F486748

General Info

Members Datasets Scaffolds Average Seq Length
956 324 1912 110

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1710174|Ga0436365_1710174_566_892
Length 108
Sequence MPKPSDLLQEPLDLLFLKSLAREPLHGWGIAKRIQLLSGDVLAVGQGSLYPALHRLEQQGWLAEWKDSDLGRSAKFYALTREGRKQLERELQSWNRLSSAVQLLLENA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
196 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
232 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
233 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
236 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
307 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.3
Rhizosphere 93.72
Stem 0
Stem Tuber 0
Unclassified 35.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1710174 3300039437 Bacteria 1462
2 MBSR1b_contig_2374457 2162886012 Bacteria 824
3 MBSR1b_contig_3238983 2162886012 Bacteria 894
4 ARcpr5yngRDRAFT_c022125 3300000043 Unclassified 540
5 JGI24745J21846_1034316 3300002073 Unclassified 618
6 Ga0065704_10326589 3300005289 Unclassified 839
7 Ga0065712_10496300 3300005290 Bacteria 648
8 Ga0065712_10570198 3300005290 Bacteria 607
9 Ga0065715_10102249 3300005293 Unclassified 3131
10 Ga0065715_10369545 3300005293 Bacteria 923
11 Ga0065715_10711949 3300005293 Unclassified 648
12 Ga0065715_10796632 3300005293 Unclassified 591
13 Ga0065715_10812326 3300005293 Bacteria 605
14 Ga0065715_11056152 3300005293 Bacteria 520
15 Ga0065707_10019043 3300005295 Bacteria 1673
16 Ga0065707_10299712 3300005295 Unclassified 1007
17 Ga0070676_10024796 3300005328 Unclassified 3383
18 Ga0070676_10384674 3300005328 Unclassified 972
19 Ga0070676_10448695 3300005328 Bacteria 906
20 Ga0070683_100000012 3300005329 Bacteria 274646
21 Ga0070683_100077206 3300005329 Bacteria 3114
22 Ga0070683_101919880 3300005329 Bacteria 569
23 Ga0070690_100005077 3300005330 Bacteria 7377
24 Ga0070690_100273649 3300005330 Bacteria 1202
25 Ga0070670_100973749 3300005331 Bacteria 771
26 Ga0070677_10001801 3300005333 Bacteria 6780
27 Ga0070677_10003494 3300005333 Bacteria 5070
28 Ga0070677_10443369 3300005333 Bacteria 693
29 Ga0068869_100020157 3300005334 Unclassified 4568
30 Ga0068869_100040367 3300005334 Unclassified 3337
31 Ga0070666_10007928 3300005335 Bacteria 6563
32 Ga0070666_10017201 3300005335 Unclassified 4634
33 Ga0070666_10409772 3300005335 Bacteria 975
34 Ga0070666_10551531 3300005335 Bacteria 838
35 Ga0070680_100000822 3300005336 Bacteria 21901
36 Ga0068868_100017783 3300005338 Bacteria 5302
37 Ga0068868_101096525 3300005338 Bacteria 732
38 Ga0068868_101265445 3300005338 Unclassified 684
39 Ga0068868_101460720 3300005338 Unclassified 639
40 Ga0070660_100071768 3300005339 Bacteria 2704
41 Ga0070660_100310474 3300005339 Unclassified 1294
42 Ga0070689_100041632 3300005340 Unclassified 3526
43 Ga0070689_100167725 3300005340 Unclassified 1778
44 Ga0070689_100217853 3300005340 Bacteria 1565
45 Ga0070691_10723620 3300005341 Unclassified 599
46 Ga0070687_100005713 3300005343 Bacteria 5048
47 Ga0070687_100376105 3300005343 Bacteria 924
48 Ga0070687_100384743 3300005343 Bacteria 915
49 Ga0070687_101039466 3300005343 Bacteria 596
50 Ga0070687_101171836 3300005343 Unclassified 565
51 Ga0070661_100072510 3300005344 Unclassified 2534
52 Ga0070692_10341193 3300005345 Bacteria 928
53 Ga0070668_100156591 3300005347 Unclassified 1846
54 Ga0070668_100201406 3300005347 Bacteria 1634
55 Ga0070668_101900054 3300005347 Bacteria 548
56 Ga0070669_100002675 3300005353 Bacteria 12836
57 Ga0070669_100086064 3300005353 Bacteria 2348
58 Ga0070669_100143844 3300005353 Bacteria 1841
59 Ga0070669_100322174 3300005353 Bacteria 1248
60 Ga0070669_100323428 3300005353 Bacteria 1246
61 Ga0070669_100527343 3300005353 Bacteria 982
62 Ga0070669_101157609 3300005353 Unclassified 667
63 Ga0070675_100001787 3300005354 Bacteria 15871
64 Ga0070675_100006343 3300005354 Bacteria 9079
65 Ga0070675_100058810 3300005354 Unclassified 3171
66 Ga0070675_100133359 3300005354 Unclassified 2118
67 Ga0070675_100144258 3300005354 Bacteria 2037
68 Ga0070671_100035560 3300005355 Bacteria 4127
69 Ga0070671_100073889 3300005355 Bacteria 2848
70 Ga0070671_100250062 3300005355 Bacteria 1506
71 Ga0070674_100000172 3300005356 Bacteria 30047
72 Ga0070674_100023066 3300005356 Bacteria 4021
73 Ga0070674_100033534 3300005356 Bacteria 3419
74 Ga0070674_100064888 3300005356 Bacteria 2561
75 Ga0070674_100184969 3300005356 Unclassified 1598
76 Ga0070674_101139647 3300005356 Unclassified 690
77 Ga0070673_100047379 3300005364 Unclassified 3344
78 Ga0070688_100001785 3300005365 Bacteria 10774
79 Ga0070688_100467155 3300005365 Bacteria 946
80 Ga0070688_100989341 3300005365 Bacteria 668
81 Ga0070659_100015168 3300005366 Bacteria 5764
82 Ga0070659_100100918 3300005366 Unclassified 2323
83 Ga0070659_100142317 3300005366 Bacteria 1953
84 Ga0070659_100171925 3300005366 Bacteria 1775
85 Ga0070667_100036079 3300005367 Unclassified 4144
86 Ga0070667_100706955 3300005367 Unclassified 933
87 Ga0070667_100885236 3300005367 Bacteria 831
88 Ga0070667_101221036 3300005367 Unclassified 704
89 Ga0070667_101933576 3300005367 Unclassified 555
90 Ga0070703_10051757 3300005406 Bacteria 1315
91 Ga0070714_100010981 3300005435 Bacteria 7173
92 Ga0070714_100227328 3300005435 Unclassified 1718
93 Ga0070713_100062030 3300005436 Bacteria 3130
94 Ga0070713_100114535 3300005436 Bacteria 2356
95 Ga0070713_100123400 3300005436 Bacteria 2275
96 Ga0070713_100149127 3300005436 Bacteria 2079
97 Ga0070713_101134023 3300005436 Unclassified 756
98 Ga0070710_11350818 3300005437 Bacteria 531
99 Ga0070701_10040824 3300005438 Unclassified 2361
100 Ga0070701_11070992 3300005438 Bacteria 566
101 Ga0070711_101295661 3300005439 Bacteria 632
102 Ga0070711_101717388 3300005439 Unclassified 550
103 Ga0070705_100195886 3300005440 Bacteria 1381
104 Ga0070694_100031742 3300005444 Bacteria 3464
105 Ga0070694_100680322 3300005444 Bacteria 835
106 Ga0070694_101750653 3300005444 Bacteria 529
107 Ga0070708_100011344 3300005445 Bacteria 7247
108 Ga0070708_100778013 3300005445 Bacteria 900
109 Ga0070708_102194890 3300005445 Bacteria 510
110 Ga0070663_100219863 3300005455 Bacteria 1491
111 Ga0070678_100473267 3300005456 Bacteria 1101
112 Ga0070678_101252869 3300005456 Bacteria 689
113 Ga0070662_100029297 3300005457 Unclassified 3841
114 Ga0070662_100257071 3300005457 Bacteria 1406
115 Ga0070662_100348885 3300005457 Bacteria 1212
116 Ga0070662_101030532 3300005457 Unclassified 705
117 Ga0070681_10016588 3300005458 Bacteria 7354
118 Ga0070681_10190546 3300005458 Bacteria 1970
119 Ga0068867_100045613 3300005459 Unclassified 3216
120 Ga0068867_100065686 3300005459 Unclassified 2700
121 Ga0068867_100100521 3300005459 Unclassified 2208
122 Ga0068867_100142492 3300005459 Bacteria 1875
123 Ga0068867_100196678 3300005459 Bacteria 1612
124 Ga0068867_102263480 3300005459 Bacteria 516
125 Ga0070685_10041762 3300005466 Unclassified 2615
126 Ga0070685_10160404 3300005466 Bacteria 1433
127 Ga0070707_100044393 3300005468 Bacteria 4255
128 Ga0070707_100478193 3300005468 Bacteria 1207
129 Ga0070698_100085229 3300005471 Bacteria 3147
130 Ga0070698_100394916 3300005471 Unclassified 1316
131 Ga0070698_101557476 3300005471 Bacteria 613
132 Ga0070699_100002633 3300005518 Bacteria 16034
133 Ga0070699_100066877 3300005518 Unclassified 3121
134 Ga0070699_100614234 3300005518 Unclassified 992
135 Ga0070679_100077002 3300005530 Bacteria 3324
136 Ga0070679_100387518 3300005530 Unclassified 1344
137 Ga0070679_100421559 3300005530 Bacteria 1280
138 Ga0070679_101184054 3300005530 Unclassified 709
139 Ga0070679_101290700 3300005530 Bacteria 676
140 Ga0070679_101319365 3300005530 Unclassified 667
141 Ga0070684_100000013 3300005535 Bacteria 167281
142 Ga0070684_100308778 3300005535 Unclassified 1452
143 Ga0070684_100655510 3300005535 Bacteria 977
144 Ga0070684_101731353 3300005535 Unclassified 590
145 Ga0070697_100199170 3300005536 Bacteria 1702
146 Ga0070697_100643812 3300005536 Bacteria 933
147 Ga0070672_100001740 3300005543 Bacteria 13628
148 Ga0070672_101524726 3300005543 Bacteria 599
149 Ga0070686_100004504 3300005544 Bacteria 7681
150 Ga0070686_100534064 3300005544 Bacteria 915
151 Ga0070686_100977696 3300005544 Unclassified 693
152 Ga0070686_101092429 3300005544 Bacteria 658
153 Ga0070695_100011689 3300005545 Bacteria 5254
154 Ga0070695_100080427 3300005545 Unclassified 2154
155 Ga0070695_100510270 3300005545 Bacteria 931
156 Ga0070695_100760693 3300005545 Bacteria 773
157 Ga0070695_100774487 3300005545 Bacteria 767
158 Ga0070696_100166791 3300005546 Bacteria 1625
159 Ga0070696_101992653 3300005546 Unclassified 504
160 Ga0070693_100150246 3300005547 Bacteria 1475
161 Ga0070693_100206616 3300005547 Unclassified 1279
162 Ga0070665_100017706 3300005548 Bacteria 7154
163 Ga0070665_100017950 3300005548 Bacteria 7103
164 Ga0070665_100095330 3300005548 Bacteria 2980
165 Ga0070665_100604900 3300005548 Unclassified 1109
166 Ga0070665_100987746 3300005548 Bacteria 854
167 Ga0070665_101578417 3300005548 Unclassified 664
168 Ga0070665_101609535 3300005548 Unclassified 657
169 Ga0070704_100607886 3300005549 Bacteria 961
170 Ga0070704_100958511 3300005549 Bacteria 772
171 Ga0070704_101402346 3300005549 Unclassified 641
172 Ga0068855_100004899 3300005563 Bacteria 16339
173 Ga0068855_100022241 3300005563 Bacteria 7598
174 Ga0068855_100078988 3300005563 Bacteria 3817
175 Ga0068855_100250964 3300005563 Bacteria 1974
176 Ga0068855_100519943 3300005563 Bacteria 1291
177 Ga0068855_100704013 3300005563 Unclassified 1081
178 Ga0068855_101460787 3300005563 Unclassified 703
179 Ga0070664_100005833 3300005564 Bacteria 9934
180 Ga0070664_100301090 3300005564 Bacteria 1449
181 Ga0070664_100945057 3300005564 Bacteria 809
182 Ga0070664_101202482 3300005564 Unclassified 715
183 Ga0070664_101970807 3300005564 Bacteria 554
184 Ga0068857_100004964 3300005577 Bacteria 11304
185 Ga0068857_100132356 3300005577 Unclassified 2250
186 Ga0068857_100293713 3300005577 Bacteria 1497
187 Ga0068857_100628700 3300005577 Unclassified 1016
188 Ga0068857_101094691 3300005577 Bacteria 769
189 Ga0068857_101369270 3300005577 Bacteria 688
190 Ga0068857_101464261 3300005577 Bacteria 665
191 Ga0068856_100009114 3300005614 Bacteria 9647
192 Ga0068856_100011460 3300005614 Bacteria 8604
193 Ga0068856_100119058 3300005614 Unclassified 2641
194 Ga0068852_100006626 3300005616 Bacteria 8392
195 Ga0068852_100201990 3300005616 Unclassified 1881
196 Ga0068852_100570716 3300005616 Bacteria 1133
197 Ga0068852_100600142 3300005616 Bacteria 1105
198 Ga0068859_100012492 3300005617 Bacteria 8543
199 Ga0068859_100078332 3300005617 Unclassified 3345
200 Ga0068859_101235165 3300005617 Unclassified 823
201 Ga0068859_101258353 3300005617 Bacteria 815
202 Ga0068859_101994885 3300005617 Bacteria 641
203 Ga0068859_102142603 3300005617 Unclassified 617
204 Ga0068859_102233019 3300005617 Unclassified 604
205 Ga0068859_102317295 3300005617 Bacteria 592
206 Ga0068864_100049642 3300005618 Unclassified 3610
207 Ga0068864_100121711 3300005618 Unclassified 2334
208 Ga0068864_100143748 3300005618 Unclassified 2154
209 Ga0068864_101158449 3300005618 Unclassified 771
210 Ga0068864_101363451 3300005618 Unclassified 710
211 Ga0068864_101388194 3300005618 Unclassified 704
212 Ga0068864_102147051 3300005618 Unclassified 565
213 Ga0068866_10741305 3300005718 Unclassified 678
214 Ga0068866_11290399 3300005718 Unclassified 530
215 Ga0068861_100537245 3300005719 Bacteria 1063
216 Ga0068870_10000827 3300005840 Bacteria 12055
217 Ga0068870_10095518 3300005840 Unclassified 1670
218 Ga0068863_100002004 3300005841 Bacteria 20212
219 Ga0068863_100027325 3300005841 Bacteria 5442
220 Ga0068863_100164198 3300005841 Bacteria 2129
221 Ga0068863_100590979 3300005841 Bacteria 1098
222 Ga0068863_100730569 3300005841 Bacteria 985
223 Ga0068863_100915141 3300005841 Unclassified 878
224 Ga0068863_101155878 3300005841 Bacteria 779
225 Ga0068858_100016775 3300005842 Bacteria 6877
226 Ga0068858_100126947 3300005842 Unclassified 2389
227 Ga0068858_100325421 3300005842 Unclassified 1470
228 Ga0068858_100338839 3300005842 Bacteria 1439
229 Ga0068858_100487223 3300005842 Bacteria 1190
230 Ga0068858_100698525 3300005842 Unclassified 987
231 Ga0068860_100025560 3300005843 Bacteria 5696
232 Ga0068860_100119167 3300005843 Bacteria 2527
233 Ga0068860_100359615 3300005843 Unclassified 1434
234 Ga0068862_100008067 3300005844 Bacteria 8718
235 Ga0068862_100668799 3300005844 Bacteria 1003
236 Ga0068862_101443508 3300005844 Bacteria 692
237 Ga0068862_101774069 3300005844 Unclassified 626
238 Ga0081455_10015552 3300005937 Bacteria 7387
239 Ga0081455_10925982 3300005937 Unclassified 541
240 Ga0081539_10049033 3300005985 Bacteria 2398
241 Ga0081539_10053598 3300005985 Bacteria 2257
242 Ga0081539_10095259 3300005985 Bacteria 1529
243 Ga0070717_10029188 3300006028 Bacteria 4422
244 Ga0070717_10045836 3300006028 Bacteria 3576
245 Ga0070717_10458649 3300006028 Unclassified 1149
246 Ga0075432_10242619 3300006058 Unclassified 728
247 Ga0070716_101487428 3300006173 Bacteria 553
248 Ga0097621_100018641 3300006237 Bacteria 5308
249 Ga0097621_100080294 3300006237 Bacteria 2713
250 Ga0097621_100236242 3300006237 Unclassified 1597
251 Ga0097621_100247816 3300006237 Bacteria 1559
252 Ga0097621_100375911 3300006237 Bacteria 1268
253 Ga0068871_100068995 3300006358 Unclassified 2903
254 Ga0068871_100389538 3300006358 Bacteria 1239
255 Ga0068871_100448384 3300006358 Bacteria 1156
256 Ga0068871_100600641 3300006358 Unclassified 1001
257 Ga0068871_101829120 3300006358 Unclassified 577
258 Ga0075428_100009050 3300006844 Bacteria 11048
259 Ga0075428_100057339 3300006844 Bacteria 4264
260 Ga0075428_100161532 3300006844 Unclassified 2432
261 Ga0075428_100188377 3300006844 Bacteria 2232
262 Ga0075428_101991043 3300006844 Unclassified 602
263 Ga0075430_100015272 3300006846 Bacteria 6538
264 Ga0075430_100036082 3300006846 Bacteria 4192
265 Ga0075430_100177309 3300006846 Bacteria 1773
266 Ga0075430_100466097 3300006846 Bacteria 1043
267 Ga0075430_100640283 3300006846 Unclassified 877
268 Ga0075431_100024630 3300006847 Bacteria 6170
269 Ga0075431_100046174 3300006847 Unclassified 4491
270 Ga0075431_100107620 3300006847 Bacteria 2877
271 Ga0075431_100155137 3300006847 Unclassified 2356
272 Ga0075431_100752888 3300006847 Unclassified 949
273 Ga0075431_100891114 3300006847 Bacteria 860
274 Ga0075431_100938259 3300006847 Bacteria 834
275 Ga0075431_101790535 3300006847 Unclassified 570
276 Ga0075431_102203713 3300006847 Unclassified 505
277 Ga0075431_102217907 3300006847 Bacteria 503
278 Ga0075433_10000346 3300006852 Bacteria 28887
279 Ga0075433_10005849 3300006852 Bacteria 9689
280 Ga0075433_10007651 3300006852 Bacteria 8580
281 Ga0075433_10081808 3300006852 Bacteria 2847
282 Ga0075433_10232463 3300006852 Unclassified 1637
283 Ga0075433_10306734 3300006852 Bacteria 1405
284 Ga0075433_10330384 3300006852 Bacteria 1348
285 Ga0075433_10447439 3300006852 Bacteria 1139
286 Ga0075433_11448959 3300006852 Unclassified 593
287 Ga0075434_100006772 3300006871 Bacteria 10532
288 Ga0075434_100011872 3300006871 Bacteria 8235
289 Ga0075434_100028945 3300006871 Bacteria 5447
290 Ga0075434_100032810 3300006871 Bacteria 5122
291 Ga0075434_100064092 3300006871 Bacteria 3658
292 Ga0075434_102204051 3300006871 Bacteria 555
293 Ga0075429_100214494 3300006880 Bacteria 1686
294 Ga0075429_100274571 3300006880 Bacteria 1476
295 Ga0075429_101376659 3300006880 Bacteria 615
296 Ga0075429_101379937 3300006880 Unclassified 614
297 Ga0068865_100045749 3300006881 Unclassified 3001
298 Ga0068865_100061622 3300006881 Unclassified 2630
299 Ga0068865_100469833 3300006881 Bacteria 1043
300 Ga0068865_100630593 3300006881 Bacteria 909
301 Ga0068865_101074537 3300006881 Bacteria 708
302 Ga0068865_101086330 3300006881 Bacteria 704
303 Ga0075436_101126946 3300006914 Unclassified 591
304 Ga0097620_100012492 3300006931 Bacteria 8543
305 Ga0097620_100078328 3300006931 Unclassified 3345
306 Ga0097620_101235263 3300006931 Unclassified 823
307 Ga0097620_101258099 3300006931 Bacteria 815
308 Ga0097620_101994922 3300006931 Bacteria 641
309 Ga0097620_102142408 3300006931 Unclassified 617
310 Ga0097620_102233349 3300006931 Unclassified 604
311 Ga0097620_102316199 3300006931 Bacteria 592
312 Ga0075435_100021977 3300007076 Bacteria 4917
313 Ga0075435_100039064 3300007076 Unclassified 3787
314 Ga0099794_10427793 3300007265 Unclassified 693
315 Ga0105240_10009440 3300009093 Bacteria 13810
316 Ga0105240_10017856 3300009093 Bacteria 9545
317 Ga0105240_10017899 3300009093 Bacteria 9533
318 Ga0105240_10025280 3300009093 Bacteria 7807
319 Ga0105240_10110658 3300009093 Bacteria 3324
320 Ga0105240_10246699 3300009093 Unclassified 2067
321 Ga0105240_10253765 3300009093 Bacteria 2033
322 Ga0105240_10584004 3300009093 Bacteria 1232
323 Ga0111539_10001233 3300009094 Bacteria 34025
324 Ga0111539_10022643 3300009094 Bacteria 7718
325 Ga0111539_10287498 3300009094 Bacteria 1913
326 Ga0111539_10476455 3300009094 Bacteria 1454
327 Ga0111539_10581396 3300009094 Unclassified 1304
328 Ga0111539_10773869 3300009094 Bacteria 1117
329 Ga0111539_13096418 3300009094 Unclassified 537
330 Ga0105245_10002014 3300009098 Bacteria 18418
331 Ga0105245_10002505 3300009098 Bacteria 16554
332 Ga0105245_10009708 3300009098 Bacteria 8395
333 Ga0105245_10289552 3300009098 Bacteria 1604
334 Ga0105245_10568617 3300009098 Bacteria 1157
335 Ga0105245_11047100 3300009098 Unclassified 861
336 Ga0105245_12266193 3300009098 Unclassified 597
337 Ga0105247_10013117 3300009101 Bacteria 4970
338 Ga0114129_10000872 3300009147 Bacteria 39245
339 Ga0114129_10006410 3300009147 Bacteria 16682
340 Ga0114129_10011701 3300009147 Bacteria 12485
341 Ga0114129_10013537 3300009147 Bacteria 11625
342 Ga0114129_10071421 3300009147 Bacteria 4841
343 Ga0114129_10078548 3300009147 Bacteria 4590
344 Ga0114129_10262787 3300009147 Bacteria 2312
345 Ga0114129_10380504 3300009147 Bacteria 1864
346 Ga0114129_11089316 3300009147 Bacteria 1001
347 Ga0114129_11232204 3300009147 Unclassified 930
348 Ga0114129_11728419 3300009147 Bacteria 763
349 Ga0114129_12384782 3300009147 Unclassified 634
350 Ga0105243_11490730 3300009148 Bacteria 700
351 Ga0105243_11819062 3300009148 Unclassified 640
352 Ga0105241_10170106 3300009174 Unclassified 1799
353 Ga0105241_10568657 3300009174 Bacteria 1020
354 Ga0105241_10779179 3300009174 Unclassified 879
355 Ga0105241_11200613 3300009174 Unclassified 718
356 Ga0105241_12571931 3300009174 Unclassified 511
357 Ga0105242_10011639 3300009176 Bacteria 6768
358 Ga0105242_10351971 3300009176 Bacteria 1360
359 Ga0105242_11565913 3300009176 Unclassified 692
360 Ga0105242_12413055 3300009176 Unclassified 573
361 Ga0105242_13236372 3300009176 Unclassified 506
362 Ga0105242_13258348 3300009176 Unclassified 504
363 Ga0105248_10002325 3300009177 Bacteria 21083
364 Ga0105248_10031048 3300009177 Bacteria 5970
365 Ga0105248_10039057 3300009177 Bacteria 5315
366 Ga0105248_10075883 3300009177 Bacteria 3778
367 Ga0105248_10243843 3300009177 Unclassified 2023
368 Ga0105248_10360238 3300009177 Bacteria 1637
369 Ga0105248_10842328 3300009177 Bacteria 1035
370 Ga0105248_10935760 3300009177 Unclassified 979
371 Ga0105248_11155085 3300009177 Bacteria 875
372 Ga0105237_10004243 3300009545 Bacteria 16682
373 Ga0105237_10009915 3300009545 Bacteria 10166
374 Ga0105237_10101389 3300009545 Bacteria 2871
375 Ga0105237_11321262 3300009545 Unclassified 727
376 Ga0105238_10007616 3300009551 Bacteria 10848
377 Ga0105238_10043000 3300009551 Bacteria 4572
378 Ga0105238_10182192 3300009551 Bacteria 2077
379 Ga0105238_10287111 3300009551 Bacteria 1627
380 Ga0105238_12480677 3300009551 Unclassified 554
381 Ga0105238_12884539 3300009551 Unclassified 517
382 Ga0105249_10012319 3300009553 Bacteria 7534
383 Ga0105249_10115048 3300009553 Bacteria 2548
384 Ga0105249_10148147 3300009553 Unclassified 2257
385 Ga0105249_10260838 3300009553 Unclassified 1722
386 Ga0105249_10526142 3300009553 Bacteria 1230
387 Ga0105249_10670162 3300009553 Bacteria 1096
388 Ga0105249_11677985 3300009553 Bacteria 708
389 Ga0105249_11741741 3300009553 Bacteria 696
390 Ga0105249_13419119 3300009553 Bacteria 511
391 Ga0099796_10290507 3300010159 Unclassified 690
392 Ga0105239_10018004 3300010375 Bacteria 7813
393 Ga0105239_10350431 3300010375 Unclassified 1667
394 Ga0105239_11071634 3300010375 Unclassified 927
395 Ga0105239_12117699 3300010375 Bacteria 654
396 Ga0105246_10005035 3300011119 Bacteria 8038
397 Ga0105246_10085041 3300011119 Unclassified 2264
398 Ga0105246_10193560 3300011119 Bacteria 1576
399 Ga0105246_10505814 3300011119 Bacteria 1027
400 Ga0105246_10933485 3300011119 Bacteria 781
401 Ga0157373_10708319 3300013100 Unclassified 738
402 Ga0157371_10091446 3300013102 Unclassified 2155
403 Ga0157370_10002587 3300013104 Bacteria 21740
404 Ga0157370_10002772 3300013104 Bacteria 20942
405 Ga0157370_10178721 3300013104 Bacteria 1972
406 Ga0157370_10241430 3300013104 Unclassified 1671
407 Ga0157370_10292415 3300013104 Bacteria 1505
408 Ga0157370_11028913 3300013104 Unclassified 745
409 Ga0157369_10004043 3300013105 Bacteria 17380
410 Ga0157369_10004682 3300013105 Bacteria 16085
411 Ga0157369_10048017 3300013105 Unclassified 4633
412 Ga0157369_10083429 3300013105 Bacteria 3418
413 Ga0157369_10114496 3300013105 Unclassified 2864
414 Ga0157369_10791071 3300013105 Unclassified 975
415 Ga0157374_10042798 3300013296 Bacteria 4180
416 Ga0157374_10072225 3300013296 Unclassified 3255
417 Ga0157374_10705491 3300013296 Unclassified 1022
418 Ga0157378_10004146 3300013297 Bacteria 12799
419 Ga0157378_10030115 3300013297 Unclassified 4795
420 Ga0157378_10393345 3300013297 Bacteria 1364
421 Ga0163162_10016275 3300013306 Bacteria 7271
422 Ga0163162_10508575 3300013306 Bacteria 1335
423 Ga0163162_11019159 3300013306 Unclassified 936
424 Ga0163162_11352922 3300013306 Unclassified 810
425 Ga0163162_11401254 3300013306 Unclassified 795
426 Ga0163162_12869985 3300013306 Unclassified 555
427 Ga0157372_10040352 3300013307 Bacteria 5155
428 Ga0157372_10062279 3300013307 Bacteria 4180
429 Ga0157372_10075704 3300013307 Bacteria 3798
430 Ga0157372_10363691 3300013307 Bacteria 1686
431 Ga0157372_10405661 3300013307 Unclassified 1588
432 Ga0157372_10424329 3300013307 Bacteria 1550
433 Ga0157375_10001615 3300013308 Bacteria 19377
434 Ga0157375_10136128 3300013308 Unclassified 2580
435 Ga0157375_10820903 3300013308 Bacteria 1078
436 Ga0157375_10910029 3300013308 Bacteria 1023
437 Ga0157375_12447577 3300013308 Unclassified 623
438 Ga0157375_13691749 3300013308 Unclassified 509
439 Ga0163163_10160418 3300014325 Unclassified 2294
440 Ga0163163_10509583 3300014325 Unclassified 1265
441 Ga0163163_10608914 3300014325 Bacteria 1155
442 Ga0163163_10721808 3300014325 Bacteria 1060
443 Ga0157380_10016775 3300014326 Bacteria 5409
444 Ga0157380_10045075 3300014326 Unclassified 3459
445 Ga0157380_10049039 3300014326 Bacteria 3329
446 Ga0157380_10101478 3300014326 Bacteria 2398
447 Ga0157377_10154344 3300014745 Bacteria 1422
448 Ga0157377_10356874 3300014745 Bacteria 983
449 Ga0157379_10061437 3300014968 Bacteria 3359
450 Ga0157379_10466823 3300014968 Unclassified 1167
451 Ga0157379_10840991 3300014968 Unclassified 868
452 Ga0157379_11481065 3300014968 Unclassified 660
453 Ga0157376_10043035 3300014969 Unclassified 3704
454 Ga0157376_10692646 3300014969 Unclassified 1023
455 Ga0157376_10775373 3300014969 Unclassified 970
456 Ga0157376_11108659 3300014969 Unclassified 817
457 Ga0157376_11156925 3300014969 Unclassified 801
458 Ga0163161_10336548 3300017792 Bacteria 1196
459 Ga0163161_10623920 3300017792 Unclassified 891
460 Ga0163161_10675987 3300017792 Unclassified 858
461 Ga0163161_10756462 3300017792 Bacteria 813
462 Ga0197907_10297313 3300020069 Unclassified 560
463 Ga0213873_10300292 3300021358 Unclassified 518
464 Ga0213874_10020315 3300021377 Bacteria 1819
465 Ga0213874_10039399 3300021377 Bacteria 1407
466 Ga0213876_10111686 3300021384 Bacteria 1450
467 Ga0213876_10150618 3300021384 Unclassified 1237
468 Ga0213875_10000008 3300021388 Bacteria 533344
469 Ga0213875_10000088 3300021388 Bacteria 106188
470 Ga0213875_10041295 3300021388 Bacteria 2171
471 Ga0213875_10044896 3300021388 Bacteria 2075
472 Ga0213875_10049259 3300021388 Bacteria 1975
473 Ga0213875_10118805 3300021388 Unclassified 1235
474 Ga0213875_10356341 3300021388 Unclassified 695
475 Ga0207697_10002108 3300025315 Bacteria 10446
476 Ga0207653_10194715 3300025885 Unclassified 762
477 Ga0207653_10431281 3300025885 Bacteria 517
478 Ga0207682_10001721 3300025893 Bacteria 10029
479 Ga0207682_10019081 3300025893 Bacteria 2684
480 Ga0207682_10326483 3300025893 Bacteria 721
481 Ga0207692_10892980 3300025898 Unclassified 584
482 Ga0207642_10352210 3300025899 Bacteria 869
483 Ga0207642_10617997 3300025899 Unclassified 676
484 Ga0207688_10010146 3300025901 Bacteria 5124
485 Ga0207688_10155824 3300025901 Bacteria 1352
486 Ga0207680_10051516 3300025903 Unclassified 2462
487 Ga0207680_10137549 3300025903 Unclassified 1616
488 Ga0207680_10682436 3300025903 Bacteria 736
489 Ga0207647_10121883 3300025904 Bacteria 1537
490 Ga0207699_10802207 3300025906 Unclassified 692
491 Ga0207645_10016931 3300025907 Unclassified 4816
492 Ga0207645_10029523 3300025907 Bacteria 3534
493 Ga0207643_10000158 3300025908 Bacteria 46661
494 Ga0207684_11419234 3300025910 Bacteria 568
495 Ga0207654_10115834 3300025911 Bacteria 1675
496 Ga0207654_10305737 3300025911 Unclassified 1083
497 Ga0207654_10488975 3300025911 Unclassified 868
498 Ga0207707_10274480 3300025912 Bacteria 1461
499 Ga0207707_10398116 3300025912 Unclassified 1182
500 Ga0207707_11363171 3300025912 Unclassified 567
501 Ga0207695_10002722 3300025913 Bacteria 25812
502 Ga0207695_10006239 3300025913 Bacteria 15528
503 Ga0207695_10061336 3300025913 Unclassified 3886
504 Ga0207695_10238194 3300025913 Bacteria 1722
505 Ga0207695_10275376 3300025913 Bacteria 1577
506 Ga0207695_10688839 3300025913 Unclassified 903
507 Ga0207695_10711079 3300025913 Bacteria 885
508 Ga0207695_10898420 3300025913 Unclassified 765
509 Ga0207695_11573272 3300025913 Unclassified 538
510 Ga0207671_10023090 3300025914 Unclassified 4693
511 Ga0207671_10172656 3300025914 Unclassified 1679
512 Ga0207671_10725728 3300025914 Unclassified 790
513 Ga0207693_10574083 3300025915 Bacteria 879
514 Ga0207663_10172177 3300025916 Bacteria 1539
515 Ga0207663_10468819 3300025916 Bacteria 974
516 Ga0207660_10001537 3300025917 Bacteria 15451
517 Ga0207660_10294164 3300025917 Bacteria 1292
518 Ga0207662_10006624 3300025918 Bacteria 6255
519 Ga0207662_10222802 3300025918 Bacteria 1229
520 Ga0207657_10148823 3300025919 Bacteria 1908
521 Ga0207657_10259544 3300025919 Bacteria 1383
522 Ga0207649_10028909 3300025920 Unclassified 3269
523 Ga0207652_10056026 3300025921 Bacteria 3393
524 Ga0207652_10312234 3300025921 Bacteria 1419
525 Ga0207652_11179297 3300025921 Unclassified 667
526 Ga0207652_11704479 3300025921 Bacteria 535
527 Ga0207646_10119769 3300025922 Bacteria 2365
528 Ga0207646_11154959 3300025922 Bacteria 680
529 Ga0207681_10107503 3300025923 Bacteria 2023
530 Ga0207681_10159670 3300025923 Bacteria 1698
531 Ga0207681_11163979 3300025923 Unclassified 648
532 Ga0207694_10006271 3300025924 Bacteria 9083
533 Ga0207694_10011679 3300025924 Bacteria 6624
534 Ga0207694_10012169 3300025924 Bacteria 6488
535 Ga0207694_10244938 3300025924 Bacteria 1466
536 Ga0207694_10551619 3300025924 Unclassified 967
537 Ga0207650_11673695 3300025925 Bacteria 540
538 Ga0207659_10002688 3300025926 Bacteria 10595
539 Ga0207659_10005321 3300025926 Bacteria 7798
540 Ga0207659_10021596 3300025926 Unclassified 4276
541 Ga0207659_10056372 3300025926 Unclassified 2814
542 Ga0207659_10178586 3300025926 Unclassified 1680
543 Ga0207687_10001770 3300025927 Bacteria 14844
544 Ga0207687_10006219 3300025927 Bacteria 7900
545 Ga0207687_10008662 3300025927 Bacteria 6648
546 Ga0207687_10394933 3300025927 Bacteria 1136
547 Ga0207687_10762750 3300025927 Unclassified 824
548 Ga0207700_10048966 3300025928 Bacteria 3141
549 Ga0207700_10101665 3300025928 Bacteria 2294
550 Ga0207700_10132761 3300025928 Bacteria 2035
551 Ga0207700_10316516 3300025928 Bacteria 1351
552 Ga0207664_10083195 3300025929 Bacteria 2609
553 Ga0207664_10338160 3300025929 Unclassified 1331
554 Ga0207664_11100935 3300025929 Unclassified 710
555 Ga0207644_10371008 3300025931 Bacteria 1166
556 Ga0207644_10783243 3300025931 Unclassified 797
557 Ga0207690_10089869 3300025932 Unclassified 2166
558 Ga0207690_10389921 3300025932 Bacteria 1109
559 Ga0207690_10448122 3300025932 Unclassified 1037
560 Ga0207706_10005297 3300025933 Bacteria 12026
561 Ga0207706_10139231 3300025933 Bacteria 2135
562 Ga0207706_10702969 3300025933 Unclassified 863
563 Ga0207706_10842530 3300025933 Bacteria 777
564 Ga0207686_10092629 3300025934 Bacteria 1999
565 Ga0207686_10629332 3300025934 Unclassified 847
566 Ga0207686_11030020 3300025934 Unclassified 669
567 Ga0207709_11504096 3300025935 Unclassified 558
568 Ga0207670_10066315 3300025936 Unclassified 2480
569 Ga0207670_10091516 3300025936 Bacteria 2151
570 Ga0207670_10950897 3300025936 Unclassified 721
571 Ga0207669_10000320 3300025937 Bacteria 21935
572 Ga0207669_10018836 3300025937 Bacteria 3580
573 Ga0207669_10194243 3300025937 Bacteria 1467
574 Ga0207669_10363627 3300025937 Bacteria 1122
575 Ga0207669_10480342 3300025937 Bacteria 990
576 Ga0207704_10375752 3300025938 Unclassified 1114
577 Ga0207704_10477397 3300025938 Bacteria 1000
578 Ga0207704_10813465 3300025938 Bacteria 781
579 Ga0207704_11370728 3300025938 Unclassified 606
580 Ga0207665_11442112 3300025939 Unclassified 548
581 Ga0207691_10009994 3300025940 Bacteria 9113
582 Ga0207691_11358431 3300025940 Bacteria 585
583 Ga0207691_11470921 3300025940 Bacteria 558
584 Ga0207711_10001367 3300025941 Bacteria 22990
585 Ga0207711_10249930 3300025941 Bacteria 1628
586 Ga0207711_10257693 3300025941 Bacteria 1602
587 Ga0207711_10559401 3300025941 Bacteria 1067
588 Ga0207711_10755618 3300025941 Bacteria 906
589 Ga0207689_10004173 3300025942 Bacteria 13131
590 Ga0207689_10031190 3300025942 Bacteria 4440
591 Ga0207689_10184716 3300025942 Bacteria 1720
592 Ga0207689_11350153 3300025942 Unclassified 598
593 Ga0207661_10000034 3300025944 Bacteria 154138
594 Ga0207661_10032874 3300025944 Unclassified 4023
595 Ga0207661_10489924 3300025944 Unclassified 1123
596 Ga0207679_10003829 3300025945 Bacteria 9326
597 Ga0207679_10224252 3300025945 Bacteria 1583
598 Ga0207679_10527864 3300025945 Bacteria 1056
599 Ga0207679_11269185 3300025945 Unclassified 676
600 Ga0207679_11461844 3300025945 Unclassified 627
601 Ga0207679_11696962 3300025945 Bacteria 578
602 Ga0207679_11822490 3300025945 Bacteria 556
603 Ga0207667_10014002 3300025949 Bacteria 9158
604 Ga0207667_10039277 3300025949 Bacteria 5045
605 Ga0207667_10464551 3300025949 Bacteria 1285
606 Ga0207667_10543877 3300025949 Unclassified 1175
607 Ga0207667_10971523 3300025949 Unclassified 838
608 Ga0207651_10046980 3300025960 Unclassified 2907
609 Ga0207712_10062750 3300025961 Unclassified 2643
610 Ga0207712_10063516 3300025961 Unclassified 2629
611 Ga0207712_10067020 3300025961 Bacteria 2568
612 Ga0207668_11414509 3300025972 Bacteria 627
613 Ga0207658_10055402 3300025986 Unclassified 2938
614 Ga0207658_10934832 3300025986 Unclassified 790
615 Ga0207677_10351395 3300026023 Bacteria 1235
616 Ga0207677_10509703 3300026023 Bacteria 1042
617 Ga0207677_10819647 3300026023 Unclassified 834
618 Ga0207703_10208405 3300026035 Unclassified 1741
619 Ga0207703_10295250 3300026035 Unclassified 1476
620 Ga0207703_10688740 3300026035 Bacteria 971
621 Ga0207639_10370799 3300026041 Bacteria 1283
622 Ga0207639_11753531 3300026041 Bacteria 581
623 Ga0207678_10159415 3300026067 Unclassified 1927
624 Ga0207678_10251107 3300026067 Bacteria 1515
625 Ga0207678_11520129 3300026067 Bacteria 591
626 Ga0207678_11585622 3300026067 Unclassified 577
627 Ga0207708_11754702 3300026075 Bacteria 545
628 Ga0207702_10009873 3300026078 Bacteria 8000
629 Ga0207702_10099839 3300026078 Unclassified 2559
630 Ga0207702_10196012 3300026078 Bacteria 1870
631 Ga0207702_11139817 3300026078 Bacteria 774
632 Ga0207641_10025118 3300026088 Unclassified 4911
633 Ga0207641_10075997 3300026088 Bacteria 2902
634 Ga0207641_10339680 3300026088 Bacteria 1429
635 Ga0207648_10021097 3300026089 Bacteria 5858
636 Ga0207648_10067339 3300026089 Unclassified 3122
637 Ga0207648_10176992 3300026089 Bacteria 1887
638 Ga0207648_10403549 3300026089 Bacteria 1239
639 Ga0207648_10453314 3300026089 Bacteria 1168
640 Ga0207648_10778467 3300026089 Unclassified 890
641 Ga0207676_10107414 3300026095 Unclassified 2328
642 Ga0207676_10508702 3300026095 Bacteria 1145
643 Ga0207676_10956100 3300026095 Unclassified 842
644 Ga0207676_11515391 3300026095 Unclassified 668
645 Ga0207674_10013841 3300026116 Bacteria 8926
646 Ga0207674_10147960 3300026116 Unclassified 2307
647 Ga0207674_10537201 3300026116 Bacteria 1129
648 Ga0207674_10606827 3300026116 Bacteria 1057
649 Ga0207674_10668245 3300026116 Bacteria 1003
650 Ga0207675_100029718 3300026118 Bacteria 5089
651 Ga0207675_100426275 3300026118 Bacteria 1311
652 Ga0207683_10000925 3300026121 Bacteria 26990
653 Ga0207683_10110895 3300026121 Bacteria 2456
654 Ga0207683_10501605 3300026121 Bacteria 1121
655 Ga0207698_10033565 3300026142 Bacteria 3730
656 Ga0207698_10928244 3300026142 Bacteria 879
657 Ga0207698_11565093 3300026142 Bacteria 675
658 Ga0207428_10001518 3300027907 Bacteria 24220
659 Ga0207428_10002065 3300027907 Bacteria 20261
660 Ga0207428_10528397 3300027907 Unclassified 855
661 Ga0207428_10777687 3300027907 Unclassified 681
662 Ga0268266_10069504 3300028379 Unclassified 3051
663 Ga0268266_10540497 3300028379 Bacteria 1115
664 Ga0268266_10554587 3300028379 Bacteria 1101
665 Ga0268266_12316798 3300028379 Unclassified 508
666 Ga0268265_10011411 3300028380 Bacteria 6008
667 Ga0268265_10269833 3300028380 Bacteria 1517
668 Ga0268265_10671428 3300028380 Bacteria 998
669 Ga0268264_10079301 3300028381 Unclassified 2801
670 Ga0268264_10139958 3300028381 Bacteria 2157
671 Ga0265323_10005006 3300028653 Bacteria 5657
672 Ga0265330_10184550 3300031235 Unclassified 883
673 Ga0265332_10106897 3300031238 Bacteria 1180
674 Ga0265328_10465931 3300031239 Unclassified 501
675 Ga0265325_10367172 3300031241 Unclassified 634
676 Ga0265340_10032541 3300031247 Bacteria 2603
677 Ga0265316_10001914 3300031344 Bacteria 21862
678 Ga0265316_10028222 3300031344 Bacteria 4632
679 Ga0307408_100161333 3300031548 Bacteria 1781
680 Ga0265313_10007334 3300031595 Bacteria 7562
681 Ga0265314_10000776 3300031711 Bacteria 37903
682 Ga0265314_10011058 3300031711 Bacteria 7481
683 Ga0307412_12329803 3300031911 Unclassified 500
684 Ga0307409_102756694 3300031995 Bacteria 519
685 Ga0307416_100328758 3300032002 Unclassified 1535
686 Ga0307416_101754649 3300032002 Unclassified 725
687 Ga0307416_102879660 3300032002 Unclassified 576
688 Ga0307411_10397072 3300032005 Bacteria 1139
689 Ga0373958_0021245 3300034819 Bacteria 1203
690 Ga0373934_0000774 3300035086 Bacteria 11483
691 Ga0373934_0140077 3300035086 Bacteria 989
692 Ga0373934_0211441 3300035086 Bacteria 799
693 Ga0373944_0189288 3300035089 Bacteria 741
694 Ga0373944_0272110 3300035089 Unclassified 630
695 Ga0373939_0004091 3300035114 Unclassified 3436
696 Ga0373953_0295905 3300035117 Unclassified 706
697 Ga0373954_0001092 3300035118 Bacteria 10845
698 Ga0373954_0364941 3300035118 Bacteria 713
699 Ga0373954_0498346 3300035118 Bacteria 603
700 Ga0373956_0046850 3300035119 Unclassified 1933
701 Ga0373956_0281115 3300035119 Unclassified 792
702 Ga0373956_0511122 3300035119 Unclassified 573
703 Ga0373957_0016513 3300035120 Bacteria 2556
704 Ga0373957_0127705 3300035120 Bacteria 1033
705 Ga0373957_0240987 3300035120 Bacteria 760
706 Ga0373957_0455455 3300035120 Bacteria 554
707 Ga0373943_0174658 3300035170 Bacteria 1178
708 Ga0373955_0339260 3300035172 Bacteria 909
709 Ga0373955_0809177 3300035172 Bacteria 576
710 Ga0373961_0378758 3300035241 Bacteria 539
711 Ga0373962_0124166 3300035242 Unclassified 826
712 Ga0373931_0714899 3300035691 Unclassified 662
713 Ga0373935_0327163 3300035692 Bacteria 1089
714 Ga0373935_0582452 3300035692 Bacteria 817
715 Ga0373933_0132902 3300035724 Bacteria 1566
716 Ga0373933_0830147 3300035724 Bacteria 608
717 Ga0373933_1143320 3300035724 Unclassified 513
718 Ga0373947_0171519 3300035725 Bacteria 1408
719 Ga0373947_0402834 3300035725 Bacteria 923
720 Ga0373937_0003513 3300036401 Bacteria 13184
721 Ga0373937_0065954 3300036401 Unclassified 3333
722 Ga0373937_0159751 3300036401 Bacteria 2113
723 Ga0373937_0166851 3300036401 Bacteria 2065
724 Ga0373937_0218205 3300036401 Bacteria 1795
725 Ga0373937_0612321 3300036401 Bacteria 1034
726 Ga0373937_0638915 3300036401 Unclassified 1010
727 Ga0373925_0017088 3300037068 Bacteria 5252
728 Ga0373925_0221379 3300037068 Bacteria 1511
729 Ga0395905_0869232 3300037471 Unclassified 805
730 Ga0436364_0091827 3300037853 Unclassified 544
731 Ga0436364_0117819 3300037853 Unclassified 531
732 Ga0436364_0154123 3300037853 Bacteria 7439
733 Ga0436364_0278774 3300037853 Bacteria 400541
734 Ga0436364_0466454 3300037853 Unclassified 776
735 Ga0436364_0511894 3300037853 Unclassified 525
736 Ga0436364_0562228 3300037853 Unclassified 1055
737 Ga0436364_0568781 3300037853 Bacteria 2934
738 Ga0436364_0613877 3300037853 Unclassified 742
739 Ga0436364_0772554 3300037853 Bacteria 5751
740 Ga0436364_0938901 3300037853 Bacteria 1410
741 Ga0436364_0993293 3300037853 Bacteria 3217
742 Ga0436364_1172528 3300037853 Bacteria 1251
743 Ga0436364_1415525 3300037853 Bacteria 425173
744 Ga0436364_1527124 3300037853 Unclassified 3953
745 Ga0436365_0405905 3300039437 Bacteria 607
746 Ga0436365_0480035 3300039437 Bacteria 2605
747 Ga0436365_0712875 3300039437 Bacteria 1400
748 Ga0436365_1270184 3300039437 Unclassified 4294
749 Ga0436365_1884243 3300039437 Bacteria 691
750 Ga0436361_0981129 3300039447 Unclassified 985
751 Ga0436363_0689488 3300039450 Bacteria 4304
752 Ga0436363_0933554 3300039450 Unclassified 1063
753 Ga0436363_1135331 3300039450 Bacteria 4523
754 Ga0436363_1279168 3300039450 Unclassified 1090
755 Ga0436363_1416554 3300039450 Unclassified 689
756 Ga0436362_0443984 3300039453 Unclassified 567
757 Ga0436362_0973259 3300039453 Unclassified 625
758 Ga0436362_1036551 3300039453 Unclassified 589
759 Ga0436362_1143208 3300039453 Bacteria 1579
760 Ga0436362_1150066 3300039453 Bacteria 1635
761 Ga0436362_1152312 3300039453 Bacteria 4520
762 Ga0439448_0203172 3300042005 Bacteria 695
763 Ga0439435_0160655 3300042436 Bacteria 725
764 Ga0439435_0222787 3300042436 Unclassified 628
765 Ga0451577_0247707 3300042876 Bacteria 1613
766 Ga0439440_0075149 3300042993 Bacteria 886
767 Ga0453683_0573410 3300044673 Bacteria 735
768 Ga0466963_0419954 3300044694 Unclassified 943
769 Ga0466963_0533307 3300044694 Unclassified 829
770 Ga0466963_1196980 3300044694 Unclassified 534
771 Ga0453684_0424423 3300044712 Unclassified 1485
772 Ga0466971_0334253 3300044719 Unclassified 731
773 Ga0466957_0682033 3300044842 Bacteria 724
774 Ga0466959_0241055 3300045049 Unclassified 1249
775 Ga0451576_0030246 3300045051 Bacteria 5790
776 Ga0451576_0261331 3300045051 Unclassified 1809
777 Ga0451576_0352679 3300045051 Unclassified 1540
778 Ga0451576_2727057 3300045051 Bacteria 503
779 Ga0466958_0269285 3300045836 Bacteria 1091
780 Ga0466967_0048424 3300045976 Bacteria 3711
781 Ga0466967_0441551 3300045976 Unclassified 1271
782 Ga0495592_0011489 3300046454 Bacteria 6703
783 Ga0495592_0029591 3300046454 Bacteria 4147
784 Ga0495629_0272274 3300046459 Bacteria 1163
785 Ga0495629_0307522 3300046459 Bacteria 1085
786 Ga0495651_0046187 3300046462 Unclassified 3371
787 Ga0495651_0125666 3300046462 Unclassified 1878
788 Ga0495651_0159035 3300046462 Bacteria 1620
789 Ga0495580_0073881 3300046472 Bacteria 2380
790 Ga0495580_0094921 3300046472 Bacteria 2075
791 Ga0495582_0035912 3300046473 Bacteria 2726
792 Ga0495582_0493655 3300046473 Bacteria 708
793 Ga0495639_0077830 3300046475 Bacteria 1540
794 Ga0495639_0475911 3300046475 Unclassified 636
795 Ga0495662_0013564 3300046476 Bacteria 3966
796 Ga0495662_0016769 3300046476 Bacteria 3547
797 Ga0495662_0072248 3300046476 Unclassified 1673
798 Ga0495662_0442257 3300046476 Bacteria 638
799 Ga0495664_0119884 3300046477 Bacteria 1591
800 Ga0495608_0419502 3300046511 Bacteria 817
801 Ga0495618_0156689 3300046514 Bacteria 1453
802 Ga0495628_0302442 3300046516 Unclassified 1184
803 Ga0495628_0344477 3300046516 Bacteria 1096
804 Ga0495630_0115514 3300046517 Bacteria 2034
805 Ga0495643_0004442 3300046522 Bacteria 9801
806 Ga0495666_0079097 3300046526 Bacteria 1557
807 Ga0495652_0049094 3300046529 Bacteria 3614
808 Ga0495652_0078174 3300046529 Bacteria 2740
809 Ga0495652_0533403 3300046529 Bacteria 809
810 Ga0495652_0817851 3300046529 Bacteria 619
811 Ga0495665_0306510 3300046531 Unclassified 812
812 Ga0495640_0354609 3300046533 Bacteria 905
813 Ga0495586_0249373 3300046535 Bacteria 1013
814 Ga0495586_0406781 3300046535 Bacteria 783
815 Ga0495587_0002501 3300046536 Bacteria 12273
816 Ga0495587_0028881 3300046536 Bacteria 3370
817 Ga0495587_0029449 3300046536 Bacteria 3333
818 Ga0495587_0153034 3300046536 Bacteria 1314
819 Ga0495587_0364005 3300046536 Unclassified 805
820 Ga0495621_0366035 3300046539 Bacteria 607
821 Ga0495645_0038006 3300046543 Unclassified 3510
822 Ga0495645_0139250 3300046543 Bacteria 1694
823 Ga0495645_0141767 3300046543 Bacteria 1676
824 Ga0495656_0532165 3300046615 Unclassified 625
825 Ga0495634_0140727 3300046642 Bacteria 1532
826 Ga0495635_0028305 3300046663 Bacteria 3895
827 Ga0495635_0406721 3300046663 Unclassified 903
828 Ga0495659_0155993 3300046664 Unclassified 919
829 Ga0495588_0094919 3300046674 Bacteria 1564
830 Ga0495657_0573808 3300046675 Unclassified 654
831 Ga0495599_0028672 3300046678 Bacteria 3488
832 Ga0495599_0173872 3300046678 Bacteria 1328
833 Ga0495623_0096106 3300046679 Unclassified 1811
834 Ga0495623_0165210 3300046679 Bacteria 1297
835 Ga0495623_0259803 3300046679 Bacteria 973
836 Ga0495623_0470720 3300046679 Bacteria 666
837 Ga0495646_0179104 3300046680 Bacteria 1164
838 Ga0495669_0069932 3300046684 Unclassified 1598
839 Ga0495669_0380802 3300046684 Bacteria 683
840 Ga0495613_0366714 3300046689 Bacteria 987
841 Ga0495613_0875830 3300046689 Bacteria 582
842 Ga0495624_0350189 3300046690 Bacteria 888
843 Ga0495624_0641861 3300046690 Bacteria 632
844 Ga0495600_0157640 3300046809 Bacteria 1468
845 Ga0495600_0406791 3300046809 Unclassified 846
846 Ga0495600_0572310 3300046809 Unclassified 689
847 Ga0495604_0226022 3300047317 Bacteria 1286
848 Ga0495674_0055646 3300047319 Bacteria 3468
849 Ga0495674_0082062 3300047319 Unclassified 2765
850 Ga0495674_0131256 3300047319 Bacteria 2111
851 Ga0495674_0898823 3300047319 Unclassified 684
852 Ga0495674_1055307 3300047319 Bacteria 620
853 Ga0495680_0052926 3300047322 Bacteria 3162
854 Ga0495675_0132536 3300047444 Bacteria 1548
855 Ga0495675_0734086 3300047444 Bacteria 551
856 Ga0495684_0004503 3300047471 Bacteria 10882
857 Ga0495684_0011009 3300047471 Bacteria 6994
858 Ga0495684_0020716 3300047471 Bacteria 5066
859 Ga0495684_0208524 3300047471 Bacteria 1438
860 Ga0495684_0857248 3300047471 Unclassified 589
861 Ga0495602_0064130 3300048088 Bacteria 3179
862 Ga0495602_0831201 3300048088 Bacteria 618
863 Ga0495602_0953728 3300048088 Bacteria 568
864 Ga0495602_0995126 3300048088 Unclassified 554
865 Ga0496100_0147667 3300048903 Bacteria 1674
866 Ga0496100_0725046 3300048903 Bacteria 777
867 Ga0496102_0011172 3300048905 Bacteria 7734
868 Ga0496102_0585346 3300048905 Bacteria 1039
869 Ga0496103_0038977 3300048906 Bacteria 2919
870 Ga0496105_0080000 3300048908 Bacteria 2699
871 Ga0496105_0405126 3300048908 Bacteria 1082
872 Ga0496106_0074772 3300048909 Bacteria 2594
873 Ga0496106_1333394 3300048909 Unclassified 556
874 Ga0496108_0391429 3300048911 Bacteria 1214
875 Ga0496109_0242075 3300048912 Unclassified 1698
876 Ga0496109_0502959 3300048912 Unclassified 1144
877 Ga0496110_0042864 3300048913 Bacteria 3950
878 Ga0496111_0811363 3300048914 Bacteria 677
879 Ga0496112_0012842 3300048915 Bacteria 7710
880 Ga0496112_0072712 3300048915 Unclassified 3399
881 Ga0496112_0400872 3300048915 Bacteria 1312
882 Ga0496113_0022458 3300048916 Bacteria 4464
883 Ga0496113_0227868 3300048916 Unclassified 1486
884 Ga0496113_0529324 3300048916 Bacteria 946
885 Ga0496114_0419023 3300048917 Bacteria 1186
886 Ga0496115_0670197 3300048918 Bacteria 818
887 Ga0496126_0300270 3300048929 Bacteria 1325
888 Ga0501299_051150 3300049522 Bacteria 854
889 Ga0501047_0227312 3300049581 Unclassified 1720
890 Ga0501067_0431079 3300049583 Bacteria 736
891 Ga0501070_0042003 3300049586 Unclassified 3808
892 Ga0501071_1308551 3300049587 Unclassified 560
893 Ga0501080_1659463 3300049742 Bacteria 540
894 Ga0501083_0512226 3300049744 Bacteria 781
895 Ga0501264_036586 3300049761 Bacteria 586
896 Ga0501279_039961 3300049775 Unclassified 717
897 Ga0501035_0150616 3300049822 Unclassified 2019
898 Ga0501044_0023985 3300049823 Bacteria 6482
899 Ga0501045_0257635 3300049824 Bacteria 1298
900 Ga0501045_0381204 3300049824 Bacteria 1050
901 nmdc:mga05p37_293167_c1 3300050507 Bacteria 1936
902 nmdc:mga05p37_29338_c1 3300050507 Bacteria 6713
903 nmdc:mga05p37_348324_c1 3300050507 Bacteria 1745
904 nmdc:mga05p37_67576_c1 3300050507 Bacteria 4397
905 nmdc:mga05p37_71966_c1 3300050507 Bacteria 4254
906 nmdc:mga09592_1068608_c1 3300050508 Bacteria 672
907 nmdc:mga09592_184018_c1 3300050508 Bacteria 1807
908 nmdc:mga09592_226088_c1 3300050508 Unclassified 1621
909 nmdc:mga09592_871590_c1 3300050508 Bacteria 758
910 nmdc:mga09592_980529_c1 3300050508 Unclassified 707
911 nmdc:mga0qj67_115272_c1 3300050509 Unclassified 2171
912 nmdc:mga0qj67_153987_c1 3300050509 Bacteria 1865
913 nmdc:mga0qj67_727061_c1 3300050509 Bacteria 789
914 nmdc:mga0qj67_85525_c1 3300050509 Bacteria 2529
915 nmdc:mga0qj67_9852_c1 3300050509 Bacteria 7123
916 nmdc:mga06r32_1055679_c1 3300050510 Bacteria 763
917 nmdc:mga06r32_1092362_c1 3300050510 Unclassified 747
918 nmdc:mga06r32_1094333_c1 3300050510 Unclassified 746
919 nmdc:mga06r32_156877_c1 3300050510 Bacteria 2257
920 nmdc:mga06r32_26374_c2 3300050510 Unclassified 962
921 nmdc:mga06r32_44265_c1 3300050510 Unclassified 4238
922 nmdc:mga06r32_918802_c1 3300050510 Unclassified 831
923 nmdc:mga08y16_1626342_c1 3300050511 Unclassified 603
924 nmdc:mga08y16_27959_c1 3300050511 Bacteria 5946
925 nmdc:mga08y16_2818_c1 3300050511 Bacteria 17856
926 nmdc:mga08y16_373574_c1 3300050511 Bacteria 1462
927 nmdc:mga08y16_386841_c1 3300050511 Bacteria 1433
928 nmdc:mga08y16_393975_c1 3300050511 Unclassified 1418
929 nmdc:mga08y16_593354_c1 3300050511 Bacteria 1117
930 nmdc:mga0n895_11438_c1 3300050512 Bacteria 7918
931 nmdc:mga0n895_1146092_c1 3300050512 Unclassified 753
932 nmdc:mga0n895_1185508_c1 3300050512 Bacteria 738
933 nmdc:mga0n895_15605_c1 3300050512 Bacteria 6934
934 nmdc:mga0n895_209296_c1 3300050512 Bacteria 1981
935 nmdc:mga0n895_30447_c1 3300050512 Bacteria 5158
936 nmdc:mga0n895_557555_c1 3300050512 Bacteria 1151
937 nmdc:mga0n895_86135_c1 3300050512 Unclassified 3138
938 nmdc:mga0rr50_1228403_c1 3300050513 Bacteria 636
939 nmdc:mga0rr50_1402536_c1 3300050513 Bacteria 591
940 nmdc:mga0rr50_31096_c1 3300050513 Unclassified 3787
941 nmdc:mga0a205_109389_c1 3300050515 Unclassified 2662
942 nmdc:mga0a205_126209_c1 3300050515 Bacteria 2459
943 nmdc:mga0a205_15464_c1 3300050515 Bacteria 7133
944 nmdc:mga0a205_181455_c1 3300050515 Bacteria 1999
945 nmdc:mga0a205_192_c1 3300050515 Bacteria 42287
946 nmdc:mga0a205_244010_c1 3300050515 Bacteria 1677
947 nmdc:mga0a205_448999_c1 3300050515 Bacteria 1149
948 nmdc:mga0a205_6048_c1 3300050515 Bacteria 10918
949 nmdc:mga0a205_624_c1 3300050515 Bacteria 28124
950 Ga0495601_0516848 3300053077 Bacteria 770
951 Ga0495595_0408104 3300053084 Bacteria 689
952 Ga0495595_0458637 3300053084 Bacteria 648
953 Ga0495619_0463834 3300053085 Unclassified 873
954 Ga0501082_1553029 3300060353 Unclassified 578
955 Ga0466962_0600037 3300061719 Unclassified 561
956 Ga0530510_1146121 3300061734 Bacteria 596
957 Ga0436365_1710174
958 MBSR1b_contig_2374457
959 MBSR1b_contig_3238983
960 ARcpr5yngRDRAFT_c022125
961 JGI24745J21846_1034316
962 Ga0065704_10326589
963 Ga0065712_10496300
964 Ga0065712_10570198
965 Ga0065715_10102249
966 Ga0065715_10369545
967 Ga0065715_10711949
968 Ga0065715_10796632
969 Ga0065715_10812326
970 Ga0065715_11056152
971 Ga0065707_10019043
972 Ga0065707_10299712
973 Ga0070676_10024796
974 Ga0070676_10384674
975 Ga0070676_10448695
976 Ga0070683_100000012
977 Ga0070683_100077206
978 Ga0070683_101919880
979 Ga0070690_100005077
980 Ga0070690_100273649
981 Ga0070670_100973749
982 Ga0070677_10001801
983 Ga0070677_10003494
984 Ga0070677_10443369
985 Ga0068869_100020157
986 Ga0068869_100040367
987 Ga0070666_10007928
988 Ga0070666_10017201
989 Ga0070666_10409772
990 Ga0070666_10551531
991 Ga0070680_100000822
992 Ga0068868_100017783
993 Ga0068868_101096525
994 Ga0068868_101265445
995 Ga0068868_101460720
996 Ga0070660_100071768
997 Ga0070660_100310474
998 Ga0070689_100041632
999 Ga0070689_100167725
1000 Ga0070689_100217853
1001 Ga0070691_10723620
1002 Ga0070687_100005713
1003 Ga0070687_100376105
1004 Ga0070687_100384743
1005 Ga0070687_101039466
1006 Ga0070687_101171836
1007 Ga0070661_100072510
1008 Ga0070692_10341193
1009 Ga0070668_100156591
1010 Ga0070668_100201406
1011 Ga0070668_101900054
1012 Ga0070669_100002675
1013 Ga0070669_100086064
1014 Ga0070669_100143844
1015 Ga0070669_100322174
1016 Ga0070669_100323428
1017 Ga0070669_100527343
1018 Ga0070669_101157609
1019 Ga0070675_100001787
1020 Ga0070675_100006343
1021 Ga0070675_100058810
1022 Ga0070675_100133359
1023 Ga0070675_100144258
1024 Ga0070671_100035560
1025 Ga0070671_100073889
1026 Ga0070671_100250062
1027 Ga0070674_100000172
1028 Ga0070674_100023066
1029 Ga0070674_100033534
1030 Ga0070674_100064888
1031 Ga0070674_100184969
1032 Ga0070674_101139647
1033 Ga0070673_100047379
1034 Ga0070688_100001785
1035 Ga0070688_100467155
1036 Ga0070688_100989341
1037 Ga0070659_100015168
1038 Ga0070659_100100918
1039 Ga0070659_100142317
1040 Ga0070659_100171925
1041 Ga0070667_100036079
1042 Ga0070667_100706955
1043 Ga0070667_100885236
1044 Ga0070667_101221036
1045 Ga0070667_101933576
1046 Ga0070703_10051757
1047 Ga0070714_100010981
1048 Ga0070714_100227328
1049 Ga0070713_100062030
1050 Ga0070713_100114535
1051 Ga0070713_100123400
1052 Ga0070713_100149127
1053 Ga0070713_101134023
1054 Ga0070710_11350818
1055 Ga0070701_10040824
1056 Ga0070701_11070992
1057 Ga0070711_101295661
1058 Ga0070711_101717388
1059 Ga0070705_100195886
1060 Ga0070694_100031742
1061 Ga0070694_100680322
1062 Ga0070694_101750653
1063 Ga0070708_100011344
1064 Ga0070708_100778013
1065 Ga0070708_102194890
1066 Ga0070663_100219863
1067 Ga0070678_100473267
1068 Ga0070678_101252869
1069 Ga0070662_100029297
1070 Ga0070662_100257071
1071 Ga0070662_100348885
1072 Ga0070662_101030532
1073 Ga0070681_10016588
1074 Ga0070681_10190546
1075 Ga0068867_100045613
1076 Ga0068867_100065686
1077 Ga0068867_100100521
1078 Ga0068867_100142492
1079 Ga0068867_100196678
1080 Ga0068867_102263480
1081 Ga0070685_10041762
1082 Ga0070685_10160404
1083 Ga0070707_100044393
1084 Ga0070707_100478193
1085 Ga0070698_100085229
1086 Ga0070698_100394916
1087 Ga0070698_101557476
1088 Ga0070699_100002633
1089 Ga0070699_100066877
1090 Ga0070699_100614234
1091 Ga0070679_100077002
1092 Ga0070679_100387518
1093 Ga0070679_100421559
1094 Ga0070679_101184054
1095 Ga0070679_101290700
1096 Ga0070679_101319365
1097 Ga0070684_100000013
1098 Ga0070684_100308778
1099 Ga0070684_100655510
1100 Ga0070684_101731353
1101 Ga0070697_100199170
1102 Ga0070697_100643812
1103 Ga0070672_100001740
1104 Ga0070672_101524726
1105 Ga0070686_100004504
1106 Ga0070686_100534064
1107 Ga0070686_100977696
1108 Ga0070686_101092429
1109 Ga0070695_100011689
1110 Ga0070695_100080427
1111 Ga0070695_100510270
1112 Ga0070695_100760693
1113 Ga0070695_100774487
1114 Ga0070696_100166791
1115 Ga0070696_101992653
1116 Ga0070693_100150246
1117 Ga0070693_100206616
1118 Ga0070665_100017706
1119 Ga0070665_100017950
1120 Ga0070665_100095330
1121 Ga0070665_100604900
1122 Ga0070665_100987746
1123 Ga0070665_101578417
1124 Ga0070665_101609535
1125 Ga0070704_100607886
1126 Ga0070704_100958511
1127 Ga0070704_101402346
1128 Ga0068855_100004899
1129 Ga0068855_100022241
1130 Ga0068855_100078988
1131 Ga0068855_100250964
1132 Ga0068855_100519943
1133 Ga0068855_100704013
1134 Ga0068855_101460787
1135 Ga0070664_100005833
1136 Ga0070664_100301090
1137 Ga0070664_100945057
1138 Ga0070664_101202482
1139 Ga0070664_101970807
1140 Ga0068857_100004964
1141 Ga0068857_100132356
1142 Ga0068857_100293713
1143 Ga0068857_100628700
1144 Ga0068857_101094691
1145 Ga0068857_101369270
1146 Ga0068857_101464261
1147 Ga0068856_100009114
1148 Ga0068856_100011460
1149 Ga0068856_100119058
1150 Ga0068852_100006626
1151 Ga0068852_100201990
1152 Ga0068852_100570716
1153 Ga0068852_100600142
1154 Ga0068859_100012492
1155 Ga0068859_100078332
1156 Ga0068859_101235165
1157 Ga0068859_101258353
1158 Ga0068859_101994885
1159 Ga0068859_102142603
1160 Ga0068859_102233019
1161 Ga0068859_102317295
1162 Ga0068864_100049642
1163 Ga0068864_100121711
1164 Ga0068864_100143748
1165 Ga0068864_101158449
1166 Ga0068864_101363451
1167 Ga0068864_101388194
1168 Ga0068864_102147051
1169 Ga0068866_10741305
1170 Ga0068866_11290399
1171 Ga0068861_100537245
1172 Ga0068870_10000827
1173 Ga0068870_10095518
1174 Ga0068863_100002004
1175 Ga0068863_100027325
1176 Ga0068863_100164198
1177 Ga0068863_100590979
1178 Ga0068863_100730569
1179 Ga0068863_100915141
1180 Ga0068863_101155878
1181 Ga0068858_100016775
1182 Ga0068858_100126947
1183 Ga0068858_100325421
1184 Ga0068858_100338839
1185 Ga0068858_100487223
1186 Ga0068858_100698525
1187 Ga0068860_100025560
1188 Ga0068860_100119167
1189 Ga0068860_100359615
1190 Ga0068862_100008067
1191 Ga0068862_100668799
1192 Ga0068862_101443508
1193 Ga0068862_101774069
1194 Ga0081455_10015552
1195 Ga0081455_10925982
1196 Ga0081539_10049033
1197 Ga0081539_10053598
1198 Ga0081539_10095259
1199 Ga0070717_10029188
1200 Ga0070717_10045836
1201 Ga0070717_10458649
1202 Ga0075432_10242619
1203 Ga0070716_101487428
1204 Ga0097621_100018641
1205 Ga0097621_100080294
1206 Ga0097621_100236242
1207 Ga0097621_100247816
1208 Ga0097621_100375911
1209 Ga0068871_100068995
1210 Ga0068871_100389538
1211 Ga0068871_100448384
1212 Ga0068871_100600641
1213 Ga0068871_101829120
1214 Ga0075428_100009050
1215 Ga0075428_100057339
1216 Ga0075428_100161532
1217 Ga0075428_100188377
1218 Ga0075428_101991043
1219 Ga0075430_100015272
1220 Ga0075430_100036082
1221 Ga0075430_100177309
1222 Ga0075430_100466097
1223 Ga0075430_100640283
1224 Ga0075431_100024630
1225 Ga0075431_100046174
1226 Ga0075431_100107620
1227 Ga0075431_100155137
1228 Ga0075431_100752888
1229 Ga0075431_100891114
1230 Ga0075431_100938259
1231 Ga0075431_101790535
1232 Ga0075431_102203713
1233 Ga0075431_102217907
1234 Ga0075433_10000346
1235 Ga0075433_10005849
1236 Ga0075433_10007651
1237 Ga0075433_10081808
1238 Ga0075433_10232463
1239 Ga0075433_10306734
1240 Ga0075433_10330384
1241 Ga0075433_10447439
1242 Ga0075433_11448959
1243 Ga0075434_100006772
1244 Ga0075434_100011872
1245 Ga0075434_100028945
1246 Ga0075434_100032810
1247 Ga0075434_100064092
1248 Ga0075434_102204051
1249 Ga0075429_100214494
1250 Ga0075429_100274571
1251 Ga0075429_101376659
1252 Ga0075429_101379937
1253 Ga0068865_100045749
1254 Ga0068865_100061622
1255 Ga0068865_100469833
1256 Ga0068865_100630593
1257 Ga0068865_101074537
1258 Ga0068865_101086330
1259 Ga0075436_101126946
1260 Ga0097620_100012492
1261 Ga0097620_100078328
1262 Ga0097620_101235263
1263 Ga0097620_101258099
1264 Ga0097620_101994922
1265 Ga0097620_102142408
1266 Ga0097620_102233349
1267 Ga0097620_102316199
1268 Ga0075435_100021977
1269 Ga0075435_100039064
1270 Ga0099794_10427793
1271 Ga0105240_10009440
1272 Ga0105240_10017856
1273 Ga0105240_10017899
1274 Ga0105240_10025280
1275 Ga0105240_10110658
1276 Ga0105240_10246699
1277 Ga0105240_10253765
1278 Ga0105240_10584004
1279 Ga0111539_10001233
1280 Ga0111539_10022643
1281 Ga0111539_10287498
1282 Ga0111539_10476455
1283 Ga0111539_10581396
1284 Ga0111539_10773869
1285 Ga0111539_13096418
1286 Ga0105245_10002014
1287 Ga0105245_10002505
1288 Ga0105245_10009708
1289 Ga0105245_10289552
1290 Ga0105245_10568617
1291 Ga0105245_11047100
1292 Ga0105245_12266193
1293 Ga0105247_10013117
1294 Ga0114129_10000872
1295 Ga0114129_10006410
1296 Ga0114129_10011701
1297 Ga0114129_10013537
1298 Ga0114129_10071421
1299 Ga0114129_10078548
1300 Ga0114129_10262787
1301 Ga0114129_10380504
1302 Ga0114129_11089316
1303 Ga0114129_11232204
1304 Ga0114129_11728419
1305 Ga0114129_12384782
1306 Ga0105243_11490730
1307 Ga0105243_11819062
1308 Ga0105241_10170106
1309 Ga0105241_10568657
1310 Ga0105241_10779179
1311 Ga0105241_11200613
1312 Ga0105241_12571931
1313 Ga0105242_10011639
1314 Ga0105242_10351971
1315 Ga0105242_11565913
1316 Ga0105242_12413055
1317 Ga0105242_13236372
1318 Ga0105242_13258348
1319 Ga0105248_10002325
1320 Ga0105248_10031048
1321 Ga0105248_10039057
1322 Ga0105248_10075883
1323 Ga0105248_10243843
1324 Ga0105248_10360238
1325 Ga0105248_10842328
1326 Ga0105248_10935760
1327 Ga0105248_11155085
1328 Ga0105237_10004243
1329 Ga0105237_10009915
1330 Ga0105237_10101389
1331 Ga0105237_11321262
1332 Ga0105238_10007616
1333 Ga0105238_10043000
1334 Ga0105238_10182192
1335 Ga0105238_10287111
1336 Ga0105238_12480677
1337 Ga0105238_12884539
1338 Ga0105249_10012319
1339 Ga0105249_10115048
1340 Ga0105249_10148147
1341 Ga0105249_10260838
1342 Ga0105249_10526142
1343 Ga0105249_10670162
1344 Ga0105249_11677985
1345 Ga0105249_11741741
1346 Ga0105249_13419119
1347 Ga0099796_10290507
1348 Ga0105239_10018004
1349 Ga0105239_10350431
1350 Ga0105239_11071634
1351 Ga0105239_12117699
1352 Ga0105246_10005035
1353 Ga0105246_10085041
1354 Ga0105246_10193560
1355 Ga0105246_10505814
1356 Ga0105246_10933485
1357 Ga0157373_10708319
1358 Ga0157371_10091446
1359 Ga0157370_10002587
1360 Ga0157370_10002772
1361 Ga0157370_10178721
1362 Ga0157370_10241430
1363 Ga0157370_10292415
1364 Ga0157370_11028913
1365 Ga0157369_10004043
1366 Ga0157369_10004682
1367 Ga0157369_10048017
1368 Ga0157369_10083429
1369 Ga0157369_10114496
1370 Ga0157369_10791071
1371 Ga0157374_10042798
1372 Ga0157374_10072225
1373 Ga0157374_10705491
1374 Ga0157378_10004146
1375 Ga0157378_10030115
1376 Ga0157378_10393345
1377 Ga0163162_10016275
1378 Ga0163162_10508575
1379 Ga0163162_11019159
1380 Ga0163162_11352922
1381 Ga0163162_11401254
1382 Ga0163162_12869985
1383 Ga0157372_10040352
1384 Ga0157372_10062279
1385 Ga0157372_10075704
1386 Ga0157372_10363691
1387 Ga0157372_10405661
1388 Ga0157372_10424329
1389 Ga0157375_10001615
1390 Ga0157375_10136128
1391 Ga0157375_10820903
1392 Ga0157375_10910029
1393 Ga0157375_12447577
1394 Ga0157375_13691749
1395 Ga0163163_10160418
1396 Ga0163163_10509583
1397 Ga0163163_10608914
1398 Ga0163163_10721808
1399 Ga0157380_10016775
1400 Ga0157380_10045075
1401 Ga0157380_10049039
1402 Ga0157380_10101478
1403 Ga0157377_10154344
1404 Ga0157377_10356874
1405 Ga0157379_10061437
1406 Ga0157379_10466823
1407 Ga0157379_10840991
1408 Ga0157379_11481065
1409 Ga0157376_10043035
1410 Ga0157376_10692646
1411 Ga0157376_10775373
1412 Ga0157376_11108659
1413 Ga0157376_11156925
1414 Ga0163161_10336548
1415 Ga0163161_10623920
1416 Ga0163161_10675987
1417 Ga0163161_10756462
1418 Ga0197907_10297313
1419 Ga0213873_10300292
1420 Ga0213874_10020315
1421 Ga0213874_10039399
1422 Ga0213876_10111686
1423 Ga0213876_10150618
1424 Ga0213875_10000008
1425 Ga0213875_10000088
1426 Ga0213875_10041295
1427 Ga0213875_10044896
1428 Ga0213875_10049259
1429 Ga0213875_10118805
1430 Ga0213875_10356341
1431 Ga0207697_10002108
1432 Ga0207653_10194715
1433 Ga0207653_10431281
1434 Ga0207682_10001721
1435 Ga0207682_10019081
1436 Ga0207682_10326483
1437 Ga0207692_10892980
1438 Ga0207642_10352210
1439 Ga0207642_10617997
1440 Ga0207688_10010146
1441 Ga0207688_10155824
1442 Ga0207680_10051516
1443 Ga0207680_10137549
1444 Ga0207680_10682436
1445 Ga0207647_10121883
1446 Ga0207699_10802207
1447 Ga0207645_10016931
1448 Ga0207645_10029523
1449 Ga0207643_10000158
1450 Ga0207684_11419234
1451 Ga0207654_10115834
1452 Ga0207654_10305737
1453 Ga0207654_10488975
1454 Ga0207707_10274480
1455 Ga0207707_10398116
1456 Ga0207707_11363171
1457 Ga0207695_10002722
1458 Ga0207695_10006239
1459 Ga0207695_10061336
1460 Ga0207695_10238194
1461 Ga0207695_10275376
1462 Ga0207695_10688839
1463 Ga0207695_10711079
1464 Ga0207695_10898420
1465 Ga0207695_11573272
1466 Ga0207671_10023090
1467 Ga0207671_10172656
1468 Ga0207671_10725728
1469 Ga0207693_10574083
1470 Ga0207663_10172177
1471 Ga0207663_10468819
1472 Ga0207660_10001537
1473 Ga0207660_10294164
1474 Ga0207662_10006624
1475 Ga0207662_10222802
1476 Ga0207657_10148823
1477 Ga0207657_10259544
1478 Ga0207649_10028909
1479 Ga0207652_10056026
1480 Ga0207652_10312234
1481 Ga0207652_11179297
1482 Ga0207652_11704479
1483 Ga0207646_10119769
1484 Ga0207646_11154959
1485 Ga0207681_10107503
1486 Ga0207681_10159670
1487 Ga0207681_11163979
1488 Ga0207694_10006271
1489 Ga0207694_10011679
1490 Ga0207694_10012169
1491 Ga0207694_10244938
1492 Ga0207694_10551619
1493 Ga0207650_11673695
1494 Ga0207659_10002688
1495 Ga0207659_10005321
1496 Ga0207659_10021596
1497 Ga0207659_10056372
1498 Ga0207659_10178586
1499 Ga0207687_10001770
1500 Ga0207687_10006219
1501 Ga0207687_10008662
1502 Ga0207687_10394933
1503 Ga0207687_10762750
1504 Ga0207700_10048966
1505 Ga0207700_10101665
1506 Ga0207700_10132761
1507 Ga0207700_10316516
1508 Ga0207664_10083195
1509 Ga0207664_10338160
1510 Ga0207664_11100935
1511 Ga0207644_10371008
1512 Ga0207644_10783243
1513 Ga0207690_10089869
1514 Ga0207690_10389921
1515 Ga0207690_10448122
1516 Ga0207706_10005297
1517 Ga0207706_10139231
1518 Ga0207706_10702969
1519 Ga0207706_10842530
1520 Ga0207686_10092629
1521 Ga0207686_10629332
1522 Ga0207686_11030020
1523 Ga0207709_11504096
1524 Ga0207670_10066315
1525 Ga0207670_10091516
1526 Ga0207670_10950897
1527 Ga0207669_10000320
1528 Ga0207669_10018836
1529 Ga0207669_10194243
1530 Ga0207669_10363627
1531 Ga0207669_10480342
1532 Ga0207704_10375752
1533 Ga0207704_10477397
1534 Ga0207704_10813465
1535 Ga0207704_11370728
1536 Ga0207665_11442112
1537 Ga0207691_10009994
1538 Ga0207691_11358431
1539 Ga0207691_11470921
1540 Ga0207711_10001367
1541 Ga0207711_10249930
1542 Ga0207711_10257693
1543 Ga0207711_10559401
1544 Ga0207711_10755618
1545 Ga0207689_10004173
1546 Ga0207689_10031190
1547 Ga0207689_10184716
1548 Ga0207689_11350153
1549 Ga0207661_10000034
1550 Ga0207661_10032874
1551 Ga0207661_10489924
1552 Ga0207679_10003829
1553 Ga0207679_10224252
1554 Ga0207679_10527864
1555 Ga0207679_11269185
1556 Ga0207679_11461844
1557 Ga0207679_11696962
1558 Ga0207679_11822490
1559 Ga0207667_10014002
1560 Ga0207667_10039277
1561 Ga0207667_10464551
1562 Ga0207667_10543877
1563 Ga0207667_10971523
1564 Ga0207651_10046980
1565 Ga0207712_10062750
1566 Ga0207712_10063516
1567 Ga0207712_10067020
1568 Ga0207668_11414509
1569 Ga0207658_10055402
1570 Ga0207658_10934832
1571 Ga0207677_10351395
1572 Ga0207677_10509703
1573 Ga0207677_10819647
1574 Ga0207703_10208405
1575 Ga0207703_10295250
1576 Ga0207703_10688740
1577 Ga0207639_10370799
1578 Ga0207639_11753531
1579 Ga0207678_10159415
1580 Ga0207678_10251107
1581 Ga0207678_11520129
1582 Ga0207678_11585622
1583 Ga0207708_11754702
1584 Ga0207702_10009873
1585 Ga0207702_10099839
1586 Ga0207702_10196012
1587 Ga0207702_11139817
1588 Ga0207641_10025118
1589 Ga0207641_10075997
1590 Ga0207641_10339680
1591 Ga0207648_10021097
1592 Ga0207648_10067339
1593 Ga0207648_10176992
1594 Ga0207648_10403549
1595 Ga0207648_10453314
1596 Ga0207648_10778467
1597 Ga0207676_10107414
1598 Ga0207676_10508702
1599 Ga0207676_10956100
1600 Ga0207676_11515391
1601 Ga0207674_10013841
1602 Ga0207674_10147960
1603 Ga0207674_10537201
1604 Ga0207674_10606827
1605 Ga0207674_10668245
1606 Ga0207675_100029718
1607 Ga0207675_100426275
1608 Ga0207683_10000925
1609 Ga0207683_10110895
1610 Ga0207683_10501605
1611 Ga0207698_10033565
1612 Ga0207698_10928244
1613 Ga0207698_11565093
1614 Ga0207428_10001518
1615 Ga0207428_10002065
1616 Ga0207428_10528397
1617 Ga0207428_10777687
1618 Ga0268266_10069504
1619 Ga0268266_10540497
1620 Ga0268266_10554587
1621 Ga0268266_12316798
1622 Ga0268265_10011411
1623 Ga0268265_10269833
1624 Ga0268265_10671428
1625 Ga0268264_10079301
1626 Ga0268264_10139958
1627 Ga0265323_10005006
1628 Ga0265330_10184550
1629 Ga0265332_10106897
1630 Ga0265328_10465931
1631 Ga0265325_10367172
1632 Ga0265340_10032541
1633 Ga0265316_10001914
1634 Ga0265316_10028222
1635 Ga0307408_100161333
1636 Ga0265313_10007334
1637 Ga0265314_10000776
1638 Ga0265314_10011058
1639 Ga0307412_12329803
1640 Ga0307409_102756694
1641 Ga0307416_100328758
1642 Ga0307416_101754649
1643 Ga0307416_102879660
1644 Ga0307411_10397072
1645 Ga0373958_0021245
1646 Ga0373934_0000774
1647 Ga0373934_0140077
1648 Ga0373934_0211441
1649 Ga0373944_0189288
1650 Ga0373944_0272110
1651 Ga0373939_0004091
1652 Ga0373953_0295905
1653 Ga0373954_0001092
1654 Ga0373954_0364941
1655 Ga0373954_0498346
1656 Ga0373956_0046850
1657 Ga0373956_0281115
1658 Ga0373956_0511122
1659 Ga0373957_0016513
1660 Ga0373957_0127705
1661 Ga0373957_0240987
1662 Ga0373957_0455455
1663 Ga0373943_0174658
1664 Ga0373955_0339260
1665 Ga0373955_0809177
1666 Ga0373961_0378758
1667 Ga0373962_0124166
1668 Ga0373931_0714899
1669 Ga0373935_0327163
1670 Ga0373935_0582452
1671 Ga0373933_0132902
1672 Ga0373933_0830147
1673 Ga0373933_1143320
1674 Ga0373947_0171519
1675 Ga0373947_0402834
1676 Ga0373937_0003513
1677 Ga0373937_0065954
1678 Ga0373937_0159751
1679 Ga0373937_0166851
1680 Ga0373937_0218205
1681 Ga0373937_0612321
1682 Ga0373937_0638915
1683 Ga0373925_0017088
1684 Ga0373925_0221379
1685 Ga0395905_0869232
1686 Ga0436364_0091827
1687 Ga0436364_0117819
1688 Ga0436364_0154123
1689 Ga0436364_0278774
1690 Ga0436364_0466454
1691 Ga0436364_0511894
1692 Ga0436364_0562228
1693 Ga0436364_0568781
1694 Ga0436364_0613877
1695 Ga0436364_0772554
1696 Ga0436364_0938901
1697 Ga0436364_0993293
1698 Ga0436364_1172528
1699 Ga0436364_1415525
1700 Ga0436364_1527124
1701 Ga0436365_0405905
1702 Ga0436365_0480035
1703 Ga0436365_0712875
1704 Ga0436365_1270184
1705 Ga0436365_1884243
1706 Ga0436361_0981129
1707 Ga0436363_0689488
1708 Ga0436363_0933554
1709 Ga0436363_1135331
1710 Ga0436363_1279168
1711 Ga0436363_1416554
1712 Ga0436362_0443984
1713 Ga0436362_0973259
1714 Ga0436362_1036551
1715 Ga0436362_1143208
1716 Ga0436362_1150066
1717 Ga0436362_1152312
1718 Ga0439448_0203172
1719 Ga0439435_0160655
1720 Ga0439435_0222787
1721 Ga0451577_0247707
1722 Ga0439440_0075149
1723 Ga0453683_0573410
1724 Ga0466963_0419954
1725 Ga0466963_0533307
1726 Ga0466963_1196980
1727 Ga0453684_0424423
1728 Ga0466971_0334253
1729 Ga0466957_0682033
1730 Ga0466959_0241055
1731 Ga0451576_0030246
1732 Ga0451576_0261331
1733 Ga0451576_0352679
1734 Ga0451576_2727057
1735 Ga0466958_0269285
1736 Ga0466967_0048424
1737 Ga0466967_0441551
1738 Ga0495592_0011489
1739 Ga0495592_0029591
1740 Ga0495629_0272274
1741 Ga0495629_0307522
1742 Ga0495651_0046187
1743 Ga0495651_0125666
1744 Ga0495651_0159035
1745 Ga0495580_0073881
1746 Ga0495580_0094921
1747 Ga0495582_0035912
1748 Ga0495582_0493655
1749 Ga0495639_0077830
1750 Ga0495639_0475911
1751 Ga0495662_0013564
1752 Ga0495662_0016769
1753 Ga0495662_0072248
1754 Ga0495662_0442257
1755 Ga0495664_0119884
1756 Ga0495608_0419502
1757 Ga0495618_0156689
1758 Ga0495628_0302442
1759 Ga0495628_0344477
1760 Ga0495630_0115514
1761 Ga0495643_0004442
1762 Ga0495666_0079097
1763 Ga0495652_0049094
1764 Ga0495652_0078174
1765 Ga0495652_0533403
1766 Ga0495652_0817851
1767 Ga0495665_0306510
1768 Ga0495640_0354609
1769 Ga0495586_0249373
1770 Ga0495586_0406781
1771 Ga0495587_0002501
1772 Ga0495587_0028881
1773 Ga0495587_0029449
1774 Ga0495587_0153034
1775 Ga0495587_0364005
1776 Ga0495621_0366035
1777 Ga0495645_0038006
1778 Ga0495645_0139250
1779 Ga0495645_0141767
1780 Ga0495656_0532165
1781 Ga0495634_0140727
1782 Ga0495635_0028305
1783 Ga0495635_0406721
1784 Ga0495659_0155993
1785 Ga0495588_0094919
1786 Ga0495657_0573808
1787 Ga0495599_0028672
1788 Ga0495599_0173872
1789 Ga0495623_0096106
1790 Ga0495623_0165210
1791 Ga0495623_0259803
1792 Ga0495623_0470720
1793 Ga0495646_0179104
1794 Ga0495669_0069932
1795 Ga0495669_0380802
1796 Ga0495613_0366714
1797 Ga0495613_0875830
1798 Ga0495624_0350189
1799 Ga0495624_0641861
1800 Ga0495600_0157640
1801 Ga0495600_0406791
1802 Ga0495600_0572310
1803 Ga0495604_0226022
1804 Ga0495674_0055646
1805 Ga0495674_0082062
1806 Ga0495674_0131256
1807 Ga0495674_0898823
1808 Ga0495674_1055307
1809 Ga0495680_0052926
1810 Ga0495675_0132536
1811 Ga0495675_0734086
1812 Ga0495684_0004503
1813 Ga0495684_0011009
1814 Ga0495684_0020716
1815 Ga0495684_0208524
1816 Ga0495684_0857248
1817 Ga0495602_0064130
1818 Ga0495602_0831201
1819 Ga0495602_0953728
1820 Ga0495602_0995126
1821 Ga0496100_0147667
1822 Ga0496100_0725046
1823 Ga0496102_0011172
1824 Ga0496102_0585346
1825 Ga0496103_0038977
1826 Ga0496105_0080000
1827 Ga0496105_0405126
1828 Ga0496106_0074772
1829 Ga0496106_1333394
1830 Ga0496108_0391429
1831 Ga0496109_0242075
1832 Ga0496109_0502959
1833 Ga0496110_0042864
1834 Ga0496111_0811363
1835 Ga0496112_0012842
1836 Ga0496112_0072712
1837 Ga0496112_0400872
1838 Ga0496113_0022458
1839 Ga0496113_0227868
1840 Ga0496113_0529324
1841 Ga0496114_0419023
1842 Ga0496115_0670197
1843 Ga0496126_0300270
1844 Ga0501299_051150
1845 Ga0501047_0227312
1846 Ga0501067_0431079
1847 Ga0501070_0042003
1848 Ga0501071_1308551
1849 Ga0501080_1659463
1850 Ga0501083_0512226
1851 Ga0501264_036586
1852 Ga0501279_039961
1853 Ga0501035_0150616
1854 Ga0501044_0023985
1855 Ga0501045_0257635
1856 Ga0501045_0381204
1857 nmdc:mga05p37_293167_c1
1858 nmdc:mga05p37_29338_c1
1859 nmdc:mga05p37_348324_c1
1860 nmdc:mga05p37_67576_c1
1861 nmdc:mga05p37_71966_c1
1862 nmdc:mga09592_1068608_c1
1863 nmdc:mga09592_184018_c1
1864 nmdc:mga09592_226088_c1
1865 nmdc:mga09592_871590_c1
1866 nmdc:mga09592_980529_c1
1867 nmdc:mga0qj67_115272_c1
1868 nmdc:mga0qj67_153987_c1
1869 nmdc:mga0qj67_727061_c1
1870 nmdc:mga0qj67_85525_c1
1871 nmdc:mga0qj67_9852_c1
1872 nmdc:mga06r32_1055679_c1
1873 nmdc:mga06r32_1092362_c1
1874 nmdc:mga06r32_1094333_c1
1875 nmdc:mga06r32_156877_c1
1876 nmdc:mga06r32_26374_c2
1877 nmdc:mga06r32_44265_c1
1878 nmdc:mga06r32_918802_c1
1879 nmdc:mga08y16_1626342_c1
1880 nmdc:mga08y16_27959_c1
1881 nmdc:mga08y16_2818_c1
1882 nmdc:mga08y16_373574_c1
1883 nmdc:mga08y16_386841_c1
1884 nmdc:mga08y16_393975_c1
1885 nmdc:mga08y16_593354_c1
1886 nmdc:mga0n895_11438_c1
1887 nmdc:mga0n895_1146092_c1
1888 nmdc:mga0n895_1185508_c1
1889 nmdc:mga0n895_15605_c1
1890 nmdc:mga0n895_209296_c1
1891 nmdc:mga0n895_30447_c1
1892 nmdc:mga0n895_557555_c1
1893 nmdc:mga0n895_86135_c1
1894 nmdc:mga0rr50_1228403_c1
1895 nmdc:mga0rr50_1402536_c1
1896 nmdc:mga0rr50_31096_c1
1897 nmdc:mga0a205_109389_c1
1898 nmdc:mga0a205_126209_c1
1899 nmdc:mga0a205_15464_c1
1900 nmdc:mga0a205_181455_c1
1901 nmdc:mga0a205_192_c1
1902 nmdc:mga0a205_244010_c1
1903 nmdc:mga0a205_448999_c1
1904 nmdc:mga0a205_6048_c1
1905 nmdc:mga0a205_624_c1
1906 Ga0495601_0516848
1907 Ga0495595_0408104
1908 Ga0495595_0458637
1909 Ga0495619_0463834
1910 Ga0501082_1553029
1911 Ga0466962_0600037
1912 Ga0530510_1146121

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

16

89

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9486 12 105
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9455 9 103
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9288 8 107
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9163 5 103
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9122 9 109
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9422 9 105 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9284 9 102 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9242 16 82 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9163 5 103 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9042 12 92 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Q6Y065-F1-model_v4 PadR family transcriptional regulator 0.9965 8 106
AF-A0A1I4FIW9-F1-model_v4 Transcriptional regulator, PadR family 0.9952 14 108
AF-A0A4Q7XXC7-F1-model_v4 PadR family transcriptional regulator 0.9951 9 105 GO:0000150
GO:0003677
AF-A0A7W7ZJD9-F1-model_v4 Transcriptional regulator 0.9946 15 107
AF-A0A2V8J116-F1-model_v4 PadR family transcriptional regulator 0.9939 15 108

Map