F486748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 956 | 324 | 1912 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1710174|Ga0436365_1710174_566_892 |
| Length | 108 |
| Sequence | MPKPSDLLQEPLDLLFLKSLAREPLHGWGIAKRIQLLSGDVLAVGQGSLYPALHRLEQQGWLAEWKDSDLGRSAKFYALTREGRKQLERELQSWNRLSSAVQLLLENA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 232 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 233 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 236 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 307 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.3 |
| Rhizosphere | 93.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436365_1710174 | 3300039437 | Bacteria | 1462 |
| 2 | MBSR1b_contig_2374457 | 2162886012 | Bacteria | 824 |
| 3 | MBSR1b_contig_3238983 | 2162886012 | Bacteria | 894 |
| 4 | ARcpr5yngRDRAFT_c022125 | 3300000043 | Unclassified | 540 |
| 5 | JGI24745J21846_1034316 | 3300002073 | Unclassified | 618 |
| 6 | Ga0065704_10326589 | 3300005289 | Unclassified | 839 |
| 7 | Ga0065712_10496300 | 3300005290 | Bacteria | 648 |
| 8 | Ga0065712_10570198 | 3300005290 | Bacteria | 607 |
| 9 | Ga0065715_10102249 | 3300005293 | Unclassified | 3131 |
| 10 | Ga0065715_10369545 | 3300005293 | Bacteria | 923 |
| 11 | Ga0065715_10711949 | 3300005293 | Unclassified | 648 |
| 12 | Ga0065715_10796632 | 3300005293 | Unclassified | 591 |
| 13 | Ga0065715_10812326 | 3300005293 | Bacteria | 605 |
| 14 | Ga0065715_11056152 | 3300005293 | Bacteria | 520 |
| 15 | Ga0065707_10019043 | 3300005295 | Bacteria | 1673 |
| 16 | Ga0065707_10299712 | 3300005295 | Unclassified | 1007 |
| 17 | Ga0070676_10024796 | 3300005328 | Unclassified | 3383 |
| 18 | Ga0070676_10384674 | 3300005328 | Unclassified | 972 |
| 19 | Ga0070676_10448695 | 3300005328 | Bacteria | 906 |
| 20 | Ga0070683_100000012 | 3300005329 | Bacteria | 274646 |
| 21 | Ga0070683_100077206 | 3300005329 | Bacteria | 3114 |
| 22 | Ga0070683_101919880 | 3300005329 | Bacteria | 569 |
| 23 | Ga0070690_100005077 | 3300005330 | Bacteria | 7377 |
| 24 | Ga0070690_100273649 | 3300005330 | Bacteria | 1202 |
| 25 | Ga0070670_100973749 | 3300005331 | Bacteria | 771 |
| 26 | Ga0070677_10001801 | 3300005333 | Bacteria | 6780 |
| 27 | Ga0070677_10003494 | 3300005333 | Bacteria | 5070 |
| 28 | Ga0070677_10443369 | 3300005333 | Bacteria | 693 |
| 29 | Ga0068869_100020157 | 3300005334 | Unclassified | 4568 |
| 30 | Ga0068869_100040367 | 3300005334 | Unclassified | 3337 |
| 31 | Ga0070666_10007928 | 3300005335 | Bacteria | 6563 |
| 32 | Ga0070666_10017201 | 3300005335 | Unclassified | 4634 |
| 33 | Ga0070666_10409772 | 3300005335 | Bacteria | 975 |
| 34 | Ga0070666_10551531 | 3300005335 | Bacteria | 838 |
| 35 | Ga0070680_100000822 | 3300005336 | Bacteria | 21901 |
| 36 | Ga0068868_100017783 | 3300005338 | Bacteria | 5302 |
| 37 | Ga0068868_101096525 | 3300005338 | Bacteria | 732 |
| 38 | Ga0068868_101265445 | 3300005338 | Unclassified | 684 |
| 39 | Ga0068868_101460720 | 3300005338 | Unclassified | 639 |
| 40 | Ga0070660_100071768 | 3300005339 | Bacteria | 2704 |
| 41 | Ga0070660_100310474 | 3300005339 | Unclassified | 1294 |
| 42 | Ga0070689_100041632 | 3300005340 | Unclassified | 3526 |
| 43 | Ga0070689_100167725 | 3300005340 | Unclassified | 1778 |
| 44 | Ga0070689_100217853 | 3300005340 | Bacteria | 1565 |
| 45 | Ga0070691_10723620 | 3300005341 | Unclassified | 599 |
| 46 | Ga0070687_100005713 | 3300005343 | Bacteria | 5048 |
| 47 | Ga0070687_100376105 | 3300005343 | Bacteria | 924 |
| 48 | Ga0070687_100384743 | 3300005343 | Bacteria | 915 |
| 49 | Ga0070687_101039466 | 3300005343 | Bacteria | 596 |
| 50 | Ga0070687_101171836 | 3300005343 | Unclassified | 565 |
| 51 | Ga0070661_100072510 | 3300005344 | Unclassified | 2534 |
| 52 | Ga0070692_10341193 | 3300005345 | Bacteria | 928 |
| 53 | Ga0070668_100156591 | 3300005347 | Unclassified | 1846 |
| 54 | Ga0070668_100201406 | 3300005347 | Bacteria | 1634 |
| 55 | Ga0070668_101900054 | 3300005347 | Bacteria | 548 |
| 56 | Ga0070669_100002675 | 3300005353 | Bacteria | 12836 |
| 57 | Ga0070669_100086064 | 3300005353 | Bacteria | 2348 |
| 58 | Ga0070669_100143844 | 3300005353 | Bacteria | 1841 |
| 59 | Ga0070669_100322174 | 3300005353 | Bacteria | 1248 |
| 60 | Ga0070669_100323428 | 3300005353 | Bacteria | 1246 |
| 61 | Ga0070669_100527343 | 3300005353 | Bacteria | 982 |
| 62 | Ga0070669_101157609 | 3300005353 | Unclassified | 667 |
| 63 | Ga0070675_100001787 | 3300005354 | Bacteria | 15871 |
| 64 | Ga0070675_100006343 | 3300005354 | Bacteria | 9079 |
| 65 | Ga0070675_100058810 | 3300005354 | Unclassified | 3171 |
| 66 | Ga0070675_100133359 | 3300005354 | Unclassified | 2118 |
| 67 | Ga0070675_100144258 | 3300005354 | Bacteria | 2037 |
| 68 | Ga0070671_100035560 | 3300005355 | Bacteria | 4127 |
| 69 | Ga0070671_100073889 | 3300005355 | Bacteria | 2848 |
| 70 | Ga0070671_100250062 | 3300005355 | Bacteria | 1506 |
| 71 | Ga0070674_100000172 | 3300005356 | Bacteria | 30047 |
| 72 | Ga0070674_100023066 | 3300005356 | Bacteria | 4021 |
| 73 | Ga0070674_100033534 | 3300005356 | Bacteria | 3419 |
| 74 | Ga0070674_100064888 | 3300005356 | Bacteria | 2561 |
| 75 | Ga0070674_100184969 | 3300005356 | Unclassified | 1598 |
| 76 | Ga0070674_101139647 | 3300005356 | Unclassified | 690 |
| 77 | Ga0070673_100047379 | 3300005364 | Unclassified | 3344 |
| 78 | Ga0070688_100001785 | 3300005365 | Bacteria | 10774 |
| 79 | Ga0070688_100467155 | 3300005365 | Bacteria | 946 |
| 80 | Ga0070688_100989341 | 3300005365 | Bacteria | 668 |
| 81 | Ga0070659_100015168 | 3300005366 | Bacteria | 5764 |
| 82 | Ga0070659_100100918 | 3300005366 | Unclassified | 2323 |
| 83 | Ga0070659_100142317 | 3300005366 | Bacteria | 1953 |
| 84 | Ga0070659_100171925 | 3300005366 | Bacteria | 1775 |
| 85 | Ga0070667_100036079 | 3300005367 | Unclassified | 4144 |
| 86 | Ga0070667_100706955 | 3300005367 | Unclassified | 933 |
| 87 | Ga0070667_100885236 | 3300005367 | Bacteria | 831 |
| 88 | Ga0070667_101221036 | 3300005367 | Unclassified | 704 |
| 89 | Ga0070667_101933576 | 3300005367 | Unclassified | 555 |
| 90 | Ga0070703_10051757 | 3300005406 | Bacteria | 1315 |
| 91 | Ga0070714_100010981 | 3300005435 | Bacteria | 7173 |
| 92 | Ga0070714_100227328 | 3300005435 | Unclassified | 1718 |
| 93 | Ga0070713_100062030 | 3300005436 | Bacteria | 3130 |
| 94 | Ga0070713_100114535 | 3300005436 | Bacteria | 2356 |
| 95 | Ga0070713_100123400 | 3300005436 | Bacteria | 2275 |
| 96 | Ga0070713_100149127 | 3300005436 | Bacteria | 2079 |
| 97 | Ga0070713_101134023 | 3300005436 | Unclassified | 756 |
| 98 | Ga0070710_11350818 | 3300005437 | Bacteria | 531 |
| 99 | Ga0070701_10040824 | 3300005438 | Unclassified | 2361 |
| 100 | Ga0070701_11070992 | 3300005438 | Bacteria | 566 |
| 101 | Ga0070711_101295661 | 3300005439 | Bacteria | 632 |
| 102 | Ga0070711_101717388 | 3300005439 | Unclassified | 550 |
| 103 | Ga0070705_100195886 | 3300005440 | Bacteria | 1381 |
| 104 | Ga0070694_100031742 | 3300005444 | Bacteria | 3464 |
| 105 | Ga0070694_100680322 | 3300005444 | Bacteria | 835 |
| 106 | Ga0070694_101750653 | 3300005444 | Bacteria | 529 |
| 107 | Ga0070708_100011344 | 3300005445 | Bacteria | 7247 |
| 108 | Ga0070708_100778013 | 3300005445 | Bacteria | 900 |
| 109 | Ga0070708_102194890 | 3300005445 | Bacteria | 510 |
| 110 | Ga0070663_100219863 | 3300005455 | Bacteria | 1491 |
| 111 | Ga0070678_100473267 | 3300005456 | Bacteria | 1101 |
| 112 | Ga0070678_101252869 | 3300005456 | Bacteria | 689 |
| 113 | Ga0070662_100029297 | 3300005457 | Unclassified | 3841 |
| 114 | Ga0070662_100257071 | 3300005457 | Bacteria | 1406 |
| 115 | Ga0070662_100348885 | 3300005457 | Bacteria | 1212 |
| 116 | Ga0070662_101030532 | 3300005457 | Unclassified | 705 |
| 117 | Ga0070681_10016588 | 3300005458 | Bacteria | 7354 |
| 118 | Ga0070681_10190546 | 3300005458 | Bacteria | 1970 |
| 119 | Ga0068867_100045613 | 3300005459 | Unclassified | 3216 |
| 120 | Ga0068867_100065686 | 3300005459 | Unclassified | 2700 |
| 121 | Ga0068867_100100521 | 3300005459 | Unclassified | 2208 |
| 122 | Ga0068867_100142492 | 3300005459 | Bacteria | 1875 |
| 123 | Ga0068867_100196678 | 3300005459 | Bacteria | 1612 |
| 124 | Ga0068867_102263480 | 3300005459 | Bacteria | 516 |
| 125 | Ga0070685_10041762 | 3300005466 | Unclassified | 2615 |
| 126 | Ga0070685_10160404 | 3300005466 | Bacteria | 1433 |
| 127 | Ga0070707_100044393 | 3300005468 | Bacteria | 4255 |
| 128 | Ga0070707_100478193 | 3300005468 | Bacteria | 1207 |
| 129 | Ga0070698_100085229 | 3300005471 | Bacteria | 3147 |
| 130 | Ga0070698_100394916 | 3300005471 | Unclassified | 1316 |
| 131 | Ga0070698_101557476 | 3300005471 | Bacteria | 613 |
| 132 | Ga0070699_100002633 | 3300005518 | Bacteria | 16034 |
| 133 | Ga0070699_100066877 | 3300005518 | Unclassified | 3121 |
| 134 | Ga0070699_100614234 | 3300005518 | Unclassified | 992 |
| 135 | Ga0070679_100077002 | 3300005530 | Bacteria | 3324 |
| 136 | Ga0070679_100387518 | 3300005530 | Unclassified | 1344 |
| 137 | Ga0070679_100421559 | 3300005530 | Bacteria | 1280 |
| 138 | Ga0070679_101184054 | 3300005530 | Unclassified | 709 |
| 139 | Ga0070679_101290700 | 3300005530 | Bacteria | 676 |
| 140 | Ga0070679_101319365 | 3300005530 | Unclassified | 667 |
| 141 | Ga0070684_100000013 | 3300005535 | Bacteria | 167281 |
| 142 | Ga0070684_100308778 | 3300005535 | Unclassified | 1452 |
| 143 | Ga0070684_100655510 | 3300005535 | Bacteria | 977 |
| 144 | Ga0070684_101731353 | 3300005535 | Unclassified | 590 |
| 145 | Ga0070697_100199170 | 3300005536 | Bacteria | 1702 |
| 146 | Ga0070697_100643812 | 3300005536 | Bacteria | 933 |
| 147 | Ga0070672_100001740 | 3300005543 | Bacteria | 13628 |
| 148 | Ga0070672_101524726 | 3300005543 | Bacteria | 599 |
| 149 | Ga0070686_100004504 | 3300005544 | Bacteria | 7681 |
| 150 | Ga0070686_100534064 | 3300005544 | Bacteria | 915 |
| 151 | Ga0070686_100977696 | 3300005544 | Unclassified | 693 |
| 152 | Ga0070686_101092429 | 3300005544 | Bacteria | 658 |
| 153 | Ga0070695_100011689 | 3300005545 | Bacteria | 5254 |
| 154 | Ga0070695_100080427 | 3300005545 | Unclassified | 2154 |
| 155 | Ga0070695_100510270 | 3300005545 | Bacteria | 931 |
| 156 | Ga0070695_100760693 | 3300005545 | Bacteria | 773 |
| 157 | Ga0070695_100774487 | 3300005545 | Bacteria | 767 |
| 158 | Ga0070696_100166791 | 3300005546 | Bacteria | 1625 |
| 159 | Ga0070696_101992653 | 3300005546 | Unclassified | 504 |
| 160 | Ga0070693_100150246 | 3300005547 | Bacteria | 1475 |
| 161 | Ga0070693_100206616 | 3300005547 | Unclassified | 1279 |
| 162 | Ga0070665_100017706 | 3300005548 | Bacteria | 7154 |
| 163 | Ga0070665_100017950 | 3300005548 | Bacteria | 7103 |
| 164 | Ga0070665_100095330 | 3300005548 | Bacteria | 2980 |
| 165 | Ga0070665_100604900 | 3300005548 | Unclassified | 1109 |
| 166 | Ga0070665_100987746 | 3300005548 | Bacteria | 854 |
| 167 | Ga0070665_101578417 | 3300005548 | Unclassified | 664 |
| 168 | Ga0070665_101609535 | 3300005548 | Unclassified | 657 |
| 169 | Ga0070704_100607886 | 3300005549 | Bacteria | 961 |
| 170 | Ga0070704_100958511 | 3300005549 | Bacteria | 772 |
| 171 | Ga0070704_101402346 | 3300005549 | Unclassified | 641 |
| 172 | Ga0068855_100004899 | 3300005563 | Bacteria | 16339 |
| 173 | Ga0068855_100022241 | 3300005563 | Bacteria | 7598 |
| 174 | Ga0068855_100078988 | 3300005563 | Bacteria | 3817 |
| 175 | Ga0068855_100250964 | 3300005563 | Bacteria | 1974 |
| 176 | Ga0068855_100519943 | 3300005563 | Bacteria | 1291 |
| 177 | Ga0068855_100704013 | 3300005563 | Unclassified | 1081 |
| 178 | Ga0068855_101460787 | 3300005563 | Unclassified | 703 |
| 179 | Ga0070664_100005833 | 3300005564 | Bacteria | 9934 |
| 180 | Ga0070664_100301090 | 3300005564 | Bacteria | 1449 |
| 181 | Ga0070664_100945057 | 3300005564 | Bacteria | 809 |
| 182 | Ga0070664_101202482 | 3300005564 | Unclassified | 715 |
| 183 | Ga0070664_101970807 | 3300005564 | Bacteria | 554 |
| 184 | Ga0068857_100004964 | 3300005577 | Bacteria | 11304 |
| 185 | Ga0068857_100132356 | 3300005577 | Unclassified | 2250 |
| 186 | Ga0068857_100293713 | 3300005577 | Bacteria | 1497 |
| 187 | Ga0068857_100628700 | 3300005577 | Unclassified | 1016 |
| 188 | Ga0068857_101094691 | 3300005577 | Bacteria | 769 |
| 189 | Ga0068857_101369270 | 3300005577 | Bacteria | 688 |
| 190 | Ga0068857_101464261 | 3300005577 | Bacteria | 665 |
| 191 | Ga0068856_100009114 | 3300005614 | Bacteria | 9647 |
| 192 | Ga0068856_100011460 | 3300005614 | Bacteria | 8604 |
| 193 | Ga0068856_100119058 | 3300005614 | Unclassified | 2641 |
| 194 | Ga0068852_100006626 | 3300005616 | Bacteria | 8392 |
| 195 | Ga0068852_100201990 | 3300005616 | Unclassified | 1881 |
| 196 | Ga0068852_100570716 | 3300005616 | Bacteria | 1133 |
| 197 | Ga0068852_100600142 | 3300005616 | Bacteria | 1105 |
| 198 | Ga0068859_100012492 | 3300005617 | Bacteria | 8543 |
| 199 | Ga0068859_100078332 | 3300005617 | Unclassified | 3345 |
| 200 | Ga0068859_101235165 | 3300005617 | Unclassified | 823 |
| 201 | Ga0068859_101258353 | 3300005617 | Bacteria | 815 |
| 202 | Ga0068859_101994885 | 3300005617 | Bacteria | 641 |
| 203 | Ga0068859_102142603 | 3300005617 | Unclassified | 617 |
| 204 | Ga0068859_102233019 | 3300005617 | Unclassified | 604 |
| 205 | Ga0068859_102317295 | 3300005617 | Bacteria | 592 |
| 206 | Ga0068864_100049642 | 3300005618 | Unclassified | 3610 |
| 207 | Ga0068864_100121711 | 3300005618 | Unclassified | 2334 |
| 208 | Ga0068864_100143748 | 3300005618 | Unclassified | 2154 |
| 209 | Ga0068864_101158449 | 3300005618 | Unclassified | 771 |
| 210 | Ga0068864_101363451 | 3300005618 | Unclassified | 710 |
| 211 | Ga0068864_101388194 | 3300005618 | Unclassified | 704 |
| 212 | Ga0068864_102147051 | 3300005618 | Unclassified | 565 |
| 213 | Ga0068866_10741305 | 3300005718 | Unclassified | 678 |
| 214 | Ga0068866_11290399 | 3300005718 | Unclassified | 530 |
| 215 | Ga0068861_100537245 | 3300005719 | Bacteria | 1063 |
| 216 | Ga0068870_10000827 | 3300005840 | Bacteria | 12055 |
| 217 | Ga0068870_10095518 | 3300005840 | Unclassified | 1670 |
| 218 | Ga0068863_100002004 | 3300005841 | Bacteria | 20212 |
| 219 | Ga0068863_100027325 | 3300005841 | Bacteria | 5442 |
| 220 | Ga0068863_100164198 | 3300005841 | Bacteria | 2129 |
| 221 | Ga0068863_100590979 | 3300005841 | Bacteria | 1098 |
| 222 | Ga0068863_100730569 | 3300005841 | Bacteria | 985 |
| 223 | Ga0068863_100915141 | 3300005841 | Unclassified | 878 |
| 224 | Ga0068863_101155878 | 3300005841 | Bacteria | 779 |
| 225 | Ga0068858_100016775 | 3300005842 | Bacteria | 6877 |
| 226 | Ga0068858_100126947 | 3300005842 | Unclassified | 2389 |
| 227 | Ga0068858_100325421 | 3300005842 | Unclassified | 1470 |
| 228 | Ga0068858_100338839 | 3300005842 | Bacteria | 1439 |
| 229 | Ga0068858_100487223 | 3300005842 | Bacteria | 1190 |
| 230 | Ga0068858_100698525 | 3300005842 | Unclassified | 987 |
| 231 | Ga0068860_100025560 | 3300005843 | Bacteria | 5696 |
| 232 | Ga0068860_100119167 | 3300005843 | Bacteria | 2527 |
| 233 | Ga0068860_100359615 | 3300005843 | Unclassified | 1434 |
| 234 | Ga0068862_100008067 | 3300005844 | Bacteria | 8718 |
| 235 | Ga0068862_100668799 | 3300005844 | Bacteria | 1003 |
| 236 | Ga0068862_101443508 | 3300005844 | Bacteria | 692 |
| 237 | Ga0068862_101774069 | 3300005844 | Unclassified | 626 |
| 238 | Ga0081455_10015552 | 3300005937 | Bacteria | 7387 |
| 239 | Ga0081455_10925982 | 3300005937 | Unclassified | 541 |
| 240 | Ga0081539_10049033 | 3300005985 | Bacteria | 2398 |
| 241 | Ga0081539_10053598 | 3300005985 | Bacteria | 2257 |
| 242 | Ga0081539_10095259 | 3300005985 | Bacteria | 1529 |
| 243 | Ga0070717_10029188 | 3300006028 | Bacteria | 4422 |
| 244 | Ga0070717_10045836 | 3300006028 | Bacteria | 3576 |
| 245 | Ga0070717_10458649 | 3300006028 | Unclassified | 1149 |
| 246 | Ga0075432_10242619 | 3300006058 | Unclassified | 728 |
| 247 | Ga0070716_101487428 | 3300006173 | Bacteria | 553 |
| 248 | Ga0097621_100018641 | 3300006237 | Bacteria | 5308 |
| 249 | Ga0097621_100080294 | 3300006237 | Bacteria | 2713 |
| 250 | Ga0097621_100236242 | 3300006237 | Unclassified | 1597 |
| 251 | Ga0097621_100247816 | 3300006237 | Bacteria | 1559 |
| 252 | Ga0097621_100375911 | 3300006237 | Bacteria | 1268 |
| 253 | Ga0068871_100068995 | 3300006358 | Unclassified | 2903 |
| 254 | Ga0068871_100389538 | 3300006358 | Bacteria | 1239 |
| 255 | Ga0068871_100448384 | 3300006358 | Bacteria | 1156 |
| 256 | Ga0068871_100600641 | 3300006358 | Unclassified | 1001 |
| 257 | Ga0068871_101829120 | 3300006358 | Unclassified | 577 |
| 258 | Ga0075428_100009050 | 3300006844 | Bacteria | 11048 |
| 259 | Ga0075428_100057339 | 3300006844 | Bacteria | 4264 |
| 260 | Ga0075428_100161532 | 3300006844 | Unclassified | 2432 |
| 261 | Ga0075428_100188377 | 3300006844 | Bacteria | 2232 |
| 262 | Ga0075428_101991043 | 3300006844 | Unclassified | 602 |
| 263 | Ga0075430_100015272 | 3300006846 | Bacteria | 6538 |
| 264 | Ga0075430_100036082 | 3300006846 | Bacteria | 4192 |
| 265 | Ga0075430_100177309 | 3300006846 | Bacteria | 1773 |
| 266 | Ga0075430_100466097 | 3300006846 | Bacteria | 1043 |
| 267 | Ga0075430_100640283 | 3300006846 | Unclassified | 877 |
| 268 | Ga0075431_100024630 | 3300006847 | Bacteria | 6170 |
| 269 | Ga0075431_100046174 | 3300006847 | Unclassified | 4491 |
| 270 | Ga0075431_100107620 | 3300006847 | Bacteria | 2877 |
| 271 | Ga0075431_100155137 | 3300006847 | Unclassified | 2356 |
| 272 | Ga0075431_100752888 | 3300006847 | Unclassified | 949 |
| 273 | Ga0075431_100891114 | 3300006847 | Bacteria | 860 |
| 274 | Ga0075431_100938259 | 3300006847 | Bacteria | 834 |
| 275 | Ga0075431_101790535 | 3300006847 | Unclassified | 570 |
| 276 | Ga0075431_102203713 | 3300006847 | Unclassified | 505 |
| 277 | Ga0075431_102217907 | 3300006847 | Bacteria | 503 |
| 278 | Ga0075433_10000346 | 3300006852 | Bacteria | 28887 |
| 279 | Ga0075433_10005849 | 3300006852 | Bacteria | 9689 |
| 280 | Ga0075433_10007651 | 3300006852 | Bacteria | 8580 |
| 281 | Ga0075433_10081808 | 3300006852 | Bacteria | 2847 |
| 282 | Ga0075433_10232463 | 3300006852 | Unclassified | 1637 |
| 283 | Ga0075433_10306734 | 3300006852 | Bacteria | 1405 |
| 284 | Ga0075433_10330384 | 3300006852 | Bacteria | 1348 |
| 285 | Ga0075433_10447439 | 3300006852 | Bacteria | 1139 |
| 286 | Ga0075433_11448959 | 3300006852 | Unclassified | 593 |
| 287 | Ga0075434_100006772 | 3300006871 | Bacteria | 10532 |
| 288 | Ga0075434_100011872 | 3300006871 | Bacteria | 8235 |
| 289 | Ga0075434_100028945 | 3300006871 | Bacteria | 5447 |
| 290 | Ga0075434_100032810 | 3300006871 | Bacteria | 5122 |
| 291 | Ga0075434_100064092 | 3300006871 | Bacteria | 3658 |
| 292 | Ga0075434_102204051 | 3300006871 | Bacteria | 555 |
| 293 | Ga0075429_100214494 | 3300006880 | Bacteria | 1686 |
| 294 | Ga0075429_100274571 | 3300006880 | Bacteria | 1476 |
| 295 | Ga0075429_101376659 | 3300006880 | Bacteria | 615 |
| 296 | Ga0075429_101379937 | 3300006880 | Unclassified | 614 |
| 297 | Ga0068865_100045749 | 3300006881 | Unclassified | 3001 |
| 298 | Ga0068865_100061622 | 3300006881 | Unclassified | 2630 |
| 299 | Ga0068865_100469833 | 3300006881 | Bacteria | 1043 |
| 300 | Ga0068865_100630593 | 3300006881 | Bacteria | 909 |
| 301 | Ga0068865_101074537 | 3300006881 | Bacteria | 708 |
| 302 | Ga0068865_101086330 | 3300006881 | Bacteria | 704 |
| 303 | Ga0075436_101126946 | 3300006914 | Unclassified | 591 |
| 304 | Ga0097620_100012492 | 3300006931 | Bacteria | 8543 |
| 305 | Ga0097620_100078328 | 3300006931 | Unclassified | 3345 |
| 306 | Ga0097620_101235263 | 3300006931 | Unclassified | 823 |
| 307 | Ga0097620_101258099 | 3300006931 | Bacteria | 815 |
| 308 | Ga0097620_101994922 | 3300006931 | Bacteria | 641 |
| 309 | Ga0097620_102142408 | 3300006931 | Unclassified | 617 |
| 310 | Ga0097620_102233349 | 3300006931 | Unclassified | 604 |
| 311 | Ga0097620_102316199 | 3300006931 | Bacteria | 592 |
| 312 | Ga0075435_100021977 | 3300007076 | Bacteria | 4917 |
| 313 | Ga0075435_100039064 | 3300007076 | Unclassified | 3787 |
| 314 | Ga0099794_10427793 | 3300007265 | Unclassified | 693 |
| 315 | Ga0105240_10009440 | 3300009093 | Bacteria | 13810 |
| 316 | Ga0105240_10017856 | 3300009093 | Bacteria | 9545 |
| 317 | Ga0105240_10017899 | 3300009093 | Bacteria | 9533 |
| 318 | Ga0105240_10025280 | 3300009093 | Bacteria | 7807 |
| 319 | Ga0105240_10110658 | 3300009093 | Bacteria | 3324 |
| 320 | Ga0105240_10246699 | 3300009093 | Unclassified | 2067 |
| 321 | Ga0105240_10253765 | 3300009093 | Bacteria | 2033 |
| 322 | Ga0105240_10584004 | 3300009093 | Bacteria | 1232 |
| 323 | Ga0111539_10001233 | 3300009094 | Bacteria | 34025 |
| 324 | Ga0111539_10022643 | 3300009094 | Bacteria | 7718 |
| 325 | Ga0111539_10287498 | 3300009094 | Bacteria | 1913 |
| 326 | Ga0111539_10476455 | 3300009094 | Bacteria | 1454 |
| 327 | Ga0111539_10581396 | 3300009094 | Unclassified | 1304 |
| 328 | Ga0111539_10773869 | 3300009094 | Bacteria | 1117 |
| 329 | Ga0111539_13096418 | 3300009094 | Unclassified | 537 |
| 330 | Ga0105245_10002014 | 3300009098 | Bacteria | 18418 |
| 331 | Ga0105245_10002505 | 3300009098 | Bacteria | 16554 |
| 332 | Ga0105245_10009708 | 3300009098 | Bacteria | 8395 |
| 333 | Ga0105245_10289552 | 3300009098 | Bacteria | 1604 |
| 334 | Ga0105245_10568617 | 3300009098 | Bacteria | 1157 |
| 335 | Ga0105245_11047100 | 3300009098 | Unclassified | 861 |
| 336 | Ga0105245_12266193 | 3300009098 | Unclassified | 597 |
| 337 | Ga0105247_10013117 | 3300009101 | Bacteria | 4970 |
| 338 | Ga0114129_10000872 | 3300009147 | Bacteria | 39245 |
| 339 | Ga0114129_10006410 | 3300009147 | Bacteria | 16682 |
| 340 | Ga0114129_10011701 | 3300009147 | Bacteria | 12485 |
| 341 | Ga0114129_10013537 | 3300009147 | Bacteria | 11625 |
| 342 | Ga0114129_10071421 | 3300009147 | Bacteria | 4841 |
| 343 | Ga0114129_10078548 | 3300009147 | Bacteria | 4590 |
| 344 | Ga0114129_10262787 | 3300009147 | Bacteria | 2312 |
| 345 | Ga0114129_10380504 | 3300009147 | Bacteria | 1864 |
| 346 | Ga0114129_11089316 | 3300009147 | Bacteria | 1001 |
| 347 | Ga0114129_11232204 | 3300009147 | Unclassified | 930 |
| 348 | Ga0114129_11728419 | 3300009147 | Bacteria | 763 |
| 349 | Ga0114129_12384782 | 3300009147 | Unclassified | 634 |
| 350 | Ga0105243_11490730 | 3300009148 | Bacteria | 700 |
| 351 | Ga0105243_11819062 | 3300009148 | Unclassified | 640 |
| 352 | Ga0105241_10170106 | 3300009174 | Unclassified | 1799 |
| 353 | Ga0105241_10568657 | 3300009174 | Bacteria | 1020 |
| 354 | Ga0105241_10779179 | 3300009174 | Unclassified | 879 |
| 355 | Ga0105241_11200613 | 3300009174 | Unclassified | 718 |
| 356 | Ga0105241_12571931 | 3300009174 | Unclassified | 511 |
| 357 | Ga0105242_10011639 | 3300009176 | Bacteria | 6768 |
| 358 | Ga0105242_10351971 | 3300009176 | Bacteria | 1360 |
| 359 | Ga0105242_11565913 | 3300009176 | Unclassified | 692 |
| 360 | Ga0105242_12413055 | 3300009176 | Unclassified | 573 |
| 361 | Ga0105242_13236372 | 3300009176 | Unclassified | 506 |
| 362 | Ga0105242_13258348 | 3300009176 | Unclassified | 504 |
| 363 | Ga0105248_10002325 | 3300009177 | Bacteria | 21083 |
| 364 | Ga0105248_10031048 | 3300009177 | Bacteria | 5970 |
| 365 | Ga0105248_10039057 | 3300009177 | Bacteria | 5315 |
| 366 | Ga0105248_10075883 | 3300009177 | Bacteria | 3778 |
| 367 | Ga0105248_10243843 | 3300009177 | Unclassified | 2023 |
| 368 | Ga0105248_10360238 | 3300009177 | Bacteria | 1637 |
| 369 | Ga0105248_10842328 | 3300009177 | Bacteria | 1035 |
| 370 | Ga0105248_10935760 | 3300009177 | Unclassified | 979 |
| 371 | Ga0105248_11155085 | 3300009177 | Bacteria | 875 |
| 372 | Ga0105237_10004243 | 3300009545 | Bacteria | 16682 |
| 373 | Ga0105237_10009915 | 3300009545 | Bacteria | 10166 |
| 374 | Ga0105237_10101389 | 3300009545 | Bacteria | 2871 |
| 375 | Ga0105237_11321262 | 3300009545 | Unclassified | 727 |
| 376 | Ga0105238_10007616 | 3300009551 | Bacteria | 10848 |
| 377 | Ga0105238_10043000 | 3300009551 | Bacteria | 4572 |
| 378 | Ga0105238_10182192 | 3300009551 | Bacteria | 2077 |
| 379 | Ga0105238_10287111 | 3300009551 | Bacteria | 1627 |
| 380 | Ga0105238_12480677 | 3300009551 | Unclassified | 554 |
| 381 | Ga0105238_12884539 | 3300009551 | Unclassified | 517 |
| 382 | Ga0105249_10012319 | 3300009553 | Bacteria | 7534 |
| 383 | Ga0105249_10115048 | 3300009553 | Bacteria | 2548 |
| 384 | Ga0105249_10148147 | 3300009553 | Unclassified | 2257 |
| 385 | Ga0105249_10260838 | 3300009553 | Unclassified | 1722 |
| 386 | Ga0105249_10526142 | 3300009553 | Bacteria | 1230 |
| 387 | Ga0105249_10670162 | 3300009553 | Bacteria | 1096 |
| 388 | Ga0105249_11677985 | 3300009553 | Bacteria | 708 |
| 389 | Ga0105249_11741741 | 3300009553 | Bacteria | 696 |
| 390 | Ga0105249_13419119 | 3300009553 | Bacteria | 511 |
| 391 | Ga0099796_10290507 | 3300010159 | Unclassified | 690 |
| 392 | Ga0105239_10018004 | 3300010375 | Bacteria | 7813 |
| 393 | Ga0105239_10350431 | 3300010375 | Unclassified | 1667 |
| 394 | Ga0105239_11071634 | 3300010375 | Unclassified | 927 |
| 395 | Ga0105239_12117699 | 3300010375 | Bacteria | 654 |
| 396 | Ga0105246_10005035 | 3300011119 | Bacteria | 8038 |
| 397 | Ga0105246_10085041 | 3300011119 | Unclassified | 2264 |
| 398 | Ga0105246_10193560 | 3300011119 | Bacteria | 1576 |
| 399 | Ga0105246_10505814 | 3300011119 | Bacteria | 1027 |
| 400 | Ga0105246_10933485 | 3300011119 | Bacteria | 781 |
| 401 | Ga0157373_10708319 | 3300013100 | Unclassified | 738 |
| 402 | Ga0157371_10091446 | 3300013102 | Unclassified | 2155 |
| 403 | Ga0157370_10002587 | 3300013104 | Bacteria | 21740 |
| 404 | Ga0157370_10002772 | 3300013104 | Bacteria | 20942 |
| 405 | Ga0157370_10178721 | 3300013104 | Bacteria | 1972 |
| 406 | Ga0157370_10241430 | 3300013104 | Unclassified | 1671 |
| 407 | Ga0157370_10292415 | 3300013104 | Bacteria | 1505 |
| 408 | Ga0157370_11028913 | 3300013104 | Unclassified | 745 |
| 409 | Ga0157369_10004043 | 3300013105 | Bacteria | 17380 |
| 410 | Ga0157369_10004682 | 3300013105 | Bacteria | 16085 |
| 411 | Ga0157369_10048017 | 3300013105 | Unclassified | 4633 |
| 412 | Ga0157369_10083429 | 3300013105 | Bacteria | 3418 |
| 413 | Ga0157369_10114496 | 3300013105 | Unclassified | 2864 |
| 414 | Ga0157369_10791071 | 3300013105 | Unclassified | 975 |
| 415 | Ga0157374_10042798 | 3300013296 | Bacteria | 4180 |
| 416 | Ga0157374_10072225 | 3300013296 | Unclassified | 3255 |
| 417 | Ga0157374_10705491 | 3300013296 | Unclassified | 1022 |
| 418 | Ga0157378_10004146 | 3300013297 | Bacteria | 12799 |
| 419 | Ga0157378_10030115 | 3300013297 | Unclassified | 4795 |
| 420 | Ga0157378_10393345 | 3300013297 | Bacteria | 1364 |
| 421 | Ga0163162_10016275 | 3300013306 | Bacteria | 7271 |
| 422 | Ga0163162_10508575 | 3300013306 | Bacteria | 1335 |
| 423 | Ga0163162_11019159 | 3300013306 | Unclassified | 936 |
| 424 | Ga0163162_11352922 | 3300013306 | Unclassified | 810 |
| 425 | Ga0163162_11401254 | 3300013306 | Unclassified | 795 |
| 426 | Ga0163162_12869985 | 3300013306 | Unclassified | 555 |
| 427 | Ga0157372_10040352 | 3300013307 | Bacteria | 5155 |
| 428 | Ga0157372_10062279 | 3300013307 | Bacteria | 4180 |
| 429 | Ga0157372_10075704 | 3300013307 | Bacteria | 3798 |
| 430 | Ga0157372_10363691 | 3300013307 | Bacteria | 1686 |
| 431 | Ga0157372_10405661 | 3300013307 | Unclassified | 1588 |
| 432 | Ga0157372_10424329 | 3300013307 | Bacteria | 1550 |
| 433 | Ga0157375_10001615 | 3300013308 | Bacteria | 19377 |
| 434 | Ga0157375_10136128 | 3300013308 | Unclassified | 2580 |
| 435 | Ga0157375_10820903 | 3300013308 | Bacteria | 1078 |
| 436 | Ga0157375_10910029 | 3300013308 | Bacteria | 1023 |
| 437 | Ga0157375_12447577 | 3300013308 | Unclassified | 623 |
| 438 | Ga0157375_13691749 | 3300013308 | Unclassified | 509 |
| 439 | Ga0163163_10160418 | 3300014325 | Unclassified | 2294 |
| 440 | Ga0163163_10509583 | 3300014325 | Unclassified | 1265 |
| 441 | Ga0163163_10608914 | 3300014325 | Bacteria | 1155 |
| 442 | Ga0163163_10721808 | 3300014325 | Bacteria | 1060 |
| 443 | Ga0157380_10016775 | 3300014326 | Bacteria | 5409 |
| 444 | Ga0157380_10045075 | 3300014326 | Unclassified | 3459 |
| 445 | Ga0157380_10049039 | 3300014326 | Bacteria | 3329 |
| 446 | Ga0157380_10101478 | 3300014326 | Bacteria | 2398 |
| 447 | Ga0157377_10154344 | 3300014745 | Bacteria | 1422 |
| 448 | Ga0157377_10356874 | 3300014745 | Bacteria | 983 |
| 449 | Ga0157379_10061437 | 3300014968 | Bacteria | 3359 |
| 450 | Ga0157379_10466823 | 3300014968 | Unclassified | 1167 |
| 451 | Ga0157379_10840991 | 3300014968 | Unclassified | 868 |
| 452 | Ga0157379_11481065 | 3300014968 | Unclassified | 660 |
| 453 | Ga0157376_10043035 | 3300014969 | Unclassified | 3704 |
| 454 | Ga0157376_10692646 | 3300014969 | Unclassified | 1023 |
| 455 | Ga0157376_10775373 | 3300014969 | Unclassified | 970 |
| 456 | Ga0157376_11108659 | 3300014969 | Unclassified | 817 |
| 457 | Ga0157376_11156925 | 3300014969 | Unclassified | 801 |
| 458 | Ga0163161_10336548 | 3300017792 | Bacteria | 1196 |
| 459 | Ga0163161_10623920 | 3300017792 | Unclassified | 891 |
| 460 | Ga0163161_10675987 | 3300017792 | Unclassified | 858 |
| 461 | Ga0163161_10756462 | 3300017792 | Bacteria | 813 |
| 462 | Ga0197907_10297313 | 3300020069 | Unclassified | 560 |
| 463 | Ga0213873_10300292 | 3300021358 | Unclassified | 518 |
| 464 | Ga0213874_10020315 | 3300021377 | Bacteria | 1819 |
| 465 | Ga0213874_10039399 | 3300021377 | Bacteria | 1407 |
| 466 | Ga0213876_10111686 | 3300021384 | Bacteria | 1450 |
| 467 | Ga0213876_10150618 | 3300021384 | Unclassified | 1237 |
| 468 | Ga0213875_10000008 | 3300021388 | Bacteria | 533344 |
| 469 | Ga0213875_10000088 | 3300021388 | Bacteria | 106188 |
| 470 | Ga0213875_10041295 | 3300021388 | Bacteria | 2171 |
| 471 | Ga0213875_10044896 | 3300021388 | Bacteria | 2075 |
| 472 | Ga0213875_10049259 | 3300021388 | Bacteria | 1975 |
| 473 | Ga0213875_10118805 | 3300021388 | Unclassified | 1235 |
| 474 | Ga0213875_10356341 | 3300021388 | Unclassified | 695 |
| 475 | Ga0207697_10002108 | 3300025315 | Bacteria | 10446 |
| 476 | Ga0207653_10194715 | 3300025885 | Unclassified | 762 |
| 477 | Ga0207653_10431281 | 3300025885 | Bacteria | 517 |
| 478 | Ga0207682_10001721 | 3300025893 | Bacteria | 10029 |
| 479 | Ga0207682_10019081 | 3300025893 | Bacteria | 2684 |
| 480 | Ga0207682_10326483 | 3300025893 | Bacteria | 721 |
| 481 | Ga0207692_10892980 | 3300025898 | Unclassified | 584 |
| 482 | Ga0207642_10352210 | 3300025899 | Bacteria | 869 |
| 483 | Ga0207642_10617997 | 3300025899 | Unclassified | 676 |
| 484 | Ga0207688_10010146 | 3300025901 | Bacteria | 5124 |
| 485 | Ga0207688_10155824 | 3300025901 | Bacteria | 1352 |
| 486 | Ga0207680_10051516 | 3300025903 | Unclassified | 2462 |
| 487 | Ga0207680_10137549 | 3300025903 | Unclassified | 1616 |
| 488 | Ga0207680_10682436 | 3300025903 | Bacteria | 736 |
| 489 | Ga0207647_10121883 | 3300025904 | Bacteria | 1537 |
| 490 | Ga0207699_10802207 | 3300025906 | Unclassified | 692 |
| 491 | Ga0207645_10016931 | 3300025907 | Unclassified | 4816 |
| 492 | Ga0207645_10029523 | 3300025907 | Bacteria | 3534 |
| 493 | Ga0207643_10000158 | 3300025908 | Bacteria | 46661 |
| 494 | Ga0207684_11419234 | 3300025910 | Bacteria | 568 |
| 495 | Ga0207654_10115834 | 3300025911 | Bacteria | 1675 |
| 496 | Ga0207654_10305737 | 3300025911 | Unclassified | 1083 |
| 497 | Ga0207654_10488975 | 3300025911 | Unclassified | 868 |
| 498 | Ga0207707_10274480 | 3300025912 | Bacteria | 1461 |
| 499 | Ga0207707_10398116 | 3300025912 | Unclassified | 1182 |
| 500 | Ga0207707_11363171 | 3300025912 | Unclassified | 567 |
| 501 | Ga0207695_10002722 | 3300025913 | Bacteria | 25812 |
| 502 | Ga0207695_10006239 | 3300025913 | Bacteria | 15528 |
| 503 | Ga0207695_10061336 | 3300025913 | Unclassified | 3886 |
| 504 | Ga0207695_10238194 | 3300025913 | Bacteria | 1722 |
| 505 | Ga0207695_10275376 | 3300025913 | Bacteria | 1577 |
| 506 | Ga0207695_10688839 | 3300025913 | Unclassified | 903 |
| 507 | Ga0207695_10711079 | 3300025913 | Bacteria | 885 |
| 508 | Ga0207695_10898420 | 3300025913 | Unclassified | 765 |
| 509 | Ga0207695_11573272 | 3300025913 | Unclassified | 538 |
| 510 | Ga0207671_10023090 | 3300025914 | Unclassified | 4693 |
| 511 | Ga0207671_10172656 | 3300025914 | Unclassified | 1679 |
| 512 | Ga0207671_10725728 | 3300025914 | Unclassified | 790 |
| 513 | Ga0207693_10574083 | 3300025915 | Bacteria | 879 |
| 514 | Ga0207663_10172177 | 3300025916 | Bacteria | 1539 |
| 515 | Ga0207663_10468819 | 3300025916 | Bacteria | 974 |
| 516 | Ga0207660_10001537 | 3300025917 | Bacteria | 15451 |
| 517 | Ga0207660_10294164 | 3300025917 | Bacteria | 1292 |
| 518 | Ga0207662_10006624 | 3300025918 | Bacteria | 6255 |
| 519 | Ga0207662_10222802 | 3300025918 | Bacteria | 1229 |
| 520 | Ga0207657_10148823 | 3300025919 | Bacteria | 1908 |
| 521 | Ga0207657_10259544 | 3300025919 | Bacteria | 1383 |
| 522 | Ga0207649_10028909 | 3300025920 | Unclassified | 3269 |
| 523 | Ga0207652_10056026 | 3300025921 | Bacteria | 3393 |
| 524 | Ga0207652_10312234 | 3300025921 | Bacteria | 1419 |
| 525 | Ga0207652_11179297 | 3300025921 | Unclassified | 667 |
| 526 | Ga0207652_11704479 | 3300025921 | Bacteria | 535 |
| 527 | Ga0207646_10119769 | 3300025922 | Bacteria | 2365 |
| 528 | Ga0207646_11154959 | 3300025922 | Bacteria | 680 |
| 529 | Ga0207681_10107503 | 3300025923 | Bacteria | 2023 |
| 530 | Ga0207681_10159670 | 3300025923 | Bacteria | 1698 |
| 531 | Ga0207681_11163979 | 3300025923 | Unclassified | 648 |
| 532 | Ga0207694_10006271 | 3300025924 | Bacteria | 9083 |
| 533 | Ga0207694_10011679 | 3300025924 | Bacteria | 6624 |
| 534 | Ga0207694_10012169 | 3300025924 | Bacteria | 6488 |
| 535 | Ga0207694_10244938 | 3300025924 | Bacteria | 1466 |
| 536 | Ga0207694_10551619 | 3300025924 | Unclassified | 967 |
| 537 | Ga0207650_11673695 | 3300025925 | Bacteria | 540 |
| 538 | Ga0207659_10002688 | 3300025926 | Bacteria | 10595 |
| 539 | Ga0207659_10005321 | 3300025926 | Bacteria | 7798 |
| 540 | Ga0207659_10021596 | 3300025926 | Unclassified | 4276 |
| 541 | Ga0207659_10056372 | 3300025926 | Unclassified | 2814 |
| 542 | Ga0207659_10178586 | 3300025926 | Unclassified | 1680 |
| 543 | Ga0207687_10001770 | 3300025927 | Bacteria | 14844 |
| 544 | Ga0207687_10006219 | 3300025927 | Bacteria | 7900 |
| 545 | Ga0207687_10008662 | 3300025927 | Bacteria | 6648 |
| 546 | Ga0207687_10394933 | 3300025927 | Bacteria | 1136 |
| 547 | Ga0207687_10762750 | 3300025927 | Unclassified | 824 |
| 548 | Ga0207700_10048966 | 3300025928 | Bacteria | 3141 |
| 549 | Ga0207700_10101665 | 3300025928 | Bacteria | 2294 |
| 550 | Ga0207700_10132761 | 3300025928 | Bacteria | 2035 |
| 551 | Ga0207700_10316516 | 3300025928 | Bacteria | 1351 |
| 552 | Ga0207664_10083195 | 3300025929 | Bacteria | 2609 |
| 553 | Ga0207664_10338160 | 3300025929 | Unclassified | 1331 |
| 554 | Ga0207664_11100935 | 3300025929 | Unclassified | 710 |
| 555 | Ga0207644_10371008 | 3300025931 | Bacteria | 1166 |
| 556 | Ga0207644_10783243 | 3300025931 | Unclassified | 797 |
| 557 | Ga0207690_10089869 | 3300025932 | Unclassified | 2166 |
| 558 | Ga0207690_10389921 | 3300025932 | Bacteria | 1109 |
| 559 | Ga0207690_10448122 | 3300025932 | Unclassified | 1037 |
| 560 | Ga0207706_10005297 | 3300025933 | Bacteria | 12026 |
| 561 | Ga0207706_10139231 | 3300025933 | Bacteria | 2135 |
| 562 | Ga0207706_10702969 | 3300025933 | Unclassified | 863 |
| 563 | Ga0207706_10842530 | 3300025933 | Bacteria | 777 |
| 564 | Ga0207686_10092629 | 3300025934 | Bacteria | 1999 |
| 565 | Ga0207686_10629332 | 3300025934 | Unclassified | 847 |
| 566 | Ga0207686_11030020 | 3300025934 | Unclassified | 669 |
| 567 | Ga0207709_11504096 | 3300025935 | Unclassified | 558 |
| 568 | Ga0207670_10066315 | 3300025936 | Unclassified | 2480 |
| 569 | Ga0207670_10091516 | 3300025936 | Bacteria | 2151 |
| 570 | Ga0207670_10950897 | 3300025936 | Unclassified | 721 |
| 571 | Ga0207669_10000320 | 3300025937 | Bacteria | 21935 |
| 572 | Ga0207669_10018836 | 3300025937 | Bacteria | 3580 |
| 573 | Ga0207669_10194243 | 3300025937 | Bacteria | 1467 |
| 574 | Ga0207669_10363627 | 3300025937 | Bacteria | 1122 |
| 575 | Ga0207669_10480342 | 3300025937 | Bacteria | 990 |
| 576 | Ga0207704_10375752 | 3300025938 | Unclassified | 1114 |
| 577 | Ga0207704_10477397 | 3300025938 | Bacteria | 1000 |
| 578 | Ga0207704_10813465 | 3300025938 | Bacteria | 781 |
| 579 | Ga0207704_11370728 | 3300025938 | Unclassified | 606 |
| 580 | Ga0207665_11442112 | 3300025939 | Unclassified | 548 |
| 581 | Ga0207691_10009994 | 3300025940 | Bacteria | 9113 |
| 582 | Ga0207691_11358431 | 3300025940 | Bacteria | 585 |
| 583 | Ga0207691_11470921 | 3300025940 | Bacteria | 558 |
| 584 | Ga0207711_10001367 | 3300025941 | Bacteria | 22990 |
| 585 | Ga0207711_10249930 | 3300025941 | Bacteria | 1628 |
| 586 | Ga0207711_10257693 | 3300025941 | Bacteria | 1602 |
| 587 | Ga0207711_10559401 | 3300025941 | Bacteria | 1067 |
| 588 | Ga0207711_10755618 | 3300025941 | Bacteria | 906 |
| 589 | Ga0207689_10004173 | 3300025942 | Bacteria | 13131 |
| 590 | Ga0207689_10031190 | 3300025942 | Bacteria | 4440 |
| 591 | Ga0207689_10184716 | 3300025942 | Bacteria | 1720 |
| 592 | Ga0207689_11350153 | 3300025942 | Unclassified | 598 |
| 593 | Ga0207661_10000034 | 3300025944 | Bacteria | 154138 |
| 594 | Ga0207661_10032874 | 3300025944 | Unclassified | 4023 |
| 595 | Ga0207661_10489924 | 3300025944 | Unclassified | 1123 |
| 596 | Ga0207679_10003829 | 3300025945 | Bacteria | 9326 |
| 597 | Ga0207679_10224252 | 3300025945 | Bacteria | 1583 |
| 598 | Ga0207679_10527864 | 3300025945 | Bacteria | 1056 |
| 599 | Ga0207679_11269185 | 3300025945 | Unclassified | 676 |
| 600 | Ga0207679_11461844 | 3300025945 | Unclassified | 627 |
| 601 | Ga0207679_11696962 | 3300025945 | Bacteria | 578 |
| 602 | Ga0207679_11822490 | 3300025945 | Bacteria | 556 |
| 603 | Ga0207667_10014002 | 3300025949 | Bacteria | 9158 |
| 604 | Ga0207667_10039277 | 3300025949 | Bacteria | 5045 |
| 605 | Ga0207667_10464551 | 3300025949 | Bacteria | 1285 |
| 606 | Ga0207667_10543877 | 3300025949 | Unclassified | 1175 |
| 607 | Ga0207667_10971523 | 3300025949 | Unclassified | 838 |
| 608 | Ga0207651_10046980 | 3300025960 | Unclassified | 2907 |
| 609 | Ga0207712_10062750 | 3300025961 | Unclassified | 2643 |
| 610 | Ga0207712_10063516 | 3300025961 | Unclassified | 2629 |
| 611 | Ga0207712_10067020 | 3300025961 | Bacteria | 2568 |
| 612 | Ga0207668_11414509 | 3300025972 | Bacteria | 627 |
| 613 | Ga0207658_10055402 | 3300025986 | Unclassified | 2938 |
| 614 | Ga0207658_10934832 | 3300025986 | Unclassified | 790 |
| 615 | Ga0207677_10351395 | 3300026023 | Bacteria | 1235 |
| 616 | Ga0207677_10509703 | 3300026023 | Bacteria | 1042 |
| 617 | Ga0207677_10819647 | 3300026023 | Unclassified | 834 |
| 618 | Ga0207703_10208405 | 3300026035 | Unclassified | 1741 |
| 619 | Ga0207703_10295250 | 3300026035 | Unclassified | 1476 |
| 620 | Ga0207703_10688740 | 3300026035 | Bacteria | 971 |
| 621 | Ga0207639_10370799 | 3300026041 | Bacteria | 1283 |
| 622 | Ga0207639_11753531 | 3300026041 | Bacteria | 581 |
| 623 | Ga0207678_10159415 | 3300026067 | Unclassified | 1927 |
| 624 | Ga0207678_10251107 | 3300026067 | Bacteria | 1515 |
| 625 | Ga0207678_11520129 | 3300026067 | Bacteria | 591 |
| 626 | Ga0207678_11585622 | 3300026067 | Unclassified | 577 |
| 627 | Ga0207708_11754702 | 3300026075 | Bacteria | 545 |
| 628 | Ga0207702_10009873 | 3300026078 | Bacteria | 8000 |
| 629 | Ga0207702_10099839 | 3300026078 | Unclassified | 2559 |
| 630 | Ga0207702_10196012 | 3300026078 | Bacteria | 1870 |
| 631 | Ga0207702_11139817 | 3300026078 | Bacteria | 774 |
| 632 | Ga0207641_10025118 | 3300026088 | Unclassified | 4911 |
| 633 | Ga0207641_10075997 | 3300026088 | Bacteria | 2902 |
| 634 | Ga0207641_10339680 | 3300026088 | Bacteria | 1429 |
| 635 | Ga0207648_10021097 | 3300026089 | Bacteria | 5858 |
| 636 | Ga0207648_10067339 | 3300026089 | Unclassified | 3122 |
| 637 | Ga0207648_10176992 | 3300026089 | Bacteria | 1887 |
| 638 | Ga0207648_10403549 | 3300026089 | Bacteria | 1239 |
| 639 | Ga0207648_10453314 | 3300026089 | Bacteria | 1168 |
| 640 | Ga0207648_10778467 | 3300026089 | Unclassified | 890 |
| 641 | Ga0207676_10107414 | 3300026095 | Unclassified | 2328 |
| 642 | Ga0207676_10508702 | 3300026095 | Bacteria | 1145 |
| 643 | Ga0207676_10956100 | 3300026095 | Unclassified | 842 |
| 644 | Ga0207676_11515391 | 3300026095 | Unclassified | 668 |
| 645 | Ga0207674_10013841 | 3300026116 | Bacteria | 8926 |
| 646 | Ga0207674_10147960 | 3300026116 | Unclassified | 2307 |
| 647 | Ga0207674_10537201 | 3300026116 | Bacteria | 1129 |
| 648 | Ga0207674_10606827 | 3300026116 | Bacteria | 1057 |
| 649 | Ga0207674_10668245 | 3300026116 | Bacteria | 1003 |
| 650 | Ga0207675_100029718 | 3300026118 | Bacteria | 5089 |
| 651 | Ga0207675_100426275 | 3300026118 | Bacteria | 1311 |
| 652 | Ga0207683_10000925 | 3300026121 | Bacteria | 26990 |
| 653 | Ga0207683_10110895 | 3300026121 | Bacteria | 2456 |
| 654 | Ga0207683_10501605 | 3300026121 | Bacteria | 1121 |
| 655 | Ga0207698_10033565 | 3300026142 | Bacteria | 3730 |
| 656 | Ga0207698_10928244 | 3300026142 | Bacteria | 879 |
| 657 | Ga0207698_11565093 | 3300026142 | Bacteria | 675 |
| 658 | Ga0207428_10001518 | 3300027907 | Bacteria | 24220 |
| 659 | Ga0207428_10002065 | 3300027907 | Bacteria | 20261 |
| 660 | Ga0207428_10528397 | 3300027907 | Unclassified | 855 |
| 661 | Ga0207428_10777687 | 3300027907 | Unclassified | 681 |
| 662 | Ga0268266_10069504 | 3300028379 | Unclassified | 3051 |
| 663 | Ga0268266_10540497 | 3300028379 | Bacteria | 1115 |
| 664 | Ga0268266_10554587 | 3300028379 | Bacteria | 1101 |
| 665 | Ga0268266_12316798 | 3300028379 | Unclassified | 508 |
| 666 | Ga0268265_10011411 | 3300028380 | Bacteria | 6008 |
| 667 | Ga0268265_10269833 | 3300028380 | Bacteria | 1517 |
| 668 | Ga0268265_10671428 | 3300028380 | Bacteria | 998 |
| 669 | Ga0268264_10079301 | 3300028381 | Unclassified | 2801 |
| 670 | Ga0268264_10139958 | 3300028381 | Bacteria | 2157 |
| 671 | Ga0265323_10005006 | 3300028653 | Bacteria | 5657 |
| 672 | Ga0265330_10184550 | 3300031235 | Unclassified | 883 |
| 673 | Ga0265332_10106897 | 3300031238 | Bacteria | 1180 |
| 674 | Ga0265328_10465931 | 3300031239 | Unclassified | 501 |
| 675 | Ga0265325_10367172 | 3300031241 | Unclassified | 634 |
| 676 | Ga0265340_10032541 | 3300031247 | Bacteria | 2603 |
| 677 | Ga0265316_10001914 | 3300031344 | Bacteria | 21862 |
| 678 | Ga0265316_10028222 | 3300031344 | Bacteria | 4632 |
| 679 | Ga0307408_100161333 | 3300031548 | Bacteria | 1781 |
| 680 | Ga0265313_10007334 | 3300031595 | Bacteria | 7562 |
| 681 | Ga0265314_10000776 | 3300031711 | Bacteria | 37903 |
| 682 | Ga0265314_10011058 | 3300031711 | Bacteria | 7481 |
| 683 | Ga0307412_12329803 | 3300031911 | Unclassified | 500 |
| 684 | Ga0307409_102756694 | 3300031995 | Bacteria | 519 |
| 685 | Ga0307416_100328758 | 3300032002 | Unclassified | 1535 |
| 686 | Ga0307416_101754649 | 3300032002 | Unclassified | 725 |
| 687 | Ga0307416_102879660 | 3300032002 | Unclassified | 576 |
| 688 | Ga0307411_10397072 | 3300032005 | Bacteria | 1139 |
| 689 | Ga0373958_0021245 | 3300034819 | Bacteria | 1203 |
| 690 | Ga0373934_0000774 | 3300035086 | Bacteria | 11483 |
| 691 | Ga0373934_0140077 | 3300035086 | Bacteria | 989 |
| 692 | Ga0373934_0211441 | 3300035086 | Bacteria | 799 |
| 693 | Ga0373944_0189288 | 3300035089 | Bacteria | 741 |
| 694 | Ga0373944_0272110 | 3300035089 | Unclassified | 630 |
| 695 | Ga0373939_0004091 | 3300035114 | Unclassified | 3436 |
| 696 | Ga0373953_0295905 | 3300035117 | Unclassified | 706 |
| 697 | Ga0373954_0001092 | 3300035118 | Bacteria | 10845 |
| 698 | Ga0373954_0364941 | 3300035118 | Bacteria | 713 |
| 699 | Ga0373954_0498346 | 3300035118 | Bacteria | 603 |
| 700 | Ga0373956_0046850 | 3300035119 | Unclassified | 1933 |
| 701 | Ga0373956_0281115 | 3300035119 | Unclassified | 792 |
| 702 | Ga0373956_0511122 | 3300035119 | Unclassified | 573 |
| 703 | Ga0373957_0016513 | 3300035120 | Bacteria | 2556 |
| 704 | Ga0373957_0127705 | 3300035120 | Bacteria | 1033 |
| 705 | Ga0373957_0240987 | 3300035120 | Bacteria | 760 |
| 706 | Ga0373957_0455455 | 3300035120 | Bacteria | 554 |
| 707 | Ga0373943_0174658 | 3300035170 | Bacteria | 1178 |
| 708 | Ga0373955_0339260 | 3300035172 | Bacteria | 909 |
| 709 | Ga0373955_0809177 | 3300035172 | Bacteria | 576 |
| 710 | Ga0373961_0378758 | 3300035241 | Bacteria | 539 |
| 711 | Ga0373962_0124166 | 3300035242 | Unclassified | 826 |
| 712 | Ga0373931_0714899 | 3300035691 | Unclassified | 662 |
| 713 | Ga0373935_0327163 | 3300035692 | Bacteria | 1089 |
| 714 | Ga0373935_0582452 | 3300035692 | Bacteria | 817 |
| 715 | Ga0373933_0132902 | 3300035724 | Bacteria | 1566 |
| 716 | Ga0373933_0830147 | 3300035724 | Bacteria | 608 |
| 717 | Ga0373933_1143320 | 3300035724 | Unclassified | 513 |
| 718 | Ga0373947_0171519 | 3300035725 | Bacteria | 1408 |
| 719 | Ga0373947_0402834 | 3300035725 | Bacteria | 923 |
| 720 | Ga0373937_0003513 | 3300036401 | Bacteria | 13184 |
| 721 | Ga0373937_0065954 | 3300036401 | Unclassified | 3333 |
| 722 | Ga0373937_0159751 | 3300036401 | Bacteria | 2113 |
| 723 | Ga0373937_0166851 | 3300036401 | Bacteria | 2065 |
| 724 | Ga0373937_0218205 | 3300036401 | Bacteria | 1795 |
| 725 | Ga0373937_0612321 | 3300036401 | Bacteria | 1034 |
| 726 | Ga0373937_0638915 | 3300036401 | Unclassified | 1010 |
| 727 | Ga0373925_0017088 | 3300037068 | Bacteria | 5252 |
| 728 | Ga0373925_0221379 | 3300037068 | Bacteria | 1511 |
| 729 | Ga0395905_0869232 | 3300037471 | Unclassified | 805 |
| 730 | Ga0436364_0091827 | 3300037853 | Unclassified | 544 |
| 731 | Ga0436364_0117819 | 3300037853 | Unclassified | 531 |
| 732 | Ga0436364_0154123 | 3300037853 | Bacteria | 7439 |
| 733 | Ga0436364_0278774 | 3300037853 | Bacteria | 400541 |
| 734 | Ga0436364_0466454 | 3300037853 | Unclassified | 776 |
| 735 | Ga0436364_0511894 | 3300037853 | Unclassified | 525 |
| 736 | Ga0436364_0562228 | 3300037853 | Unclassified | 1055 |
| 737 | Ga0436364_0568781 | 3300037853 | Bacteria | 2934 |
| 738 | Ga0436364_0613877 | 3300037853 | Unclassified | 742 |
| 739 | Ga0436364_0772554 | 3300037853 | Bacteria | 5751 |
| 740 | Ga0436364_0938901 | 3300037853 | Bacteria | 1410 |
| 741 | Ga0436364_0993293 | 3300037853 | Bacteria | 3217 |
| 742 | Ga0436364_1172528 | 3300037853 | Bacteria | 1251 |
| 743 | Ga0436364_1415525 | 3300037853 | Bacteria | 425173 |
| 744 | Ga0436364_1527124 | 3300037853 | Unclassified | 3953 |
| 745 | Ga0436365_0405905 | 3300039437 | Bacteria | 607 |
| 746 | Ga0436365_0480035 | 3300039437 | Bacteria | 2605 |
| 747 | Ga0436365_0712875 | 3300039437 | Bacteria | 1400 |
| 748 | Ga0436365_1270184 | 3300039437 | Unclassified | 4294 |
| 749 | Ga0436365_1884243 | 3300039437 | Bacteria | 691 |
| 750 | Ga0436361_0981129 | 3300039447 | Unclassified | 985 |
| 751 | Ga0436363_0689488 | 3300039450 | Bacteria | 4304 |
| 752 | Ga0436363_0933554 | 3300039450 | Unclassified | 1063 |
| 753 | Ga0436363_1135331 | 3300039450 | Bacteria | 4523 |
| 754 | Ga0436363_1279168 | 3300039450 | Unclassified | 1090 |
| 755 | Ga0436363_1416554 | 3300039450 | Unclassified | 689 |
| 756 | Ga0436362_0443984 | 3300039453 | Unclassified | 567 |
| 757 | Ga0436362_0973259 | 3300039453 | Unclassified | 625 |
| 758 | Ga0436362_1036551 | 3300039453 | Unclassified | 589 |
| 759 | Ga0436362_1143208 | 3300039453 | Bacteria | 1579 |
| 760 | Ga0436362_1150066 | 3300039453 | Bacteria | 1635 |
| 761 | Ga0436362_1152312 | 3300039453 | Bacteria | 4520 |
| 762 | Ga0439448_0203172 | 3300042005 | Bacteria | 695 |
| 763 | Ga0439435_0160655 | 3300042436 | Bacteria | 725 |
| 764 | Ga0439435_0222787 | 3300042436 | Unclassified | 628 |
| 765 | Ga0451577_0247707 | 3300042876 | Bacteria | 1613 |
| 766 | Ga0439440_0075149 | 3300042993 | Bacteria | 886 |
| 767 | Ga0453683_0573410 | 3300044673 | Bacteria | 735 |
| 768 | Ga0466963_0419954 | 3300044694 | Unclassified | 943 |
| 769 | Ga0466963_0533307 | 3300044694 | Unclassified | 829 |
| 770 | Ga0466963_1196980 | 3300044694 | Unclassified | 534 |
| 771 | Ga0453684_0424423 | 3300044712 | Unclassified | 1485 |
| 772 | Ga0466971_0334253 | 3300044719 | Unclassified | 731 |
| 773 | Ga0466957_0682033 | 3300044842 | Bacteria | 724 |
| 774 | Ga0466959_0241055 | 3300045049 | Unclassified | 1249 |
| 775 | Ga0451576_0030246 | 3300045051 | Bacteria | 5790 |
| 776 | Ga0451576_0261331 | 3300045051 | Unclassified | 1809 |
| 777 | Ga0451576_0352679 | 3300045051 | Unclassified | 1540 |
| 778 | Ga0451576_2727057 | 3300045051 | Bacteria | 503 |
| 779 | Ga0466958_0269285 | 3300045836 | Bacteria | 1091 |
| 780 | Ga0466967_0048424 | 3300045976 | Bacteria | 3711 |
| 781 | Ga0466967_0441551 | 3300045976 | Unclassified | 1271 |
| 782 | Ga0495592_0011489 | 3300046454 | Bacteria | 6703 |
| 783 | Ga0495592_0029591 | 3300046454 | Bacteria | 4147 |
| 784 | Ga0495629_0272274 | 3300046459 | Bacteria | 1163 |
| 785 | Ga0495629_0307522 | 3300046459 | Bacteria | 1085 |
| 786 | Ga0495651_0046187 | 3300046462 | Unclassified | 3371 |
| 787 | Ga0495651_0125666 | 3300046462 | Unclassified | 1878 |
| 788 | Ga0495651_0159035 | 3300046462 | Bacteria | 1620 |
| 789 | Ga0495580_0073881 | 3300046472 | Bacteria | 2380 |
| 790 | Ga0495580_0094921 | 3300046472 | Bacteria | 2075 |
| 791 | Ga0495582_0035912 | 3300046473 | Bacteria | 2726 |
| 792 | Ga0495582_0493655 | 3300046473 | Bacteria | 708 |
| 793 | Ga0495639_0077830 | 3300046475 | Bacteria | 1540 |
| 794 | Ga0495639_0475911 | 3300046475 | Unclassified | 636 |
| 795 | Ga0495662_0013564 | 3300046476 | Bacteria | 3966 |
| 796 | Ga0495662_0016769 | 3300046476 | Bacteria | 3547 |
| 797 | Ga0495662_0072248 | 3300046476 | Unclassified | 1673 |
| 798 | Ga0495662_0442257 | 3300046476 | Bacteria | 638 |
| 799 | Ga0495664_0119884 | 3300046477 | Bacteria | 1591 |
| 800 | Ga0495608_0419502 | 3300046511 | Bacteria | 817 |
| 801 | Ga0495618_0156689 | 3300046514 | Bacteria | 1453 |
| 802 | Ga0495628_0302442 | 3300046516 | Unclassified | 1184 |
| 803 | Ga0495628_0344477 | 3300046516 | Bacteria | 1096 |
| 804 | Ga0495630_0115514 | 3300046517 | Bacteria | 2034 |
| 805 | Ga0495643_0004442 | 3300046522 | Bacteria | 9801 |
| 806 | Ga0495666_0079097 | 3300046526 | Bacteria | 1557 |
| 807 | Ga0495652_0049094 | 3300046529 | Bacteria | 3614 |
| 808 | Ga0495652_0078174 | 3300046529 | Bacteria | 2740 |
| 809 | Ga0495652_0533403 | 3300046529 | Bacteria | 809 |
| 810 | Ga0495652_0817851 | 3300046529 | Bacteria | 619 |
| 811 | Ga0495665_0306510 | 3300046531 | Unclassified | 812 |
| 812 | Ga0495640_0354609 | 3300046533 | Bacteria | 905 |
| 813 | Ga0495586_0249373 | 3300046535 | Bacteria | 1013 |
| 814 | Ga0495586_0406781 | 3300046535 | Bacteria | 783 |
| 815 | Ga0495587_0002501 | 3300046536 | Bacteria | 12273 |
| 816 | Ga0495587_0028881 | 3300046536 | Bacteria | 3370 |
| 817 | Ga0495587_0029449 | 3300046536 | Bacteria | 3333 |
| 818 | Ga0495587_0153034 | 3300046536 | Bacteria | 1314 |
| 819 | Ga0495587_0364005 | 3300046536 | Unclassified | 805 |
| 820 | Ga0495621_0366035 | 3300046539 | Bacteria | 607 |
| 821 | Ga0495645_0038006 | 3300046543 | Unclassified | 3510 |
| 822 | Ga0495645_0139250 | 3300046543 | Bacteria | 1694 |
| 823 | Ga0495645_0141767 | 3300046543 | Bacteria | 1676 |
| 824 | Ga0495656_0532165 | 3300046615 | Unclassified | 625 |
| 825 | Ga0495634_0140727 | 3300046642 | Bacteria | 1532 |
| 826 | Ga0495635_0028305 | 3300046663 | Bacteria | 3895 |
| 827 | Ga0495635_0406721 | 3300046663 | Unclassified | 903 |
| 828 | Ga0495659_0155993 | 3300046664 | Unclassified | 919 |
| 829 | Ga0495588_0094919 | 3300046674 | Bacteria | 1564 |
| 830 | Ga0495657_0573808 | 3300046675 | Unclassified | 654 |
| 831 | Ga0495599_0028672 | 3300046678 | Bacteria | 3488 |
| 832 | Ga0495599_0173872 | 3300046678 | Bacteria | 1328 |
| 833 | Ga0495623_0096106 | 3300046679 | Unclassified | 1811 |
| 834 | Ga0495623_0165210 | 3300046679 | Bacteria | 1297 |
| 835 | Ga0495623_0259803 | 3300046679 | Bacteria | 973 |
| 836 | Ga0495623_0470720 | 3300046679 | Bacteria | 666 |
| 837 | Ga0495646_0179104 | 3300046680 | Bacteria | 1164 |
| 838 | Ga0495669_0069932 | 3300046684 | Unclassified | 1598 |
| 839 | Ga0495669_0380802 | 3300046684 | Bacteria | 683 |
| 840 | Ga0495613_0366714 | 3300046689 | Bacteria | 987 |
| 841 | Ga0495613_0875830 | 3300046689 | Bacteria | 582 |
| 842 | Ga0495624_0350189 | 3300046690 | Bacteria | 888 |
| 843 | Ga0495624_0641861 | 3300046690 | Bacteria | 632 |
| 844 | Ga0495600_0157640 | 3300046809 | Bacteria | 1468 |
| 845 | Ga0495600_0406791 | 3300046809 | Unclassified | 846 |
| 846 | Ga0495600_0572310 | 3300046809 | Unclassified | 689 |
| 847 | Ga0495604_0226022 | 3300047317 | Bacteria | 1286 |
| 848 | Ga0495674_0055646 | 3300047319 | Bacteria | 3468 |
| 849 | Ga0495674_0082062 | 3300047319 | Unclassified | 2765 |
| 850 | Ga0495674_0131256 | 3300047319 | Bacteria | 2111 |
| 851 | Ga0495674_0898823 | 3300047319 | Unclassified | 684 |
| 852 | Ga0495674_1055307 | 3300047319 | Bacteria | 620 |
| 853 | Ga0495680_0052926 | 3300047322 | Bacteria | 3162 |
| 854 | Ga0495675_0132536 | 3300047444 | Bacteria | 1548 |
| 855 | Ga0495675_0734086 | 3300047444 | Bacteria | 551 |
| 856 | Ga0495684_0004503 | 3300047471 | Bacteria | 10882 |
| 857 | Ga0495684_0011009 | 3300047471 | Bacteria | 6994 |
| 858 | Ga0495684_0020716 | 3300047471 | Bacteria | 5066 |
| 859 | Ga0495684_0208524 | 3300047471 | Bacteria | 1438 |
| 860 | Ga0495684_0857248 | 3300047471 | Unclassified | 589 |
| 861 | Ga0495602_0064130 | 3300048088 | Bacteria | 3179 |
| 862 | Ga0495602_0831201 | 3300048088 | Bacteria | 618 |
| 863 | Ga0495602_0953728 | 3300048088 | Bacteria | 568 |
| 864 | Ga0495602_0995126 | 3300048088 | Unclassified | 554 |
| 865 | Ga0496100_0147667 | 3300048903 | Bacteria | 1674 |
| 866 | Ga0496100_0725046 | 3300048903 | Bacteria | 777 |
| 867 | Ga0496102_0011172 | 3300048905 | Bacteria | 7734 |
| 868 | Ga0496102_0585346 | 3300048905 | Bacteria | 1039 |
| 869 | Ga0496103_0038977 | 3300048906 | Bacteria | 2919 |
| 870 | Ga0496105_0080000 | 3300048908 | Bacteria | 2699 |
| 871 | Ga0496105_0405126 | 3300048908 | Bacteria | 1082 |
| 872 | Ga0496106_0074772 | 3300048909 | Bacteria | 2594 |
| 873 | Ga0496106_1333394 | 3300048909 | Unclassified | 556 |
| 874 | Ga0496108_0391429 | 3300048911 | Bacteria | 1214 |
| 875 | Ga0496109_0242075 | 3300048912 | Unclassified | 1698 |
| 876 | Ga0496109_0502959 | 3300048912 | Unclassified | 1144 |
| 877 | Ga0496110_0042864 | 3300048913 | Bacteria | 3950 |
| 878 | Ga0496111_0811363 | 3300048914 | Bacteria | 677 |
| 879 | Ga0496112_0012842 | 3300048915 | Bacteria | 7710 |
| 880 | Ga0496112_0072712 | 3300048915 | Unclassified | 3399 |
| 881 | Ga0496112_0400872 | 3300048915 | Bacteria | 1312 |
| 882 | Ga0496113_0022458 | 3300048916 | Bacteria | 4464 |
| 883 | Ga0496113_0227868 | 3300048916 | Unclassified | 1486 |
| 884 | Ga0496113_0529324 | 3300048916 | Bacteria | 946 |
| 885 | Ga0496114_0419023 | 3300048917 | Bacteria | 1186 |
| 886 | Ga0496115_0670197 | 3300048918 | Bacteria | 818 |
| 887 | Ga0496126_0300270 | 3300048929 | Bacteria | 1325 |
| 888 | Ga0501299_051150 | 3300049522 | Bacteria | 854 |
| 889 | Ga0501047_0227312 | 3300049581 | Unclassified | 1720 |
| 890 | Ga0501067_0431079 | 3300049583 | Bacteria | 736 |
| 891 | Ga0501070_0042003 | 3300049586 | Unclassified | 3808 |
| 892 | Ga0501071_1308551 | 3300049587 | Unclassified | 560 |
| 893 | Ga0501080_1659463 | 3300049742 | Bacteria | 540 |
| 894 | Ga0501083_0512226 | 3300049744 | Bacteria | 781 |
| 895 | Ga0501264_036586 | 3300049761 | Bacteria | 586 |
| 896 | Ga0501279_039961 | 3300049775 | Unclassified | 717 |
| 897 | Ga0501035_0150616 | 3300049822 | Unclassified | 2019 |
| 898 | Ga0501044_0023985 | 3300049823 | Bacteria | 6482 |
| 899 | Ga0501045_0257635 | 3300049824 | Bacteria | 1298 |
| 900 | Ga0501045_0381204 | 3300049824 | Bacteria | 1050 |
| 901 | nmdc:mga05p37_293167_c1 | 3300050507 | Bacteria | 1936 |
| 902 | nmdc:mga05p37_29338_c1 | 3300050507 | Bacteria | 6713 |
| 903 | nmdc:mga05p37_348324_c1 | 3300050507 | Bacteria | 1745 |
| 904 | nmdc:mga05p37_67576_c1 | 3300050507 | Bacteria | 4397 |
| 905 | nmdc:mga05p37_71966_c1 | 3300050507 | Bacteria | 4254 |
| 906 | nmdc:mga09592_1068608_c1 | 3300050508 | Bacteria | 672 |
| 907 | nmdc:mga09592_184018_c1 | 3300050508 | Bacteria | 1807 |
| 908 | nmdc:mga09592_226088_c1 | 3300050508 | Unclassified | 1621 |
| 909 | nmdc:mga09592_871590_c1 | 3300050508 | Bacteria | 758 |
| 910 | nmdc:mga09592_980529_c1 | 3300050508 | Unclassified | 707 |
| 911 | nmdc:mga0qj67_115272_c1 | 3300050509 | Unclassified | 2171 |
| 912 | nmdc:mga0qj67_153987_c1 | 3300050509 | Bacteria | 1865 |
| 913 | nmdc:mga0qj67_727061_c1 | 3300050509 | Bacteria | 789 |
| 914 | nmdc:mga0qj67_85525_c1 | 3300050509 | Bacteria | 2529 |
| 915 | nmdc:mga0qj67_9852_c1 | 3300050509 | Bacteria | 7123 |
| 916 | nmdc:mga06r32_1055679_c1 | 3300050510 | Bacteria | 763 |
| 917 | nmdc:mga06r32_1092362_c1 | 3300050510 | Unclassified | 747 |
| 918 | nmdc:mga06r32_1094333_c1 | 3300050510 | Unclassified | 746 |
| 919 | nmdc:mga06r32_156877_c1 | 3300050510 | Bacteria | 2257 |
| 920 | nmdc:mga06r32_26374_c2 | 3300050510 | Unclassified | 962 |
| 921 | nmdc:mga06r32_44265_c1 | 3300050510 | Unclassified | 4238 |
| 922 | nmdc:mga06r32_918802_c1 | 3300050510 | Unclassified | 831 |
| 923 | nmdc:mga08y16_1626342_c1 | 3300050511 | Unclassified | 603 |
| 924 | nmdc:mga08y16_27959_c1 | 3300050511 | Bacteria | 5946 |
| 925 | nmdc:mga08y16_2818_c1 | 3300050511 | Bacteria | 17856 |
| 926 | nmdc:mga08y16_373574_c1 | 3300050511 | Bacteria | 1462 |
| 927 | nmdc:mga08y16_386841_c1 | 3300050511 | Bacteria | 1433 |
| 928 | nmdc:mga08y16_393975_c1 | 3300050511 | Unclassified | 1418 |
| 929 | nmdc:mga08y16_593354_c1 | 3300050511 | Bacteria | 1117 |
| 930 | nmdc:mga0n895_11438_c1 | 3300050512 | Bacteria | 7918 |
| 931 | nmdc:mga0n895_1146092_c1 | 3300050512 | Unclassified | 753 |
| 932 | nmdc:mga0n895_1185508_c1 | 3300050512 | Bacteria | 738 |
| 933 | nmdc:mga0n895_15605_c1 | 3300050512 | Bacteria | 6934 |
| 934 | nmdc:mga0n895_209296_c1 | 3300050512 | Bacteria | 1981 |
| 935 | nmdc:mga0n895_30447_c1 | 3300050512 | Bacteria | 5158 |
| 936 | nmdc:mga0n895_557555_c1 | 3300050512 | Bacteria | 1151 |
| 937 | nmdc:mga0n895_86135_c1 | 3300050512 | Unclassified | 3138 |
| 938 | nmdc:mga0rr50_1228403_c1 | 3300050513 | Bacteria | 636 |
| 939 | nmdc:mga0rr50_1402536_c1 | 3300050513 | Bacteria | 591 |
| 940 | nmdc:mga0rr50_31096_c1 | 3300050513 | Unclassified | 3787 |
| 941 | nmdc:mga0a205_109389_c1 | 3300050515 | Unclassified | 2662 |
| 942 | nmdc:mga0a205_126209_c1 | 3300050515 | Bacteria | 2459 |
| 943 | nmdc:mga0a205_15464_c1 | 3300050515 | Bacteria | 7133 |
| 944 | nmdc:mga0a205_181455_c1 | 3300050515 | Bacteria | 1999 |
| 945 | nmdc:mga0a205_192_c1 | 3300050515 | Bacteria | 42287 |
| 946 | nmdc:mga0a205_244010_c1 | 3300050515 | Bacteria | 1677 |
| 947 | nmdc:mga0a205_448999_c1 | 3300050515 | Bacteria | 1149 |
| 948 | nmdc:mga0a205_6048_c1 | 3300050515 | Bacteria | 10918 |
| 949 | nmdc:mga0a205_624_c1 | 3300050515 | Bacteria | 28124 |
| 950 | Ga0495601_0516848 | 3300053077 | Bacteria | 770 |
| 951 | Ga0495595_0408104 | 3300053084 | Bacteria | 689 |
| 952 | Ga0495595_0458637 | 3300053084 | Bacteria | 648 |
| 953 | Ga0495619_0463834 | 3300053085 | Unclassified | 873 |
| 954 | Ga0501082_1553029 | 3300060353 | Unclassified | 578 |
| 955 | Ga0466962_0600037 | 3300061719 | Unclassified | 561 |
| 956 | Ga0530510_1146121 | 3300061734 | Bacteria | 596 |
| 957 | Ga0436365_1710174 | |||
| 958 | MBSR1b_contig_2374457 | |||
| 959 | MBSR1b_contig_3238983 | |||
| 960 | ARcpr5yngRDRAFT_c022125 | |||
| 961 | JGI24745J21846_1034316 | |||
| 962 | Ga0065704_10326589 | |||
| 963 | Ga0065712_10496300 | |||
| 964 | Ga0065712_10570198 | |||
| 965 | Ga0065715_10102249 | |||
| 966 | Ga0065715_10369545 | |||
| 967 | Ga0065715_10711949 | |||
| 968 | Ga0065715_10796632 | |||
| 969 | Ga0065715_10812326 | |||
| 970 | Ga0065715_11056152 | |||
| 971 | Ga0065707_10019043 | |||
| 972 | Ga0065707_10299712 | |||
| 973 | Ga0070676_10024796 | |||
| 974 | Ga0070676_10384674 | |||
| 975 | Ga0070676_10448695 | |||
| 976 | Ga0070683_100000012 | |||
| 977 | Ga0070683_100077206 | |||
| 978 | Ga0070683_101919880 | |||
| 979 | Ga0070690_100005077 | |||
| 980 | Ga0070690_100273649 | |||
| 981 | Ga0070670_100973749 | |||
| 982 | Ga0070677_10001801 | |||
| 983 | Ga0070677_10003494 | |||
| 984 | Ga0070677_10443369 | |||
| 985 | Ga0068869_100020157 | |||
| 986 | Ga0068869_100040367 | |||
| 987 | Ga0070666_10007928 | |||
| 988 | Ga0070666_10017201 | |||
| 989 | Ga0070666_10409772 | |||
| 990 | Ga0070666_10551531 | |||
| 991 | Ga0070680_100000822 | |||
| 992 | Ga0068868_100017783 | |||
| 993 | Ga0068868_101096525 | |||
| 994 | Ga0068868_101265445 | |||
| 995 | Ga0068868_101460720 | |||
| 996 | Ga0070660_100071768 | |||
| 997 | Ga0070660_100310474 | |||
| 998 | Ga0070689_100041632 | |||
| 999 | Ga0070689_100167725 | |||
| 1000 | Ga0070689_100217853 | |||
| 1001 | Ga0070691_10723620 | |||
| 1002 | Ga0070687_100005713 | |||
| 1003 | Ga0070687_100376105 | |||
| 1004 | Ga0070687_100384743 | |||
| 1005 | Ga0070687_101039466 | |||
| 1006 | Ga0070687_101171836 | |||
| 1007 | Ga0070661_100072510 | |||
| 1008 | Ga0070692_10341193 | |||
| 1009 | Ga0070668_100156591 | |||
| 1010 | Ga0070668_100201406 | |||
| 1011 | Ga0070668_101900054 | |||
| 1012 | Ga0070669_100002675 | |||
| 1013 | Ga0070669_100086064 | |||
| 1014 | Ga0070669_100143844 | |||
| 1015 | Ga0070669_100322174 | |||
| 1016 | Ga0070669_100323428 | |||
| 1017 | Ga0070669_100527343 | |||
| 1018 | Ga0070669_101157609 | |||
| 1019 | Ga0070675_100001787 | |||
| 1020 | Ga0070675_100006343 | |||
| 1021 | Ga0070675_100058810 | |||
| 1022 | Ga0070675_100133359 | |||
| 1023 | Ga0070675_100144258 | |||
| 1024 | Ga0070671_100035560 | |||
| 1025 | Ga0070671_100073889 | |||
| 1026 | Ga0070671_100250062 | |||
| 1027 | Ga0070674_100000172 | |||
| 1028 | Ga0070674_100023066 | |||
| 1029 | Ga0070674_100033534 | |||
| 1030 | Ga0070674_100064888 | |||
| 1031 | Ga0070674_100184969 | |||
| 1032 | Ga0070674_101139647 | |||
| 1033 | Ga0070673_100047379 | |||
| 1034 | Ga0070688_100001785 | |||
| 1035 | Ga0070688_100467155 | |||
| 1036 | Ga0070688_100989341 | |||
| 1037 | Ga0070659_100015168 | |||
| 1038 | Ga0070659_100100918 | |||
| 1039 | Ga0070659_100142317 | |||
| 1040 | Ga0070659_100171925 | |||
| 1041 | Ga0070667_100036079 | |||
| 1042 | Ga0070667_100706955 | |||
| 1043 | Ga0070667_100885236 | |||
| 1044 | Ga0070667_101221036 | |||
| 1045 | Ga0070667_101933576 | |||
| 1046 | Ga0070703_10051757 | |||
| 1047 | Ga0070714_100010981 | |||
| 1048 | Ga0070714_100227328 | |||
| 1049 | Ga0070713_100062030 | |||
| 1050 | Ga0070713_100114535 | |||
| 1051 | Ga0070713_100123400 | |||
| 1052 | Ga0070713_100149127 | |||
| 1053 | Ga0070713_101134023 | |||
| 1054 | Ga0070710_11350818 | |||
| 1055 | Ga0070701_10040824 | |||
| 1056 | Ga0070701_11070992 | |||
| 1057 | Ga0070711_101295661 | |||
| 1058 | Ga0070711_101717388 | |||
| 1059 | Ga0070705_100195886 | |||
| 1060 | Ga0070694_100031742 | |||
| 1061 | Ga0070694_100680322 | |||
| 1062 | Ga0070694_101750653 | |||
| 1063 | Ga0070708_100011344 | |||
| 1064 | Ga0070708_100778013 | |||
| 1065 | Ga0070708_102194890 | |||
| 1066 | Ga0070663_100219863 | |||
| 1067 | Ga0070678_100473267 | |||
| 1068 | Ga0070678_101252869 | |||
| 1069 | Ga0070662_100029297 | |||
| 1070 | Ga0070662_100257071 | |||
| 1071 | Ga0070662_100348885 | |||
| 1072 | Ga0070662_101030532 | |||
| 1073 | Ga0070681_10016588 | |||
| 1074 | Ga0070681_10190546 | |||
| 1075 | Ga0068867_100045613 | |||
| 1076 | Ga0068867_100065686 | |||
| 1077 | Ga0068867_100100521 | |||
| 1078 | Ga0068867_100142492 | |||
| 1079 | Ga0068867_100196678 | |||
| 1080 | Ga0068867_102263480 | |||
| 1081 | Ga0070685_10041762 | |||
| 1082 | Ga0070685_10160404 | |||
| 1083 | Ga0070707_100044393 | |||
| 1084 | Ga0070707_100478193 | |||
| 1085 | Ga0070698_100085229 | |||
| 1086 | Ga0070698_100394916 | |||
| 1087 | Ga0070698_101557476 | |||
| 1088 | Ga0070699_100002633 | |||
| 1089 | Ga0070699_100066877 | |||
| 1090 | Ga0070699_100614234 | |||
| 1091 | Ga0070679_100077002 | |||
| 1092 | Ga0070679_100387518 | |||
| 1093 | Ga0070679_100421559 | |||
| 1094 | Ga0070679_101184054 | |||
| 1095 | Ga0070679_101290700 | |||
| 1096 | Ga0070679_101319365 | |||
| 1097 | Ga0070684_100000013 | |||
| 1098 | Ga0070684_100308778 | |||
| 1099 | Ga0070684_100655510 | |||
| 1100 | Ga0070684_101731353 | |||
| 1101 | Ga0070697_100199170 | |||
| 1102 | Ga0070697_100643812 | |||
| 1103 | Ga0070672_100001740 | |||
| 1104 | Ga0070672_101524726 | |||
| 1105 | Ga0070686_100004504 | |||
| 1106 | Ga0070686_100534064 | |||
| 1107 | Ga0070686_100977696 | |||
| 1108 | Ga0070686_101092429 | |||
| 1109 | Ga0070695_100011689 | |||
| 1110 | Ga0070695_100080427 | |||
| 1111 | Ga0070695_100510270 | |||
| 1112 | Ga0070695_100760693 | |||
| 1113 | Ga0070695_100774487 | |||
| 1114 | Ga0070696_100166791 | |||
| 1115 | Ga0070696_101992653 | |||
| 1116 | Ga0070693_100150246 | |||
| 1117 | Ga0070693_100206616 | |||
| 1118 | Ga0070665_100017706 | |||
| 1119 | Ga0070665_100017950 | |||
| 1120 | Ga0070665_100095330 | |||
| 1121 | Ga0070665_100604900 | |||
| 1122 | Ga0070665_100987746 | |||
| 1123 | Ga0070665_101578417 | |||
| 1124 | Ga0070665_101609535 | |||
| 1125 | Ga0070704_100607886 | |||
| 1126 | Ga0070704_100958511 | |||
| 1127 | Ga0070704_101402346 | |||
| 1128 | Ga0068855_100004899 | |||
| 1129 | Ga0068855_100022241 | |||
| 1130 | Ga0068855_100078988 | |||
| 1131 | Ga0068855_100250964 | |||
| 1132 | Ga0068855_100519943 | |||
| 1133 | Ga0068855_100704013 | |||
| 1134 | Ga0068855_101460787 | |||
| 1135 | Ga0070664_100005833 | |||
| 1136 | Ga0070664_100301090 | |||
| 1137 | Ga0070664_100945057 | |||
| 1138 | Ga0070664_101202482 | |||
| 1139 | Ga0070664_101970807 | |||
| 1140 | Ga0068857_100004964 | |||
| 1141 | Ga0068857_100132356 | |||
| 1142 | Ga0068857_100293713 | |||
| 1143 | Ga0068857_100628700 | |||
| 1144 | Ga0068857_101094691 | |||
| 1145 | Ga0068857_101369270 | |||
| 1146 | Ga0068857_101464261 | |||
| 1147 | Ga0068856_100009114 | |||
| 1148 | Ga0068856_100011460 | |||
| 1149 | Ga0068856_100119058 | |||
| 1150 | Ga0068852_100006626 | |||
| 1151 | Ga0068852_100201990 | |||
| 1152 | Ga0068852_100570716 | |||
| 1153 | Ga0068852_100600142 | |||
| 1154 | Ga0068859_100012492 | |||
| 1155 | Ga0068859_100078332 | |||
| 1156 | Ga0068859_101235165 | |||
| 1157 | Ga0068859_101258353 | |||
| 1158 | Ga0068859_101994885 | |||
| 1159 | Ga0068859_102142603 | |||
| 1160 | Ga0068859_102233019 | |||
| 1161 | Ga0068859_102317295 | |||
| 1162 | Ga0068864_100049642 | |||
| 1163 | Ga0068864_100121711 | |||
| 1164 | Ga0068864_100143748 | |||
| 1165 | Ga0068864_101158449 | |||
| 1166 | Ga0068864_101363451 | |||
| 1167 | Ga0068864_101388194 | |||
| 1168 | Ga0068864_102147051 | |||
| 1169 | Ga0068866_10741305 | |||
| 1170 | Ga0068866_11290399 | |||
| 1171 | Ga0068861_100537245 | |||
| 1172 | Ga0068870_10000827 | |||
| 1173 | Ga0068870_10095518 | |||
| 1174 | Ga0068863_100002004 | |||
| 1175 | Ga0068863_100027325 | |||
| 1176 | Ga0068863_100164198 | |||
| 1177 | Ga0068863_100590979 | |||
| 1178 | Ga0068863_100730569 | |||
| 1179 | Ga0068863_100915141 | |||
| 1180 | Ga0068863_101155878 | |||
| 1181 | Ga0068858_100016775 | |||
| 1182 | Ga0068858_100126947 | |||
| 1183 | Ga0068858_100325421 | |||
| 1184 | Ga0068858_100338839 | |||
| 1185 | Ga0068858_100487223 | |||
| 1186 | Ga0068858_100698525 | |||
| 1187 | Ga0068860_100025560 | |||
| 1188 | Ga0068860_100119167 | |||
| 1189 | Ga0068860_100359615 | |||
| 1190 | Ga0068862_100008067 | |||
| 1191 | Ga0068862_100668799 | |||
| 1192 | Ga0068862_101443508 | |||
| 1193 | Ga0068862_101774069 | |||
| 1194 | Ga0081455_10015552 | |||
| 1195 | Ga0081455_10925982 | |||
| 1196 | Ga0081539_10049033 | |||
| 1197 | Ga0081539_10053598 | |||
| 1198 | Ga0081539_10095259 | |||
| 1199 | Ga0070717_10029188 | |||
| 1200 | Ga0070717_10045836 | |||
| 1201 | Ga0070717_10458649 | |||
| 1202 | Ga0075432_10242619 | |||
| 1203 | Ga0070716_101487428 | |||
| 1204 | Ga0097621_100018641 | |||
| 1205 | Ga0097621_100080294 | |||
| 1206 | Ga0097621_100236242 | |||
| 1207 | Ga0097621_100247816 | |||
| 1208 | Ga0097621_100375911 | |||
| 1209 | Ga0068871_100068995 | |||
| 1210 | Ga0068871_100389538 | |||
| 1211 | Ga0068871_100448384 | |||
| 1212 | Ga0068871_100600641 | |||
| 1213 | Ga0068871_101829120 | |||
| 1214 | Ga0075428_100009050 | |||
| 1215 | Ga0075428_100057339 | |||
| 1216 | Ga0075428_100161532 | |||
| 1217 | Ga0075428_100188377 | |||
| 1218 | Ga0075428_101991043 | |||
| 1219 | Ga0075430_100015272 | |||
| 1220 | Ga0075430_100036082 | |||
| 1221 | Ga0075430_100177309 | |||
| 1222 | Ga0075430_100466097 | |||
| 1223 | Ga0075430_100640283 | |||
| 1224 | Ga0075431_100024630 | |||
| 1225 | Ga0075431_100046174 | |||
| 1226 | Ga0075431_100107620 | |||
| 1227 | Ga0075431_100155137 | |||
| 1228 | Ga0075431_100752888 | |||
| 1229 | Ga0075431_100891114 | |||
| 1230 | Ga0075431_100938259 | |||
| 1231 | Ga0075431_101790535 | |||
| 1232 | Ga0075431_102203713 | |||
| 1233 | Ga0075431_102217907 | |||
| 1234 | Ga0075433_10000346 | |||
| 1235 | Ga0075433_10005849 | |||
| 1236 | Ga0075433_10007651 | |||
| 1237 | Ga0075433_10081808 | |||
| 1238 | Ga0075433_10232463 | |||
| 1239 | Ga0075433_10306734 | |||
| 1240 | Ga0075433_10330384 | |||
| 1241 | Ga0075433_10447439 | |||
| 1242 | Ga0075433_11448959 | |||
| 1243 | Ga0075434_100006772 | |||
| 1244 | Ga0075434_100011872 | |||
| 1245 | Ga0075434_100028945 | |||
| 1246 | Ga0075434_100032810 | |||
| 1247 | Ga0075434_100064092 | |||
| 1248 | Ga0075434_102204051 | |||
| 1249 | Ga0075429_100214494 | |||
| 1250 | Ga0075429_100274571 | |||
| 1251 | Ga0075429_101376659 | |||
| 1252 | Ga0075429_101379937 | |||
| 1253 | Ga0068865_100045749 | |||
| 1254 | Ga0068865_100061622 | |||
| 1255 | Ga0068865_100469833 | |||
| 1256 | Ga0068865_100630593 | |||
| 1257 | Ga0068865_101074537 | |||
| 1258 | Ga0068865_101086330 | |||
| 1259 | Ga0075436_101126946 | |||
| 1260 | Ga0097620_100012492 | |||
| 1261 | Ga0097620_100078328 | |||
| 1262 | Ga0097620_101235263 | |||
| 1263 | Ga0097620_101258099 | |||
| 1264 | Ga0097620_101994922 | |||
| 1265 | Ga0097620_102142408 | |||
| 1266 | Ga0097620_102233349 | |||
| 1267 | Ga0097620_102316199 | |||
| 1268 | Ga0075435_100021977 | |||
| 1269 | Ga0075435_100039064 | |||
| 1270 | Ga0099794_10427793 | |||
| 1271 | Ga0105240_10009440 | |||
| 1272 | Ga0105240_10017856 | |||
| 1273 | Ga0105240_10017899 | |||
| 1274 | Ga0105240_10025280 | |||
| 1275 | Ga0105240_10110658 | |||
| 1276 | Ga0105240_10246699 | |||
| 1277 | Ga0105240_10253765 | |||
| 1278 | Ga0105240_10584004 | |||
| 1279 | Ga0111539_10001233 | |||
| 1280 | Ga0111539_10022643 | |||
| 1281 | Ga0111539_10287498 | |||
| 1282 | Ga0111539_10476455 | |||
| 1283 | Ga0111539_10581396 | |||
| 1284 | Ga0111539_10773869 | |||
| 1285 | Ga0111539_13096418 | |||
| 1286 | Ga0105245_10002014 | |||
| 1287 | Ga0105245_10002505 | |||
| 1288 | Ga0105245_10009708 | |||
| 1289 | Ga0105245_10289552 | |||
| 1290 | Ga0105245_10568617 | |||
| 1291 | Ga0105245_11047100 | |||
| 1292 | Ga0105245_12266193 | |||
| 1293 | Ga0105247_10013117 | |||
| 1294 | Ga0114129_10000872 | |||
| 1295 | Ga0114129_10006410 | |||
| 1296 | Ga0114129_10011701 | |||
| 1297 | Ga0114129_10013537 | |||
| 1298 | Ga0114129_10071421 | |||
| 1299 | Ga0114129_10078548 | |||
| 1300 | Ga0114129_10262787 | |||
| 1301 | Ga0114129_10380504 | |||
| 1302 | Ga0114129_11089316 | |||
| 1303 | Ga0114129_11232204 | |||
| 1304 | Ga0114129_11728419 | |||
| 1305 | Ga0114129_12384782 | |||
| 1306 | Ga0105243_11490730 | |||
| 1307 | Ga0105243_11819062 | |||
| 1308 | Ga0105241_10170106 | |||
| 1309 | Ga0105241_10568657 | |||
| 1310 | Ga0105241_10779179 | |||
| 1311 | Ga0105241_11200613 | |||
| 1312 | Ga0105241_12571931 | |||
| 1313 | Ga0105242_10011639 | |||
| 1314 | Ga0105242_10351971 | |||
| 1315 | Ga0105242_11565913 | |||
| 1316 | Ga0105242_12413055 | |||
| 1317 | Ga0105242_13236372 | |||
| 1318 | Ga0105242_13258348 | |||
| 1319 | Ga0105248_10002325 | |||
| 1320 | Ga0105248_10031048 | |||
| 1321 | Ga0105248_10039057 | |||
| 1322 | Ga0105248_10075883 | |||
| 1323 | Ga0105248_10243843 | |||
| 1324 | Ga0105248_10360238 | |||
| 1325 | Ga0105248_10842328 | |||
| 1326 | Ga0105248_10935760 | |||
| 1327 | Ga0105248_11155085 | |||
| 1328 | Ga0105237_10004243 | |||
| 1329 | Ga0105237_10009915 | |||
| 1330 | Ga0105237_10101389 | |||
| 1331 | Ga0105237_11321262 | |||
| 1332 | Ga0105238_10007616 | |||
| 1333 | Ga0105238_10043000 | |||
| 1334 | Ga0105238_10182192 | |||
| 1335 | Ga0105238_10287111 | |||
| 1336 | Ga0105238_12480677 | |||
| 1337 | Ga0105238_12884539 | |||
| 1338 | Ga0105249_10012319 | |||
| 1339 | Ga0105249_10115048 | |||
| 1340 | Ga0105249_10148147 | |||
| 1341 | Ga0105249_10260838 | |||
| 1342 | Ga0105249_10526142 | |||
| 1343 | Ga0105249_10670162 | |||
| 1344 | Ga0105249_11677985 | |||
| 1345 | Ga0105249_11741741 | |||
| 1346 | Ga0105249_13419119 | |||
| 1347 | Ga0099796_10290507 | |||
| 1348 | Ga0105239_10018004 | |||
| 1349 | Ga0105239_10350431 | |||
| 1350 | Ga0105239_11071634 | |||
| 1351 | Ga0105239_12117699 | |||
| 1352 | Ga0105246_10005035 | |||
| 1353 | Ga0105246_10085041 | |||
| 1354 | Ga0105246_10193560 | |||
| 1355 | Ga0105246_10505814 | |||
| 1356 | Ga0105246_10933485 | |||
| 1357 | Ga0157373_10708319 | |||
| 1358 | Ga0157371_10091446 | |||
| 1359 | Ga0157370_10002587 | |||
| 1360 | Ga0157370_10002772 | |||
| 1361 | Ga0157370_10178721 | |||
| 1362 | Ga0157370_10241430 | |||
| 1363 | Ga0157370_10292415 | |||
| 1364 | Ga0157370_11028913 | |||
| 1365 | Ga0157369_10004043 | |||
| 1366 | Ga0157369_10004682 | |||
| 1367 | Ga0157369_10048017 | |||
| 1368 | Ga0157369_10083429 | |||
| 1369 | Ga0157369_10114496 | |||
| 1370 | Ga0157369_10791071 | |||
| 1371 | Ga0157374_10042798 | |||
| 1372 | Ga0157374_10072225 | |||
| 1373 | Ga0157374_10705491 | |||
| 1374 | Ga0157378_10004146 | |||
| 1375 | Ga0157378_10030115 | |||
| 1376 | Ga0157378_10393345 | |||
| 1377 | Ga0163162_10016275 | |||
| 1378 | Ga0163162_10508575 | |||
| 1379 | Ga0163162_11019159 | |||
| 1380 | Ga0163162_11352922 | |||
| 1381 | Ga0163162_11401254 | |||
| 1382 | Ga0163162_12869985 | |||
| 1383 | Ga0157372_10040352 | |||
| 1384 | Ga0157372_10062279 | |||
| 1385 | Ga0157372_10075704 | |||
| 1386 | Ga0157372_10363691 | |||
| 1387 | Ga0157372_10405661 | |||
| 1388 | Ga0157372_10424329 | |||
| 1389 | Ga0157375_10001615 | |||
| 1390 | Ga0157375_10136128 | |||
| 1391 | Ga0157375_10820903 | |||
| 1392 | Ga0157375_10910029 | |||
| 1393 | Ga0157375_12447577 | |||
| 1394 | Ga0157375_13691749 | |||
| 1395 | Ga0163163_10160418 | |||
| 1396 | Ga0163163_10509583 | |||
| 1397 | Ga0163163_10608914 | |||
| 1398 | Ga0163163_10721808 | |||
| 1399 | Ga0157380_10016775 | |||
| 1400 | Ga0157380_10045075 | |||
| 1401 | Ga0157380_10049039 | |||
| 1402 | Ga0157380_10101478 | |||
| 1403 | Ga0157377_10154344 | |||
| 1404 | Ga0157377_10356874 | |||
| 1405 | Ga0157379_10061437 | |||
| 1406 | Ga0157379_10466823 | |||
| 1407 | Ga0157379_10840991 | |||
| 1408 | Ga0157379_11481065 | |||
| 1409 | Ga0157376_10043035 | |||
| 1410 | Ga0157376_10692646 | |||
| 1411 | Ga0157376_10775373 | |||
| 1412 | Ga0157376_11108659 | |||
| 1413 | Ga0157376_11156925 | |||
| 1414 | Ga0163161_10336548 | |||
| 1415 | Ga0163161_10623920 | |||
| 1416 | Ga0163161_10675987 | |||
| 1417 | Ga0163161_10756462 | |||
| 1418 | Ga0197907_10297313 | |||
| 1419 | Ga0213873_10300292 | |||
| 1420 | Ga0213874_10020315 | |||
| 1421 | Ga0213874_10039399 | |||
| 1422 | Ga0213876_10111686 | |||
| 1423 | Ga0213876_10150618 | |||
| 1424 | Ga0213875_10000008 | |||
| 1425 | Ga0213875_10000088 | |||
| 1426 | Ga0213875_10041295 | |||
| 1427 | Ga0213875_10044896 | |||
| 1428 | Ga0213875_10049259 | |||
| 1429 | Ga0213875_10118805 | |||
| 1430 | Ga0213875_10356341 | |||
| 1431 | Ga0207697_10002108 | |||
| 1432 | Ga0207653_10194715 | |||
| 1433 | Ga0207653_10431281 | |||
| 1434 | Ga0207682_10001721 | |||
| 1435 | Ga0207682_10019081 | |||
| 1436 | Ga0207682_10326483 | |||
| 1437 | Ga0207692_10892980 | |||
| 1438 | Ga0207642_10352210 | |||
| 1439 | Ga0207642_10617997 | |||
| 1440 | Ga0207688_10010146 | |||
| 1441 | Ga0207688_10155824 | |||
| 1442 | Ga0207680_10051516 | |||
| 1443 | Ga0207680_10137549 | |||
| 1444 | Ga0207680_10682436 | |||
| 1445 | Ga0207647_10121883 | |||
| 1446 | Ga0207699_10802207 | |||
| 1447 | Ga0207645_10016931 | |||
| 1448 | Ga0207645_10029523 | |||
| 1449 | Ga0207643_10000158 | |||
| 1450 | Ga0207684_11419234 | |||
| 1451 | Ga0207654_10115834 | |||
| 1452 | Ga0207654_10305737 | |||
| 1453 | Ga0207654_10488975 | |||
| 1454 | Ga0207707_10274480 | |||
| 1455 | Ga0207707_10398116 | |||
| 1456 | Ga0207707_11363171 | |||
| 1457 | Ga0207695_10002722 | |||
| 1458 | Ga0207695_10006239 | |||
| 1459 | Ga0207695_10061336 | |||
| 1460 | Ga0207695_10238194 | |||
| 1461 | Ga0207695_10275376 | |||
| 1462 | Ga0207695_10688839 | |||
| 1463 | Ga0207695_10711079 | |||
| 1464 | Ga0207695_10898420 | |||
| 1465 | Ga0207695_11573272 | |||
| 1466 | Ga0207671_10023090 | |||
| 1467 | Ga0207671_10172656 | |||
| 1468 | Ga0207671_10725728 | |||
| 1469 | Ga0207693_10574083 | |||
| 1470 | Ga0207663_10172177 | |||
| 1471 | Ga0207663_10468819 | |||
| 1472 | Ga0207660_10001537 | |||
| 1473 | Ga0207660_10294164 | |||
| 1474 | Ga0207662_10006624 | |||
| 1475 | Ga0207662_10222802 | |||
| 1476 | Ga0207657_10148823 | |||
| 1477 | Ga0207657_10259544 | |||
| 1478 | Ga0207649_10028909 | |||
| 1479 | Ga0207652_10056026 | |||
| 1480 | Ga0207652_10312234 | |||
| 1481 | Ga0207652_11179297 | |||
| 1482 | Ga0207652_11704479 | |||
| 1483 | Ga0207646_10119769 | |||
| 1484 | Ga0207646_11154959 | |||
| 1485 | Ga0207681_10107503 | |||
| 1486 | Ga0207681_10159670 | |||
| 1487 | Ga0207681_11163979 | |||
| 1488 | Ga0207694_10006271 | |||
| 1489 | Ga0207694_10011679 | |||
| 1490 | Ga0207694_10012169 | |||
| 1491 | Ga0207694_10244938 | |||
| 1492 | Ga0207694_10551619 | |||
| 1493 | Ga0207650_11673695 | |||
| 1494 | Ga0207659_10002688 | |||
| 1495 | Ga0207659_10005321 | |||
| 1496 | Ga0207659_10021596 | |||
| 1497 | Ga0207659_10056372 | |||
| 1498 | Ga0207659_10178586 | |||
| 1499 | Ga0207687_10001770 | |||
| 1500 | Ga0207687_10006219 | |||
| 1501 | Ga0207687_10008662 | |||
| 1502 | Ga0207687_10394933 | |||
| 1503 | Ga0207687_10762750 | |||
| 1504 | Ga0207700_10048966 | |||
| 1505 | Ga0207700_10101665 | |||
| 1506 | Ga0207700_10132761 | |||
| 1507 | Ga0207700_10316516 | |||
| 1508 | Ga0207664_10083195 | |||
| 1509 | Ga0207664_10338160 | |||
| 1510 | Ga0207664_11100935 | |||
| 1511 | Ga0207644_10371008 | |||
| 1512 | Ga0207644_10783243 | |||
| 1513 | Ga0207690_10089869 | |||
| 1514 | Ga0207690_10389921 | |||
| 1515 | Ga0207690_10448122 | |||
| 1516 | Ga0207706_10005297 | |||
| 1517 | Ga0207706_10139231 | |||
| 1518 | Ga0207706_10702969 | |||
| 1519 | Ga0207706_10842530 | |||
| 1520 | Ga0207686_10092629 | |||
| 1521 | Ga0207686_10629332 | |||
| 1522 | Ga0207686_11030020 | |||
| 1523 | Ga0207709_11504096 | |||
| 1524 | Ga0207670_10066315 | |||
| 1525 | Ga0207670_10091516 | |||
| 1526 | Ga0207670_10950897 | |||
| 1527 | Ga0207669_10000320 | |||
| 1528 | Ga0207669_10018836 | |||
| 1529 | Ga0207669_10194243 | |||
| 1530 | Ga0207669_10363627 | |||
| 1531 | Ga0207669_10480342 | |||
| 1532 | Ga0207704_10375752 | |||
| 1533 | Ga0207704_10477397 | |||
| 1534 | Ga0207704_10813465 | |||
| 1535 | Ga0207704_11370728 | |||
| 1536 | Ga0207665_11442112 | |||
| 1537 | Ga0207691_10009994 | |||
| 1538 | Ga0207691_11358431 | |||
| 1539 | Ga0207691_11470921 | |||
| 1540 | Ga0207711_10001367 | |||
| 1541 | Ga0207711_10249930 | |||
| 1542 | Ga0207711_10257693 | |||
| 1543 | Ga0207711_10559401 | |||
| 1544 | Ga0207711_10755618 | |||
| 1545 | Ga0207689_10004173 | |||
| 1546 | Ga0207689_10031190 | |||
| 1547 | Ga0207689_10184716 | |||
| 1548 | Ga0207689_11350153 | |||
| 1549 | Ga0207661_10000034 | |||
| 1550 | Ga0207661_10032874 | |||
| 1551 | Ga0207661_10489924 | |||
| 1552 | Ga0207679_10003829 | |||
| 1553 | Ga0207679_10224252 | |||
| 1554 | Ga0207679_10527864 | |||
| 1555 | Ga0207679_11269185 | |||
| 1556 | Ga0207679_11461844 | |||
| 1557 | Ga0207679_11696962 | |||
| 1558 | Ga0207679_11822490 | |||
| 1559 | Ga0207667_10014002 | |||
| 1560 | Ga0207667_10039277 | |||
| 1561 | Ga0207667_10464551 | |||
| 1562 | Ga0207667_10543877 | |||
| 1563 | Ga0207667_10971523 | |||
| 1564 | Ga0207651_10046980 | |||
| 1565 | Ga0207712_10062750 | |||
| 1566 | Ga0207712_10063516 | |||
| 1567 | Ga0207712_10067020 | |||
| 1568 | Ga0207668_11414509 | |||
| 1569 | Ga0207658_10055402 | |||
| 1570 | Ga0207658_10934832 | |||
| 1571 | Ga0207677_10351395 | |||
| 1572 | Ga0207677_10509703 | |||
| 1573 | Ga0207677_10819647 | |||
| 1574 | Ga0207703_10208405 | |||
| 1575 | Ga0207703_10295250 | |||
| 1576 | Ga0207703_10688740 | |||
| 1577 | Ga0207639_10370799 | |||
| 1578 | Ga0207639_11753531 | |||
| 1579 | Ga0207678_10159415 | |||
| 1580 | Ga0207678_10251107 | |||
| 1581 | Ga0207678_11520129 | |||
| 1582 | Ga0207678_11585622 | |||
| 1583 | Ga0207708_11754702 | |||
| 1584 | Ga0207702_10009873 | |||
| 1585 | Ga0207702_10099839 | |||
| 1586 | Ga0207702_10196012 | |||
| 1587 | Ga0207702_11139817 | |||
| 1588 | Ga0207641_10025118 | |||
| 1589 | Ga0207641_10075997 | |||
| 1590 | Ga0207641_10339680 | |||
| 1591 | Ga0207648_10021097 | |||
| 1592 | Ga0207648_10067339 | |||
| 1593 | Ga0207648_10176992 | |||
| 1594 | Ga0207648_10403549 | |||
| 1595 | Ga0207648_10453314 | |||
| 1596 | Ga0207648_10778467 | |||
| 1597 | Ga0207676_10107414 | |||
| 1598 | Ga0207676_10508702 | |||
| 1599 | Ga0207676_10956100 | |||
| 1600 | Ga0207676_11515391 | |||
| 1601 | Ga0207674_10013841 | |||
| 1602 | Ga0207674_10147960 | |||
| 1603 | Ga0207674_10537201 | |||
| 1604 | Ga0207674_10606827 | |||
| 1605 | Ga0207674_10668245 | |||
| 1606 | Ga0207675_100029718 | |||
| 1607 | Ga0207675_100426275 | |||
| 1608 | Ga0207683_10000925 | |||
| 1609 | Ga0207683_10110895 | |||
| 1610 | Ga0207683_10501605 | |||
| 1611 | Ga0207698_10033565 | |||
| 1612 | Ga0207698_10928244 | |||
| 1613 | Ga0207698_11565093 | |||
| 1614 | Ga0207428_10001518 | |||
| 1615 | Ga0207428_10002065 | |||
| 1616 | Ga0207428_10528397 | |||
| 1617 | Ga0207428_10777687 | |||
| 1618 | Ga0268266_10069504 | |||
| 1619 | Ga0268266_10540497 | |||
| 1620 | Ga0268266_10554587 | |||
| 1621 | Ga0268266_12316798 | |||
| 1622 | Ga0268265_10011411 | |||
| 1623 | Ga0268265_10269833 | |||
| 1624 | Ga0268265_10671428 | |||
| 1625 | Ga0268264_10079301 | |||
| 1626 | Ga0268264_10139958 | |||
| 1627 | Ga0265323_10005006 | |||
| 1628 | Ga0265330_10184550 | |||
| 1629 | Ga0265332_10106897 | |||
| 1630 | Ga0265328_10465931 | |||
| 1631 | Ga0265325_10367172 | |||
| 1632 | Ga0265340_10032541 | |||
| 1633 | Ga0265316_10001914 | |||
| 1634 | Ga0265316_10028222 | |||
| 1635 | Ga0307408_100161333 | |||
| 1636 | Ga0265313_10007334 | |||
| 1637 | Ga0265314_10000776 | |||
| 1638 | Ga0265314_10011058 | |||
| 1639 | Ga0307412_12329803 | |||
| 1640 | Ga0307409_102756694 | |||
| 1641 | Ga0307416_100328758 | |||
| 1642 | Ga0307416_101754649 | |||
| 1643 | Ga0307416_102879660 | |||
| 1644 | Ga0307411_10397072 | |||
| 1645 | Ga0373958_0021245 | |||
| 1646 | Ga0373934_0000774 | |||
| 1647 | Ga0373934_0140077 | |||
| 1648 | Ga0373934_0211441 | |||
| 1649 | Ga0373944_0189288 | |||
| 1650 | Ga0373944_0272110 | |||
| 1651 | Ga0373939_0004091 | |||
| 1652 | Ga0373953_0295905 | |||
| 1653 | Ga0373954_0001092 | |||
| 1654 | Ga0373954_0364941 | |||
| 1655 | Ga0373954_0498346 | |||
| 1656 | Ga0373956_0046850 | |||
| 1657 | Ga0373956_0281115 | |||
| 1658 | Ga0373956_0511122 | |||
| 1659 | Ga0373957_0016513 | |||
| 1660 | Ga0373957_0127705 | |||
| 1661 | Ga0373957_0240987 | |||
| 1662 | Ga0373957_0455455 | |||
| 1663 | Ga0373943_0174658 | |||
| 1664 | Ga0373955_0339260 | |||
| 1665 | Ga0373955_0809177 | |||
| 1666 | Ga0373961_0378758 | |||
| 1667 | Ga0373962_0124166 | |||
| 1668 | Ga0373931_0714899 | |||
| 1669 | Ga0373935_0327163 | |||
| 1670 | Ga0373935_0582452 | |||
| 1671 | Ga0373933_0132902 | |||
| 1672 | Ga0373933_0830147 | |||
| 1673 | Ga0373933_1143320 | |||
| 1674 | Ga0373947_0171519 | |||
| 1675 | Ga0373947_0402834 | |||
| 1676 | Ga0373937_0003513 | |||
| 1677 | Ga0373937_0065954 | |||
| 1678 | Ga0373937_0159751 | |||
| 1679 | Ga0373937_0166851 | |||
| 1680 | Ga0373937_0218205 | |||
| 1681 | Ga0373937_0612321 | |||
| 1682 | Ga0373937_0638915 | |||
| 1683 | Ga0373925_0017088 | |||
| 1684 | Ga0373925_0221379 | |||
| 1685 | Ga0395905_0869232 | |||
| 1686 | Ga0436364_0091827 | |||
| 1687 | Ga0436364_0117819 | |||
| 1688 | Ga0436364_0154123 | |||
| 1689 | Ga0436364_0278774 | |||
| 1690 | Ga0436364_0466454 | |||
| 1691 | Ga0436364_0511894 | |||
| 1692 | Ga0436364_0562228 | |||
| 1693 | Ga0436364_0568781 | |||
| 1694 | Ga0436364_0613877 | |||
| 1695 | Ga0436364_0772554 | |||
| 1696 | Ga0436364_0938901 | |||
| 1697 | Ga0436364_0993293 | |||
| 1698 | Ga0436364_1172528 | |||
| 1699 | Ga0436364_1415525 | |||
| 1700 | Ga0436364_1527124 | |||
| 1701 | Ga0436365_0405905 | |||
| 1702 | Ga0436365_0480035 | |||
| 1703 | Ga0436365_0712875 | |||
| 1704 | Ga0436365_1270184 | |||
| 1705 | Ga0436365_1884243 | |||
| 1706 | Ga0436361_0981129 | |||
| 1707 | Ga0436363_0689488 | |||
| 1708 | Ga0436363_0933554 | |||
| 1709 | Ga0436363_1135331 | |||
| 1710 | Ga0436363_1279168 | |||
| 1711 | Ga0436363_1416554 | |||
| 1712 | Ga0436362_0443984 | |||
| 1713 | Ga0436362_0973259 | |||
| 1714 | Ga0436362_1036551 | |||
| 1715 | Ga0436362_1143208 | |||
| 1716 | Ga0436362_1150066 | |||
| 1717 | Ga0436362_1152312 | |||
| 1718 | Ga0439448_0203172 | |||
| 1719 | Ga0439435_0160655 | |||
| 1720 | Ga0439435_0222787 | |||
| 1721 | Ga0451577_0247707 | |||
| 1722 | Ga0439440_0075149 | |||
| 1723 | Ga0453683_0573410 | |||
| 1724 | Ga0466963_0419954 | |||
| 1725 | Ga0466963_0533307 | |||
| 1726 | Ga0466963_1196980 | |||
| 1727 | Ga0453684_0424423 | |||
| 1728 | Ga0466971_0334253 | |||
| 1729 | Ga0466957_0682033 | |||
| 1730 | Ga0466959_0241055 | |||
| 1731 | Ga0451576_0030246 | |||
| 1732 | Ga0451576_0261331 | |||
| 1733 | Ga0451576_0352679 | |||
| 1734 | Ga0451576_2727057 | |||
| 1735 | Ga0466958_0269285 | |||
| 1736 | Ga0466967_0048424 | |||
| 1737 | Ga0466967_0441551 | |||
| 1738 | Ga0495592_0011489 | |||
| 1739 | Ga0495592_0029591 | |||
| 1740 | Ga0495629_0272274 | |||
| 1741 | Ga0495629_0307522 | |||
| 1742 | Ga0495651_0046187 | |||
| 1743 | Ga0495651_0125666 | |||
| 1744 | Ga0495651_0159035 | |||
| 1745 | Ga0495580_0073881 | |||
| 1746 | Ga0495580_0094921 | |||
| 1747 | Ga0495582_0035912 | |||
| 1748 | Ga0495582_0493655 | |||
| 1749 | Ga0495639_0077830 | |||
| 1750 | Ga0495639_0475911 | |||
| 1751 | Ga0495662_0013564 | |||
| 1752 | Ga0495662_0016769 | |||
| 1753 | Ga0495662_0072248 | |||
| 1754 | Ga0495662_0442257 | |||
| 1755 | Ga0495664_0119884 | |||
| 1756 | Ga0495608_0419502 | |||
| 1757 | Ga0495618_0156689 | |||
| 1758 | Ga0495628_0302442 | |||
| 1759 | Ga0495628_0344477 | |||
| 1760 | Ga0495630_0115514 | |||
| 1761 | Ga0495643_0004442 | |||
| 1762 | Ga0495666_0079097 | |||
| 1763 | Ga0495652_0049094 | |||
| 1764 | Ga0495652_0078174 | |||
| 1765 | Ga0495652_0533403 | |||
| 1766 | Ga0495652_0817851 | |||
| 1767 | Ga0495665_0306510 | |||
| 1768 | Ga0495640_0354609 | |||
| 1769 | Ga0495586_0249373 | |||
| 1770 | Ga0495586_0406781 | |||
| 1771 | Ga0495587_0002501 | |||
| 1772 | Ga0495587_0028881 | |||
| 1773 | Ga0495587_0029449 | |||
| 1774 | Ga0495587_0153034 | |||
| 1775 | Ga0495587_0364005 | |||
| 1776 | Ga0495621_0366035 | |||
| 1777 | Ga0495645_0038006 | |||
| 1778 | Ga0495645_0139250 | |||
| 1779 | Ga0495645_0141767 | |||
| 1780 | Ga0495656_0532165 | |||
| 1781 | Ga0495634_0140727 | |||
| 1782 | Ga0495635_0028305 | |||
| 1783 | Ga0495635_0406721 | |||
| 1784 | Ga0495659_0155993 | |||
| 1785 | Ga0495588_0094919 | |||
| 1786 | Ga0495657_0573808 | |||
| 1787 | Ga0495599_0028672 | |||
| 1788 | Ga0495599_0173872 | |||
| 1789 | Ga0495623_0096106 | |||
| 1790 | Ga0495623_0165210 | |||
| 1791 | Ga0495623_0259803 | |||
| 1792 | Ga0495623_0470720 | |||
| 1793 | Ga0495646_0179104 | |||
| 1794 | Ga0495669_0069932 | |||
| 1795 | Ga0495669_0380802 | |||
| 1796 | Ga0495613_0366714 | |||
| 1797 | Ga0495613_0875830 | |||
| 1798 | Ga0495624_0350189 | |||
| 1799 | Ga0495624_0641861 | |||
| 1800 | Ga0495600_0157640 | |||
| 1801 | Ga0495600_0406791 | |||
| 1802 | Ga0495600_0572310 | |||
| 1803 | Ga0495604_0226022 | |||
| 1804 | Ga0495674_0055646 | |||
| 1805 | Ga0495674_0082062 | |||
| 1806 | Ga0495674_0131256 | |||
| 1807 | Ga0495674_0898823 | |||
| 1808 | Ga0495674_1055307 | |||
| 1809 | Ga0495680_0052926 | |||
| 1810 | Ga0495675_0132536 | |||
| 1811 | Ga0495675_0734086 | |||
| 1812 | Ga0495684_0004503 | |||
| 1813 | Ga0495684_0011009 | |||
| 1814 | Ga0495684_0020716 | |||
| 1815 | Ga0495684_0208524 | |||
| 1816 | Ga0495684_0857248 | |||
| 1817 | Ga0495602_0064130 | |||
| 1818 | Ga0495602_0831201 | |||
| 1819 | Ga0495602_0953728 | |||
| 1820 | Ga0495602_0995126 | |||
| 1821 | Ga0496100_0147667 | |||
| 1822 | Ga0496100_0725046 | |||
| 1823 | Ga0496102_0011172 | |||
| 1824 | Ga0496102_0585346 | |||
| 1825 | Ga0496103_0038977 | |||
| 1826 | Ga0496105_0080000 | |||
| 1827 | Ga0496105_0405126 | |||
| 1828 | Ga0496106_0074772 | |||
| 1829 | Ga0496106_1333394 | |||
| 1830 | Ga0496108_0391429 | |||
| 1831 | Ga0496109_0242075 | |||
| 1832 | Ga0496109_0502959 | |||
| 1833 | Ga0496110_0042864 | |||
| 1834 | Ga0496111_0811363 | |||
| 1835 | Ga0496112_0012842 | |||
| 1836 | Ga0496112_0072712 | |||
| 1837 | Ga0496112_0400872 | |||
| 1838 | Ga0496113_0022458 | |||
| 1839 | Ga0496113_0227868 | |||
| 1840 | Ga0496113_0529324 | |||
| 1841 | Ga0496114_0419023 | |||
| 1842 | Ga0496115_0670197 | |||
| 1843 | Ga0496126_0300270 | |||
| 1844 | Ga0501299_051150 | |||
| 1845 | Ga0501047_0227312 | |||
| 1846 | Ga0501067_0431079 | |||
| 1847 | Ga0501070_0042003 | |||
| 1848 | Ga0501071_1308551 | |||
| 1849 | Ga0501080_1659463 | |||
| 1850 | Ga0501083_0512226 | |||
| 1851 | Ga0501264_036586 | |||
| 1852 | Ga0501279_039961 | |||
| 1853 | Ga0501035_0150616 | |||
| 1854 | Ga0501044_0023985 | |||
| 1855 | Ga0501045_0257635 | |||
| 1856 | Ga0501045_0381204 | |||
| 1857 | nmdc:mga05p37_293167_c1 | |||
| 1858 | nmdc:mga05p37_29338_c1 | |||
| 1859 | nmdc:mga05p37_348324_c1 | |||
| 1860 | nmdc:mga05p37_67576_c1 | |||
| 1861 | nmdc:mga05p37_71966_c1 | |||
| 1862 | nmdc:mga09592_1068608_c1 | |||
| 1863 | nmdc:mga09592_184018_c1 | |||
| 1864 | nmdc:mga09592_226088_c1 | |||
| 1865 | nmdc:mga09592_871590_c1 | |||
| 1866 | nmdc:mga09592_980529_c1 | |||
| 1867 | nmdc:mga0qj67_115272_c1 | |||
| 1868 | nmdc:mga0qj67_153987_c1 | |||
| 1869 | nmdc:mga0qj67_727061_c1 | |||
| 1870 | nmdc:mga0qj67_85525_c1 | |||
| 1871 | nmdc:mga0qj67_9852_c1 | |||
| 1872 | nmdc:mga06r32_1055679_c1 | |||
| 1873 | nmdc:mga06r32_1092362_c1 | |||
| 1874 | nmdc:mga06r32_1094333_c1 | |||
| 1875 | nmdc:mga06r32_156877_c1 | |||
| 1876 | nmdc:mga06r32_26374_c2 | |||
| 1877 | nmdc:mga06r32_44265_c1 | |||
| 1878 | nmdc:mga06r32_918802_c1 | |||
| 1879 | nmdc:mga08y16_1626342_c1 | |||
| 1880 | nmdc:mga08y16_27959_c1 | |||
| 1881 | nmdc:mga08y16_2818_c1 | |||
| 1882 | nmdc:mga08y16_373574_c1 | |||
| 1883 | nmdc:mga08y16_386841_c1 | |||
| 1884 | nmdc:mga08y16_393975_c1 | |||
| 1885 | nmdc:mga08y16_593354_c1 | |||
| 1886 | nmdc:mga0n895_11438_c1 | |||
| 1887 | nmdc:mga0n895_1146092_c1 | |||
| 1888 | nmdc:mga0n895_1185508_c1 | |||
| 1889 | nmdc:mga0n895_15605_c1 | |||
| 1890 | nmdc:mga0n895_209296_c1 | |||
| 1891 | nmdc:mga0n895_30447_c1 | |||
| 1892 | nmdc:mga0n895_557555_c1 | |||
| 1893 | nmdc:mga0n895_86135_c1 | |||
| 1894 | nmdc:mga0rr50_1228403_c1 | |||
| 1895 | nmdc:mga0rr50_1402536_c1 | |||
| 1896 | nmdc:mga0rr50_31096_c1 | |||
| 1897 | nmdc:mga0a205_109389_c1 | |||
| 1898 | nmdc:mga0a205_126209_c1 | |||
| 1899 | nmdc:mga0a205_15464_c1 | |||
| 1900 | nmdc:mga0a205_181455_c1 | |||
| 1901 | nmdc:mga0a205_192_c1 | |||
| 1902 | nmdc:mga0a205_244010_c1 | |||
| 1903 | nmdc:mga0a205_448999_c1 | |||
| 1904 | nmdc:mga0a205_6048_c1 | |||
| 1905 | nmdc:mga0a205_624_c1 | |||
| 1906 | Ga0495601_0516848 | |||
| 1907 | Ga0495595_0408104 | |||
| 1908 | Ga0495595_0458637 | |||
| 1909 | Ga0495619_0463834 | |||
| 1910 | Ga0501082_1553029 | |||
| 1911 | Ga0466962_0600037 | |||
| 1912 | Ga0530510_1146121 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9486 | 12 | 105 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9455 | 9 | 103 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9288 | 8 | 107 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9163 | 5 | 103 |
| 7wjp-assembly1.cif.gz_A-2 | structure of padr-like protein from listeria monocytogenes | 0.9122 | 9 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9422 | 9 | 105 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9284 | 9 | 102 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9242 | 16 | 82 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9163 | 5 | 103 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9042 | 12 | 92 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q6Y065-F1-model_v4 | PadR family transcriptional regulator | 0.9965 | 8 | 106 |
|
| AF-A0A1I4FIW9-F1-model_v4 | Transcriptional regulator, PadR family | 0.9952 | 14 | 108 |
|
| AF-A0A4Q7XXC7-F1-model_v4 | PadR family transcriptional regulator | 0.9951 | 9 | 105 |
GO:0000150
GO:0003677 |
| AF-A0A7W7ZJD9-F1-model_v4 | Transcriptional regulator | 0.9946 | 15 | 107 |
|
| AF-A0A2V8J116-F1-model_v4 | PadR family transcriptional regulator | 0.9939 | 15 | 108 |
|