706_100188398 3300005467 Bacteria 1928
148 Ga0070706_100289524 3300005467 Bacteria 1528
149 Ga0070706_100395065 3300005467 Bacteria 1287
150 Ga0070707_100003729 3300005468 Bacteria 14376
151 Ga0070707_100026185 3300005468 Bacteria 5536
152 Ga0070707_100026489 3300005468 Bacteria 5505
153 Ga0070707_100073463 3300005468 Unclassified 3297
154 Ga0070707_100128430 3300005468 Bacteria 2464
155 Ga0070707_100171540 3300005468 Unclassified 2114
156 Ga0070707_100788852 3300005468 Bacteria 914
157 Ga0070698_100000668 3300005471 Bacteria 36568
158 Ga0070698_100001479 3300005471 Bacteria 26097
159 Ga0070698_100300389 3300005471 Bacteria 1536
160 Ga0070698_100386315 3300005471 Bacteria 1333
161 Ga0070698_100609268 3300005471 Bacteria 1032
162 Ga0070698_100949922 3300005471 Unclassified 806
163 Ga0070699_100001479 3300005518 Bacteria 21520
164 Ga0070699_100006406 3300005518 Bacteria 10250
165 Ga0070699_100007572 3300005518 Bacteria 9441
166 Ga0070699_100033855 3300005518 Bacteria 4414
167 Ga0070699_100040293 3300005518 Bacteria 4045
168 Ga0070699_100048237 3300005518 Bacteria 3685
169 Ga0070699_100051965 3300005518 Bacteria 3548
170 Ga0070699_100227814 3300005518 Unclassified 1662
171 Ga0070699_100304521 3300005518 Unclassified 1430
172 Ga0070699_100507755 3300005518 Bacteria 1095
173 Ga0070679_100008772 3300005530 Bacteria 9537
174 Ga0070679_100053773 3300005530 Bacteria 4008
175 Ga0070679_100115061 3300005530 Unclassified 2675
176 Ga0070684_100018722 3300005535 Bacteria 5712
177 Ga0070684_100020863 3300005535 Bacteria 5439
178 Ga0070684_100033927 3300005535 Unclassified 4360
179 Ga0070684_100048534 3300005535 Bacteria 3683
180 Ga0070684_100106194 3300005535 Bacteria 2513
181 Ga0070684_100144800 3300005535 Unclassified 2150
182 Ga0070684_100285996 3300005535 Bacteria 1511
183 Ga0070684_100323866 3300005535 Bacteria 1416
184 Ga0070684_100393338 3300005535 Unclassified 1278
185 Ga0070684_100417628 3300005535 Bacteria 1238
186 Ga0070684_100437105 3300005535 Unclassified 1209
187 Ga0070697_100013007 3300005536 Bacteria 6523
188 Ga0070697_100021746 3300005536 Bacteria 5084
189 Ga0070697_100039493 3300005536 Bacteria 3816
190 Ga0070697_100081738 3300005536 Bacteria 2662
191 Ga0070697_100097438 3300005536 Bacteria 2440
192 Ga0070697_100181817 3300005536 Unclassified 1782
193 Ga0070697_100206066 3300005536 Bacteria 1673
194 Ga0070697_100224661 3300005536 Unclassified 1601
195 Ga0070697_100250867 3300005536 Bacteria 1513
196 Ga0070697_100374622 3300005536 Bacteria 1232
197 Ga0068853_100050521 3300005539 Unclassified 3577
198 Ga0068853_100116338 3300005539 Bacteria 2380
199 Ga0068853_100170151 3300005539 Bacteria 1971
200 Ga0068853_100260109 3300005539 Bacteria 1595
201 Ga0068853_100333140 3300005539 Bacteria 1409
202 Ga0070672_100043316 3300005543 Bacteria 3469
203 Ga0070672_100082084 3300005543 Unclassified 2586
204 Ga0070672_100659162 3300005543 Bacteria 914
205 Ga0070686_100000114 3300005544 Bacteria 56363
206 Ga0070686_100066865 3300005544 Bacteria 2340
207 Ga0070695_100002531 3300005545 Bacteria 10557
208 Ga0070695_100004641 3300005545 Bacteria 8074
209 Ga0070695_100048443 3300005545 Bacteria 2717
210 Ga0070695_100109012 3300005545 Bacteria 1876
211 Ga0070695_100158079 3300005545 Bacteria 1588
212 Ga0070695_100253636 3300005545 Bacteria 1282
213 Ga0070696_100000241 3300005546 Bacteria 32915
214 Ga0070696_100009848 3300005546 Bacteria 6392
215 Ga0070696_100019530 3300005546 Bacteria 4589
216 Ga0070696_100040174 3300005546 Bacteria 3230
217 Ga0070696_100148010 3300005546 Bacteria 1721
218 Ga0070696_100158280 3300005546 Unclassified 1667
219 Ga0070696_100226812 3300005546 Unclassified 1404
220 Ga0070696_100361606 3300005546 Unclassified 1126
221 Ga0070696_100619279 3300005546 Bacteria 874
222 Ga0070693_100001077 3300005547 Bacteria 12211
223 Ga0070665_100241285 3300005548 Bacteria 1808
224 Ga0070704_100009110 3300005549 Bacteria 5990
225 Ga0070704_100074055 3300005549 Unclassified 2483
226 Ga0070704_100283144 3300005549 Bacteria 1374
227 Ga0068855_100100024 3300005563 Bacteria 3339
228 Ga0070664_100031879 3300005564 Bacteria 4407
229 Ga0070664_100032017 3300005564 Unclassified 4398
230 Ga0070664_100206275 3300005564 Bacteria 1755
231 Ga0070664_100247244 3300005564 Unclassified 1602
232 Ga0070664_100283058 3300005564 Bacteria 1495
233 Ga0070664_100458478 3300005564 Unclassified 1171
234 Ga0070664_100807487 3300005564 Bacteria 877
235 Ga0068857_100004955 3300005577 Bacteria 11311
236 Ga0068857_100007823 3300005577 Bacteria 9216
237 Ga0068857_100011807 3300005577 Bacteria 7597
238 Ga0068857_100115451 3300005577 Unclassified 2415
239 Ga0068854_100003232 3300005578 Bacteria 10161
240 Ga0068854_100081057 3300005578 Bacteria 2396
241 Ga0068854_100746702 3300005578 Bacteria 848
242 Ga0068856_100028535 3300005614 Bacteria 5449
243 Ga0068856_100045653 3300005614 Bacteria 4315
244 Ga0068856_100755481 3300005614 Bacteria 992
245 Ga0068856_101110712 3300005614 Bacteria 808
246 Ga0070702_100003782 3300005615 Bacteria 6837
247 Ga0070702_100037858 3300005615 Bacteria 2681
248 Ga0068852_100014555 3300005616 Bacteria 6061
249 Ga0068852_100080929 3300005616 Bacteria 2882
250 Ga0068852_100132849 3300005616 Unclassified 2294
251 Ga0068852_100194517 3300005616 Bacteria 1916
252 Ga0068852_100555471 3300005616 Bacteria 1149
253 Ga0068859_100006533 3300005617 Bacteria 11838
254 Ga0068859_100153091 3300005617 Bacteria 2382
255 Ga0068859_100325500 3300005617 Bacteria 1631
256 Ga0068859_101299583 3300005617 Bacteria 802
257 Ga0068864_100000669 3300005618 Bacteria 28600
258 Ga0068864_100007489 3300005618 Bacteria 8994
259 Ga0068864_100018976 3300005618 Bacteria 5749
260 Ga0068864_100095394 3300005618 Unclassified 2630
261 Ga0068864_100363959 3300005618 Bacteria 1367
262 Ga0068866_10000619 3300005718 Bacteria 16200
263 Ga0068861_100004749 3300005719 Bacteria 9133
264 Ga0068861_100021579 3300005719 Bacteria 4629
265 Ga0068861_100114083 3300005719 Bacteria 2169
266 Ga0068861_100523464 3300005719 Bacteria 1076
267 Ga0068851_10023940 3300005834 Unclassified 2987
268 Ga0068851_10029966 3300005834 Bacteria 2696
269 Ga0068851_10282228 3300005834 Bacteria 950
270 Ga0068870_10028183 3300005840 Unclassified 2817
271 Ga0068870_10096015 3300005840 Bacteria 1666
272 Ga0068863_100038000 3300005841 Bacteria 4581
273 Ga0068863_100054592 3300005841 Bacteria 3785
274 Ga0068863_100392811 3300005841 Bacteria 1356
275 Ga0068863_100525076 3300005841 Bacteria 1167
276 Ga0068858_100033195 3300005842 Bacteria 4792
277 Ga0068858_100045418 3300005842 Bacteria 4071
278 Ga0068858_100092628 3300005842 Bacteria 2813
279 Ga0068860_100059238 3300005843 Unclassified 3641
280 Ga0068862_100001715 3300005844 Bacteria 19837
281 Ga0068862_100116238 3300005844 Unclassified 2353
282 Ga0068862_100159984 3300005844 Bacteria 2009
283 Ga0068862_100296858 3300005844 Bacteria 1485
284 Ga0070717_10413876 3300006028 Bacteria 1212
285 Ga0070716_100162156 3300006173 Bacteria 1450
286 Ga0070712_100786490 3300006175 Unclassified 816
287 Ga0097621_100025205 3300006237 Bacteria 4651
288 Ga0068871_100010208 3300006358 Bacteria 6840
289 Ga0068871_100047421 3300006358 Unclassified 3465
290 Ga0075428_100009465 3300006844 Bacteria 10813
291 Ga0075428_100072228 3300006844 Bacteria 3770
292 Ga0075430_100001631 3300006846 Bacteria 18318
293 Ga0075430_100019552 3300006846 Bacteria 5761
294 Ga0075430_100209610 3300006846 Bacteria 1617
295 Ga0075431_100003312 3300006847 Bacteria 15601
296 Ga0075431_100029554 3300006847 Bacteria 5643
297 Ga0075431_100031351 3300006847 Bacteria 5476
298 Ga0075431_101275727 3300006847 Unclassified 696
299 Ga0075433_10000784 3300006852 Bacteria 21949
300 Ga0075433_10002805 3300006852 Bacteria 13352
301 Ga0075433_10005515 3300006852 Bacteria 9934
302 Ga0075433_10014997 3300006852 Bacteria 6345
303 Ga0075433_10017886 3300006852 Bacteria 5880
304 Ga0075433_10060199 3300006852 Bacteria 3324
305 Ga0075433_10076834 3300006852 Bacteria 2941
306 Ga0075433_10104484 3300006852 Unclassified 2510
307 Ga0075433_10129053 3300006852 Bacteria 2246
308 Ga0075433_10139652 3300006852 Bacteria 2153
309 Ga0075433_10310518 3300006852 Bacteria 1396
310 Ga0075433_10761740 3300006852 Unclassified 847
311 Ga0075434_100001037 3300006871 Bacteria 22656
312 Ga0075434_100003544 3300006871 Bacteria 13936
313 Ga0075434_100030607 3300006871 Bacteria 5301
314 Ga0075434_100044406 3300006871 Bacteria 4409
315 Ga0075434_100051175 3300006871 Bacteria 4104
316 Ga0075434_100168357 3300006871 Unclassified 2211
317 Ga0075434_100183076 3300006871 Unclassified 2116
318 Ga0075434_100188822 3300006871 Bacteria 2081
319 Ga0075434_100241240 3300006871 Bacteria 1827
320 Ga0075434_100341026 3300006871 Bacteria 1519
321 Ga0075429_100018080 3300006880 Bacteria 6098
322 Ga0075429_100029208 3300006880 Bacteria 4789
323 Ga0075429_100138452 3300006880 Bacteria 2131
324 Ga0068865_100008800 3300006881 Bacteria 6242
325 Ga0068865_100056467 3300006881 Unclassified 2735
326 Ga0068865_100163938 3300006881 Bacteria 1698
327 Ga0075436_100025162 3300006914 Bacteria 4093
328 Ga0075436_100044438 3300006914 Bacteria 3063
329 Ga0075436_100150778 3300006914 Bacteria 1636
330 Ga0097620_100006532 3300006931 Bacteria 11838
331 Ga0097620_100153093 3300006931 Bacteria 2382
332 Ga0097620_100325513 3300006931 Bacteria 1631
333 Ga0097620_101299640 3300006931 Bacteria 802
334 Ga0075435_100018185 3300007076 Bacteria 5337
335 Ga0075435_100025282 3300007076 Bacteria 4621
336 Ga0075435_100064339 3300007076 Bacteria 2980
337 Ga0075435_100356081 3300007076 Bacteria 1255
338 Ga0075435_100400844 3300007076 Bacteria 1180
339 Ga0105240_10005769 3300009093 Bacteria 18361
340 Ga0105240_10239835 3300009093 Bacteria 2102
341 Ga0105240_10273584 3300009093 Bacteria 1943
342 Ga0105240_10721767 3300009093 Bacteria 1086
343 Ga0111539_10036569 3300009094 Bacteria 5934
344 Ga0111539_10074930 3300009094 Bacteria 3988
345 Ga0111539_10233074 3300009094 Bacteria 2143
346 Ga0105245_10013096 3300009098 Bacteria 7226
347 Ga0105245_10046580 3300009098 Bacteria 3875
348 Ga0105245_10114320 3300009098 Bacteria 2514
349 Ga0105245_10682031 3300009098 Unclassified 1060
350 Ga0105245_10945025 3300009098 Bacteria 905
351 Ga0114129_10012770 3300009147 Bacteria 11955
352 Ga0114129_10133324 3300009147 Bacteria 3411
353 Ga0114129_10214148 3300009147 Bacteria 2602
354 Ga0114129_10249413 3300009147 Bacteria 2384
355 Ga0114129_10382371 3300009147 Bacteria 1859
356 Ga0114129_10669150 3300009147 Bacteria 1338
357 Ga0114129_10676128 3300009147 Bacteria 1330
358 Ga0114129_10930808 3300009147 Bacteria 1099
359 Ga0114129_11242091 3300009147 Unclassified 926
360 Ga0114129_11258135 3300009147 Unclassified 919
361 Ga0105243_10003139 3300009148 Bacteria 13569
362 Ga0105243_10684579 3300009148 Bacteria 998
363 Ga0105241_10001507 3300009174 Bacteria 17870
364 Ga0105241_10035622 3300009174 Bacteria 3743
365 Ga0105241_10631330 3300009174 Bacteria 971
366 Ga0105242_10002497 3300009176 Bacteria 14419
367 Ga0105242_10086854 3300009176 Bacteria 2625
368 Ga0105242_10345074 3300009176 Bacteria 1373
369 Ga0105248_10004111 3300009177 Bacteria 16093
370 Ga0105248_10014964 3300009177 Bacteria 8541
371 Ga0105248_10068908 3300009177 Bacteria 3972
372 Ga0105248_10151606 3300009177 Bacteria 2615
373 Ga0105248_10153205 3300009177 Unclassified 2600
374 Ga0105237_10021484 3300009545 Bacteria 6633
375 Ga0105238_10000081 3300009551 Bacteria 107822
376 Ga0105238_10180937 3300009551 Bacteria 2085
377 Ga0105238_10191528 3300009551 Bacteria 2021
378 Ga0105249_10000180 3300009553 Bacteria 74064
379 Ga0105249_10000231 3300009553 Bacteria 63172
380 Ga0105249_10005450 3300009553 Bacteria 10982
381 Ga0105249_10045737 3300009553 Bacteria 3982
382 Ga0105249_10111769 3300009553 Bacteria 2583
383 Ga0105249_10146143 3300009553 Bacteria 2272
384 Ga0105249_10299552 3300009553 Bacteria 1612
385 Ga0105249_10476987 3300009553 Unclassified 1290
386 Ga0105239_10005622 3300010375 Bacteria 14657
387 Ga0105239_10011262 3300010375 Bacteria 9976
388 Ga0105239_10016864 3300010375 Bacteria 8073
389 Ga0105239_10097898 3300010375 Unclassified 3242
390 Ga0105239_10181236 3300010375 Bacteria 2357
391 Ga0105239_11299224 3300010375 Bacteria 839
392 Ga0105246_10015254 3300011119 Unclassified 4848
393 Ga0105246_10038682 3300011119 Bacteria 3209
394 Ga0105246_10734562 3300011119 Unclassified 869
395 Ga0105246_10934518 3300011119 Bacteria 780
396 Ga0157373_10582972 3300013100 Bacteria 813
397 Ga0157371_10008591 3300013102 Bacteria 8117
398 Ga0157371_10014063 3300013102 Bacteria 6054
399 Ga0157371_10619241 3300013102 Unclassified 806
400 Ga0157370_10016812 3300013104 Bacteria 7395
401 Ga0157370_10139685 3300013104 Bacteria 2257
402 Ga0157369_10057814 3300013105 Bacteria 4183
403 Ga0157369_10080591 3300013105 Unclassified 3485
404 Ga0157369_10096501 3300013105 Unclassified 3154
405 Ga0157369_10339297 3300013105 Unclassified 1561
406 Ga0157369_10498752 3300013105 Bacteria 1260
407 Ga0157369_10943840 3300013105 Unclassified 884
408 Ga0157374_10004155 3300013296 Bacteria 12149
409 Ga0157374_10112549 3300013296 Bacteria 2619
410 Ga0157374_10131613 3300013296 Unclassified 2421
411 Ga0157374_10639000 3300013296 Unclassified 1076
412 Ga0157378_10000788 3300013297 Bacteria 29413
413 Ga0157378_10093418 3300013297 Bacteria 2738
414 Ga0157378_10721334 3300013297 Bacteria 1018
415 Ga0163162_10020298 3300013306 Bacteria 6526
416 Ga0163162_10071700 3300013306 Bacteria 3518
417 Ga0163162_10525218 3300013306 Bacteria 1313
418 Ga0157372_10002537 3300013307 Bacteria 19815
419 Ga0157372_10012310 3300013307 Bacteria 9116
420 Ga0157372_10103936 3300013307 Bacteria 3247
421 Ga0157372_10279424 3300013307 Bacteria 1941
422 Ga0157372_10344008 3300013307 Unclassified 1737
423 Ga0157372_10589333 3300013307 Unclassified 1296
424 Ga0157372_11237018 3300013307 Bacteria 862
425 Ga0157375_10068436 3300013308 Unclassified 3553
426 Ga0157375_10093743 3300013308 Bacteria 3069
427 Ga0157375_10170810 3300013308 Bacteria 2322
428 Ga0157375_10248462 3300013308 Bacteria 1939
429 Ga0157375_10522745 3300013308 Bacteria 1350
430 Ga0157375_10548755 3300013308 Bacteria 1317
431 Ga0163163_10003217 3300014325 Bacteria 13838
432 Ga0163163_10023684 3300014325 Bacteria 5830
433 Ga0163163_10873856 3300014325 Bacteria 962
434 Ga0157380_10006354 3300014326 Bacteria 8311
435 Ga0157380_10020831 3300014326 Unclassified 4908
436 Ga0182008_10011270 3300014497 Bacteria 4763
437 Ga0157377_10009075 3300014745 Bacteria 4872
438 Ga0157377_10051514 3300014745 Bacteria 2322
439 Ga0157377_10414755 3300014745 Unclassified 920
440 Ga0157377_10454447 3300014745 Unclassified 885
441 Ga0157379_10061161 3300014968 Bacteria 3368
442 Ga0157379_10347565 3300014968 Bacteria 1357
443 Ga0157376_10808717 3300014969 Bacteria 950
444 Ga0182005_1011205 3300015265 Unclassified 2562
445 Ga0163161_10016469 3300017792 Bacteria 5161
446 Ga0163161_10152900 3300017792 Unclassified 1755
447 Ga0163161_10155767 3300017792 Bacteria 1739
448 Ga0213876_10028493 3300021384 Bacteria 2945
449 Ga0213875_10007636 3300021388 Bacteria 5573
450 Ga0207673_1010238 3300025290 Bacteria 1204
451 Ga0207697_10009061 3300025315 Bacteria 4314
452 Ga0207656_10034765 3300025321 Bacteria 2106
453 Ga0207656_10224112 3300025321 Unclassified 914
454 Ga0207653_10007615 3300025885 Unclassified 3377
455 Ga0207653_10085451 3300025885 Bacteria 1098
456 Ga0207642_10001673 3300025899 Bacteria 6844
457 Ga0207642_10105414 3300025899 Bacteria 1424
458 Ga0207688_10343059 3300025901 Bacteria 919
459 Ga0207680_10010734 3300025903 Unclassified 4595
460 Ga0207680_10107976 3300025903 Bacteria 1800
461 Ga0207680_10290158 3300025903 Bacteria 1138
462 Ga0207699_10038118 3300025906 Bacteria 2752
463 Ga0207699_10220286 3300025906 Unclassified 1295
464 Ga0207645_10000366 3300025907 Bacteria 37447
465 Ga0207645_10002871 3300025907 Bacteria 13343
466 Ga0207645_10041771 3300025907 Bacteria 2935
467 Ga0207643_10003297 3300025908 Bacteria 8717
468 Ga0207643_10033389 3300025908 Unclassified 2879
469 Ga0207643_10092590 3300025908 Unclassified 1764
470 Ga0207684_10027076 3300025910 Unclassified 4889
471 Ga0207684_10087275 3300025910 Bacteria 2658
472 Ga0207684_10339186 3300025910 Bacteria 1294
473 Ga0207684_10343602 3300025910 Bacteria 1285
474 Ga0207654_10005096 3300025911 Bacteria 6629
475 Ga0207654_10028056 3300025911 Bacteria 3066
476 Ga0207654_10295777 3300025911 Bacteria 1099
477 Ga0207707_10011939 3300025912 Bacteria 7556
478 Ga0207707_10195726 3300025912 Bacteria 1763
479 Ga0207707_10423211 3300025912 Bacteria 1142
480 Ga0207707_10448020 3300025912 Bacteria 1105
481 Ga0207695_10017698 3300025913 Bacteria 8278
482 Ga0207695_10022752 3300025913 Bacteria 7102
483 Ga0207695_10556097 3300025913 Unclassified 1029
484 Ga0207671_10341591 3300025914 Unclassified 1186
485 Ga0207693_10806467 3300025915 Unclassified 723
486 Ga0207663_10000034 3300025916 Bacteria 88414
487 Ga0207663_10179306 3300025916 Bacteria 1511
488 Ga0207663_10238585 3300025916 Bacteria 1332
489 Ga0207663_10691873 3300025916 Bacteria 807
490 Ga0207660_10016237 3300025917 Bacteria 4927
491 Ga0207660_10061249 3300025917 Unclassified 2708
492 Ga0207660_10170680 3300025917 Bacteria 1683
493 Ga0207660_10241142 3300025917 Bacteria 1424
494 Ga0207662_10008225 3300025918 Bacteria 5706
495 Ga0207662_10009229 3300025918 Bacteria 5421
496 Ga0207662_10564248 3300025918 Unclassified 789
497 Ga0207657_10018301 3300025919 Bacteria 6695
498 Ga0207657_10084312 3300025919 Bacteria 2664
499 Ga0207657_10794961 3300025919 Bacteria 731
500 Ga0207649_10016029 3300025920 Unclassified 4219
501 Ga0207649_10017697 3300025920 Bacteria 4039
502 Ga0207649_10083340 3300025920 Unclassified 2075
503 Ga0207652_10022318 3300025921 Bacteria 5235
504 Ga0207652_10128865 3300025921 Unclassified 2255
505 Ga0207646_10053111 3300025922 Bacteria 3625
506 Ga0207646_10096751 3300025922 Bacteria 2645
507 Ga0207646_10106431 3300025922 Unclassified 2516
508 Ga0207646_10124035 3300025922 Bacteria 2322
509 Ga0207646_10132132 3300025922 Unclassified 2247
510 Ga0207646_10178399 3300025922 Bacteria 1918
511 Ga0207646_10578391 3300025922 Bacteria 1009
512 Ga0207646_10802620 3300025922 Bacteria 838
513 Ga0207681_10001066 3300025923 Bacteria 17800
514 Ga0207681_10013499 3300025923 Bacteria 5056
515 Ga0207681_10019368 3300025923 Bacteria 4299
516 Ga0207681_10021259 3300025923 Bacteria 4122
517 Ga0207681_10022617 3300025923 Bacteria 4012
518 Ga0207694_10000074 3300025924 Bacteria 118396
519 Ga0207694_10043666 3300025924 Unclassified 3459
520 Ga0207694_10521538 3300025924 Bacteria 996
521 Ga0207650_10008725 3300025925 Bacteria 6923
522 Ga0207650_10041391 3300025925 Unclassified 3375
523 Ga0207650_10500869 3300025925 Unclassified 1015
524 Ga0207659_10068878 3300025926 Bacteria 2575
525 Ga0207659_10103415 3300025926 Bacteria 2152
526 Ga0207659_10232413 3300025926 Unclassified 1488
527 Ga0207659_10267355 3300025926 Unclassified 1394
528 Ga0207659_10650143 3300025926 Bacteria 901
529 Ga0207659_10839859 3300025926 Unclassified 789
530 Ga0207687_10034655 3300025927 Unclassified 3428
531 Ga0207687_10035240 3300025927 Bacteria 3403
532 Ga0207700_10043962 3300025928 Unclassified 3285
533 Ga0207700_10109275 3300025928 Bacteria 2222
534 Ga0207700_10444661 3300025928 Bacteria 1142
535 Ga0207700_10543669 3300025928 Bacteria 1030
536 Ga0207664_10250681 3300025929 Bacteria 1545
537 Ga0207644_10085889 3300025931 Bacteria 2335
538 Ga0207644_10258629 3300025931 Bacteria 1391
539 Ga0207644_10513514 3300025931 Bacteria 989
540 Ga0207644_11082048 3300025931 Archaea 674
541 Ga0207690_10017420 3300025932 Unclassified 4384
542 Ga0207690_10045122 3300025932 Bacteria 2910
543 Ga0207690_10110535 3300025932 Bacteria 1979
544 Ga0207690_10167354 3300025932 Unclassified 1644
545 Ga0207690_10274681 3300025932 Unclassified 1311
546 Ga0207690_10282345 3300025932 Unclassified 1293
547 Ga0207706_10000005 3300025933 Bacteria 224460
548 Ga0207706_10000271 3300025933 Bacteria 56353
549 Ga0207706_10006727 3300025933 Bacteria 10627
550 Ga0207706_10017865 3300025933 Bacteria 6386
551 Ga0207706_10115996 3300025933 Unclassified 2355
552 Ga0207686_10000129 3300025934 Bacteria 61050
553 Ga0207709_10004559 3300025935 Bacteria 7984
554 Ga0207709_10233859 3300025935 Unclassified 1333
555 Ga0207709_10782102 3300025935 Bacteria 769
556 Ga0207670_10013922 3300025936 Bacteria 4761
557 Ga0207670_10158764 3300025936 Bacteria 1686
558 Ga0207669_10000371 3300025937 Bacteria 20157
559 Ga0207669_10146546 3300025937 Bacteria 1647
560 Ga0207669_10180188 3300025937 Unclassified 1514
561 Ga0207704_10026219 3300025938 Bacteria 3194
562 Ga0207704_10072406 3300025938 Bacteria 2190
563 Ga0207704_10085915 3300025938 Bacteria 2050
564 Ga0207665_10191816 3300025939 Bacteria 1485
565 Ga0207665_10252139 3300025939 Unclassified 1304
566 Ga0207691_10001502 3300025940 Bacteria 23219
567 Ga0207691_10005026 3300025940 Bacteria 12757
568 Ga0207691_10026767 3300025940 Bacteria 5411
569 Ga0207691_10091238 3300025940 Unclassified 2730
570 Ga0207691_10109295 3300025940 Unclassified 2460
571 Ga0207691_10271493 3300025940 Bacteria 1460
572 Ga0207691_10712472 3300025940 Unclassified 846
573 Ga0207711_10000854 3300025941 Bacteria 29448
574 Ga0207711_10033563 3300025941 Unclassified 4344
575 Ga0207711_10958847 3300025941 Unclassified 794
576 Ga0207689_10003784 3300025942 Bacteria 13788
577 Ga0207689_10007240 3300025942 Bacteria 9745
578 Ga0207689_10007761 3300025942 Bacteria 9389
579 Ga0207661_10004655 3300025944 Bacteria 9609
580 Ga0207661_10012577 3300025944 Bacteria 6156
581 Ga0207661_10058283 3300025944 Unclassified 3108
582 Ga0207661_10190974 3300025944 Unclassified 1795
583 Ga0207661_10322385 3300025944 Bacteria 1389
584 Ga0207679_10034047 3300025945 Bacteria 3591
585 Ga0207679_10049494 3300025945 Unclassified 3066
586 Ga0207679_10065497 3300025945 Unclassified 2719
587 Ga0207679_10235036 3300025945 Bacteria 1550
588 Ga0207679_10238746 3300025945 Unclassified 1539
589 Ga0207679_10332643 3300025945 Bacteria 1319
590 Ga0207679_10389163 3300025945 Unclassified 1224
591 Ga0207679_10682550 3300025945 Bacteria 931
592 Ga0207667_10150109 3300025949 Unclassified 2399
593 Ga0207651_10051231 3300025960 Unclassified 2807
594 Ga0207651_10101159 3300025960 Unclassified 2139
595 Ga0207651_10264385 3300025960 Bacteria 1414
596 Ga0207651_10435961 3300025960 Unclassified 1121
597 Ga0207651_10508181 3300025960 Unclassified 1043
598 Ga0207651_10883230 3300025960 Unclassified 795
599 Ga0207712_10000391 3300025961 Bacteria 38113
600 Ga0207712_10034240 3300025961 Bacteria 3441
601 Ga0207712_10034593 3300025961 Bacteria 3425
602 Ga0207712_10075146 3300025961 Bacteria 2442
603 Ga0207712_10532805 3300025961 Bacteria 1008
604 Ga0207668_10032194 3300025972 Bacteria 3462
605 Ga0207668_10034326 3300025972 Bacteria 3368
606 Ga0207668_10037336 3300025972 Bacteria 3250
607 Ga0207668_10721138 3300025972 Unclassified 878
608 Ga0207640_10002079 3300025981 Bacteria 10782
609 Ga0207658_10132008 3300025986 Bacteria 2008
610 Ga0207658_10188677 3300025986 Unclassified 1712
611 Ga0207658_10935449 3300025986 Unclassified 790
612 Ga0207677_10430153 3300026023 Bacteria 1126
613 Ga0207703_10041262 3300026035 Unclassified 3695
614 Ga0207703_10533123 3300026035 Bacteria 1105
615 Ga0207639_10155908 3300026041 Unclassified 1918
616 Ga0207639_10297223 3300026041 Bacteria 1426
617 Ga0207639_10612206 3300026041 Bacteria 1005
618 Ga0207639_10842083 3300026041 Bacteria 856
619 Ga0207678_10008469 3300026067 Bacteria 9070
620 Ga0207678_10255460 3300026067 Bacteria 1501
621 Ga0207708_10006997 3300026075 Bacteria 8339
622 Ga0207708_10062231 3300026075 Unclassified 2851
623 Ga0207702_10102122 3300026078 Bacteria 2534
624 Ga0207702_10305836 3300026078 Unclassified 1510
625 Ga0207702_10354652 3300026078 Bacteria 1404
626 Ga0207702_11286127 3300026078 Bacteria 725
627 Ga0207641_10836830 3300026088 Unclassified 912
628 Ga0207648_10000021 3300026089 Bacteria 139257
629 Ga0207648_10038586 3300026089 Bacteria 4202
630 Ga0207648_10053556 3300026089 Unclassified 3527
631 Ga0207676_10001551 3300026095 Bacteria 16926
632 Ga0207676_10012912 3300026095 Bacteria 5999
633 Ga0207676_10066461 3300026095 Unclassified 2876
634 Ga0207676_10545348 3300026095 Bacteria 1107
635 Ga0207674_10001530 3300026116 Bacteria 29786
636 Ga0207674_10001691 3300026116 Bacteria 28302
637 Ga0207674_10007225 3300026116 Bacteria 12959
638 Ga0207674_10015380 3300026116 Bacteria 8406
639 Ga0207674_10047388 3300026116 Bacteria 4407
640 Ga0207674_10130972 3300026116 Bacteria 2471
641 Ga0207674_10522452 3300026116 Bacteria 1147
642 Ga0207675_100000306 3300026118 Bacteria 47063
643 Ga0207675_100252834 3300026118 Bacteria 1706
644 Ga0207675_100556298 3300026118 Bacteria 1147
645 Ga0207675_100754815 3300026118 Bacteria 984
646 Ga0207683_10143670 3300026121 Bacteria 2151
647 Ga0207683_10417510 3300026121 Bacteria 1235
648 Ga0207683_10508015 3300026121 Archaea 1113
649 Ga0207683_10646798 3300026121 Unclassified 979
650 Ga0207683_10962243 3300026121 Unclassified 793
651 Ga0207698_10012180 3300026142 Bacteria 5614
652 Ga0207698_10021230 3300026142 Bacteria 4486
653 Ga0207698_10053709 3300026142 Bacteria 3095
654 Ga0207698_10097526 3300026142 Bacteria 2426
655 Ga0207698_10834655 3300026142 Bacteria 926
656 Ga0207428_10104240 3300027907 Bacteria 2189
657 Ga0207428_10560357 3300027907 Bacteria 826
658 Ga0268266_10119940 3300028379 Bacteria 2340
659 Ga0268266_10319382 3300028379 Unclassified 1453
660 Ga0268266_10905914 3300028379 Bacteria 853
661 Ga0268265_10039587 3300028380 Bacteria 3475
662 Ga0268265_10040656 3300028380 Unclassified 3435
663 Ga0268265_10081756 3300028380 Bacteria 2552
664 Ga0268265_10104408 3300028380 Bacteria 2296
665 Ga0268265_10147550 3300028380 Unclassified 1979
666 Ga0268265_10668369 3300028380 Bacteria 1000
667 Ga0268264_10004704 3300028381 Bacteria 11598
668 Ga0307408_100013542 3300031548 Bacteria 5414
669 Ga0307408_100017112 3300031548 Bacteria 4850
670 Ga0307408_100180834 3300031548 Unclassified 1691
671 Ga0307408_101089072 3300031548 Unclassified 741
672 Ga0307405_10001572 3300031731 Bacteria 9693
673 Ga0307405_10257687 3300031731 Unclassified 1301
674 Ga0307413_10003676 3300031824 Bacteria 6515
675 Ga0307413_10021095 3300031824 Bacteria 3480
676 Ga0307413_10065719 3300031824 Bacteria 2260
677 Ga0307410_10000534 3300031852 Bacteria 15571
678 Ga0307410_10053885 3300031852 Bacteria 2724
679 Ga0307410_10129024 3300031852 Unclassified 1855
680 Ga0307410_10428116 3300031852 Unclassified 1075
681 Ga0307410_10718186 3300031852 Unclassified 844
682 Ga0307406_10083947 3300031901 Bacteria 2125
683 Ga0307406_10272661 3300031901 Unclassified 1286
684 Ga0307407_10007291 3300031903 Bacteria 4998
685 Ga0307407_10054020 3300031903 Bacteria 2314
686 Ga0307407_10064745 3300031903 Bacteria 2150
687 Ga0307412_10007612 3300031911 Bacteria 6149
688 Ga0307409_100004304 3300031995 Bacteria 7967
689 Ga0307409_100011136 3300031995 Bacteria 5648
690 Ga0307409_100025765 3300031995 Bacteria 4133
691 Ga0307409_100074623 3300031995 Unclassified 2711
692 Ga0307409_100131770 3300031995 Bacteria 2138
693 Ga0307409_100190806 3300031995 Bacteria 1824
694 Ga0307409_100342199 3300031995 Bacteria 1408
695 Ga0307409_100529244 3300031995 Bacteria 1153
696 Ga0307416_100009861 3300032002 Bacteria 6279
697 Ga0307416_100047608 3300032002 Bacteria 3395
698 Ga0307416_100600870 3300032002 Bacteria 1180
699 Ga0307416_101073591 3300032002 Bacteria 909
700 Ga0307414_10004540 3300032004 Bacteria 7548
701 Ga0307414_10031579 3300032004 Unclassified 3477
702 Ga0307414_10119849 3300032004 Bacteria 2021
703 Ga0307414_10245400 3300032004 Unclassified 1485
704 Ga0307414_11412291 3300032004 Unclassified 647
705 Ga0307411_10000572 3300032005 Bacteria 13140
706 Ga0307411_10014487 3300032005 Bacteria 4390
707 Ga0307411_10372585 3300032005 Unclassified 1172
708 Ga0307411_10626945 3300032005 Bacteria 928
709 Ga0307415_100003899 3300032126 Bacteria 7663
710 Ga0307415_100052554 3300032126 Bacteria 2772
711 Ga0307415_100120589 3300032126 Bacteria 1966
712 Ga0307415_100166894 3300032126 Unclassified 1713
713 Ga0307415_100855285 3300032126 Bacteria 835
714 Ga0373959_0000044 3300034820 Bacteria 28049
715 Ga0373934_0015010 3300035086 Bacteria 2938
716 Ga0373934_0038274 3300035086 Unclassified 1888
717 Ga0373932_0085013 3300035112 Bacteria 1006
718 Ga0373939_0151128 3300035114 Bacteria 845
719 Ga0373953_0124361 3300035117 Unclassified 1097
720 Ga0373960_0022942 3300035121 Bacteria 1677
721 Ga0373943_0195978 3300035170 Unclassified 1116
722 Ga0373955_0080180 3300035172 Bacteria 1843
723 Ga0373931_0081802 3300035691 Bacteria 1784
724 Ga0373931_0091294 3300035691 Bacteria 1697
725 Ga0373931_0216449 3300035691 Unclassified 1151
726 Ga0373931_0250690 3300035691 Bacteria 1076
727 Ga0373935_0326253 3300035692 Unclassified 1090
728 Ga0373927_0020604 3300035695 Bacteria 4323
729 Ga0373933_0031933 3300035724 Bacteria 3058
730 Ga0373947_0188935 3300035725 Unclassified 1343
731 Ga0373937_0004884 3300036401 Bacteria 11395
732 Ga0373937_0056952 3300036401 Unclassified 3589
733 Ga0373937_0528347 3300036401 Unclassified 1121
734 Ga0373937_0782023 3300036401 Unclassified 902
735 Ga0373925_0491443 3300037068 Unclassified 1007
736 Ga0395905_0466708 3300037471 Bacteria 1161
737 Ga0436364_0508766 3300037853 Bacteria 7460
738 Ga0395901_0744964 3300038443 Bacteria 973
739 Ga0242420_001555 3300038996 Bacteria 3084
740 Ga0242420_008022 3300038996 Bacteria 1705
741 Ga0242420_010963 3300038996 Bacteria 1514
742 Ga0436365_1494207 3300039437 Bacteria 13030
743 Ga0451791_0724933 3300041451 Bacteria 806
744 Ga0451853_1697498 3300041512 Unclassified 877
745 Ga0439445_0067733 3300042004 Archaea 984
746 Ga0450914_023598 3300042118 Unclassified 701
747 Ga0451577_0055150 3300042876 Unclassified 3547
748 Ga0451577_0235024 3300042876 Bacteria 1658
749 Ga0451577_0470669 3300042876 Bacteria 1141
750 Ga0451577_0991343 3300042876 Bacteria 755
751 Ga0453683_0012581 3300044673 Bacteria 5544
752 Ga0453683_0082764 3300044673 Bacteria 2011
753 Ga0453683_0276620 3300044673 Bacteria 1072
754 Ga0453684_0697781 3300044712 Bacteria 1103
755 Ga0451576_0016016 3300045051 Bacteria 8283
756 Ga0451576_0078909 3300045051 Bacteria 3425
757 Ga0451576_0202425 3300045051 Bacteria 2073
758 Ga0451576_0751615 3300045051 Unclassified 1024
759 Ga0451576_1023419 3300045051 Bacteria 865
760 Ga0451576_1394388 3300045051 Unclassified 729
761 Ga0495592_0442693 3300046454 Unclassified 815
762 Ga0495603_0017157 3300046455 Unclassified 4383
763 Ga0495629_0059822 3300046459 Bacteria 2663
764 Ga0495651_0041381 3300046462 Unclassified 3580
765 Ga0495651_0074121 3300046462 Bacteria 2583
766 Ga0495653_0022688 3300046463 Bacteria 5077
767 Ga0495580_0040218 3300046472 Unclassified 3342
768 Ga0495580_0046474 3300046472 Bacteria 3080
769 Ga0495580_0188503 3300046472 Bacteria 1423
770 Ga0495582_0004174 3300046473 Bacteria 8120
771 Ga0495639_0117495 3300046475 Unclassified 1266
772 Ga0495639_0122188 3300046475 Bacteria 1243
773 Ga0495662_0029737 3300046476 Bacteria 2637
774 Ga0495664_0057823 3300046477 Bacteria 2307
775 Ga0495594_0006581 3300046499 Bacteria 5980
776 Ga0495594_0007624 3300046499 Bacteria 5569
777 Ga0495608_0042062 3300046511 Unclassified 3055
778 Ga0495608_0378382 3300046511 Bacteria 868
779 Ga0495628_0032241 3300046516 Bacteria 4231
780 Ga0495630_0017637 3300046517 Bacteria 5233
781 Ga0495630_0073202 3300046517 Unclassified 2580
782 Ga0495666_0246149 3300046526 Unclassified 815
783 Ga0495652_0000889 3300046529 Bacteria 34387
784 Ga0495652_0129667 3300046529 Bacteria 1998
785 Ga0495652_0701601 3300046529 Bacteria 681
786 Ga0495665_0000603 3300046531 Bacteria 18285
787 Ga0495640_0098184 3300046533 Unclassified 1925
788 Ga0495586_0025302 3300046535 Bacteria 3176
789 Ga0495586_0044682 3300046535 Unclassified 2387
790 Ga0495587_0000327 3300046536 Bacteria 33954
791 Ga0495587_0006881 3300046536 Bacteria 7393
792 Ga0495587_0054179 3300046536 Bacteria 2364
793 Ga0495587_0111979 3300046536 Unclassified 1567
794 Ga0495645_0000211 3300046543 Bacteria 41774
795 Ga0495645_0118170 3300046543 Bacteria 1870
796 Ga0495667_0002556 3300046559 Bacteria 12150
797 Ga0495667_0022268 3300046559 Bacteria 4271
798 Ga0495667_0100700 3300046559 Bacteria 1869
799 Ga0495634_0102415 3300046642 Bacteria 1849
800 Ga0495635_0190603 3300046663 Bacteria 1392
801 Ga0495588_0144237 3300046674 Unclassified 1258
802 Ga0495657_0089520 3300046675 Unclassified 1977
803 Ga0495657_0131921 3300046675 Bacteria 1564
804 Ga0495599_0003821 3300046678 Bacteria 8845
805 Ga0495623_0023730 3300046679 Unclassified 3957
806 Ga0495623_0033621 3300046679 Unclassified 3290
807 Ga0495646_0040963 3300046680 Unclassified 2849
808 Ga0495658_0078730 3300046683 Bacteria 1930
809 Ga0495613_0048846 3300046689 Unclassified 3124
810 Ga0495613_0513664 3300046689 Bacteria 805
811 Ga0495600_0124676 3300046809 Bacteria 1675
812 Ga0495600_0192085 3300046809 Unclassified 1313
813 Ga0495600_0216519 3300046809 Unclassified 1226
814 Ga0495581_0060251 3300047315 Unclassified 2193
815 Ga0495581_0107779 3300047315 Bacteria 1619
816 Ga0495604_0021625 3300047317 Bacteria 5136
817 Ga0495674_0101491 3300047319 Unclassified 2447
818 Ga0495676_0288699 3300047321 Unclassified 1109
819 Ga0495680_0009874 3300047322 Bacteria 8555
820 Ga0495675_0006376 3300047444 Bacteria 7220
821 Ga0495675_0015827 3300047444 Bacteria 4770
822 Ga0495675_0175291 3300047444 Unclassified 1315
823 Ga0495684_0012476 3300047471 Bacteria 6549
824 Ga0495684_0015174 3300047471 Bacteria 5932
825 Ga0495684_0069282 3300047471 Bacteria 2682
826 Ga0495684_0071837 3300047471 Unclassified 2630
827 Ga0495684_0145995 3300047471 Bacteria 1772
828 Ga0495593_0176561 3300047673 Unclassified 1076
829 Ga0495602_0037854 3300048088 Bacteria 4468
830 Ga0495602_0085788 3300048088 Bacteria 2630
831 Ga0496100_0024473 3300048903 Unclassified 3684
832 Ga0496100_0189906 3300048903 Bacteria 1491
833 Ga0496101_0026539 3300048904 Bacteria 4028
834 Ga0496101_0045293 3300048904 Bacteria 3151
835 Ga0496101_0211183 3300048904 Bacteria 1504
836 Ga0496102_0022191 3300048905 Bacteria 5622
837 Ga0496102_0062843 3300048905 Unclassified 3400
838 Ga0496102_0091620 3300048905 Unclassified 2814
839 Ga0496102_0314585 3300048905 Bacteria 1475
840 Ga0496102_0346059 3300048905 Unclassified 1400
841 Ga0496104_0032287 3300048907 Bacteria 4873
842 Ga0496104_0065511 3300048907 Bacteria 3448
843 Ga0496104_0183389 3300048907 Bacteria 2003
844 Ga0496104_0194163 3300048907 Bacteria 1942
845 Ga0496104_0361418 3300048907 Bacteria 1364
846 Ga0496105_0062553 3300048908 Bacteria 3072
847 Ga0496106_0101096 3300048909 Bacteria 2236
848 Ga0496106_0781336 3300048909 Bacteria 758
849 Ga0496107_0039224 3300048910 Bacteria 3397
850 Ga0496107_0239890 3300048910 Bacteria 1349
851 Ga0496108_0002786 3300048911 Bacteria 14010
852 Ga0496108_0005189 3300048911 Bacteria 10528
853 Ga0496108_0011155 3300048911 Bacteria 7300
854 Ga0496108_0067030 3300048911 Bacteria 3027
855 Ga0496109_0020704 3300048912 Bacteria 5809
856 Ga0496109_0038375 3300048912 Bacteria 4330
857 Ga0496109_0069386 3300048912 Unclassified 3232
858 Ga0496109_0156113 3300048912 Bacteria 2137
859 Ga0496109_0233914 3300048912 Unclassified 1729
860 Ga0496109_0239709 3300048912 Bacteria 1707
861 Ga0496109_0521343 3300048912 Bacteria 1122
862 Ga0496110_0027788 3300048913 Bacteria 4852
863 Ga0496110_0029716 3300048913 Unclassified 4707
864 Ga0496110_0102770 3300048913 Bacteria 2563
865 Ga0496111_0044844 3300048914 Bacteria 3179
866 Ga0496111_0046516 3300048914 Bacteria 3124
867 Ga0496111_0087281 3300048914 Bacteria 2283
868 Ga0496111_0404653 3300048914 Bacteria 1008
869 Ga0496112_0000607 3300048915 Bacteria 24660
870 Ga0496112_0005273 3300048915 Bacteria 11145
871 Ga0496112_0013170 3300048915 Bacteria 7631
872 Ga0496112_0129506 3300048915 Unclassified 2494
873 Ga0496113_0000097 3300048916 Bacteria 36693
874 Ga0496113_0005097 3300048916 Bacteria 8161
875 Ga0496113_0029432 3300048916 Bacteria 3966
876 Ga0496113_0206656 3300048916 Bacteria 1562
877 Ga0496114_0020367 3300048917 Bacteria 5384
878 Ga0496114_0030541 3300048917 Bacteria 4434
879 Ga0496114_0376334 3300048917 Unclassified 1257
880 Ga0496114_0410182 3300048917 Unclassified 1200
881 Ga0496115_0010573 3300048918 Bacteria 6901
882 Ga0496115_0084200 3300048918 Bacteria 2593
883 Ga0501298_021128 3300049521 Bacteria 1218
884 Ga0501038_0178283 3300049574 Bacteria 1716
885 Ga0501040_0136322 3300049576 Bacteria 1728
886 Ga0501048_0205867 3300049582 Bacteria 1395
887 Ga0501067_0188037 3300049583 Bacteria 1150
888 Ga0501074_0128831 3300049590 Bacteria 1811
889 Ga0501077_0008022 3300049593 Bacteria 6528
890 Ga0501216_014245 3300049660 Bacteria 1327
891 Ga0501223_032661 3300049663 Unclassified 1012
892 Ga0501230_031237 3300049667 Unclassified 992
893 Ga0501233_059941 3300049668 Unclassified 942
894 Ga0501242_005926 3300049674 Unclassified 1387
895 Ga0501249_009886 3300049679 Bacteria 1987
896 Ga0501257_019603 3300049686 Bacteria 1583
897 Ga0501261_019797 3300049690 Unclassified 958
898 Ga0501080_0456112 3300049742 Unclassified 1146
899 Ga0501081_0016800 3300049743 Bacteria 4839
900 nmdc:mga05p37_10437_c1 3300050507 Bacteria 11023
901 nmdc:mga05p37_111342_c1 3300050507 Bacteria 3367
902 nmdc:mga05p37_182363_c1 3300050507 Bacteria 2553
903 nmdc:mga05p37_206331_c1 3300050507 Bacteria 2377
904 nmdc:mga05p37_333005_c1 3300050507 Bacteria 1792
905 nmdc:mga05p37_379155_c1 3300050507 Unclassified 1658
906 nmdc:mga05p37_636333_c1 3300050507 Bacteria 1197
907 nmdc:mga09592_13458_c1 3300050508 Bacteria 6678
908 nmdc:mga09592_192077_c1 3300050508 Bacteria 1767
909 nmdc:mga09592_214797_c1 3300050508 Bacteria 1667
910 nmdc:mga09592_433761_c1 3300050508 Unclassified 1134
911 nmdc:mga09592_476448_c1 3300050508 Unclassified 1076
912 nmdc:mga0qj67_175880_c1 3300050509 Bacteria 1738
913 nmdc:mga0qj67_17742_c1 3300050509 Bacteria 5414
914 nmdc:mga0qj67_574414_c1 3300050509 Bacteria 903
915 nmdc:mga0qj67_7214_c1 3300050509 Bacteria 8207
916 nmdc:mga0qj67_911714_c1 3300050509 Unclassified 692
917 nmdc:mga06r32_10526_c1 3300050510 Bacteria 8341
918 nmdc:mga06r32_1166411_c1 3300050510 Unclassified 717
919 nmdc:mga06r32_310168_c1 3300050510 Bacteria 1563
920 nmdc:mga06r32_43755_c1 3300050510 Bacteria 4261
921 nmdc:mga06r32_502690_c1 3300050510 Bacteria 1189
922 nmdc:mga06r32_598684_c1 3300050510 Unclassified 1073
923 nmdc:mga08y16_1110585_c1 3300050511 Unclassified 765
924 nmdc:mga08y16_271091_c1 3300050511 Bacteria 1752
925 nmdc:mga08y16_434844_c1 3300050511 Unclassified 1340
926 nmdc:mga0n895_1189_c1 3300050512 Bacteria 19138
927 nmdc:mga0n895_139096_c1 3300050512 Bacteria 2456
928 nmdc:mga0n895_1418844_c1 3300050512 Bacteria 662
929 nmdc:mga0n895_14212_c1 3300050512 Bacteria 7220
930 nmdc:mga0n895_161485_c1 3300050512 Bacteria 2273
931 nmdc:mga0n895_164547_c1 3300050512 Unclassified 2250
932 nmdc:mga0n895_2925_c1 3300050512 Bacteria 13540
933 nmdc:mga0n895_374301_c1 3300050512 Bacteria 1441
934 nmdc:mga0n895_3949_c1 3300050512 Bacteria 12054
935 nmdc:mga0n895_6534_c1 3300050512 Bacteria 9921
936 nmdc:mga0n895_82112_c1 3300050512 Bacteria 3212
937 nmdc:mga0rr50_114484_c1 3300050513 Unclassified 2139
938 nmdc:mga0rr50_127850_c1 3300050513 Bacteria 2031
939 nmdc:mga0rr50_81709_c1 3300050513 Bacteria 2495
940 nmdc:mga08x19_391659_c1 3300050514 Unclassified 974
941 nmdc:mga08x19_85536_c1 3300050514 Unclassified 2075
942 nmdc:mga0a205_103294_c1 3300050515 Bacteria 2749
943 nmdc:mga0a205_122582_c1 3300050515 Bacteria 2499
944 nmdc:mga0a205_142981_c1 3300050515 Bacteria 2292
945 nmdc:mga0a205_166148_c1 3300050515 Unclassified 2102
946 nmdc:mga0a205_194505_c1 3300050515 Bacteria 1919
947 nmdc:mga0a205_20757_c2 3300050515 Bacteria 5367
948 nmdc:mga0a205_23848_c1 3300050515 Bacteria 5806
949 nmdc:mga0a205_33456_c1 3300050515 Bacteria 4928
950 nmdc:mga0a205_493_c1 3300050515 Bacteria 30906
951 nmdc:mga0a205_8295_c1 3300050515 Bacteria 9447
952 nmdc:mga0a205_966931_c1 3300050515 Unclassified 698
953 nmdc:mga0a205_97586_c2 3300050515 Unclassified 2513
954 Ga0495612_0016193 3300053078 Unclassified 2987
955 Ga0495619_0053258 3300053085 Unclassified 2676
956 Ga0501082_0044042 3300060353 Bacteria 3850
957 Ga0530510_0138099 3300061734 Bacteria 1795
958 Ga0068857_100123738
959 MBSR1b_contig_11714938
960 Ga0065715_10177927
961 Ga0065715_10200486
962 Ga0070676_10005285
963 Ga0070683_100003389
964 Ga0070683_100014074
965 Ga0070683_100024705
966 Ga0070683_100073927
967 Ga0070683_100085692
968 Ga0070683_100145987
969 Ga0070683_100169958
970 Ga0070683_100176545
971 Ga0070683_100298876
972 Ga0070683_100366536
973 Ga0070690_100192241
974 Ga0070670_100020074
975 Ga0070670_100032599
976 Ga0070670_100047997
977 Ga0070670_100298559
978 Ga0068869_100008951
979 Ga0068869_100051097
980 Ga0070666_10012446
981 Ga0070666_10199661
982 Ga0070666_10569915
983 Ga0070680_100003560
984 Ga0070680_100019138
985 Ga0070680_100354453
986 Ga0070682_100125580
987 Ga0070682_101015285
988 Ga0068868_100128892
989 Ga0068868_100165379
990 Ga0070660_100074773
991 Ga0070660_100621979
992 Ga0070689_100036132
993 Ga0070689_100057724
994 Ga0070689_100148918
995 Ga0070689_100865080
996 Ga0070687_100005149
997 Ga0070687_100044408
998 Ga0070687_100114474
999 Ga0070687_100185976
1000 Ga0070661_100014670
1001 Ga0070661_101018328
1002 Ga0070692_10025009
1003 Ga0070692_10069202
1004 Ga0070668_100004653
1005 Ga0070668_100006466
1006 Ga0070668_100010136
1007 Ga0070668_100085116
1008 Ga0070668_100604601
1009 Ga0070668_100929962
1010 Ga0070669_100010261
1011 Ga0070669_100017780
1012 Ga0070669_100106104
1013 Ga0070669_100131038
1014 Ga0070669_100237633
1015 Ga0070669_100258613
1016 Ga0070669_100317872
1017 Ga0070675_100002030
1018 Ga0070675_100022286
1019 Ga0070675_100029974
1020 Ga0070675_100047973
1021 Ga0070675_100199441
1022 Ga0070675_100456879
1023 Ga0070675_100590357
1024 Ga0070671_100019855
1025 Ga0070671_100047955
1026 Ga0070671_100299905
1027 Ga0070674_100000069
1028 Ga0070674_100618672
1029 Ga0070674_100755096
1030 Ga0070673_100038744
1031 Ga0070673_100049642
1032 Ga0070673_100115429
1033 Ga0070673_100136280
1034 Ga0070673_100445373
1035 Ga0070673_100993108
1036 Ga0070688_100084598
1037 Ga0070688_100092570
1038 Ga0070688_100155538
1039 Ga0070659_100008580
1040 Ga0070659_100013958
1041 Ga0070659_100206745
1042 Ga0070659_100321649
1043 Ga0070667_100079559
1044 Ga0070667_100089162
1045 Ga0070667_100693451
1046 Ga0070703_10031925
1047 Ga0070703_10181784
1048 Ga0070709_10112565
1049 Ga0070709_10216278
1050 Ga0070714_100031119
1051 Ga0070713_100096868
1052 Ga0070713_100273872
1053 Ga0070713_100615105
1054 Ga0070710_10596859
1055 Ga0070701_10095669
1056 Ga0070711_100000132
1057 Ga0070711_100054495
1058 Ga0070711_101003569
1059 Ga0070705_100038355
1060 Ga0070705_100150348
1061 Ga0070705_100220670
1062 Ga0070705_100286393
1063 Ga0070705_100694781
1064 Ga0070700_100129253
1065 Ga0070700_100147934
1066 Ga0070694_100012928
1067 Ga0070694_100015711
1068 Ga0070694_100045604
1069 Ga0070694_100100112
1070 Ga0070694_100119481
1071 Ga0070694_100142981
1072 Ga0070694_100189167
1073 Ga0070694_100246569
1074 Ga0070694_100254301
1075 Ga0070708_100000188
1076 Ga0070708_100002610
1077 Ga0070708_100017477
1078 Ga0070708_100024977
1079 Ga0070708_100107925
1080 Ga0070708_100120614
1081 Ga0070708_100133834
1082 Ga0070708_100171405
1083 Ga0070708_100216924
1084 Ga0070708_100323903
1085 Ga0070678_100114192
1086 Ga0070678_100308580
1087 Ga0070678_100615488
1088 Ga0070662_100030680
1089 Ga0070662_100122725
1090 Ga0070681_10001675
1091 Ga0070681_10022137
1092 Ga0070681_10078107
1093 Ga0070681_10263354
1094 Ga0070681_10973979
1095 Ga0068867_100002961
1096 Ga0068867_100122866
1097 Ga0068867_100210240
1098 Ga0068867_101018145
1099 Ga0070685_10006186
1100 Ga0070685_10015845
1101 Ga0070685_10202271
1102 Ga0070706_100004664
1103 Ga0070706_100069962
1104 Ga0070706_100188398
1105 Ga0070706_100289524
1106 Ga0070706_100395065
1107 Ga0070707_100003729
1108 Ga0070707_100026185
1109 Ga0070707_100026489
1110 Ga0070707_100073463
1111 Ga0070707_100128430
1112 Ga0070707_100171540
1113 Ga0070707_100788852
1114 Ga0070698_100000668
1115 Ga0070698_100001479
1116 Ga0070698_100300389
1117 Ga0070698_100386315
1118 Ga0070698_100609268
1119 Ga0070698_100949922
1120 Ga0070699_100001479
1121 Ga0070699_100006406
1122 Ga0070699_100007572
1123 Ga0070699_100033855
1124 Ga0070699_100040293
1125 Ga0070699_100048237
1126 Ga0070699_100051965
1127 Ga0070699_100227814
1128 Ga0070699_100304521
1129 Ga0070699_100507755
1130 Ga0070679_100008772
1131 Ga0070679_100053773
1132 Ga0070679_100115061
1133 Ga0070684_100018722
1134 Ga0070684_100020863
1135 Ga0070684_100033927
1136 Ga0070684_100048534
1137 Ga0070684_100106194
1138 Ga0070684_100144800
1139 Ga0070684_100285996
1140 Ga0070684_100323866
1141 Ga0070684_100393338
1142 Ga0070684_100417628
1143 Ga0070684_100437105
1144 Ga0070697_100013007
1145 Ga0070697_100021746
1146 Ga0070697_100039493
1147 Ga0070697_100081738
1148 Ga0070697_100097438
1149 Ga0070697_100181817
1150 Ga0070697_100206066
1151 Ga0070697_100224661
1152 Ga0070697_100250867
1153 Ga0070697_100374622
1154 Ga0068853_100050521
1155 Ga0068853_100116338
1156 Ga0068853_100170151
1157 Ga0068853_100260109
1158 Ga0068853_100333140
1159 Ga0070672_100043316
1160 Ga0070672_100082084
1161 Ga0070672_100659162
1162 Ga0070686_100000114
1163 Ga0070686_100066865
1164 Ga0070695_100002531
1165 Ga0070695_100004641
1166 Ga0070695_100048443
1167 Ga0070695_100109012
1168 Ga0070695_100158079
1169 Ga0070695_100253636
1170 Ga0070696_100000241
1171 Ga0070696_100009848
1172 Ga0070696_100019530
1173 Ga0070696_100040174
1174 Ga0070696_100148010
1175 Ga0070696_100158280
1176 Ga0070696_100226812
1177 Ga0070696_100361606
1178 Ga0070696_100619279
1179 Ga0070693_100001077
1180 Ga0070665_100241285
1181 Ga0070704_100009110
1182 Ga0070704_100074055
1183 Ga0070704_100283144
1184 Ga0068855_100100024
1185 Ga0070664_100031879
1186 Ga0070664_100032017
1187 Ga0070664_100206275
1188 Ga0070664_100247244
1189 Ga0070664_100283058
1190 Ga0070664_100458478
1191 Ga0070664_100807487
1192 Ga0068857_100004955
1193 Ga0068857_100007823
1194 Ga0068857_100011807
1195 Ga0068857_100115451
1196 Ga0068854_100003232
1197 Ga0068854_100081057
1198 Ga0068854_100746702
1199 Ga0068856_100028535
1200 Ga0068856_100045653
1201 Ga0068856_100755481
1202 Ga0068856_101110712
1203 Ga0070702_100003782
1204 Ga0070702_100037858
1205 Ga0068852_100014555
1206 Ga0068852_100080929
1207 Ga0068852_100132849
1208 Ga0068852_100194517
1209 Ga0068852_100555471
1210 Ga0068859_100006533
1211 Ga0068859_100153091
1212 Ga0068859_100325500
1213 Ga0068859_101299583
1214 Ga0068864_100000669
1215 Ga0068864_100007489
1216 Ga0068864_100018976
1217 Ga0068864_100095394
1218 Ga0068864_100363959
1219 Ga0068866_10000619
1220 Ga0068861_100004749
1221 Ga0068861_100021579
1222 Ga0068861_100114083
1223 Ga0068861_100523464
1224 Ga0068851_10023940
1225 Ga0068851_10029966
1226 Ga0068851_10282228
1227 Ga0068870_10028183
1228 Ga0068870_10096015
1229 Ga0068863_100038000
1230 Ga0068863_100054592
1231 Ga0068863_100392811
1232 Ga0068863_100525076
1233 Ga0068858_100033195
1234 Ga0068858_100045418
1235 Ga0068858_100092628
1236 Ga0068860_100059238
1237 Ga0068862_100001715
1238 Ga0068862_100116238
1239 Ga0068862_100159984
1240 Ga0068862_100296858
1241 Ga0070717_10413876
1242 Ga0070716_100162156
1243 Ga0070712_100786490
1244 Ga0097621_100025205
1245 Ga0068871_100010208
1246 Ga0068871_100047421
1247 Ga0075428_100009465
1248 Ga0075428_100072228
1249 Ga0075430_100001631
1250 Ga0075430_100019552
1251 Ga0075430_100209610
1252 Ga0075431_100003312
1253 Ga0075431_100029554
1254 Ga0075431_100031351
1255 Ga0075431_101275727
1256 Ga0075433_10000784
1257 Ga0075433_10002805
1258 Ga0075433_10005515
1259 Ga0075433_10014997
1260 Ga0075433_10017886
1261 Ga0075433_10060199
1262 Ga0075433_10076834
1263 Ga0075433_10104484
1264 Ga0075433_10129053
1265 Ga0075433_10139652
1266 Ga0075433_10310518
1267 Ga0075433_10761740
1268 Ga0075434_100001037
1269 Ga0075434_100003544
1270 Ga0075434_100030607
1271 Ga0075434_100044406
1272 Ga0075434_100051175
1273 Ga0075434_100168357
1274 Ga0075434_100183076
1275 Ga0075434_100188822
1276 Ga0075434_100241240
1277 Ga0075434_100341026
1278 Ga0075429_100018080
1279 Ga0075429_100029208
1280 Ga0075429_100138452
1281 Ga0068865_100008800
1282 Ga0068865_100056467
1283 Ga0068865_100163938
1284 Ga0075436_100025162
1285 Ga0075436_100044438
1286 Ga0075436_100150778
1287 Ga0097620_100006532
1288 Ga0097620_100153093
1289 Ga0097620_100325513
1290 Ga0097620_101299640
1291 Ga0075435_100018185
1292 Ga0075435_100025282
1293 Ga0075435_100064339
1294 Ga0075435_100356081
1295 Ga0075435_100400844
1296 Ga0105240_10005769
1297 Ga0105240_10239835
1298 Ga0105240_10273584
1299 Ga0105240_10721767
1300 Ga0111539_10036569
1301 Ga0111539_10074930
1302 Ga0111539_10233074
1303 Ga0105245_10013096
1304 Ga0105245_10046580
1305 Ga0105245_10114320
1306 Ga0105245_10682031
1307 Ga0105245_10945025
1308 Ga0114129_10012770
1309 Ga0114129_10133324
1310 Ga0114129_10214148
1311 Ga0114129_10249413
1312 Ga0114129_10382371
1313 Ga0114129_10669150
1314 Ga0114129_10676128
1315 Ga0114129_10930808
1316 Ga0114129_11242091
1317 Ga0114129_11258135
1318 Ga0105243_10003139
1319 Ga0105243_10684579
1320 Ga0105241_10001507
1321 Ga0105241_10035622
1322 Ga0105241_10631330
1323 Ga0105242_10002497
1324 Ga0105242_10086854
1325 Ga0105242_10345074
1326 Ga0105248_10004111
1327 Ga0105248_10014964
1328 Ga0105248_10068908
1329 Ga0105248_10151606
1330 Ga0105248_10153205
1331 Ga0105237_10021484
1332 Ga0105238_10000081
1333 Ga0105238_10180937
1334 Ga0105238_10191528
1335 Ga0105249_10000180
1336 Ga0105249_10000231
1337 Ga0105249_10005450
1338 Ga0105249_10045737
1339 Ga0105249_10111769
1340 Ga0105249_10146143
1341 Ga0105249_10299552
1342 Ga0105249_10476987
1343 Ga0105239_10005622
1344 Ga0105239_10011262
1345 Ga0105239_10016864
1346 Ga0105239_10097898
1347 Ga0105239_10181236
1348 Ga0105239_11299224
1349 Ga0105246_10015254
1350 Ga0105246_10038682
1351 Ga0105246_10734562
1352 Ga0105246_10934518
1353 Ga0157373_10582972
1354 Ga0157371_10008591
1355 Ga0157371_10014063
1356 Ga0157371_10619241
1357 Ga0157370_10016812
1358 Ga0157370_10139685
1359 Ga0157369_10057814
1360 Ga0157369_10080591
1361 Ga0157369_10096501
1362 Ga0157369_10339297
1363 Ga0157369_10498752
1364 Ga0157369_10943840
1365 Ga0157374_10004155
1366 Ga0157374_10112549
1367 Ga0157374_10131613
1368 Ga0157374_10639000
1369 Ga0157378_10000788
1370 Ga0157378_10093418
1371 Ga0157378_10721334
1372 Ga0163162_10020298
1373 Ga0163162_10071700
1374 Ga0163162_10525218
1375 Ga0157372_10002537
1376 Ga0157372_10012310
1377 Ga0157372_10103936
1378 Ga0157372_10279424
1379 Ga0157372_10344008
1380 Ga0157372_10589333
1381 Ga0157372_11237018
1382 Ga0157375_10068436
1383 Ga0157375_10093743
1384 Ga0157375_10170810
1385 Ga0157375_10248462
1386 Ga0157375_10522745
1387 Ga0157375_10548755
1388 Ga0163163_10003217
1389 Ga0163163_10023684
1390 Ga0163163_10873856
1391 Ga0157380_10006354
1392 Ga0157380_10020831
1393 Ga0182008_10011270
1394 Ga0157377_10009075
1395 Ga0157377_10051514
1396 Ga0157377_10414755
1397 Ga0157377_10454447
1398 Ga0157379_10061161
1399 Ga0157379_10347565
1400 Ga0157376_10808717
1401 Ga0182005_1011205
1402 Ga0163161_10016469
1403 Ga0163161_10152900
1404 Ga0163161_10155767
1405 Ga0213876_10028493
1406 Ga0213875_10007636
1407 Ga0207673_1010238
1408 Ga0207697_10009061
1409 Ga0207656_10034765
1410 Ga0207656_10224112
1411 Ga0207653_10007615
1412 Ga0207653_10085451
1413 Ga0207642_10001673
1414 Ga0207642_10105414
1415 Ga0207688_10343059
1416 Ga0207680_10010734
1417 Ga0207680_10107976
1418 Ga0207680_10290158
1419 Ga0207699_10038118
1420 Ga0207699_10220286
1421 Ga0207645_10000366
1422 Ga0207645_10002871
1423 Ga0207645_10041771
1424 Ga0207643_10003297
1425 Ga0207643_10033389
1426 Ga0207643_10092590
1427 Ga0207684_10027076
1428 Ga0207684_10087275
1429 Ga0207684_10339186
1430 Ga0207684_10343602
1431 Ga0207654_10005096
1432 Ga0207654_10028056
1433 Ga0207654_10295777
1434 Ga0207707_10011939
1435 Ga0207707_10195726
1436 Ga0207707_10423211
1437 Ga0207707_10448020
1438 Ga0207695_10017698
1439 Ga0207695_10022752
1440 Ga0207695_10556097
1441 Ga0207671_10341591
1442 Ga0207693_10806467
1443 Ga0207663_10000034
1444 Ga0207663_10179306
1445 Ga0207663_10238585
1446 Ga0207663_10691873
1447 Ga0207660_10016237
1448 Ga0207660_10061249
1449 Ga0207660_10170680
1450 Ga0207660_10241142
1451 Ga0207662_10008225
1452 Ga0207662_10009229
1453 Ga0207662_10564248
1454 Ga0207657_10018301
1455 Ga0207657_10084312
1456 Ga0207657_10794961
1457 Ga0207649_10016029
1458 Ga0207649_10017697
1459 Ga0207649_10083340
1460 Ga0207652_10022318
1461 Ga0207652_10128865
1462 Ga0207646_10053111
1463 Ga0207646_10096751
1464 Ga0207646_10106431
1465 Ga0207646_10124035
1466 Ga0207646_10132132
1467 Ga0207646_10178399
1468 Ga0207646_10578391
1469 Ga0207646_10802620
1470 Ga0207681_10001066
1471 Ga0207681_10013499
1472 Ga0207681_10019368
1473 Ga0207681_10021259
1474 Ga0207681_10022617
1475 Ga0207694_10000074
1476 Ga0207694_10043666
1477 Ga0207694_10521538
1478 Ga0207650_10008725
1479 Ga0207650_10041391
1480 Ga0207650_10500869
1481 Ga0207659_10068878
1482 Ga0207659_10103415
1483 Ga0207659_10232413
1484 Ga0207659_10267355
1485 Ga0207659_10650143
1486 Ga0207659_10839859
1487 Ga0207687_10034655
1488 Ga0207687_10035240
1489 Ga0207700_10043962
1490 Ga0207700_10109275
1491 Ga0207700_10444661
1492 Ga0207700_10543669
1493 Ga0207664_10250681
1494 Ga0207644_10085889
1495 Ga0207644_10258629
1496 Ga0207644_10513514
1497 Ga0207644_11082048
1498 Ga0207690_10017420
1499 Ga0207690_10045122
1500 Ga0207690_10110535
1501 Ga0207690_10167354
1502 Ga0207690_10274681
1503 Ga0207690_10282345
1504 Ga0207706_10000005
1505 Ga0207706_10000271
1506 Ga0207706_10006727
1507 Ga0207706_10017865
1508 Ga0207706_10115996
1509 Ga0207686_10000129
1510 Ga0207709_10004559
1511 Ga0207709_10233859
1512 Ga0207709_10782102
1513 Ga0207670_10013922
1514 Ga0207670_10158764
1515 Ga0207669_10000371
1516 Ga0207669_10146546
1517 Ga0207669_10180188
1518 Ga0207704_10026219
1519 Ga0207704_10072406
1520 Ga0207704_10085915
1521 Ga0207665_10191816
1522 Ga0207665_10252139
1523 Ga0207691_10001502
1524 Ga0207691_10005026
1525 Ga0207691_10026767
1526 Ga0207691_10091238
1527 Ga0207691_10109295
1528 Ga0207691_10271493
1529 Ga0207691_10712472
1530 Ga0207711_10000854
1531 Ga0207711_10033563
1532 Ga0207711_10958847
1533 Ga0207689_10003784
1534 Ga0207689_10007240
1535 Ga0207689_10007761
1536 Ga0207661_10004655
1537 Ga0207661_10012577
1538 Ga0207661_10058283
1539 Ga0207661_10190974
1540 Ga0207661_10322385
1541 Ga0207679_10034047
1542 Ga0207679_10049494
1543 Ga0207679_10065497
1544 Ga0207679_10235036
1545 Ga0207679_10238746
1546 Ga0207679_10332643
1547 Ga0207679_10389163
1548 Ga0207679_10682550
1549 Ga0207667_10150109
1550 Ga0207651_10051231
1551 Ga0207651_10101159
1552 Ga0207651_10264385
1553 Ga0207651_10435961
1554 Ga0207651_10508181
1555 Ga0207651_10883230
1556 Ga0207712_10000391
1557 Ga0207712_10034240
1558 Ga0207712_10034593
1559 Ga0207712_10075146
1560 Ga0207712_10532805
1561 Ga0207668_10032194
1562 Ga0207668_10034326
1563 Ga0207668_10037336
1564 Ga0207668_10721138
1565 Ga0207640_10002079
1566 Ga0207658_10132008
1567 Ga0207658_10188677
1568 Ga0207658_10935449
1569 Ga0207677_10430153
1570 Ga0207703_10041262
1571 Ga0207703_10533123
1572 Ga0207639_10155908
1573 Ga0207639_10297223
1574 Ga0207639_10612206
1575 Ga0207639_10842083
1576 Ga0207678_10008469
1577 Ga0207678_10255460
1578 Ga0207708_10006997
1579 Ga0207708_10062231
1580 Ga0207702_10102122
1581 Ga0207702_10305836
1582 Ga0207702_10354652
1583 Ga0207702_11286127
1584 Ga0207641_10836830
1585 Ga0207648_10000021
1586 Ga0207648_10038586
1587 Ga0207648_10053556
1588 Ga0207676_10001551
1589 Ga0207676_10012912
1590 Ga0207676_10066461
1591 Ga0207676_10545348
1592 Ga0207674_10001530
1593 Ga0207674_10001691
1594 Ga0207674_10007225
1595 Ga0207674_10015380
1596 Ga0207674_10047388
1597 Ga0207674_10130972
1598 Ga0207674_10522452
1599 Ga0207675_100000306
1600 Ga0207675_100252834
1601 Ga0207675_100556298
1602 Ga0207675_100754815
1603 Ga0207683_10143670
1604 Ga0207683_10417510
1605 Ga0207683_10508015
1606 Ga0207683_10646798
1607 Ga0207683_10962243
1608 Ga0207698_10012180
1609 Ga0207698_10021230
1610 Ga0207698_10053709
1611 Ga0207698_10097526
1612 Ga0207698_10834655
1613 Ga0207428_10104240
1614 Ga0207428_10560357
1615 Ga0268266_10119940
1616 Ga0268266_10319382
1617 Ga0268266_10905914
1618 Ga0268265_10039587
1619 Ga0268265_10040656
1620 Ga0268265_10081756
1621 Ga0268265_10104408
1622 Ga0268265_10147550
1623 Ga0268265_10668369
1624 Ga0268264_10004704
1625 Ga0307408_100013542
1626 Ga0307408_100017112
1627 Ga0307408_100180834
1628 Ga0307408_101089072
1629 Ga0307405_10001572
1630 Ga0307405_10257687
1631 Ga0307413_10003676
1632 Ga0307413_10021095
1633 Ga0307413_10065719
1634 Ga0307410_10000534
1635 Ga0307410_10053885
1636 Ga0307410_10129024
1637 Ga0307410_10428116
1638 Ga0307410_10718186
1639 Ga0307406_10083947
1640 Ga0307406_10272661
1641 Ga0307407_10007291
1642 Ga0307407_10054020
1643 Ga0307407_10064745
1644 Ga0307412_10007612
1645 Ga0307409_100004304
1646 Ga0307409_100011136
1647 Ga0307409_100025765
1648 Ga0307409_100074623
1649 Ga0307409_100131770
1650 Ga0307409_100190806
1651 Ga0307409_100342199
1652 Ga0307409_100529244
1653 Ga0307416_100009861
1654 Ga0307416_100047608
1655 Ga0307416_100600870
1656 Ga0307416_101073591
1657 Ga0307414_10004540
1658 Ga0307414_10031579
1659 Ga0307414_10119849
1660 Ga0307414_10245400
1661 Ga0307414_11412291
1662 Ga0307411_10000572
1663 Ga0307411_10014487
1664 Ga0307411_10372585
1665 Ga0307411_10626945
1666 Ga0307415_100003899
1667 Ga0307415_100052554
1668 Ga0307415_100120589
1669 Ga0307415_100166894
1670 Ga0307415_100855285
1671 Ga0373959_0000044
1672 Ga0373934_0015010
1673 Ga0373934_0038274
1674 Ga0373932_0085013
1675 Ga0373939_0151128
1676 Ga0373953_0124361
1677 Ga0373960_0022942
1678 Ga0373943_0195978
1679 Ga0373955_0080180
1680 Ga0373931_0081802
1681 Ga0373931_0091294
1682 Ga0373931_0216449
1683 Ga0373931_0250690
1684 Ga0373935_0326253
1685 Ga0373927_0020604
1686 Ga0373933_0031933
1687 Ga0373947_0188935
1688 Ga0373937_0004884
1689 Ga0373937_0056952
1690 Ga0373937_0528347
1691 Ga0373937_0782023
1692 Ga0373925_0491443
1693 Ga0395905_0466708
1694 Ga0436364_0508766
1695 Ga0395901_0744964
1696 Ga0242420_001555
1697 Ga0242420_008022
1698 Ga0242420_010963
1699 Ga0436365_1494207
1700 Ga0451791_0724933
1701 Ga0451853_1697498
1702 Ga0439445_0067733
1703 Ga0450914_023598
1704 Ga0451577_0055150
1705 Ga0451577_0235024
1706 Ga0451577_0470669
1707 Ga0451577_0991343
1708 Ga0453683_0012581
1709 Ga0453683_0082764
1710 Ga0453683_0276620
1711 Ga0453684_0697781
1712 Ga0451576_0016016
1713 Ga0451576_0078909
1714 Ga0451576_0202425
1715 Ga0451576_0751615
1716 Ga0451576_1023419
1717 Ga0451576_1394388
1718 Ga0495592_0442693
1719 Ga0495603_0017157
1720 Ga0495629_0059822
1721 Ga0495651_0041381
1722 Ga0495651_0074121
1723 Ga0495653_0022688
1724 Ga0495580_0040218
1725 Ga0495580_0046474
1726 Ga0495580_0188503
1727 Ga0495582_0004174
1728 Ga0495639_0117495
1729 Ga0495639_0122188
1730 Ga0495662_0029737
1731 Ga0495664_0057823
1732 Ga0495594_0006581
1733 Ga0495594_0007624
1734 Ga0495608_0042062
1735 Ga0495608_0378382
1736 Ga0495628_0032241
1737 Ga0495630_0017637
1738 Ga0495630_0073202
1739 Ga0495666_0246149
1740 Ga0495652_0000889
1741 Ga0495652_0129667
1742 Ga0495652_0701601
1743 Ga0495665_0000603
1744 Ga0495640_0098184
1745 Ga0495586_0025302
1746 Ga0495586_0044682
1747 Ga0495587_0000327
1748 Ga0495587_0006881
1749 Ga0495587_0054179
1750 Ga0495587_0111979
1751 Ga0495645_0000211
1752 Ga0495645_0118170
1753 Ga0495667_0002556
1754 Ga0495667_0022268
1755 Ga0495667_0100700
1756 Ga0495634_0102415
1757 Ga0495635_0190603
1758 Ga0495588_0144237
1759 Ga0495657_0089520
1760 Ga0495657_0131921
1761 Ga0495599_0003821
1762 Ga0495623_0023730
1763 Ga0495623_0033621
1764 Ga0495646_0040963
1765 Ga0495658_0078730
1766 Ga0495613_0048846
1767 Ga0495613_0513664
1768 Ga0495600_0124676
1769 Ga0495600_0192085
1770 Ga0495600_0216519
1771 Ga0495581_0060251
1772 Ga0495581_0107779
1773 Ga0495604_0021625
1774 Ga0495674_0101491
1775 Ga0495676_0288699
1776 Ga0495680_0009874
1777 Ga0495675_0006376
1778 Ga0495675_0015827
1779 Ga0495675_0175291
1780 Ga0495684_0012476
1781 Ga0495684_0015174
1782 Ga0495684_0069282
1783 Ga0495684_0071837
1784 Ga0495684_0145995
1785 Ga0495593_0176561
1786 Ga0495602_0037854
1787 Ga0495602_0085788
1788 Ga0496100_0024473
1789 Ga0496100_0189906
1790 Ga0496101_0026539
1791 Ga0496101_0045293
1792 Ga0496101_0211183
1793 Ga0496102_0022191
1794 Ga0496102_0062843
1795 Ga0496102_0091620
1796 Ga0496102_0314585
1797 Ga0496102_0346059
1798 Ga0496104_0032287
1799 Ga0496104_0065511
1800 Ga0496104_0183389
1801 Ga0496104_0194163
1802 Ga0496104_0361418
1803 Ga0496105_0062553
1804 Ga0496106_0101096
1805 Ga0496106_0781336
1806 Ga0496107_0039224
1807 Ga0496107_0239890
1808 Ga0496108_0002786
1809 Ga0496108_0005189
1810 Ga0496108_0011155
1811 Ga0496108_0067030
1812 Ga0496109_0020704
1813 Ga0496109_0038375
1814 Ga0496109_0069386
1815 Ga0496109_0156113
1816 Ga0496109_0233914
1817 Ga0496109_0239709
1818 Ga0496109_0521343
1819 Ga0496110_0027788
1820 Ga0496110_0029716
1821 Ga0496110_0102770
1822 Ga0496111_0044844
1823 Ga0496111_0046516
1824 Ga0496111_0087281
1825 Ga0496111_0404653
1826 Ga0496112_0000607
1827 Ga0496112_0005273
1828 Ga0496112_0013170
1829 Ga0496112_0129506
1830 Ga0496113_0000097
1831 Ga0496113_0005097
1832 Ga0496113_0029432
1833 Ga0496113_0206656
1834 Ga0496114_0020367
1835 Ga0496114_0030541
1836 Ga0496114_0376334
1837 Ga0496114_0410182
1838 Ga0496115_0010573
1839 Ga0496115_0084200
1840 Ga0501298_021128
1841 Ga0501038_0178283
1842 Ga0501040_0136322
1843 Ga0501048_0205867
1844 Ga0501067_0188037
1845 Ga0501074_0128831
1846 Ga0501077_0008022
1847 Ga0501216_014245
1848 Ga0501223_032661
1849 Ga0501230_031237
1850 Ga0501233_059941
1851 Ga0501242_005926
1852 Ga0501249_009886
1853 Ga0501257_019603
1854 Ga0501261_019797
1855 Ga0501080_0456112
1856 Ga0501081_0016800
1857 nmdc:mga05p37_10437_c1
1858 nmdc:mga05p37_111342_c1
1859 nmdc:mga05p37_182363_c1
1860 nmdc:mga05p37_206331_c1
1861 nmdc:mga05p37_333005_c1
1862 nmdc:mga05p37_379155_c1
1863 nmdc:mga05p37_636333_c1
1864 nmdc:mga09592_13458_c1
1865 nmdc:mga09592_192077_c1
1866 nmdc:mga09592_214797_c1
1867 nmdc:mga09592_433761_c1
1868 nmdc:mga09592_476448_c1
1869 nmdc:mga0qj67_175880_c1
1870 nmdc:mga0qj67_17742_c1
1871 nmdc:mga0qj67_574414_c1
1872 nmdc:mga0qj67_7214_c1
1873 nmdc:mga0qj67_911714_c1
1874 nmdc:mga06r32_10526_c1
1875 nmdc:mga06r32_1166411_c1
1876 nmdc:mga06r32_310168_c1
1877 nmdc:mga06r32_43755_c1
1878 nmdc:mga06r32_502690_c1
1879 nmdc:mga06r32_598684_c1
1880 nmdc:mga08y16_1110585_c1
1881 nmdc:mga08y16_271091_c1
1882 nmdc:mga08y16_434844_c1
1883 nmdc:mga0n895_1189_c1
1884 nmdc:mga0n895_139096_c1
1885 nmdc:mga0n895_1418844_c1
1886 nmdc:mga0n895_14212_c1
1887 nmdc:mga0n895_161485_c1
1888 nmdc:mga0n895_164547_c1
1889 nmdc:mga0n895_2925_c1
1890 nmdc:mga0n895_374301_c1
1891 nmdc:mga0n895_3949_c1
1892 nmdc:mga0n895_6534_c1
1893 nmdc:mga0n895_82112_c1
1894 nmdc:mga0rr50_114484_c1
1895 nmdc:mga0rr50_127850_c1
1896 nmdc:mga0rr50_81709_c1
1897 nmdc:mga08x19_391659_c1
1898 nmdc:mga08x19_85536_c1
1899 nmdc:mga0a205_103294_c1
1900 nmdc:mga0a205_122582_c1
1901 nmdc:mga0a205_142981_c1
1902 nmdc:mga0a205_166148_c1
1903 nmdc:mga0a205_194505_c1
1904 nmdc:mga0a205_20757_c2
1905 nmdc:mga0a205_23848_c1
1906 nmdc:mga0a205_33456_c1
1907 nmdc:mga0a205_493_c1
1908 nmdc:mga0a205_8295_c1
1909 nmdc:mga0a205_966931_c1
1910 nmdc:mga0a205_97586_c2
1911 Ga0495612_0016193
1912 Ga0495619_0053258
1913 Ga0501082_0044042
1914 Ga0530510_0138099

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13795

HupE_UreJ_2

HupE / UreJ protein

25

181

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tpj-assembly1.cif.gz_A selectivity mechanism of a bacterial homologue of the human drug peptide transporters pept1 and pept2 0.5051 1 193
7ydq-assembly1.cif.gz_A structure of pfnt1(y190a)-gfp in complex with gsk4 0.4917 21 195
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.4902 4 195
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.4881 4 193
7wn1-assembly1.cif.gz_A structure of pfnt1(y190a) in complex with nanobody 48 and inosine 0.4774 21 195
ID Description Score Start End Superfamily
af_Q69S28_20_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5701 3 197 1.20.1250.20
af_Q0D5J2_1_233_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5696 3 197 1.20.1250.20
af_Q8I2A8_11_433_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5402 2 197 1.20.1250.20
af_Q4DKD0_106_299_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5298 34 197 1.20.1250.20
af_Q2FVL1_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5285 39 199 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V7PNH0-F1-model_v4 HupE / UreJ protein 0.9551 1 150 GO:0016020
AF-A0A6M4IQU1-F1-model_v4 HupE/UreJ family protein 0.9478 2 200 GO:0016020
AF-A0A2V7PNH0-F1-model_v4 HupE / UreJ protein 0.9427 1 150 GO:0016020
AF-A0A352CGM1-F1-model_v4 HupE / UreJ protein 0.9392 1 197 GO:0016020
AF-A0A0R2RZC9-F1-model_v4 HupE / UreJ protein 0.9379 1 196 GO:0016020

Map