F486696

General Info

Members Datasets Scaffolds Average Seq Length
954 562 754 151

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8046767195|8046773885
Length 176
Sequence AKPRLRVQSDAQRSCNETTSVTMIYVDADACPVKSEILKVAERHGIEVTLVANSGLRPSRDPMVKNVIVSNAFDAADNWIAEHAGPGDIVVTADVPLAGRCVTVGALVTGPSGRIFDNTNIGMVTAMRDLGAHLRETGESKGYNAAFTPRDRSAFLETFDRLCRRAKAHNPPGGQP

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
6 2516143018 Ensifer sp. BR816 Isolate Nodule
7 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
8 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
9 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
10 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
11 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
12 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
13 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
14 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
15 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
16 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
17 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
18 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
19 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
20 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
21 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
22 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
23 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
24 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
25 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
26 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
27 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
28 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
29 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
30 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
31 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
32 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
33 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
34 2643221557 Ensifer sp. Root558 Isolate Unclassified
35 2643221582 Rhizobium sp. Root651 Isolate Unclassified
36 2643221607 Rhizobium sp. Root73 Isolate Unclassified
37 2643221610 Ensifer sp. Root74 Isolate Unclassified
38 2643221618 Ensifer sp. Root231 Isolate Unclassified
39 2643221626 Ensifer sp. Root31 Isolate Unclassified
40 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
41 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
42 2643221655 Ensifer sp. Root1252 Isolate Unclassified
43 2643221659 Ensifer sp. Root127 Isolate Unclassified
44 2643221668 Ensifer sp. Root423 Isolate Unclassified
45 2643221675 Ensifer sp. Root1298 Isolate Unclassified
46 2643221680 Ensifer sp. Root1312 Isolate Unclassified
47 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
48 2643221688 Rhizobium sp. Root482 Isolate Unclassified
49 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
50 2643221693 Rhizobium sp. Root491 Isolate Unclassified
51 2643221698 Ensifer sp. Root142 Isolate Unclassified
52 2643221712 Ensifer sp. Root258 Isolate Unclassified
53 2643221718 Rhizobium sp. Root268 Isolate Unclassified
54 2643221723 Ensifer sp. Root278 Isolate Unclassified
55 2643221726 Ensifer sp. Root954 Isolate Unclassified
56 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
57 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
58 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
59 2718217927 Rhizobium sp. N324 Isolate Nodule
60 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
61 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
62 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
63 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
64 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
65 2718218423 Rhizobium sp. N941 Isolate Nodule
66 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
67 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
68 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
69 2721755809 Rhizobium sp. N541 Isolate Nodule
70 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
71 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
72 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
73 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
74 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
75 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
76 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
77 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
78 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
79 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
80 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
81 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
82 2791355256 Rhizobium sp. M10 Isolate Nodule
83 2791355262 Rhizobium sp. M1 Isolate Nodule
84 2791355265 Rhizobium sp. H4 Isolate Nodule
85 2791355267 Rhizobium sp. L18 Isolate Nodule
86 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
87 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
88 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
89 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
90 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
91 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
92 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
93 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
94 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
95 2838048938 Rhizobium pisi 27/80 Isolate Nodule
96 2838061910 Rhizobium phaseoli L15 Isolate Nodule
97 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
98 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
99 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
100 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
101 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
102 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
103 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
104 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
105 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
106 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
107 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
108 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
109 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
110 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
111 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
112 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
113 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
114 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
115 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
116 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
117 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
118 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
119 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
120 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
121 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
122 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
123 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
124 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
125 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
126 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
127 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
128 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
129 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
130 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
131 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
132 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
133 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
134 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
135 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
136 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
137 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
138 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
139 2844163670 Ensifer sp. 1H6 Isolate Unclassified
140 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
141 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
142 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
143 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
144 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
145 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
146 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
147 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
148 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
149 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
150 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
151 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
152 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
153 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
154 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
155 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
156 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
157 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
158 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
159 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
160 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
161 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
162 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
163 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
164 2933599457 Rhizobium phaseoli M3 Isolate Nodule
165 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
166 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
167 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
168 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
169 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
170 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
171 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
172 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
173 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
174 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
175 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
176 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
177 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
178 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
179 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
180 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
181 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
182 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
183 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
184 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
185 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
186 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
187 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
188 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
189 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
190 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
191 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
192 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
193 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
194 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
195 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
196 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
197 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
198 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
199 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
200 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
201 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
202 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
203 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
204 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
205 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
206 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
207 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
208 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
209 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
210 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
211 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
212 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
213 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
214 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
215 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
216 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
217 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
218 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
219 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
220 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
221 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
222 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
223 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
224 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
225 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
226 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
227 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
228 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
229 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
230 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
231 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
232 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
233 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
234 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
235 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
236 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
237 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
238 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
239 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
240 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
241 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
242 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
243 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
244 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
245 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
246 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
247 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
248 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
249 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
250 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
251 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
252 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
253 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
254 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
255 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
256 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
257 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
258 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
259 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
260 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
261 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
262 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
263 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
264 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
265 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
266 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
267 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
268 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
269 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
270 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
271 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
272 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
273 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
274 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
275 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
276 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
277 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
278 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
279 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
280 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
281 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
282 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
283 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
284 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
285 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
287 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
288 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
289 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
290 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
292 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
293 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
294 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
295 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
297 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
298 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
300 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
302 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
305 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
341 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
342 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
343 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
345 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
348 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
349 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
350 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
351 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
352 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
353 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
354 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
355 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
356 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
357 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
358 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
359 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
360 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
361 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
362 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
363 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
364 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
365 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
366 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
367 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
368 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
369 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
370 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
371 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
372 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
373 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
374 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
375 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
376 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
377 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
378 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
379 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
380 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
381 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
382 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
383 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
384 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
385 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
386 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
387 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
388 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
389 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
390 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
391 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
392 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
393 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
394 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
395 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
396 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
397 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
398 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
399 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
400 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
401 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
402 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
403 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
404 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
405 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
406 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
407 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
408 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
409 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
410 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
411 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
412 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
413 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
414 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
415 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
416 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
417 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
418 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
419 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
420 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
421 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
422 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
423 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
424 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
425 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
426 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
427 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
428 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
429 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
430 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
431 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
432 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
433 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
434 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
435 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
436 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
437 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
438 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
439 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
440 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
441 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
442 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
443 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
444 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
445 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
446 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
447 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
448 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
449 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
450 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
451 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
452 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
453 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
454 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
455 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
456 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
457 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
458 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
459 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
460 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
461 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
462 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
463 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
464 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
465 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
466 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
467 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
468 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
469 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
470 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
471 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
472 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
475 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
476 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
477 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
478 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
479 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
491 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
492 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
493 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
494 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
496 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
497 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
498 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
499 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
500 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
501 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
502 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
503 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
504 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
505 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
506 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
507 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
508 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
509 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
510 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
511 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
512 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
513 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
514 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
515 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
516 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
517 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
518 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
519 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
520 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
521 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
522 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
523 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
524 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
525 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
526 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
527 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
528 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
529 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
530 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
531 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
532 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
533 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
534 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
535 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
536 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
537 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
538 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
540 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
541 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
542 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
543 8005275841 Rhizobium sp. N4311 Isolate Nodule
544 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
545 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
546 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
547 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
548 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
549 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
550 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
551 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
552 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
553 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
554 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
555 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
556 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
557 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
558 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
559 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
560 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
561 8056382006 Rhizobium croatiense 13T Isolate Nodule
562 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.83
Metatranscriptomes 0.1
Isolates 21.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0
Endosphere 25.79
Nodule 12.05
Rhizoplane 3.46
Rhizosphere 40.15
Stem 0
Stem Tuber 0
Unclassified 18.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000215 3300002704 Bacteria 23334
2 JGI25156J39149_1000491 3300002705 Bacteria 23712
3 JGI25162J39368_1001915 3300002737 Bacteria 9531
4 JGI25162J39368_1002069 3300002737 Bacteria 8657
5 JGI25154J39366_1000407 3300002738 Bacteria 23364
6 JGI25157J39369_1000515 3300002741 Bacteria 23712
7 JGI25152J39213_1001157 3300002773 Bacteria 12218
8 JGI25152J39213_1008120 3300002773 Bacteria 2636
9 JGI25152J39213_1034106 3300002773 Bacteria 761
10 JGI25150J39212_1004568 3300002774 Bacteria 3059
11 JGI25159J45721_1000220 3300002987 Bacteria 26975
12 JGI25159J45721_1000293 3300002987 Bacteria 23430
13 JGI25159J45721_1000891 3300002987 Bacteria 12978
14 JGI25151J46595_10001450 3300003187 Bacteria 16080
15 JGI25151J46595_10045933 3300003187 Bacteria 1536
16 JGI25165J46597_1001761 3300003214 Bacteria 9426
17 JGI25165J46597_1001866 3300003214 Bacteria 8669
18 JGI25165J46597_1008613 3300003214 Bacteria 1589
19 JGI25153J46596_10004664 3300003215 Bacteria 7325
20 JGI25153J46596_10007765 3300003215 Bacteria 5218
21 JGI25153J46596_10008138 3300003215 Bacteria 5052
22 JGI25153J46596_10014056 3300003215 Bacteria 3349
23 JGI25153J46596_10087314 3300003215 Bacteria 762
24 JGI25153J46596_10087416 3300003215 Bacteria 761
25 rootL2_10300359 3300003322 Bacteria 1029
26 rootL2_10352967 3300003322 Bacteria 1332
27 rootH1_10048537 3300003323 Bacteria 1707
28 rootH1_10184069 3300003316 Bacteria 4017
29 rootH1_10184069 3300003323 Bacteria 2243
30 JGI25160J50197_1000010 3300003354 Bacteria 279365
31 JGI25160J50197_1000711 3300003354 Bacteria 18324
32 JGI25160J50197_1053583 3300003354 Bacteria 842
33 JGI25161J50226_1000006 3300003374 Bacteria 279563
34 JGI25161J50226_1000055 3300003374 Bacteria 104131
35 JGI25161J50226_1000285 3300003374 Bacteria 28780
36 JGI25161J50226_1000833 3300003374 Bacteria 11528
37 Ga0055539_1013472 3300003752 Bacteria 1001
38 Ga0055526_1004953 3300003771 Bacteria 7820
39 Ga0055526_1005675 3300003771 Bacteria 7083
40 Ga0055526_1023683 3300003771 Bacteria 2041
41 Ga0055524_1001908 3300003775 Bacteria 11299
42 Ga0055524_1012070 3300003775 Bacteria 3337
43 Ga0055524_1013230 3300003775 Bacteria 3122
44 Ga0055524_1019251 3300003775 Bacteria 2339
45 Ga0055524_1030501 3300003775 Bacteria 1571
46 Ga0055536_1001205 3300003781 Bacteria 16057
47 Ga0055528_1001381 3300003790 Bacteria 14899
48 Ga0055528_1001394 3300003790 Bacteria 14836
49 Ga0055528_1023071 3300003790 Bacteria 1912
50 Ga0055530_10027282 3300003791 Bacteria 1562
51 Ga0055540_1002604 3300003792 Bacteria 9389
52 Ga0055540_1035489 3300003792 Bacteria 1114
53 Ga0055531_10016787 3300003794 Bacteria 3134
54 Ga0055531_10056484 3300003794 Bacteria 990
55 Ga0055543_1000014 3300004625 Bacteria 177906
56 Ga0055543_1000032 3300004625 Bacteria 130218
57 Ga0055543_1001114 3300004625 Bacteria 11566
58 Ga0065165_1000262 3300005262 Bacteria 90720
59 Ga0065165_1003308 3300005262 Bacteria 11566
60 Ga0065165_1022266 3300005262 Bacteria 2177
61 Ga0065165_1024528 3300005262 Bacteria 2023
62 Ga0065165_1123427 3300005262 Bacteria 626
63 Ga0070658_10014988 3300005327 Bacteria 6205
64 Ga0070683_100218442 3300005329 Bacteria 1811
65 Ga0070670_100717376 3300005331 Bacteria 900
66 Ga0070680_100379168 3300005336 Bacteria 1204
67 Ga0070682_100118010 3300005337 Bacteria 1777
68 Ga0070689_100024653 3300005340 Bacteria 4512
69 Ga0070661_100538006 3300005344 Bacteria 939
70 Ga0070669_100148541 3300005353 Bacteria 1813
71 Ga0070669_100410377 3300005353 Bacteria 1110
72 Ga0070675_100556500 3300005354 Bacteria 1038
73 Ga0070673_100425764 3300005364 Bacteria 1191
74 Ga0070673_101001888 3300005364 Bacteria 778
75 Ga0070688_100020263 3300005365 Bacteria 3865
76 Ga0070709_10808798 3300005434 Bacteria 736
77 Ga0070713_100157884 3300005436 Bacteria 2023
78 Ga0070678_100199186 3300005456 Bacteria 1652
79 Ga0070681_10002726 3300005458 Bacteria 16270
80 Ga0070706_100058714 3300005467 Bacteria 3551
81 Ga0070707_100051334 3300005468 Bacteria 3954
82 Ga0070707_101631228 3300005468 Bacteria 612
83 Ga0070698_100000151 3300005471 Bacteria 62941
84 Ga0070699_100187335 3300005518 Bacteria 1838
85 Ga0070679_100041034 3300005530 Bacteria 4606
86 Ga0070697_100030482 3300005536 Bacteria 4333
87 Ga0070686_100076689 3300005544 Bacteria 2202
88 Ga0070665_100050726 3300005548 Bacteria 4164
89 Ga0070665_100065971 3300005548 Bacteria 3631
90 Ga0070665_100080096 3300005548 Bacteria 3271
91 Ga0070665_100555295 3300005548 Bacteria 1161
92 Ga0070665_100674061 3300005548 Bacteria 1047
93 Ga0068855_100088959 3300005563 Bacteria 3566
94 Ga0068855_100128550 3300005563 Bacteria 2895
95 Ga0068855_100415377 3300005563 Bacteria 1472
96 Ga0068855_101149095 3300005563 Bacteria 809
97 Ga0070664_100523696 3300005564 Bacteria 1094
98 Ga0068857_100424081 3300005577 Bacteria 1241
99 Ga0068856_100052692 3300005614 Bacteria 4013
100 Ga0068856_100113252 3300005614 Bacteria 2711
101 Ga0068856_100127222 3300005614 Bacteria 2551
102 Ga0068859_101183541 3300005617 Bacteria 842
103 Ga0068862_100885599 3300005844 Bacteria 877
104 Ga0081455_10095265 3300005937 Bacteria 2403
105 Ga0081455_10816168 3300005937 Bacteria 585
106 Ga0081539_10003667 3300005985 Bacteria 18436
107 Ga0075365_10010246 3300006038 Bacteria 5448
108 Ga0075365_10029689 3300006038 Bacteria 3497
109 Ga0075365_10086449 3300006038 Bacteria 2131
110 Ga0075365_10154173 3300006038 Bacteria 1599
111 Ga0075365_10262533 3300006038 Bacteria 1214
112 Ga0075365_10272960 3300006038 Bacteria 1189
113 Ga0075368_10000272 3300006042 Bacteria 14865
114 Ga0075368_10113521 3300006042 Bacteria 1118
115 Ga0075368_10180004 3300006042 Bacteria 891
116 Ga0075363_100053634 3300006048 Bacteria 2155
117 Ga0075363_100125738 3300006048 Bacteria 1435
118 Ga0075364_10048925 3300006051 Bacteria 2756
119 Ga0075364_10107682 3300006051 Bacteria 1858
120 Ga0070716_100939690 3300006173 Bacteria 680
121 Ga0070716_101294342 3300006173 Bacteria 589
122 Ga0075362_10021563 3300006177 Bacteria 2705
123 Ga0075362_10070336 3300006177 Bacteria 1597
124 Ga0075362_10086007 3300006177 Bacteria 1454
125 Ga0075362_10092371 3300006177 Bacteria 1406
126 Ga0075362_10197033 3300006177 Bacteria 980
127 Ga0075362_10215941 3300006177 Bacteria 936
128 Ga0075367_10064788 3300006178 Bacteria 2187
129 Ga0075367_10070981 3300006178 Bacteria 2094
130 Ga0075367_10099503 3300006178 Bacteria 1776
131 Ga0075367_10145943 3300006178 Bacteria 1467
132 Ga0075367_10348223 3300006178 Bacteria 935
133 Ga0075367_10971474 3300006178 Bacteria 542
134 Ga0075369_10030308 3300006186 Bacteria 2277
135 Ga0075369_10053374 3300006186 Bacteria 1754
136 Ga0075369_10142769 3300006186 Bacteria 1092
137 Ga0075369_10210664 3300006186 Bacteria 898
138 Ga0075369_10244063 3300006186 Bacteria 833
139 Ga0075369_10307386 3300006186 Bacteria 741
140 Ga0075366_10026057 3300006195 Bacteria 3422
141 Ga0075366_10040599 3300006195 Bacteria 2753
142 Ga0075366_10060404 3300006195 Bacteria 2252
143 Ga0075366_10125621 3300006195 Bacteria 1547
144 Ga0075366_10141396 3300006195 Bacteria 1455
145 Ga0075370_10025799 3300006353 Bacteria 3252
146 Ga0075370_10054206 3300006353 Bacteria 2276
147 Ga0075370_10073225 3300006353 Bacteria 1961
148 Ga0075370_10093308 3300006353 Bacteria 1738
149 Ga0075370_10103096 3300006353 Bacteria 1653
150 Ga0075370_10156256 3300006353 Bacteria 1337
151 Ga0075370_10237136 3300006353 Bacteria 1080
152 Ga0075431_100773959 3300006847 Bacteria 934
153 Ga0075431_101131689 3300006847 Bacteria 747
154 Ga0097620_101183536 3300006931 Bacteria 842
155 Ga0079104_1000187 3300006946 Bacteria 86957
156 Ga0079104_1024144 3300006946 Bacteria 1605
157 Ga0099826_10000110 3300006948 Bacteria 38129
158 Ga0099826_10002535 3300006948 Bacteria 11861
159 Ga0099826_10282748 3300006948 Bacteria 857
160 Ga0099794_10096910 3300007265 Bacteria 1469
161 Ga0099795_10131528 3300007788 Bacteria 1010
162 Ga0105240_10000005 3300009093 Bacteria 702630
163 Ga0105240_10019378 3300009093 Bacteria 9090
164 Ga0105240_10216178 3300009093 Bacteria 2236
165 Ga0111539_11167688 3300009094 Bacteria 894
166 Ga0111539_11390620 3300009094 Bacteria 814
167 Ga0105247_11161126 3300009101 Bacteria 613
168 Ga0105243_10111125 3300009148 Bacteria 2293
169 Ga0105248_10621421 3300009177 Bacteria 1219
170 Ga0105248_11954245 3300009177 Bacteria 666
171 Ga0105237_10000658 3300009545 Bacteria 47984
172 Ga0105237_10001882 3300009545 Bacteria 26776
173 Ga0105238_10382562 3300009551 Bacteria 1399
174 Ga0105238_10591476 3300009551 Bacteria 1117
175 Ga0105238_10667738 3300009551 Bacteria 1050
176 Ga0105249_10315122 3300009553 Bacteria 1574
177 Ga0105249_10885798 3300009553 Bacteria 959
178 Ga0123341_1003085 3300009765 Bacteria 14113
179 Ga0123342_1025664 3300009766 Bacteria 3519
180 Ga0099796_10047116 3300010159 Bacteria 1482
181 Ga0105239_10001871 3300010375 Bacteria 27550
182 Ga0105239_10002014 3300010375 Bacteria 26368
183 Ga0105239_10327126 3300010375 Bacteria 1729
184 Ga0105239_11069623 3300010375 Bacteria 928
185 Ga0105246_10200560 3300011119 Bacteria 1551
186 Ga0157373_10005669 3300013100 Bacteria 9354
187 Ga0157373_10082621 3300013100 Bacteria 2264
188 Ga0157371_10004379 3300013102 Bacteria 12347
189 Ga0157370_10000274 3300013104 Bacteria 65400
190 Ga0157370_10000635 3300013104 Bacteria 43790
191 Ga0157370_10546874 3300013104 Bacteria 1061
192 Ga0157369_10225583 3300013105 Bacteria 1960
193 Ga0157369_10598662 3300013105 Bacteria 1138
194 Ga0157369_10633340 3300013105 Bacteria 1103
195 Ga0171463_1011 3300013249 Bacteria 230603
196 Ga0157372_10146788 3300013307 Bacteria 2720
197 Ga0163163_10676559 3300014325 Bacteria 1095
198 Ga0182008_10055338 3300014497 Bacteria 1962
199 Ga0182008_10298689 3300014497 Bacteria 842
200 Ga0157379_10111183 3300014968 Bacteria 2461
201 Ga0157376_10219450 3300014969 Bacteria 1760
202 Ga0182007_10025628 3300015262 Bacteria 2052
203 Ga0182007_10335101 3300015262 Bacteria 564
204 Ga0182005_1001371 3300015265 Bacteria 9925
205 Ga0183363_1121 3300015690 Bacteria 20584
206 Ga0163161_10342047 3300017792 Bacteria 1187
207 Ga0214544_1002211 3300021320 Bacteria 40993
208 Ga0214542_1002553 3300021321 Bacteria 37593
209 Ga0214542_1036213 3300021321 Bacteria 1476
210 Ga0214543_1000032 3300021327 Bacteria 200766
211 Ga0214543_1005345 3300021327 Bacteria 23734
212 Ga0228711_1000015 3300022739 Bacteria 126974
213 Ga0228710_1000015 3300022740 Bacteria 133640
214 Ga0209435_100045 3300025206 Bacteria 96483
215 Ga0209436_100001 3300025208 Bacteria 304543
216 Ga0209436_101417 3300025208 Bacteria 8420
217 Ga0209436_117228 3300025208 Bacteria 1062
218 Ga0209672_103242 3300025228 Bacteria 3459
219 Ga0209672_123109 3300025228 Bacteria 576
220 Ga0209437_100047 3300025233 Bacteria 405163
221 Ga0209437_100683 3300025233 Bacteria 18100
222 Ga0207425_1014439 3300025245 Bacteria 1793
223 Ga0207425_1020398 3300025245 Bacteria 1417
224 Ga0207425_1021426 3300025245 Bacteria 1370
225 Ga0209646_1000154 3300025246 Bacteria 96483
226 Ga0209646_1027651 3300025246 Bacteria 780
227 Ga0209026_1000177 3300025250 Bacteria 96629
228 Ga0209677_100435 3300025253 Bacteria 24526
229 Ga0209759_1000795 3300025256 Bacteria 25746
230 Ga0209759_1013140 3300025256 Bacteria 2254
231 Ga0209129_1000750 3300025258 Bacteria 20640
232 Ga0209129_1000880 3300025258 Bacteria 18487
233 Ga0209129_1002899 3300025258 Bacteria 7881
234 Ga0209129_1003789 3300025258 Bacteria 6345
235 Ga0209233_1000048 3300025261 Bacteria 453669
236 Ga0209233_1000069 3300025261 Bacteria 367639
237 Ga0209233_1000221 3300025261 Bacteria 104090
238 Ga0209565_1079835 3300025263 Bacteria 540
239 Ga0209455_1017853 3300025272 Bacteria 1473
240 Ga0209673_1000013 3300025273 Bacteria 571633
241 Ga0209673_1002743 3300025273 Bacteria 11568
242 Ga0209673_1003813 3300025273 Bacteria 8545
243 Ga0209130_1000004 3300025284 Bacteria 633436
244 Ga0209130_1000007 3300025284 Bacteria 591584
245 Ga0209130_1000021 3300025284 Bacteria 374278
246 Ga0209130_1035722 3300025284 Bacteria 992
247 Ga0209676_1006442 3300025292 Bacteria 5795
248 Ga0209676_1031131 3300025292 Bacteria 1622
249 Ga0209676_1037170 3300025292 Bacteria 1408
250 Ga0209025_1000320 3300025294 Bacteria 106773
251 Ga0209025_1000572 3300025294 Bacteria 66863
252 Ga0209025_1000923 3300025294 Bacteria 45012
253 Ga0209025_1004825 3300025294 Bacteria 11394
254 Ga0209025_1078223 3300025294 Bacteria 1136
255 Ga0209025_1104696 3300025294 Bacteria 885
256 Ga0209564_1000140 3300025295 Bacteria 179856
257 Ga0209564_1000566 3300025295 Bacteria 58647
258 Ga0209564_1000631 3300025295 Bacteria 53697
259 Ga0209564_1025288 3300025295 Bacteria 2002
260 Ga0209758_1000342 3300025297 Bacteria 86095
261 Ga0209758_1000468 3300025297 Bacteria 66625
262 Ga0209758_1000977 3300025297 Bacteria 38489
263 Ga0209758_1001150 3300025297 Bacteria 33851
264 Ga0209758_1002398 3300025297 Bacteria 19243
265 Ga0209758_1003813 3300025297 Bacteria 13258
266 Ga0209050_1003942 3300025298 Bacteria 10493
267 Ga0209050_1036957 3300025298 Bacteria 1417
268 Ga0209256_1002496 3300025299 Bacteria 14872
269 Ga0209256_1003343 3300025299 Bacteria 11373
270 Ga0209256_1004862 3300025299 Bacteria 8115
271 Ga0209256_1011729 3300025299 Bacteria 3458
272 Ga0209256_1016054 3300025299 Bacteria 2577
273 Ga0207426_1000003 3300025302 Bacteria 1063212
274 Ga0207426_1000010 3300025302 Bacteria 796003
275 Ga0207426_1000064 3300025302 Bacteria 358276
276 Ga0209051_1003419 3300025303 Bacteria 10422
277 Ga0209051_1006140 3300025303 Bacteria 6824
278 Ga0209051_1008794 3300025303 Bacteria 5295
279 Ga0209051_1009251 3300025303 Bacteria 5096
280 Ga0209051_1074208 3300025303 Bacteria 1010
281 Ga0209257_1001375 3300025304 Bacteria 29208
282 Ga0209257_1004333 3300025304 Bacteria 11104
283 Ga0209257_1018136 3300025304 Bacteria 2728
284 Ga0207692_10063643 3300025898 Bacteria 1918
285 Ga0207688_10427585 3300025901 Bacteria 824
286 Ga0207680_10596173 3300025903 Bacteria 790
287 Ga0207699_10249809 3300025906 Bacteria 1222
288 Ga0207645_10127479 3300025907 Bacteria 1655
289 Ga0207645_10330119 3300025907 Bacteria 1018
290 Ga0207705_10000110 3300025909 Bacteria 92932
291 Ga0207684_10233057 3300025910 Bacteria 1588
292 Ga0207707_10017396 3300025912 Bacteria 6268
293 Ga0207695_10000011 3300025913 Bacteria 910221
294 Ga0207695_10064008 3300025913 Bacteria 3789
295 Ga0207671_10000314 3300025914 Bacteria 71414
296 Ga0207671_10000757 3300025914 Bacteria 40978
297 Ga0207660_10034157 3300025917 Bacteria 3523
298 Ga0207652_10043802 3300025921 Bacteria 3811
299 Ga0207646_10198908 3300025922 Bacteria 1810
300 Ga0207681_10069870 3300025923 Bacteria 2444
301 Ga0207681_10619260 3300025923 Bacteria 896
302 Ga0207681_11227052 3300025923 Bacteria 630
303 Ga0207694_10123053 3300025924 Bacteria 2073
304 Ga0207650_10003131 3300025925 Bacteria 11395
305 Ga0207650_10565817 3300025925 Bacteria 954
306 Ga0207650_10633696 3300025925 Bacteria 900
307 Ga0207659_10357109 3300025926 Bacteria 1214
308 Ga0207700_10487130 3300025928 Bacteria 1090
309 Ga0207706_10097804 3300025933 Unclassified 2581
310 Ga0207709_10426533 3300025935 Bacteria 1020
311 Ga0207670_10377249 3300025936 Bacteria 1129
312 Ga0207665_10505772 3300025939 Bacteria 934
313 Ga0207691_10686214 3300025940 Bacteria 864
314 Ga0207711_10445663 3300025941 Bacteria 1205
315 Ga0207667_10031492 3300025949 Bacteria 5725
316 Ga0207667_10043146 3300025949 Bacteria 4787
317 Ga0207667_10934960 3300025949 Bacteria 857
318 Ga0207651_10628178 3300025960 Bacteria 941
319 Ga0207668_10334224 3300025972 Bacteria 1262
320 Ga0207668_10627388 3300025972 Bacteria 939
321 Ga0207668_11330000 3300025972 Bacteria 647
322 Ga0207703_10433031 3300026035 Bacteria 1226
323 Ga0207703_10940471 3300026035 Bacteria 828
324 Ga0207639_10243761 3300026041 Bacteria 1564
325 Ga0207639_11450655 3300026041 Bacteria 644
326 Ga0207702_10058187 3300026078 Bacteria 3288
327 Ga0207702_10074798 3300026078 Bacteria 2924
328 Ga0207676_10586862 3300026095 Bacteria 1069
329 Ga0207683_10274142 3300026121 Bacteria 1541
330 Ga0207698_10071352 3300026142 Bacteria 2756
331 Ga0209281_1000310 3300027111 Bacteria 87212
332 Ga0209281_1001580 3300027111 Bacteria 12399
333 Ga0209281_1001651 3300027111 Bacteria 11872
334 Ga0209371_1000021 3300027312 Bacteria 555864
335 Ga0209371_1001105 3300027312 Bacteria 19999
336 Ga0209371_1013335 3300027312 Bacteria 2315
337 Ga0209371_1023301 3300027312 Bacteria 1459
338 Ga0209282_1000054 3300027666 Bacteria 101427
339 Ga0209282_1000125 3300027666 Bacteria 49073
340 Ga0209282_1019312 3300027666 Bacteria 4325
341 Ga0209588_1129356 3300027671 Bacteria 806
342 Ga0209813_10005218 3300027866 Bacteria 3143
343 Ga0209813_10121670 3300027866 Bacteria 909
344 Ga0268266_10000578 3300028379 Bacteria 50618
345 Ga0268266_10051028 3300028379 Bacteria 3550
346 Ga0268266_10455844 3300028379 Bacteria 1216
347 Ga0268266_10459297 3300028379 Bacteria 1211
348 Ga0268266_10808225 3300028379 Bacteria 906
349 Ga0268265_10552065 3300028380 Bacteria 1094
350 Ga0268265_10755517 3300028380 Bacteria 944
351 Ga0268265_10935452 3300028380 Bacteria 853
352 Ga0265334_10013945 3300028573 Bacteria 3357
353 Ga0307515_10006047 3300028794 Bacteria 24332
354 Ga0307515_10285271 3300028794 Bacteria 1353
355 Ga0265338_10036623 3300028800 Bacteria 4692
356 Ga0268256_1000020 3300030500 Bacteria 557873
357 Ga0268256_1000949 3300030500 Bacteria 19813
358 Ga0268256_1012448 3300030500 Bacteria 2630
359 Ga0268256_1026424 3300030500 Bacteria 1459
360 Ga0314311_1171563 3300030733 Bacteria 1012
361 Ga0265332_10031703 3300031238 Bacteria 2305
362 Ga0265340_10331644 3300031247 Bacteria 673
363 Ga0307513_10011737 3300031456 Bacteria 10864
364 Ga0307513_10125578 3300031456 Bacteria 2522
365 Ga0307513_10539347 3300031456 Bacteria 880
366 Ga0307408_100208409 3300031548 Bacteria 1587
367 Ga0307408_100735280 3300031548 Bacteria 890
368 Ga0307408_101802129 3300031548 Bacteria 585
369 Ga0307516_10759061 3300031730 Bacteria 630
370 Ga0307405_10044349 3300031731 Bacteria 2720
371 Ga0307405_10199485 3300031731 Bacteria 1452
372 Ga0307410_11431552 3300031852 Bacteria 607
373 Ga0307412_10161620 3300031911 Bacteria 1665
374 Ga0307412_10724618 3300031911 Bacteria 856
375 Ga0315914_1000013 3300031967 Bacteria 133640
376 Ga0307409_100241764 3300031995 Bacteria 1644
377 Ga0307409_100867732 3300031995 Bacteria 914
378 Ga0307409_101079607 3300031995 Bacteria 823
379 Ga0307411_11316796 3300032005 Bacteria 659
380 Ga0315913_1000097 3300033430 Bacteria 51051
381 Ga0315915_1000001 3300033464 Bacteria 481518
382 Ga0373930_0179619 3300034816 Bacteria 543
383 Ga0373932_0305660 3300035112 Bacteria 595
384 Ga0373936_0088725 3300035113 Bacteria 1295
385 Ga0373939_0120192 3300035114 Bacteria 926
386 Ga0373945_0584915 3300035116 Bacteria 503
387 Ga0373931_0229342 3300035691 Bacteria 1121
388 Ga0373927_0000407 3300035695 Bacteria 33133
389 Ga0373927_0136081 3300035695 Bacteria 1606
390 Ga0373947_0481725 3300035725 Bacteria 842
391 Ga0373925_0001435 3300037068 Bacteria 20631
392 Ga0395899_0024032 3300037312 Bacteria 4609
393 Ga0395899_0074375 3300037312 Bacteria 2482
394 Ga0395900_0021639 3300037418 Bacteria 6574
395 Ga0395900_0061386 3300037418 Bacteria 3864
396 Ga0395900_0388788 3300037418 Bacteria 1361
397 Ga0395898_0022898 3300037466 Bacteria 6317
398 Ga0395898_0236679 3300037466 Bacteria 1741
399 Ga0395905_0007940 3300037471 Bacteria 10495
400 Ga0436364_1446934 3300037853 Bacteria 779
401 Ga0395901_0004105 3300038443 Bacteria 14682
402 Ga0395901_0027696 3300038443 Bacteria 5826
403 Ga0395901_0177234 3300038443 Bacteria 2235
404 Ga0400483_102732 3300039062 Bacteria 1201
405 Ga0400483_148425 3300039062 Bacteria 1364
406 Ga0400483_178238 3300039062 Bacteria 3473
407 Ga0400483_274835 3300039062 Bacteria 1746
408 Ga0436365_0717650 3300039437 Bacteria 1616
409 Ga0436360_0173596 3300039438 Bacteria 1567
410 Ga0436360_0190081 3300039438 Bacteria 1184
411 Ga0436360_0744027 3300039438 Bacteria 725
412 Ga0436360_0874254 3300039438 Bacteria 936
413 Ga0436363_0112556 3300039450 Bacteria 759
414 Ga0436363_0430915 3300039450 Bacteria 1059
415 Ga0436362_0570914 3300039453 Bacteria 1176
416 Ga0439436_0012845 3300041404 Bacteria 2538
417 Ga0439436_0029228 3300041404 Bacteria 1606
418 Ga0439436_0223717 3300041404 Bacteria 542
419 Ga0439465_0008271 3300041413 Bacteria 3285
420 Ga0439465_0011638 3300041413 Bacteria 2760
421 Ga0451793_1617848 3300041452 Bacteria 504
422 Ga0451807_0712293 3300041486 Bacteria 701
423 Ga0451833_0262727 3300041491 Bacteria 1347
424 Ga0451837_1418875 3300041494 Bacteria 1435
425 Ga0451845_0362302 3300041501 Bacteria 561
426 Ga0451847_0884533 3300041503 Bacteria 885
427 Ga0451849_0921126 3300041505 Bacteria 586
428 Ga0451849_1069185 3300041505 Bacteria 788
429 Ga0451851_0100692 3300041507 Bacteria 841
430 Ga0451851_0541643 3300041507 Bacteria 1778
431 Ga0451843_0307744 3300041509 Bacteria 1531
432 Ga0451843_0379233 3300041509 Bacteria 652
433 Ga0451855_1109988 3300041511 Bacteria 1375
434 Ga0451853_0486423 3300041512 Bacteria 2090
435 Ga0451853_1097193 3300041512 Bacteria 641
436 Ga0451853_1650843 3300041512 Bacteria 892
437 Ga0439448_0028174 3300042005 Bacteria 1772
438 Ga0439432_041695 3300042006 Bacteria 1453
439 Ga0439432_101339 3300042006 Bacteria 861
440 Ga0439432_168333 3300042006 Bacteria 640
441 Ga0439449_0034264 3300042007 Bacteria 1890
442 Ga0439450_041670 3300042008 Bacteria 1068
443 Ga0439457_096206 3300042014 Bacteria 688
444 Ga0439462_0008378 3300042015 Bacteria 2605
445 Ga0439462_0048018 3300042015 Bacteria 1145
446 Ga0439462_0092616 3300042015 Bacteria 830
447 Ga0450909_053450 3300042185 Bacteria 632
448 Ga0439434_0033666 3300042435 Bacteria 1563
449 Ga0439434_0056789 3300042435 Bacteria 1220
450 Ga0439459_0033539 3300042438 Bacteria 1058
451 Ga0466963_0060459 3300044694 Bacteria 2530
452 Ga0466964_0458142 3300044706 Bacteria 677
453 Ga0466970_0028377 3300044765 Bacteria 2939
454 Ga0466957_0012593 3300044842 Bacteria 4897
455 Ga0466958_0117429 3300045836 Bacteria 1663
456 Ga0466967_0017620 3300045976 Bacteria 5679
457 Ga0495590_0056805 3300046457 Bacteria 1368
458 Ga0495629_0098719 3300046459 Bacteria 2037
459 Ga0495638_0054429 3300046460 Bacteria 2487
460 Ga0495638_0076499 3300046460 Bacteria 2039
461 Ga0495638_0217556 3300046460 Bacteria 1069
462 Ga0495651_0184285 3300046462 Bacteria 1475
463 Ga0495650_0118366 3300046471 Bacteria 977
464 Ga0495605_0013569 3300046474 Bacteria 4484
465 Ga0495605_0051434 3300046474 Bacteria 2006
466 Ga0495662_0018810 3300046476 Bacteria 3343
467 Ga0495664_0046653 3300046477 Bacteria 2571
468 Ga0495585_0048353 3300046492 Bacteria 2365
469 Ga0495607_0030720 3300046501 Bacteria 3295
470 Ga0495607_0045550 3300046501 Bacteria 2579
471 Ga0495607_0192458 3300046501 Bacteria 1015
472 Ga0495583_0033165 3300046506 Bacteria 2485
473 Ga0495606_0001192 3300046507 Bacteria 36659
474 Ga0495606_0076611 3300046507 Bacteria 2090
475 Ga0495610_0026067 3300046512 Bacteria 3126
476 Ga0495620_0006073 3300046515 Bacteria 6678
477 Ga0495631_0046658 3300046518 Bacteria 1904
478 Ga0495632_0111593 3300046519 Bacteria 1283
479 Ga0495632_0360469 3300046519 Bacteria 638
480 Ga0495643_0011245 3300046522 Bacteria 5463
481 Ga0495643_0030117 3300046522 Bacteria 3032
482 Ga0495648_0057131 3300046524 Bacteria 2343
483 Ga0495648_0316537 3300046524 Bacteria 725
484 Ga0495652_0142173 3300046529 Bacteria 1886
485 Ga0495654_0002126 3300046530 Bacteria 12943
486 Ga0495654_0064442 3300046530 Bacteria 1752
487 Ga0495609_0079329 3300046538 Bacteria 1436
488 Ga0495597_0029169 3300046542 Bacteria 2521
489 Ga0495622_0043711 3300046557 Bacteria 2082
490 Ga0495633_0028714 3300046558 Bacteria 2708
491 Ga0495633_0036908 3300046558 Bacteria 2340
492 Ga0495633_0058922 3300046558 Bacteria 1802
493 Ga0495633_0087230 3300046558 Bacteria 1451
494 Ga0495656_0330769 3300046615 Bacteria 786
495 Ga0495634_0171675 3300046642 Bacteria 1362
496 Ga0495625_0077229 3300046660 Bacteria 2327
497 Ga0495625_0099113 3300046660 Bacteria 2004
498 Ga0495625_0361690 3300046660 Bacteria 915
499 Ga0495625_0371144 3300046660 Bacteria 900
500 Ga0495625_0377928 3300046660 Bacteria 889
501 Ga0495625_0478982 3300046660 Bacteria 764
502 Ga0495635_0050271 3300046663 Bacteria 2874
503 Ga0495635_0728489 3300046663 Bacteria 642
504 Ga0495661_0140196 3300046665 Bacteria 1316
505 Ga0495661_0348037 3300046665 Bacteria 730
506 Ga0495657_0153862 3300046675 Bacteria 1426
507 Ga0495623_0287379 3300046679 Bacteria 913
508 Ga0495671_0072945 3300046692 Bacteria 1685
509 Ga0495671_0095229 3300046692 Bacteria 1457
510 Ga0495649_0024030 3300046694 Bacteria 3402
511 Ga0495649_0075632 3300046694 Bacteria 1803
512 Ga0495600_0050256 3300046809 Bacteria 2720
513 Ga0495660_0030658 3300046810 Bacteria 3029
514 Ga0495604_0031398 3300047317 Bacteria 4212
515 Ga0495674_0273722 3300047319 Bacteria 1385
516 Ga0495687_015347 3300047443 Bacteria 3901
517 Ga0495686_0002335 3300047472 Bacteria 18118
518 Ga0495686_0077913 3300047472 Bacteria 2029
519 Ga0495686_0101056 3300047472 Bacteria 1739
520 Ga0495686_0123778 3300047472 Bacteria 1539
521 Ga0495686_0129781 3300047472 Bacteria 1495
522 Ga0495615_0006352 3300048090 Bacteria 2184
523 Ga0495626_0053772 3300048091 Bacteria 1852
524 Ga0495626_0073189 3300048091 Bacteria 1535
525 Ga0496100_0531199 3300048903 Bacteria 909
526 Ga0496101_0069668 3300048904 Bacteria 2574
527 Ga0496102_0058633 3300048905 Bacteria 3518
528 Ga0496103_0018642 3300048906 Bacteria 4163
529 Ga0496104_0351237 3300048907 Bacteria 1387
530 Ga0496104_0649323 3300048907 Bacteria 964
531 Ga0496105_0130480 3300048908 Bacteria 2072
532 Ga0496106_0001595 3300048909 Bacteria 17040
533 Ga0496106_0568623 3300048909 Bacteria 909
534 Ga0496109_0066556 3300048912 Bacteria 3300
535 Ga0496110_0151349 3300048913 Bacteria 2101
536 Ga0496110_1075325 3300048913 Unclassified 712
537 Ga0496110_1234985 3300048913 Bacteria 656
538 Ga0496111_0006839 3300048914 Bacteria 7438
539 Ga0496111_0730523 3300048914 Bacteria 719
540 Ga0496112_0268704 3300048915 Bacteria 1654
541 Ga0496112_0545195 3300048915 Bacteria 1094
542 Ga0496112_0588667 3300048915 Bacteria 1045
543 Ga0496113_0092827 3300048916 Bacteria 2329
544 Ga0496114_0112998 3300048917 Bacteria 2328
545 Ga0496114_0160410 3300048917 Bacteria 1955
546 Ga0496115_0207473 3300048918 Bacteria 1618
547 Ga0496115_0296152 3300048918 Bacteria 1326
548 Ga0496116_0004156 3300048919 Bacteria 13935
549 Ga0496116_0042554 3300048919 Bacteria 3103
550 Ga0496116_0046597 3300048919 Bacteria 2925
551 Ga0496116_0098144 3300048919 Bacteria 1758
552 Ga0496116_0138094 3300048919 Bacteria 1376
553 Ga0496116_0299765 3300048919 Bacteria 766
554 Ga0496117_0000002 3300048920 Bacteria 2483758
555 Ga0496117_0000641 3300048920 Bacteria 56335
556 Ga0496117_0024393 3300048920 Bacteria 4785
557 Ga0496117_0029474 3300048920 Bacteria 4230
558 Ga0496117_0444789 3300048920 Bacteria 642
559 Ga0496118_0000707 3300048921 Bacteria 53851
560 Ga0496118_0002328 3300048921 Bacteria 25774
561 Ga0496118_0004090 3300048921 Bacteria 17684
562 Ga0496118_0046965 3300048921 Bacteria 3353
563 Ga0496118_0120492 3300048921 Bacteria 1712
564 Ga0496118_0140340 3300048921 Bacteria 1533
565 Ga0496118_0209477 3300048921 Bacteria 1145
566 Ga0496119_0004718 3300048922 Bacteria 13399
567 Ga0496119_0079346 3300048922 Bacteria 1896
568 Ga0496119_0116380 3300048922 Bacteria 1475
569 Ga0496119_0238675 3300048922 Bacteria 922
570 Ga0496119_0243854 3300048922 Bacteria 909
571 Ga0496120_0000358 3300048923 Bacteria 74781
572 Ga0496120_0005142 3300048923 Bacteria 10569
573 Ga0496120_0088542 3300048923 Bacteria 1659
574 Ga0496120_0108883 3300048923 Bacteria 1451
575 Ga0496121_0007234 3300048924 Bacteria 13436
576 Ga0496121_0013771 3300048924 Bacteria 8659
577 Ga0496121_0019385 3300048924 Bacteria 6802
578 Ga0496121_0026221 3300048924 Bacteria 5500
579 Ga0496121_0169611 3300048924 Bacteria 1587
580 Ga0496122_0000001 3300048925 Bacteria 1827766
581 Ga0496122_0000025 3300048925 Bacteria 362915
582 Ga0496122_0000651 3300048925 Bacteria 70375
583 Ga0496122_0004504 3300048925 Bacteria 17216
584 Ga0496122_0029922 3300048925 Bacteria 4576
585 Ga0496122_0038154 3300048925 Bacteria 3854
586 Ga0496122_0056329 3300048925 Bacteria 2931
587 Ga0496122_0244892 3300048925 Bacteria 1007
588 Ga0496123_0000001 3300048926 Bacteria 1831497
589 Ga0496123_0000043 3300048926 Bacteria 253752
590 Ga0496123_0000054 3300048926 Bacteria 234046
591 Ga0496123_0010645 3300048926 Bacteria 8094
592 Ga0496123_0015808 3300048926 Bacteria 6166
593 Ga0496123_0053460 3300048926 Bacteria 2668
594 Ga0496123_0129734 3300048926 Bacteria 1399
595 Ga0496124_0001513 3300048927 Bacteria 33856
596 Ga0496124_0003090 3300048927 Bacteria 20709
597 Ga0496124_0016262 3300048927 Bacteria 7084
598 Ga0496124_0017489 3300048927 Bacteria 6753
599 Ga0496124_0030733 3300048927 Bacteria 4761
600 Ga0496124_0042501 3300048927 Bacteria 3914
601 Ga0496124_0042537 3300048927 Bacteria 3911
602 Ga0496124_0208169 3300048927 Bacteria 1482
603 Ga0496124_0875200 3300048927 Bacteria 548
604 Ga0496125_0000141 3300048928 Bacteria 158991
605 Ga0496125_0000671 3300048928 Bacteria 57108
606 Ga0496125_0045121 3300048928 Bacteria 3715
607 Ga0496125_0097155 3300048928 Bacteria 2183
608 Ga0496125_0117916 3300048928 Bacteria 1902
609 Ga0496125_0230317 3300048928 Bacteria 1185
610 Ga0496126_0002292 3300048929 Bacteria 26384
611 Ga0496126_0019977 3300048929 Bacteria 6582
612 Ga0496126_0050834 3300048929 Bacteria 3776
613 Ga0496126_0053333 3300048929 Bacteria 3669
614 Ga0496126_0065017 3300048929 Bacteria 3265
615 Ga0496126_0068850 3300048929 Bacteria 3158
616 Ga0496126_0293967 3300048929 Bacteria 1342
617 Ga0501031_0080518 3300049568 Bacteria 2122
618 Ga0501032_0093495 3300049569 Bacteria 1994
619 Ga0501032_0199509 3300049569 Bacteria 1306
620 Ga0501033_0031332 3300049570 Bacteria 3996
621 Ga0501033_0040100 3300049570 Bacteria 3496
622 Ga0501033_0174992 3300049570 Bacteria 1540
623 Ga0501034_0015519 3300049571 Bacteria 7826
624 Ga0501034_0018419 3300049571 Bacteria 7160
625 Ga0501034_0178480 3300049571 Bacteria 2089
626 Ga0501034_0226966 3300049571 Bacteria 1818
627 Ga0501034_0235066 3300049571 Bacteria 1780
628 Ga0501034_0363344 3300049571 Bacteria 1374
629 Ga0501034_0550503 3300049571 Bacteria 1063
630 Ga0501034_0600154 3300049571 Bacteria 1006
631 Ga0501034_0662130 3300049571 Bacteria 945
632 Ga0501036_0910285 3300049572 Bacteria 722
633 Ga0501036_1547017 3300049572 Bacteria 536
634 Ga0501037_0154368 3300049573 Bacteria 1639
635 Ga0501037_0264360 3300049573 Bacteria 1202
636 Ga0501037_0675558 3300049573 Bacteria 689
637 Ga0501039_0458863 3300049575 Bacteria 1001
638 Ga0501043_0177359 3300049579 Bacteria 1661
639 Ga0501043_0370163 3300049579 Bacteria 1086
640 Ga0501043_0819367 3300049579 Bacteria 672
641 Ga0501046_0069988 3300049580 Bacteria 2729
642 Ga0501046_0114629 3300049580 Bacteria 2056
643 Ga0501046_0289017 3300049580 Bacteria 1199
644 Ga0501047_0187014 3300049581 Bacteria 1936
645 Ga0501047_0227216 3300049581 Bacteria 1721
646 Ga0501047_0333288 3300049581 Bacteria 1356
647 Ga0501047_0794212 3300049581 Bacteria 761
648 Ga0501048_0112436 3300049582 Bacteria 1923
649 Ga0501068_0068507 3300049584 Bacteria 2163
650 Ga0501068_0183792 3300049584 Bacteria 1322
651 Ga0501068_0521094 3300049584 Bacteria 772
652 Ga0501070_0173643 3300049586 Bacteria 1775
653 Ga0501071_1013194 3300049587 Bacteria 641
654 Ga0501280_002079 3300049776 Bacteria 3461
655 Ga0501035_0003599 3300049822 Bacteria 14796
656 Ga0501035_0179834 3300049822 Bacteria 1822
657 Ga0501035_0255694 3300049822 Bacteria 1486
658 Ga0501044_0002124 3300049823 Bacteria 22745
659 Ga0501044_0345866 3300049823 Bacteria 1407
660 Ga0501044_0608371 3300049823 Bacteria 985
661 nmdc:mga03683_10860_c2 3300050489 Bacteria 1521
662 nmdc:mga03683_31677_c1 3300050489 Bacteria 2123
663 nmdc:mga03683_32536_c1 3300050489 Bacteria 2098
664 nmdc:mga03683_61537_c1 3300050489 Bacteria 1588
665 nmdc:mga03n38_129773_c1 3300050490 Bacteria 1248
666 nmdc:mga03n38_174959_c1 3300050490 Bacteria 1096
667 nmdc:mga03n38_6480_c1 3300050490 Bacteria 4071
668 nmdc:mga00v17_189036_c1 3300050491 Bacteria 1330
669 nmdc:mga00v17_35476_c1 3300050491 Bacteria 2968
670 nmdc:mga00v17_530666_c1 3300050491 Bacteria 762
671 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
672 nmdc:mga0yw44_123075_c1 3300050492 Bacteria 1672
673 nmdc:mga0yw44_17391_c1 3300050492 Bacteria 3911
674 nmdc:mga0yw44_31324_c1 3300050492 Bacteria 2761
675 nmdc:mga0yw44_56775_c1 3300050492 Bacteria 2387
676 nmdc:mga0yw44_63759_c1 3300050492 Bacteria 2267
677 nmdc:mga0yw44_89625_c1 3300050492 Bacteria 1941
678 nmdc:mga0k408_113543_c1 3300050493 Bacteria 1602
679 nmdc:mga0k408_3640_c1 3300050493 Bacteria 3686
680 nmdc:mga0k408_576737_c1 3300050493 Bacteria 664
681 nmdc:mga0k408_671069_c1 3300050493 Bacteria 609
682 nmdc:mga06z11_210679_c1 3300050494 Bacteria 1132
683 nmdc:mga06z11_240475_c1 3300050494 Bacteria 1063
684 nmdc:mga06z11_252707_c1 3300050494 Bacteria 1038
685 nmdc:mga06z11_28078_c1 3300050494 Bacteria 2274
686 nmdc:mga06z11_28998_c1 3300050494 Bacteria 2662
687 nmdc:mga06z11_298068_c1 3300050494 Bacteria 958
688 nmdc:mga06z11_52039_c1 3300050494 Bacteria 2099
689 nmdc:mga04h51_16944_c1 3300050495 Bacteria 2123
690 nmdc:mga04h51_176772_c1 3300050495 Bacteria 829
691 nmdc:mga07m45_333242_c1 3300050496 Bacteria 882
692 nmdc:mga07m45_611173_c1 3300050496 Bacteria 629
693 nmdc:mga07m45_75383_c1 3300050496 Bacteria 1922
694 nmdc:mga07m45_91225_c1 3300050496 Bacteria 1745
695 nmdc:mga08y16_539720_c1 3300050511 Bacteria 1181
696 nmdc:mga0sz30_101_c1 3300050516 Bacteria 31878
697 nmdc:mga0sz30_107080_c1 3300050516 Bacteria 1223
698 nmdc:mga0sz30_112070_c1 3300050516 Bacteria 1196
699 nmdc:mga0sz30_147494_c1 3300050516 Bacteria 1040
700 nmdc:mga0sz30_2989_c1 3300050516 Bacteria 6066
701 nmdc:mga0sz30_31983_c2 3300050516 Bacteria 1815
702 nmdc:mga0sz30_534043_c1 3300050516 Bacteria 529
703 nmdc:mga0sz30_95617_c1 3300050516 Bacteria 1295
704 Ga0495601_0037256 3300053077 Bacteria 3040
705 Ga0495601_0305726 3300053077 Bacteria 1036
706 Ga0495612_0283504 3300053078 Bacteria 741
707 Ga0495619_0037758 3300053085 Bacteria 3150
708 Ga0495619_0932429 3300053085 Bacteria 583
709 Ga0500644_0004184 3300053088 Bacteria 3600
710 Ga0500644_0068743 3300053088 Bacteria 1270
711 Ga0500644_0138284 3300053088 Bacteria 966
712 Ga0500647_0016318 3300053091 Bacteria 3411
713 Ga0500647_0268268 3300053091 Bacteria 743
714 Ga0500647_0342116 3300053091 Bacteria 626
715 Ga0500651_0131301 3300053093 Bacteria 1515
716 Ga0500651_0244998 3300053093 Bacteria 1044
717 Ga0500651_0261845 3300053093 Bacteria 1002
718 Ga0500641_0002522 3300053096 Bacteria 6470
719 Ga0500556_0259696 3300053104 Bacteria 683
720 Ga0500560_012107 3300053107 Bacteria 2224
721 Ga0500562_048700 3300053108 Bacteria 1132
722 Ga0500569_014651 3300053109 Bacteria 1945
723 Ga0500594_0007064 3300053118 Bacteria 2535
724 Ga0500595_113604 3300053119 Bacteria 768
725 Ga0500608_171806 3300053122 Bacteria 928
726 Ga0500608_210095 3300053122 Bacteria 796
727 Ga0500618_000289 3300053125 Bacteria 38453
728 Ga0500618_051950 3300053125 Bacteria 927
729 Ga0500642_0236784 3300053130 Bacteria 842
730 Ga0500658_0004632 3300053134 Bacteria 5132
731 Ga0500561_0000069 3300053137 Bacteria 20275
732 Ga0500568_0017780 3300053139 Bacteria 3129
733 Ga0500573_0013502 3300053140 Bacteria 4604
734 Ga0500590_000180 3300053148 Bacteria 18881
735 Ga0500604_0045791 3300053151 Bacteria 1336
736 Ga0500604_0207054 3300053151 Bacteria 675
737 Ga0500616_0002029 3300053153 Bacteria 17855
738 Ga0500616_0106846 3300053153 Bacteria 1358
739 Ga0500619_184233 3300053154 Bacteria 704
740 Ga0500620_046666 3300053155 Bacteria 1440
741 Ga0500622_0000159 3300053156 Bacteria 71047
742 Ga0500622_0000428 3300053156 Bacteria 39928
743 Ga0500624_000531 3300053157 Bacteria 10891
744 Ga0500627_0060789 3300053158 Bacteria 1662
745 Ga0500633_0008836 3300053160 Bacteria 2617
746 Ga0500633_0089975 3300053160 Bacteria 1120
747 Ga0500634_0012102 3300053161 Bacteria 4481
748 Ga0500634_0028698 3300053161 Bacteria 3031
749 Ga0500636_0125301 3300053177 Bacteria 1437
750 Ga0500565_012494 3300053734 Bacteria 904
751 Ga0587072_037709 3300059643 Bacteria 928
752 Ga0501082_0072235 3300060353 Bacteria 2972
753 Ga0501082_0133402 3300060353 Bacteria 2155
754 Ga0501082_0880652 3300060353 Bacteria 783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0932429 Ga0495619_0932429_174_560 126
2 3300005329 Ga0070683_100218442 Ga0070683_1002184422 136
3 3300005563 Ga0068855_100415377 Ga0068855_1004153772 136
4 3300005614 Ga0068856_100127222 Ga0068856_1001272222 136
5 3300009093 Ga0105240_10216178 Ga0105240_102161782 136
6 3300009551 Ga0105238_10382562 Ga0105238_103825622 136
7 3300010375 Ga0105239_10327126 Ga0105239_103271262 136
8 3300013104 Ga0157370_10546874 Ga0157370_105468741 136
9 3300013105 Ga0157369_10225583 Ga0157369_102255832 136
10 3300013307 Ga0157372_10146788 Ga0157372_101467883 136
11 3300025924 Ga0207694_10123053 Ga0207694_101230533 136
12 3300025949 Ga0207667_10934960 Ga0207667_109349601 136
13 3300026078 Ga0207702_10074798 Ga0207702_100747982 136
14 3300026142 Ga0207698_10071352 Ga0207698_100713522 136
15 3300049571 Ga0501034_0662130 Ga0501034_0662130_336_752 136
16 3300005336 Ga0070680_100379168 Ga0070680_1003791682 137
17 3300037418 Ga0395900_0388788 Ga0395900_0388788_428_847 137
18 3300037466 Ga0395898_0236679 Ga0395898_0236679_469_888 137
19 3300038443 Ga0395901_0177234 Ga0395901_0177234_591_1010 137
20 3300049571 Ga0501034_0018419 Ga0501034_0018419_2820_3239 137
21 3300049571 Ga0501034_0178480 Ga0501034_0178480_337_756 137
22 3300005434 Ga0070709_10808798 Ga0070709_108087982 138
23 3300045976 Ga0466967_0017620 Ga0466967_0017620_4295_4717 138
24 3300049571 Ga0501034_0015519 Ga0501034_0015519_6810_7232 138
25 3300049584 Ga0501068_0183792 Ga0501068_0183792_519_941 138
26 3300049586 Ga0501070_0173643 Ga0501070_0173643_40_462 138
27 3300049823 Ga0501044_0608371 Ga0501044_0608371_497_919 138
28 3300005564 Ga0070664_100523696 Ga0070664_1005236962 139
29 3300005364 Ga0070673_101001888 Ga0070673_1010018881 140
30 3300005456 Ga0070678_100199186 Ga0070678_1001991862 140
31 3300006173 Ga0070716_101294342 Ga0070716_1012943422 140
32 3300014969 Ga0157376_10219450 Ga0157376_102194502 140
33 3300017792 Ga0163161_10342047 Ga0163161_103420472 140
34 3300025907 Ga0207645_10127479 Ga0207645_101274792 140
35 3300025960 Ga0207651_10628178 Ga0207651_106281782 140
36 3300026035 Ga0207703_10940471 Ga0207703_109404711 140
37 3300026121 Ga0207683_10274142 Ga0207683_102741422 140
38 iso_pu_bacteria 2510461069 2510840029 142
39 iso_pu_bacteria 2516143018 2516209173 142
40 iso_pu_bacteria 2599185352 2600192239 142
41 iso_pu_bacteria 2643221557 2643808319 142
42 iso_pu_bacteria 2643221610 2644068139 142
43 iso_pu_bacteria 2643221618 2644108055 142
44 iso_pu_bacteria 2643221626 2644150565 142
45 iso_pu_bacteria 2643221655 2644310079 142
46 iso_pu_bacteria 2643221659 2644335327 142
47 iso_pu_bacteria 2643221668 2644379309 142
48 iso_pu_bacteria 2643221675 2644419083 142
49 iso_pu_bacteria 2643221680 2644450398 142
50 iso_pu_bacteria 2643221698 2644544842 142
51 iso_pu_bacteria 2643221712 2644617169 142
52 iso_pu_bacteria 2643221723 2644677816 142
53 iso_pu_bacteria 2643221726 2644687307 142
54 iso_pu_bacteria 2657244999 2657686390 142
55 iso_pu_bacteria 2690316117 2692316509 142
56 iso_pu_bacteria 2751185821 2753460111 142
57 iso_pu_bacteria 2775507049 2776913538 142
58 iso_pu_bacteria 2775507266 2778173926 142
59 iso_pu_bacteria 2791355082 2792581274 142
60 iso_pu_bacteria 2791355091 2792624860 142
61 iso_pu_bacteria 2791355092 2792630894 142
62 iso_pu_bacteria 2791355094 2792642423 142
63 iso_pu_bacteria 2802429268 2804751770 142
64 iso_pu_bacteria 2818991448 2819612894 142
65 iso_pu_bacteria 2838029111 2838030187 142
66 iso_pu_bacteria 2838074704 2838079244 142
67 iso_pu_bacteria 2842475841 2842476528 142
68 iso_pu_bacteria 2842482326 2842484930 142
69 iso_pu_bacteria 2842502639 2842503715 142
70 iso_pu_bacteria 2844163670 2844169531 142
71 iso_pu_bacteria 2847417321 2847418423 142
72 iso_pu_bacteria 2848992105 2848993402 142
73 iso_pu_bacteria 2855872281 2855873412 142
74 iso_pu_bacteria 2896384573 2896386915 142
75 iso_pu_bacteria 2899803654 2899807560 142
76 iso_pu_bacteria 2913295892 2913301756 142
77 iso_pu_bacteria 2920822456 2920824129 142
78 iso_pu_bacteria 2941499720 2941499924 142
79 iso_pu_bacteria 3005416602 3005420197 142
80 iso_pu_bacteria 8005314921 8005317148 142
81 iso_pu_bacteria 8005645114 8005648788 142
82 iso_pu_bacteria 8049293176 8049294315 142
83 3300041452 Ga0451793_1617848 Ga0451793_1617848_47_481 143
84 iso_pu_bacteria 2599185156 2599333487 143
85 iso_pu_bacteria 2643221688 2644494791 143
86 iso_pu_bacteria 2842922631 2842925105 143
87 iso_pu_bacteria 2899259804 2899262805 143
88 iso_pu_bacteria 2920760137 2920765502 143
89 3300049575 Ga0501039_0458863 Ga0501039_0458863_134_571 144
90 iso_pu_bacteria 2599185236 2599720936 144
91 iso_pu_bacteria 2600254933 2600375739 144
92 iso_pu_bacteria 2818991272 2819241749 144
93 iso_pu_bacteria 2821123053 2821127749 144
94 iso_pu_bacteria 2838736955 2838738171 144
95 iso_pu_bacteria 2841840854 2841841459 144
96 iso_pu_bacteria 2842140634 2842141237 144
97 iso_pu_bacteria 2857531043 2857534589 144
98 iso_pu_bacteria 2989776772 2989778920 144
99 iso_pu_bacteria 8005246636 8005248473 144
100 3300006051 Ga0075364_10048925 Ga0075364_100489254 145
101 3300006186 Ga0075369_10142769 Ga0075369_101427692 145
102 3300006186 Ga0075369_10210664 Ga0075369_102106641 145
103 3300037853 Ga0436364_1446934 Ga0436364_1446934_302_760 145
104 3300050491 nmdc:mga00v17_35476_c1 nmdc:mga00v17_35476_c1_2232_2672 145
105 3300050492 nmdc:mga0yw44_89625_c1 nmdc:mga0yw44_89625_c1_1124_1570 145
106 3300050516 nmdc:mga0sz30_147494_c1 nmdc:mga0sz30_147494_c1_71_517 145
107 3300050516 nmdc:mga0sz30_534043_c1 nmdc:mga0sz30_534043_c1_67_513 145
108 3300060353 Ga0501082_0880652 Ga0501082_0880652_192_632 145
109 iso_pu_bacteria 2738541317 2738946059 145
110 iso_pu_bacteria 2913308742 2913311358 145
111 iso_pu_bacteria 2917554339 2917556710 145
112 3300002987 JGI25159J45721_1000891 JGI25159J45721_10008913 146
113 3300003187 JGI25151J46595_10045933 JGI25151J46595_100459331 146
114 3300003354 JGI25160J50197_1000711 JGI25160J50197_100071124 146
115 3300003374 JGI25161J50226_1000833 JGI25161J50226_100083314 146
116 3300003771 Ga0055526_1023683 Ga0055526_10236833 146
117 3300003775 Ga0055524_1001908 Ga0055524_100190815 146
118 3300003781 Ga0055536_1001205 Ga0055536_10012052 146
119 3300003791 Ga0055530_10027282 Ga0055530_100272822 146
120 3300003794 Ga0055531_10056484 Ga0055531_100564842 146
121 3300004625 Ga0055543_1001114 Ga0055543_100111414 146
122 3300005262 Ga0065165_1003308 Ga0065165_100330814 146
123 3300005344 Ga0070661_100538006 Ga0070661_1005380062 146
124 3300005468 Ga0070707_101631228 Ga0070707_1016312281 146
125 3300005544 Ga0070686_100076689 Ga0070686_1000766893 146
126 3300005548 Ga0070665_100065971 Ga0070665_1000659715 146
127 3300005563 Ga0068855_101149095 Ga0068855_1011490951 146
128 3300005985 Ga0081539_10003667 Ga0081539_1000366712 146
129 3300006042 Ga0075368_10000272 Ga0075368_1000027213 146
130 3300006048 Ga0075363_100053634 Ga0075363_1000536343 146
131 3300006051 Ga0075364_10107682 Ga0075364_101076823 146
132 3300006177 Ga0075362_10215941 Ga0075362_102159412 146
133 3300006178 Ga0075367_10145943 Ga0075367_101459431 146
134 3300006186 Ga0075369_10030308 Ga0075369_100303082 146
135 3300006186 Ga0075369_10053374 Ga0075369_100533743 146
136 3300006195 Ga0075366_10141396 Ga0075366_101413963 146
137 3300006353 Ga0075370_10156256 Ga0075370_101562562 146
138 3300006946 Ga0079104_1024144 Ga0079104_10241442 146
139 3300006948 Ga0099826_10000110 Ga0099826_1000011033 146
140 3300006948 Ga0099826_10002535 Ga0099826_100025356 146
141 3300006948 Ga0099826_10282748 Ga0099826_102827482 146
142 3300009148 Ga0105243_10111125 Ga0105243_101111252 146
143 3300011119 Ga0105246_10200560 Ga0105246_102005603 146
144 3300013100 Ga0157373_10005669 Ga0157373_1000566910 146
145 3300013102 Ga0157371_10004379 Ga0157371_100043799 146
146 3300013104 Ga0157370_10000635 Ga0157370_1000063511 146
147 3300013249 Ga0171463_1011 Ga0171463_101163 146
148 3300014325 Ga0163163_10676559 Ga0163163_106765592 146
149 3300014497 Ga0182008_10298689 Ga0182008_102986892 146
150 3300015262 Ga0182007_10335101 Ga0182007_103351011 146
151 3300015690 Ga0183363_1121 Ga0183363_112130 146
152 3300021320 Ga0214544_1002211 Ga0214544_100221115 146
153 3300021321 Ga0214542_1002553 Ga0214542_100255315 146
154 3300021321 Ga0214542_1036213 Ga0214542_10362132 146
155 3300021327 Ga0214543_1000032 Ga0214543_1000032150 146
156 3300021327 Ga0214543_1005345 Ga0214543_100534537 146
157 3300022739 Ga0228711_1000015 Ga0228711_10000152 146
158 3300022740 Ga0228710_1000015 Ga0228710_1000015146 146
159 3300025208 Ga0209436_101417 Ga0209436_1014172 146
160 3300025263 Ga0209565_1079835 Ga0209565_10798351 146
161 3300025284 Ga0209130_1000007 Ga0209130_1000007359 146
162 3300025292 Ga0209676_1031131 Ga0209676_10311312 146
163 3300025294 Ga0209025_1000923 Ga0209025_10009235 146
164 3300025294 Ga0209025_1004825 Ga0209025_100482514 146
165 3300025295 Ga0209564_1000140 Ga0209564_1000140139 146
166 3300025298 Ga0209050_1036957 Ga0209050_10369572 146
167 3300025299 Ga0209256_1003343 Ga0209256_100334314 146
168 3300025302 Ga0207426_1000064 Ga0207426_1000064359 146
169 3300025303 Ga0209051_1008794 Ga0209051_10087946 146
170 3300025303 Ga0209051_1074208 Ga0209051_10742082 146
171 3300025304 Ga0209257_1018136 Ga0209257_10181363 146
172 3300025903 Ga0207680_10596173 Ga0207680_105961731 146
173 3300025909 Ga0207705_10000110 Ga0207705_1000011043 146
174 3300025923 Ga0207681_11227052 Ga0207681_112270521 146
175 3300025933 Ga0207706_10097804 Ga0207706_100978041 146
176 3300025935 Ga0207709_10426533 Ga0207709_104265331 146
177 3300025972 Ga0207668_11330000 Ga0207668_113300002 146
178 3300026035 Ga0207703_10433031 Ga0207703_104330312 146
179 3300026041 Ga0207639_10243761 Ga0207639_102437611 146
180 3300026095 Ga0207676_10586862 Ga0207676_105868622 146
181 3300027111 Ga0209281_1001580 Ga0209281_100158014 146
182 3300027111 Ga0209281_1001651 Ga0209281_100165114 146
183 3300027312 Ga0209371_1000021 Ga0209371_1000021117 146
184 3300027312 Ga0209371_1001105 Ga0209371_100110511 146
185 3300027312 Ga0209371_1013335 Ga0209371_10133352 146
186 3300027666 Ga0209282_1000054 Ga0209282_1000054131 146
187 3300027666 Ga0209282_1000125 Ga0209282_100012538 146
188 3300027666 Ga0209282_1019312 Ga0209282_10193124 146
189 3300027866 Ga0209813_10005218 Ga0209813_100052183 146
190 3300028379 Ga0268266_10051028 Ga0268266_100510282 146
191 3300028800 Ga0265338_10036623 Ga0265338_100366232 146
192 3300030500 Ga0268256_1000020 Ga0268256_1000020123 146
193 3300030500 Ga0268256_1000949 Ga0268256_100094918 146
194 3300030500 Ga0268256_1012448 Ga0268256_10124483 146
195 3300031247 Ga0265340_10331644 Ga0265340_103316441 146
196 3300031731 Ga0307405_10044349 Ga0307405_100443492 146
197 3300031852 Ga0307410_11431552 Ga0307410_114315521 146
198 3300031967 Ga0315914_1000013 Ga0315914_10000132 146
199 3300031995 Ga0307409_100867732 Ga0307409_1008677321 146
200 3300033430 Ga0315913_1000097 Ga0315913_10000972 146
201 3300033464 Ga0315915_1000001 Ga0315915_10000012 146
202 3300035112 Ga0373932_0305660 Ga0373932_0305660_112_573 146
203 3300037312 Ga0395899_0074375 Ga0395899_0074375_1566_2018 146
204 3300037418 Ga0395900_0061386 Ga0395900_0061386_475_927 146
205 3300038443 Ga0395901_0004105 Ga0395901_0004105_5209_5661 146
206 3300039062 Ga0400483_178238 Ga0400483_178238_396_842 146
207 3300039450 Ga0436363_0112556 Ga0436363_0112556_222_671 146
208 3300041404 Ga0439436_0029228 Ga0439436_0029228_317_757 146
209 3300041404 Ga0439436_0223717 Ga0439436_0223717_78_518 146
210 3300042005 Ga0439448_0028174 Ga0439448_0028174_977_1441 146
211 3300042007 Ga0439449_0034264 Ga0439449_0034264_341_781 146
212 3300042008 Ga0439450_041670 Ga0439450_041670_153_617 146
213 3300042014 Ga0439457_096206 Ga0439457_096206_93_533 146
214 3300042015 Ga0439462_0008378 Ga0439462_0008378_1966_2406 146
215 3300042435 Ga0439434_0056789 Ga0439434_0056789_411_851 146
216 3300042438 Ga0439459_0033539 Ga0439459_0033539_178_696 146
217 3300046558 Ga0495633_0036908 Ga0495633_0036908_1232_1687 146
218 3300046558 Ga0495633_0087230 Ga0495633_0087230_38_493 146
219 3300046692 Ga0495671_0072945 Ga0495671_0072945_287_742 146
220 3300048916 Ga0496113_0092827 Ga0496113_0092827_1295_1750 146
221 3300048919 Ga0496116_0046597 Ga0496116_0046597_1906_2361 146
222 3300048919 Ga0496116_0098144 Ga0496116_0098144_1117_1557 146
223 3300048919 Ga0496116_0138094 Ga0496116_0138094_499_939 146
224 3300048920 Ga0496117_0000002 Ga0496117_0000002_1140906_1141361 146
225 3300048920 Ga0496117_0024393 Ga0496117_0024393_4005_4445 146
226 3300048921 Ga0496118_0000707 Ga0496118_0000707_13442_13897 146
227 3300048921 Ga0496118_0140340 Ga0496118_0140340_616_1056 146
228 3300048921 Ga0496118_0209477 Ga0496118_0209477_529_984 146
229 3300048922 Ga0496119_0079346 Ga0496119_0079346_1132_1587 146
230 3300048922 Ga0496119_0116380 Ga0496119_0116380_1008_1463 146
231 3300048922 Ga0496119_0243854 Ga0496119_0243854_41_481 146
232 3300048923 Ga0496120_0000358 Ga0496120_0000358_13445_13900 146
233 3300048923 Ga0496120_0088542 Ga0496120_0088542_422_877 146
234 3300048925 Ga0496122_0000001 Ga0496122_0000001_458018_458473 146
235 3300048925 Ga0496122_0244892 Ga0496122_0244892_469_909 146
236 3300048926 Ga0496123_0000001 Ga0496123_0000001_461749_462204 146
237 3300048926 Ga0496123_0129734 Ga0496123_0129734_687_1127 146
238 3300048927 Ga0496124_0016262 Ga0496124_0016262_3228_3683 146
239 3300048927 Ga0496124_0042537 Ga0496124_0042537_2590_3030 146
240 3300048928 Ga0496125_0000141 Ga0496125_0000141_24729_25169 146
241 3300048928 Ga0496125_0097155 Ga0496125_0097155_911_1366 146
242 3300048928 Ga0496125_0230317 Ga0496125_0230317_330_785 146
243 3300048929 Ga0496126_0053333 Ga0496126_0053333_2773_3213 146
244 3300048929 Ga0496126_0065017 Ga0496126_0065017_457_897 146
245 3300048929 Ga0496126_0293967 Ga0496126_0293967_70_525 146
246 3300049579 Ga0501043_0177359 Ga0501043_0177359_1018_1497 146
247 3300049776 Ga0501280_002079 Ga0501280_002079_2777_3223 146
248 3300050490 nmdc:mga03n38_6480_c1 nmdc:mga03n38_6480_c1_672_1127 146
249 3300050491 nmdc:mga00v17_189036_c1 nmdc:mga00v17_189036_c1_263_703 146
250 3300050491 nmdc:mga00v17_6_c1 nmdc:mga00v17_6_c1_11509_11964 146
251 3300050492 nmdc:mga0yw44_63759_c1 nmdc:mga0yw44_63759_c1_1302_1757 146
252 3300050493 nmdc:mga0k408_671069_c1 nmdc:mga0k408_671069_c1_31_486 146
253 3300050494 nmdc:mga06z11_28078_c1 nmdc:mga06z11_28078_c1_1565_2020 146
254 3300050494 nmdc:mga06z11_28998_c1 nmdc:mga06z11_28998_c1_32_487 146
255 3300050495 nmdc:mga04h51_16944_c1 nmdc:mga04h51_16944_c1_1259_1714 146
256 3300050516 nmdc:mga0sz30_101_c1 nmdc:mga0sz30_101_c1_26129_26584 146
257 3300050516 nmdc:mga0sz30_31983_c2 nmdc:mga0sz30_31983_c2_321_776 146
258 3300053078 Ga0495612_0283504 Ga0495612_0283504_229_690 146
259 3300053091 Ga0500647_0016318 Ga0500647_0016318_507_959 146
260 3300053107 Ga0500560_012107 Ga0500560_012107_66_521 146
261 3300053137 Ga0500561_0000069 Ga0500561_0000069_1562_2017 146
262 3300053157 Ga0500624_000531 Ga0500624_000531_10297_10752 146
263 3300053161 Ga0500634_0012102 Ga0500634_0012102_1138_1578 146
264 3300053161 Ga0500634_0028698 Ga0500634_0028698_125_580 146
265 3300053734 Ga0500565_012494 Ga0500565_012494_209_649 146
266 3300059643 Ga0587072_037709 Ga0587072_037709_154_609 146
267 iso_pu_bacteria 2554235003 2554247545 146
268 iso_pu_bacteria 2558860242 2559294676 146
269 iso_pu_bacteria 2599185210 2599602177 146
270 iso_pu_bacteria 2600255279 2601608307 146
271 iso_pu_bacteria 2600255308 2601745081 146
272 iso_pu_bacteria 2643221582 2643919180 146
273 iso_pu_bacteria 2643221693 2644518339 146
274 iso_pu_bacteria 2808606387 2808985548 146
275 iso_pu_bacteria 2818991439 2819559936 146
276 iso_pu_bacteria 2838675328 2838676376 146
277 iso_pu_bacteria 2838714209 2838715259 146
278 iso_pu_bacteria 2838719591 2838720941 146
279 iso_pu_bacteria 2838724970 2838726017 146
280 iso_pu_bacteria 2841846520 2841847870 146
281 iso_pu_bacteria 2841859092 2841859593 146
282 iso_pu_bacteria 2842124991 2842126100 146
283 iso_pu_bacteria 2842130223 2842131270 146
284 iso_pu_bacteria 2842152218 2842153560 146
285 iso_pu_bacteria 2842170452 2842171502 146
286 iso_pu_bacteria 2842175837 2842177180 146
287 iso_pu_bacteria 2842187318 2842188367 146
288 iso_pu_bacteria 2842211629 2842212678 146
289 iso_pu_bacteria 2842224351 2842225703 146
290 iso_pu_bacteria 2842515876 2842516378 146
291 iso_pu_bacteria 2899792073 2899796348 146
292 iso_pu_bacteria 2899845264 2899850172 146
293 iso_pu_bacteria 2919114240 2919115352 146
294 iso_pu_bacteria 2926754445 2926756402 146
295 iso_pu_bacteria 2926760298 2926760645 146
296 iso_pu_bacteria 2933006813 2933008203 146
297 iso_pu_bacteria 2933011516 2933012981 146
298 iso_pu_bacteria 2933594066 2933595502 146
299 iso_pu_bacteria 2979089926 2979094078 146
300 iso_pu_bacteria 2979095461 2979098540 146
301 iso_pu_bacteria 2979100975 2979106129 146
302 iso_pu_bacteria 2984509177 2984512076 146
303 iso_pu_bacteria 2984518228 2984521563 146
304 iso_pu_bacteria 2984537506 2984540856 146
305 iso_pu_bacteria 2984601300 2984603120 146
306 iso_pu_bacteria 650716007 650739880 146
307 iso_pu_bacteria 8003570095 8003570933 146
308 iso_pu_bacteria 8055431914 8055435851 146
309 3300002773 JGI25152J39213_1001157 JGI25152J39213_10011578 147
310 3300002773 JGI25152J39213_1034106 JGI25152J39213_10341062 147
311 3300002774 JGI25150J39212_1004568 JGI25150J39212_10045683 147
312 3300002987 JGI25159J45721_1000293 JGI25159J45721_100029328 147
313 3300003215 JGI25153J46596_10004664 JGI25153J46596_1000466410 147
314 3300003215 JGI25153J46596_10014056 JGI25153J46596_100140566 147
315 3300003215 JGI25153J46596_10087314 JGI25153J46596_100873142 147
316 3300003215 JGI25153J46596_10087416 JGI25153J46596_100874162 147
317 3300003322 rootL2_10300359 rootL2_103003592 147
318 3300003322 rootL2_10352967 rootL2_103529672 147
319 3300003354 JGI25160J50197_1053583 JGI25160J50197_10535831 147
320 3300003374 JGI25161J50226_1000055 JGI25161J50226_100005511 147
321 3300003374 JGI25161J50226_1000285 JGI25161J50226_100028528 147
322 3300003771 Ga0055526_1004953 Ga0055526_10049537 147
323 3300003775 Ga0055524_1019251 Ga0055524_10192511 147
324 3300003790 Ga0055528_1001381 Ga0055528_10013816 147
325 3300003792 Ga0055540_1035489 Ga0055540_10354891 147
326 3300004625 Ga0055543_1000032 Ga0055543_100003265 147
327 3300005262 Ga0065165_1024528 Ga0065165_10245282 147
328 3300005327 Ga0070658_10014988 Ga0070658_100149882 147
329 3300005331 Ga0070670_100717376 Ga0070670_1007173761 147
330 3300005337 Ga0070682_100118010 Ga0070682_1001180103 147
331 3300005340 Ga0070689_100024653 Ga0070689_1000246534 147
332 3300005353 Ga0070669_100148541 Ga0070669_1001485412 147
333 3300005353 Ga0070669_100410377 Ga0070669_1004103772 147
334 3300005354 Ga0070675_100556500 Ga0070675_1005565002 147
335 3300005365 Ga0070688_100020263 Ga0070688_1000202634 147
336 3300005458 Ga0070681_10002726 Ga0070681_100027268 147
337 3300005467 Ga0070706_100058714 Ga0070706_1000587143 147
338 3300005468 Ga0070707_100051334 Ga0070707_1000513341 147
339 3300005471 Ga0070698_100000151 Ga0070698_10000015112 147
340 3300005518 Ga0070699_100187335 Ga0070699_1001873352 147
341 3300005530 Ga0070679_100041034 Ga0070679_1000410343 147
342 3300005536 Ga0070697_100030482 Ga0070697_1000304823 147
343 3300005548 Ga0070665_100674061 Ga0070665_1006740612 147
344 3300005563 Ga0068855_100088959 Ga0068855_1000889593 147
345 3300005577 Ga0068857_100424081 Ga0068857_1004240812 147
346 3300005614 Ga0068856_100113252 Ga0068856_1001132522 147
347 3300005617 Ga0068859_101183541 Ga0068859_1011835411 147
348 3300006038 Ga0075365_10154173 Ga0075365_101541732 147
349 3300006038 Ga0075365_10262533 Ga0075365_102625332 147
350 3300006038 Ga0075365_10272960 Ga0075365_102729602 147
351 3300006042 Ga0075368_10180004 Ga0075368_101800042 147
352 3300006173 Ga0070716_100939690 Ga0070716_1009396902 147
353 3300006177 Ga0075362_10086007 Ga0075362_100860072 147
354 3300006177 Ga0075362_10092371 Ga0075362_100923713 147
355 3300006177 Ga0075362_10197033 Ga0075362_101970331 147
356 3300006178 Ga0075367_10064788 Ga0075367_100647883 147
357 3300006186 Ga0075369_10244063 Ga0075369_102440631 147
358 3300006186 Ga0075369_10307386 Ga0075369_103073861 147
359 3300006195 Ga0075366_10040599 Ga0075366_100405994 147
360 3300006195 Ga0075366_10060404 Ga0075366_100604042 147
361 3300006353 Ga0075370_10093308 Ga0075370_100933082 147
362 3300006353 Ga0075370_10103096 Ga0075370_101030962 147
363 3300006931 Ga0097620_101183536 Ga0097620_1011835361 147
364 3300007265 Ga0099794_10096910 Ga0099794_100969102 147
365 3300007788 Ga0099795_10131528 Ga0099795_101315282 147
366 3300009093 Ga0105240_10019378 Ga0105240_100193785 147
367 3300009094 Ga0111539_11167688 Ga0111539_111676882 147
368 3300009094 Ga0111539_11390620 Ga0111539_113906202 147
369 3300009553 Ga0105249_10885798 Ga0105249_108857981 147
370 3300010159 Ga0099796_10047116 Ga0099796_100471163 147
371 3300013105 Ga0157369_10633340 Ga0157369_106333401 147
372 3300014968 Ga0157379_10111183 Ga0157379_101111832 147
373 3300025208 Ga0209436_100001 Ga0209436_10000124 147
374 3300025245 Ga0207425_1014439 Ga0207425_10144393 147
375 3300025245 Ga0207425_1020398 Ga0207425_10203981 147
376 3300025258 Ga0209129_1000750 Ga0209129_10007505 147
377 3300025258 Ga0209129_1002899 Ga0209129_10028998 147
378 3300025258 Ga0209129_1003789 Ga0209129_10037896 147
379 3300025273 Ga0209673_1003813 Ga0209673_10038139 147
380 3300025284 Ga0209130_1000004 Ga0209130_100000488 147
381 3300025294 Ga0209025_1078223 Ga0209025_10782232 147
382 3300025295 Ga0209564_1000566 Ga0209564_100056612 147
383 3300025297 Ga0209758_1000468 Ga0209758_100046866 147
384 3300025297 Ga0209758_1000977 Ga0209758_100097743 147
385 3300025297 Ga0209758_1002398 Ga0209758_100239814 147
386 3300025299 Ga0209256_1004862 Ga0209256_10048627 147
387 3300025302 Ga0207426_1000003 Ga0207426_1000003640 147
388 3300025901 Ga0207688_10427585 Ga0207688_104275853 147
389 3300025907 Ga0207645_10330119 Ga0207645_103301192 147
390 3300025910 Ga0207684_10233057 Ga0207684_102330572 147
391 3300025912 Ga0207707_10017396 Ga0207707_100173964 147
392 3300025913 Ga0207695_10064008 Ga0207695_100640083 147
393 3300025917 Ga0207660_10034157 Ga0207660_100341572 147
394 3300025921 Ga0207652_10043802 Ga0207652_100438023 147
395 3300025922 Ga0207646_10198908 Ga0207646_101989081 147
396 3300025923 Ga0207681_10069870 Ga0207681_100698702 147
397 3300025923 Ga0207681_10619260 Ga0207681_106192602 147
398 3300025925 Ga0207650_10633696 Ga0207650_106336962 147
399 3300025936 Ga0207670_10377249 Ga0207670_103772492 147
400 3300025940 Ga0207691_10686214 Ga0207691_106862142 147
401 3300025949 Ga0207667_10031492 Ga0207667_100314923 147
402 3300025972 Ga0207668_10627388 Ga0207668_106273882 147
403 3300027671 Ga0209588_1129356 Ga0209588_11293562 147
404 3300028380 Ga0268265_10552065 Ga0268265_105520652 147
405 3300028380 Ga0268265_10935452 Ga0268265_109354522 147
406 3300028573 Ga0265334_10013945 Ga0265334_100139453 147
407 3300028794 Ga0307515_10285271 Ga0307515_102852712 147
408 3300031456 Ga0307513_10539347 Ga0307513_105393472 147
409 3300031548 Ga0307408_100208409 Ga0307408_1002084092 147
410 3300031911 Ga0307412_10161620 Ga0307412_101616201 147
411 3300031911 Ga0307412_10724618 Ga0307412_107246181 147
412 3300031995 Ga0307409_101079607 Ga0307409_1010796072 147
413 3300034816 Ga0373930_0179619 Ga0373930_0179619_57_521 147
414 3300035116 Ga0373945_0584915 Ga0373945_0584915_15_470 147
415 3300035691 Ga0373931_0229342 Ga0373931_0229342_184_648 147
416 3300035725 Ga0373947_0481725 Ga0373947_0481725_236_691 147
417 3300039062 Ga0400483_102732 Ga0400483_102732_219_665 147
418 3300039062 Ga0400483_274835 Ga0400483_274835_200_646 147
419 3300041404 Ga0439436_0012845 Ga0439436_0012845_1523_1993 147
420 3300041413 Ga0439465_0008271 Ga0439465_0008271_1446_1889 147
421 3300041413 Ga0439465_0011638 Ga0439465_0011638_626_1096 147
422 3300041486 Ga0451807_0712293 Ga0451807_0712293_126_578 147
423 3300042006 Ga0439432_101339 Ga0439432_101339_350_805 147
424 3300042015 Ga0439462_0048018 Ga0439462_0048018_601_1071 147
425 3300042185 Ga0450909_053450 Ga0450909_053450_147_617 147
426 3300042435 Ga0439434_0033666 Ga0439434_0033666_51_521 147
427 3300046457 Ga0495590_0056805 Ga0495590_0056805_126_569 147
428 3300046512 Ga0495610_0026067 Ga0495610_0026067_1611_2054 147
429 3300046519 Ga0495632_0360469 Ga0495632_0360469_19_462 147
430 3300046522 Ga0495643_0030117 Ga0495643_0030117_1685_2128 147
431 3300046558 Ga0495633_0058922 Ga0495633_0058922_128_598 147
432 3300046660 Ga0495625_0099113 Ga0495625_0099113_269_739 147
433 3300046660 Ga0495625_0361690 Ga0495625_0361690_418_873 147
434 3300046660 Ga0495625_0478982 Ga0495625_0478982_79_522 147
435 3300046694 Ga0495649_0024030 Ga0495649_0024030_2055_2498 147
436 3300047472 Ga0495686_0123778 Ga0495686_0123778_768_1211 147
437 3300048091 Ga0495626_0053772 Ga0495626_0053772_1356_1799 147
438 3300048909 Ga0496106_0001595 Ga0496106_0001595_9675_10118 147
439 3300048919 Ga0496116_0042554 Ga0496116_0042554_2093_2536 147
440 3300048921 Ga0496118_0046965 Ga0496118_0046965_2094_2537 147
441 3300048925 Ga0496122_0029922 Ga0496122_0029922_1270_1713 147
442 3300048928 Ga0496125_0117916 Ga0496125_0117916_369_812 147
443 3300048929 Ga0496126_0019977 Ga0496126_0019977_4419_4874 147
444 3300049569 Ga0501032_0199509 Ga0501032_0199509_385_828 147
445 3300049572 Ga0501036_0910285 Ga0501036_0910285_64_516 147
446 3300049572 Ga0501036_1547017 Ga0501036_1547017_19_474 147
447 3300049579 Ga0501043_0819367 Ga0501043_0819367_214_657 147
448 3300049580 Ga0501046_0069988 Ga0501046_0069988_1286_1729 147
449 3300049581 Ga0501047_0187014 Ga0501047_0187014_240_683 147
450 3300049584 Ga0501068_0521094 Ga0501068_0521094_71_514 147
451 3300050489 nmdc:mga03683_10860_c2 nmdc:mga03683_10860_c2_244_699 147
452 3300050493 nmdc:mga0k408_113543_c1 nmdc:mga0k408_113543_c1_1059_1514 147
453 3300050494 nmdc:mga06z11_210679_c1 nmdc:mga06z11_210679_c1_314_769 147
454 3300050494 nmdc:mga06z11_240475_c1 nmdc:mga06z11_240475_c1_593_1048 147
455 3300050494 nmdc:mga06z11_252707_c1 nmdc:mga06z11_252707_c1_438_893 147
456 3300050494 nmdc:mga06z11_298068_c1 nmdc:mga06z11_298068_c1_278_733 147
457 3300050496 nmdc:mga07m45_611173_c1 nmdc:mga07m45_611173_c1_134_598 147
458 3300050496 nmdc:mga07m45_91225_c1 nmdc:mga07m45_91225_c1_656_1111 147
459 3300050511 nmdc:mga08y16_539720_c1 nmdc:mga08y16_539720_c1_54_506 147
460 3300050516 nmdc:mga0sz30_112070_c1 nmdc:mga0sz30_112070_c1_162_617 147
461 3300053077 Ga0495601_0305726 Ga0495601_0305726_180_635 147
462 3300053088 Ga0500644_0068743 Ga0500644_0068743_631_1074 147
463 3300053091 Ga0500647_0342116 Ga0500647_0342116_19_477 147
464 3300053093 Ga0500651_0131301 Ga0500651_0131301_841_1296 147
465 3300053093 Ga0500651_0244998 Ga0500651_0244998_329_787 147
466 3300053093 Ga0500651_0261845 Ga0500651_0261845_89_532 147
467 3300053096 Ga0500641_0002522 Ga0500641_0002522_4198_4653 147
468 3300053108 Ga0500562_048700 Ga0500562_048700_79_522 147
469 3300053139 Ga0500568_0017780 Ga0500568_0017780_1330_1773 147
470 3300053151 Ga0500604_0045791 Ga0500604_0045791_108_578 147
471 3300053151 Ga0500604_0207054 Ga0500604_0207054_64_507 147
472 3300053155 Ga0500620_046666 Ga0500620_046666_385_843 147
473 3300053156 Ga0500622_0000428 Ga0500622_0000428_28688_29131 147
474 3300053160 Ga0500633_0008836 Ga0500633_0008836_783_1226 147
475 3300060353 Ga0501082_0133402 Ga0501082_0133402_175_618 147
476 iso_pu_bacteria 2513237159 2514002377 147
477 iso_pu_bacteria 2582581283 2585168202 147
478 iso_pu_bacteria 2582581306 2585268815 147
479 iso_pu_bacteria 2582581865 2585390994 147
480 iso_pu_bacteria 2582581866 2585398157 147
481 iso_pu_bacteria 2643221607 2644049659 147
482 iso_pu_bacteria 2643221636 2644203933 147
483 iso_pu_bacteria 2643221637 2644207684 147
484 iso_pu_bacteria 2643221686 2644482692 147
485 iso_pu_bacteria 2643221689 2644499180 147
486 iso_pu_bacteria 2643221718 2644654509 147
487 iso_pu_bacteria 2842521101 2842527541 147
488 iso_pu_bacteria 3005409236 3005415246 147
489 iso_pu_bacteria 8005658619 8005659357 147
490 3300003323 rootH1_10184069 rootH1_101840696 148
491 3300005262 Ga0065165_1022266 Ga0065165_10222662 148
492 3300005262 Ga0065165_1123427 Ga0065165_11234271 148
493 3300005548 Ga0070665_100080096 Ga0070665_1000800963 148
494 3300006038 Ga0075365_10010246 Ga0075365_100102467 148
495 3300006847 Ga0075431_100773959 Ga0075431_1007739591 148
496 3300006946 Ga0079104_1000187 Ga0079104_10001875 148
497 3300010375 Ga0105239_11069623 Ga0105239_110696232 148
498 3300013100 Ga0157373_10082621 Ga0157373_100826213 148
499 3300013105 Ga0157369_10598662 Ga0157369_105986623 148
500 3300025292 Ga0209676_1006442 Ga0209676_10064424 148
501 3300025294 Ga0209025_1104696 Ga0209025_11046962 148
502 3300025297 Ga0209758_1001150 Ga0209758_100115021 148
503 3300025298 Ga0209050_1003942 Ga0209050_10039428 148
504 3300025303 Ga0209051_1006140 Ga0209051_10061407 148
505 3300025304 Ga0209257_1004333 Ga0209257_100433311 148
506 3300025926 Ga0207659_10357109 Ga0207659_103571091 148
507 3300025972 Ga0207668_10334224 Ga0207668_103342242 148
508 3300027111 Ga0209281_1000310 Ga0209281_10003105 148
509 3300028794 Ga0307515_10006047 Ga0307515_1000604715 148
510 3300030733 Ga0314311_1171563 Ga0314311_11715632 148
511 3300031548 Ga0307408_100735280 Ga0307408_1007352802 148
512 3300031730 Ga0307516_10759061 Ga0307516_107590611 148
513 3300032005 Ga0307411_11316796 Ga0307411_113167961 148
514 3300035113 Ga0373936_0088725 Ga0373936_0088725_171_629 148
515 3300035695 Ga0373927_0000407 Ga0373927_0000407_12557_13018 148
516 3300037068 Ga0373925_0001435 Ga0373925_0001435_19980_20441 148
517 3300037312 Ga0395899_0024032 Ga0395899_0024032_430_897 148
518 3300037418 Ga0395900_0021639 Ga0395900_0021639_1101_1568 148
519 3300037466 Ga0395898_0022898 Ga0395898_0022898_1103_1570 148
520 3300037471 Ga0395905_0007940 Ga0395905_0007940_1686_2144 148
521 3300038443 Ga0395901_0027696 Ga0395901_0027696_4515_4982 148
522 3300039437 Ga0436365_0717650 Ga0436365_0717650_722_1180 148
523 3300039438 Ga0436360_0173596 Ga0436360_0173596_537_995 148
524 3300041512 Ga0451853_1097193 Ga0451853_1097193_107_571 148
525 3300042006 Ga0439432_168333 Ga0439432_168333_56_514 148
526 3300046460 Ga0495638_0054429 Ga0495638_0054429_110_577 148
527 3300046460 Ga0495638_0217556 Ga0495638_0217556_332_793 148
528 3300046530 Ga0495654_0002126 Ga0495654_0002126_10936_11382 148
529 3300048909 Ga0496106_0568623 Ga0496106_0568623_141_605 148
530 3300048913 Ga0496110_0151349 Ga0496110_0151349_1561_2013 148
531 3300048914 Ga0496111_0006839 Ga0496111_0006839_5932_6384 148
532 3300048915 Ga0496112_0268704 Ga0496112_0268704_791_1249 148
533 3300048924 Ga0496121_0013771 Ga0496121_0013771_241_687 148
534 3300048924 Ga0496121_0169611 Ga0496121_0169611_334_795 148
535 3300048925 Ga0496122_0056329 Ga0496122_0056329_1587_2039 148
536 3300048926 Ga0496123_0053460 Ga0496123_0053460_1319_1771 148
537 3300048927 Ga0496124_0017489 Ga0496124_0017489_4215_4661 148
538 3300048929 Ga0496126_0050834 Ga0496126_0050834_1448_1894 148
539 3300049822 Ga0501035_0003599 Ga0501035_0003599_2797_3285 148
540 3300050492 nmdc:mga0yw44_31324_c1 nmdc:mga0yw44_31324_c1_1190_1654 148
541 3300053088 Ga0500644_0004184 Ga0500644_0004184_1273_1734 148
542 3300053104 Ga0500556_0259696 Ga0500556_0259696_166_618 148
543 3300053122 Ga0500608_171806 Ga0500608_171806_95_553 148
544 3300053125 Ga0500618_000289 Ga0500618_000289_11541_11993 148
545 3300053156 Ga0500622_0000159 Ga0500622_0000159_61648_62109 148
546 iso_pu_bacteria 2718217927 2719385690 148
547 iso_pu_bacteria 3005452660 3005454124 148
548 iso_pu_bacteria 8005275841 8005280465 148
549 3300005364 Ga0070673_100425764 Ga0070673_1004257641 149
550 3300005548 Ga0070665_100050726 Ga0070665_1000507262 149
551 3300005548 Ga0070665_100555295 Ga0070665_1005552952 149
552 3300005844 Ga0068862_100885599 Ga0068862_1008855992 149
553 3300005937 Ga0081455_10816168 Ga0081455_108161681 149
554 3300006177 Ga0075362_10021563 Ga0075362_100215633 149
555 3300006178 Ga0075367_10070981 Ga0075367_100709812 149
556 3300006178 Ga0075367_10348223 Ga0075367_103482232 149
557 3300006195 Ga0075366_10026057 Ga0075366_100260573 149
558 3300009101 Ga0105247_11161126 Ga0105247_111611261 149
559 3300009177 Ga0105248_11954245 Ga0105248_119542452 149
560 3300009545 Ga0105237_10000658 Ga0105237_1000065832 149
561 3300009551 Ga0105238_10591476 Ga0105238_105914762 149
562 3300009553 Ga0105249_10315122 Ga0105249_103151222 149
563 3300010375 Ga0105239_10001871 Ga0105239_1000187115 149
564 3300025914 Ga0207671_10000757 Ga0207671_100007576 149
565 3300025925 Ga0207650_10565817 Ga0207650_105658172 149
566 3300026041 Ga0207639_11450655 Ga0207639_114506552 149
567 3300028379 Ga0268266_10000578 Ga0268266_1000057848 149
568 3300028379 Ga0268266_10459297 Ga0268266_104592972 149
569 3300028380 Ga0268265_10755517 Ga0268265_107555172 149
570 3300031238 Ga0265332_10031703 Ga0265332_100317032 149
571 3300031548 Ga0307408_101802129 Ga0307408_1018021291 149
572 3300039438 Ga0436360_0190081 Ga0436360_0190081_646_1107 149
573 3300039438 Ga0436360_0744027 Ga0436360_0744027_120_590 149
574 3300039450 Ga0436363_0430915 Ga0436363_0430915_185_655 149
575 3300039453 Ga0436362_0570914 Ga0436362_0570914_679_1149 149
576 3300041512 Ga0451853_1650843 Ga0451853_1650843_96_557 149
577 3300048915 Ga0496112_0588667 Ga0496112_0588667_528_998 149
578 3300049570 Ga0501033_0040100 Ga0501033_0040100_2271_2735 149
579 3300049579 Ga0501043_0370163 Ga0501043_0370163_372_833 149
580 3300049580 Ga0501046_0114629 Ga0501046_0114629_917_1378 149
581 3300049580 Ga0501046_0289017 Ga0501046_0289017_695_1156 149
582 3300049581 Ga0501047_0227216 Ga0501047_0227216_371_832 149
583 3300049581 Ga0501047_0794212 Ga0501047_0794212_269_730 149
584 3300049587 Ga0501071_1013194 Ga0501071_1013194_26_487 149
585 3300049822 Ga0501035_0179834 Ga0501035_0179834_501_965 149
586 3300050489 nmdc:mga03683_32536_c1 nmdc:mga03683_32536_c1_274_738 149
587 3300050490 nmdc:mga03n38_174959_c1 nmdc:mga03n38_174959_c1_410_874 149
588 3300050491 nmdc:mga00v17_530666_c1 nmdc:mga00v17_530666_c1_95_556 149
589 3300050492 nmdc:mga0yw44_123075_c1 nmdc:mga0yw44_123075_c1_1002_1466 149
590 3300050516 nmdc:mga0sz30_107080_c1 nmdc:mga0sz30_107080_c1_216_680 149
591 3300053088 Ga0500644_0138284 Ga0500644_0138284_349_813 149
592 3300053119 Ga0500595_113604 Ga0500595_113604_260_718 149
593 3300053130 Ga0500642_0236784 Ga0500642_0236784_349_810 149
594 3300053153 Ga0500616_0002029 Ga0500616_0002029_8042_8506 149
595 3300060353 Ga0501082_0072235 Ga0501082_0072235_2218_2679 149
596 iso_pu_bacteria 2718218423 2721399470 149
597 iso_pu_bacteria 2721755809 2724038283 149
598 iso_pu_bacteria 2791355267 2793369354 149
599 iso_pu_bacteria 2841864319 2841864661 149
600 iso_pu_bacteria 2842341865 2842345940 149
601 iso_pu_bacteria 8056375014 8056376524 149
602 3300031731 Ga0307405_10199485 Ga0307405_101994852 150
603 3300048907 Ga0496104_0351237 Ga0496104_0351237_51_515 150
604 3300048908 Ga0496105_0130480 Ga0496105_0130480_789_1253 150
605 3300048912 Ga0496109_0066556 Ga0496109_0066556_2474_2938 150
606 3300048913 Ga0496110_1075325 Ga0496110_1075325_132_596 150
607 3300048914 Ga0496111_0730523 Ga0496111_0730523_169_633 150
608 3300048915 Ga0496112_0545195 Ga0496112_0545195_109_573 150
609 3300048917 Ga0496114_0160410 Ga0496114_0160410_550_1014 150
610 3300048918 Ga0496115_0207473 Ga0496115_0207473_282_746 150
611 3300048922 Ga0496119_0238675 Ga0496119_0238675_334_789 150
612 3300048925 Ga0496122_0000025 Ga0496122_0000025_9325_9780 150
613 3300048926 Ga0496123_0000054 Ga0496123_0000054_164314_164769 150
614 3300048927 Ga0496124_0042501 Ga0496124_0042501_2481_2936 150
615 iso_pu_bacteria 2508501050 2508734657 150
616 iso_pu_bacteria 2510917022 2511135021 150
617 iso_pu_bacteria 2524023209 2524460370 150
618 iso_pu_bacteria 2582581307 2585270760 150
619 iso_pu_bacteria 2585427531 2585558483 150
620 iso_pu_bacteria 2585427609 2585904547 150
621 iso_pu_bacteria 2585428125 2587980337 150
622 iso_pu_bacteria 2615840698 2616557209 150
623 iso_pu_bacteria 2617270742 2617385694 150
624 iso_pu_bacteria 2667528174 2671111806 150
625 iso_pu_bacteria 2718218199 2720491929 150
626 iso_pu_bacteria 2718218232 2720613196 150
627 iso_pu_bacteria 2718218233 2720620071 150
628 iso_pu_bacteria 2718218235 2720631496 150
629 iso_pu_bacteria 2718218269 2720775224 150
630 iso_pu_bacteria 2721755556 2723026841 150
631 iso_pu_bacteria 2721755684 2723560458 150
632 iso_pu_bacteria 2721755685 2723567043 150
633 iso_pu_bacteria 2721755819 2724089831 150
634 iso_pu_bacteria 2721755822 2724104308 150
635 iso_pu_bacteria 2721755823 2724110103 150
636 iso_pu_bacteria 2728369352 2730107777 150
637 iso_pu_bacteria 2791355256 2793294574 150
638 iso_pu_bacteria 2791355262 2793335830 150
639 iso_pu_bacteria 2791355265 2793356693 150
640 iso_pu_bacteria 2838016132 2838021014 150
641 iso_pu_bacteria 2838048938 2838052526 150
642 iso_pu_bacteria 2838061910 2838066051 150
643 iso_pu_bacteria 2838068647 2838073485 150
644 iso_pu_bacteria 2842205361 2842206137 150
645 iso_pu_bacteria 2842264693 2842268173 150
646 iso_pu_bacteria 2842278818 2842279594 150
647 iso_pu_bacteria 2842298080 2842302137 150
648 iso_pu_bacteria 2842311132 2842313811 150
649 iso_pu_bacteria 2842357229 2842357396 150
650 iso_pu_bacteria 2842395702 2842397563 150
651 iso_pu_bacteria 2842422224 2842428009 150
652 iso_pu_bacteria 2842428310 2842431592 150
653 iso_pu_bacteria 2842434925 2842438448 150
654 iso_pu_bacteria 2842441272 2842445078 150
655 iso_pu_bacteria 2842447887 2842452397 150
656 iso_pu_bacteria 2842462802 2842465964 150
657 iso_pu_bacteria 2842469257 2842473063 150
658 iso_pu_bacteria 2842509118 2842515197 150
659 iso_pu_bacteria 2852387548 2852389801 150
660 iso_pu_bacteria 2891048133 2891051458 150
661 iso_pu_bacteria 2919408235 2919411781 150
662 iso_pu_bacteria 2933599457 2933604031 150
663 iso_pu_bacteria 2989771324 2989773630 150
664 iso_pu_bacteria 8005282627 8005283082 150
665 iso_pu_bacteria 8005289223 8005290357 150
666 iso_pu_bacteria 8005430974 8005432031 150
667 iso_pu_bacteria 8005484373 8005485054 150
668 iso_pu_bacteria 8005619151 8005621604 150
669 iso_pu_bacteria 8005682033 8005683283 150
670 iso_pu_bacteria 8005695170 8005700129 150
671 iso_pu_bacteria 8018150411 8018155534 150
672 iso_pu_bacteria 8024486573 8024492349 150
673 iso_pu_bacteria 8056382006 8056388199 150
674 3300006038 Ga0075365_10029689 Ga0075365_100296892 151
675 3300006353 Ga0075370_10054206 Ga0075370_100542063 151
676 3300006847 Ga0075431_101131689 Ga0075431_1011316891 151
677 3300025294 Ga0209025_1000320 Ga0209025_100032048 151
678 3300031456 Ga0307513_10011737 Ga0307513_100117376 151
679 3300035114 Ga0373939_0120192 Ga0373939_0120192_229_705 151
680 3300035695 Ga0373927_0136081 Ga0373927_0136081_416_892 151
681 3300039062 Ga0400483_148425 Ga0400483_148425_635_1108 151
682 3300039438 Ga0436360_0874254 Ga0436360_0874254_393_863 151
683 3300046663 Ga0495635_0728489 Ga0495635_0728489_28_504 151
684 3300048925 Ga0496122_0000651 Ga0496122_0000651_39414_39887 151
685 3300048926 Ga0496123_0000043 Ga0496123_0000043_26069_26542 151
686 3300048927 Ga0496124_0030733 Ga0496124_0030733_2693_3166 151
687 3300048928 Ga0496125_0000671 Ga0496125_0000671_16426_16899 151
688 3300048929 Ga0496126_0002292 Ga0496126_0002292_17805_18278 151
689 3300050489 nmdc:mga03683_61537_c1 nmdc:mga03683_61537_c1_612_1082 151
690 3300050492 nmdc:mga0yw44_17391_c1 nmdc:mga0yw44_17391_c1_2317_2787 151
691 3300050494 nmdc:mga06z11_52039_c1 nmdc:mga06z11_52039_c1_625_1095 151
692 iso_pu_bacteria 2891373044 2891377357 151
693 3300005436 Ga0070713_100157884 Ga0070713_1001578842 152
694 3300005937 Ga0081455_10095265 Ga0081455_100952652 152
695 3300025898 Ga0207692_10063643 Ga0207692_100636432 152
696 3300025906 Ga0207699_10249809 Ga0207699_102498092 152
697 3300025928 Ga0207700_10487130 Ga0207700_104871302 152
698 3300025939 Ga0207665_10505772 Ga0207665_105057722 152
699 3300048907 Ga0496104_0649323 Ga0496104_0649323_29_523 152
700 3300049568 Ga0501031_0080518 Ga0501031_0080518_696_1175 152
701 3300049569 Ga0501032_0093495 Ga0501032_0093495_803_1282 152
702 3300049570 Ga0501033_0031332 Ga0501033_0031332_61_534 152
703 3300049570 Ga0501033_0174992 Ga0501033_0174992_741_1220 152
704 3300049571 Ga0501034_0363344 Ga0501034_0363344_728_1207 152
705 3300049573 Ga0501037_0154368 Ga0501037_0154368_485_964 152
706 3300049573 Ga0501037_0675558 Ga0501037_0675558_186_659 152
707 3300049822 Ga0501035_0255694 Ga0501035_0255694_667_1140 152
708 3300049823 Ga0501044_0002124 Ga0501044_0002124_18187_18660 152
709 3300049823 Ga0501044_0345866 Ga0501044_0345866_828_1307 152
710 iso_pu_bacteria 2508501114 2509074982 152
711 iso_pu_bacteria 8054558443 8054559668 152
712 3300003771 Ga0055526_1005675 Ga0055526_10056752 153
713 3300003775 Ga0055524_1013230 Ga0055524_10132304 153
714 3300003790 Ga0055528_1001394 Ga0055528_100139413 153
715 3300003792 Ga0055540_1002604 Ga0055540_100260413 153
716 3300003794 Ga0055531_10016787 Ga0055531_100167874 153
717 3300006353 Ga0075370_10237136 Ga0075370_102371362 153
718 3300025273 Ga0209673_1000013 Ga0209673_1000013539 153
719 3300025292 Ga0209676_1037170 Ga0209676_10371703 153
720 3300025295 Ga0209564_1000631 Ga0209564_10006318 153
721 3300025299 Ga0209256_1002496 Ga0209256_100249613 153
722 3300025303 Ga0209051_1003419 Ga0209051_100341913 153
723 3300025304 Ga0209257_1001375 Ga0209257_100137513 153
724 3300025925 Ga0207650_10003131 Ga0207650_1000313113 153
725 3300041507 Ga0451851_0541643 Ga0451851_0541643_391_855 153
726 3300049571 Ga0501034_0226966 Ga0501034_0226966_833_1294 153
727 3300049571 Ga0501034_0550503 Ga0501034_0550503_36_497 153
728 3300050496 nmdc:mga07m45_333242_c1 nmdc:mga07m45_333242_c1_244_708 153
729 3300050516 nmdc:mga0sz30_95617_c1 nmdc:mga0sz30_95617_c1_606_1070 153
730 iso_pu_bacteria 2989349275 2989353276 153
731 3300002704 JGI25155J39150_1000215 JGI25155J39150_100021526 154
732 3300002705 JGI25156J39149_1000491 JGI25156J39149_100049126 154
733 3300002737 JGI25162J39368_1001915 JGI25162J39368_100191511 154
734 3300002737 JGI25162J39368_1002069 JGI25162J39368_10020692 154
735 3300002738 JGI25154J39366_1000407 JGI25154J39366_100040726 154
736 3300002741 JGI25157J39369_1000515 JGI25157J39369_100051526 154
737 3300002773 JGI25152J39213_1008120 JGI25152J39213_10081202 154
738 3300002987 JGI25159J45721_1000220 JGI25159J45721_100022023 154
739 3300003187 JGI25151J46595_10001450 JGI25151J46595_1000145018 154
740 3300003214 JGI25165J46597_1001761 JGI25165J46597_100176111 154
741 3300003214 JGI25165J46597_1001866 JGI25165J46597_100186612 154
742 3300003214 JGI25165J46597_1008613 JGI25165J46597_10086132 154
743 3300003215 JGI25153J46596_10007765 JGI25153J46596_100077656 154
744 3300003215 JGI25153J46596_10008138 JGI25153J46596_100081386 154
745 3300003323 rootH1_10048537 rootH1_100485371 154
746 3300003354 JGI25160J50197_1000010 JGI25160J50197_1000010192 154
747 3300003374 JGI25161J50226_1000006 JGI25161J50226_1000006192 154
748 3300003752 Ga0055539_1013472 Ga0055539_10134722 154
749 3300003775 Ga0055524_1012070 Ga0055524_10120704 154
750 3300003775 Ga0055524_1030501 Ga0055524_10305013 154
751 3300003790 Ga0055528_1023071 Ga0055528_10230713 154
752 3300004625 Ga0055543_1000014 Ga0055543_100001498 154
753 3300005262 Ga0065165_1000262 Ga0065165_100026279 154
754 3300005563 Ga0068855_100128550 Ga0068855_1001285502 154
755 3300005614 Ga0068856_100052692 Ga0068856_1000526922 154
756 3300006038 Ga0075365_10086449 Ga0075365_100864493 154
757 3300006042 Ga0075368_10113521 Ga0075368_101135212 154
758 3300006048 Ga0075363_100125738 Ga0075363_1001257382 154
759 3300006177 Ga0075362_10070336 Ga0075362_100703363 154
760 3300006178 Ga0075367_10099503 Ga0075367_100995033 154
761 3300006178 Ga0075367_10971474 Ga0075367_109714741 154
762 3300006195 Ga0075366_10125621 Ga0075366_101256213 154
763 3300006353 Ga0075370_10025799 Ga0075370_100257993 154
764 3300006353 Ga0075370_10073225 Ga0075370_100732253 154
765 3300009093 Ga0105240_10000005 Ga0105240_10000005505 154
766 3300009177 Ga0105248_10621421 Ga0105248_106214212 154
767 3300009545 Ga0105237_10001882 Ga0105237_1000188220 154
768 3300009551 Ga0105238_10667738 Ga0105238_106677382 154
769 3300009765 Ga0123341_1003085 Ga0123341_100308515 154
770 3300009766 Ga0123342_1025664 Ga0123342_10256644 154
771 3300010375 Ga0105239_10002014 Ga0105239_1000201420 154
772 3300013104 Ga0157370_10000274 Ga0157370_1000027450 154
773 3300014497 Ga0182008_10055338 Ga0182008_100553382 154
774 3300015262 Ga0182007_10025628 Ga0182007_100256282 154
775 3300015265 Ga0182005_1001371 Ga0182005_100137112 154
776 3300025206 Ga0209435_100045 Ga0209435_10004526 154
777 3300025208 Ga0209436_117228 Ga0209436_1172282 154
778 3300025228 Ga0209672_103242 Ga0209672_1032422 154
779 3300025228 Ga0209672_123109 Ga0209672_1231092 154
780 3300025233 Ga0209437_100047 Ga0209437_100047317 154
781 3300025233 Ga0209437_100683 Ga0209437_10068320 154
782 3300025245 Ga0207425_1021426 Ga0207425_10214261 154
783 3300025246 Ga0209646_1000154 Ga0209646_100015426 154
784 3300025246 Ga0209646_1027651 Ga0209646_10276512 154
785 3300025250 Ga0209026_1000177 Ga0209026_100017726 154
786 3300025253 Ga0209677_100435 Ga0209677_10043514 154
787 3300025256 Ga0209759_1000795 Ga0209759_100079526 154
788 3300025256 Ga0209759_1013140 Ga0209759_10131401 154
789 3300025258 Ga0209129_1000880 Ga0209129_10008803 154
790 3300025261 Ga0209233_1000048 Ga0209233_100004886 154
791 3300025261 Ga0209233_1000069 Ga0209233_1000069352 154
792 3300025261 Ga0209233_1000221 Ga0209233_100022131 154
793 3300025272 Ga0209455_1017853 Ga0209455_10178532 154
794 3300025273 Ga0209673_1002743 Ga0209673_100274315 154
795 3300025284 Ga0209130_1000021 Ga0209130_100002176 154
796 3300025284 Ga0209130_1035722 Ga0209130_10357222 154
797 3300025294 Ga0209025_1000572 Ga0209025_10005723 154
798 3300025295 Ga0209564_1025288 Ga0209564_10252883 154
799 3300025297 Ga0209758_1000342 Ga0209758_100034288 154
800 3300025297 Ga0209758_1003813 Ga0209758_100381315 154
801 3300025299 Ga0209256_1011729 Ga0209256_10117293 154
802 3300025299 Ga0209256_1016054 Ga0209256_10160543 154
803 3300025302 Ga0207426_1000010 Ga0207426_1000010282 154
804 3300025303 Ga0209051_1009251 Ga0209051_10092513 154
805 3300025913 Ga0207695_10000011 Ga0207695_10000011413 154
806 3300025914 Ga0207671_10000314 Ga0207671_1000031434 154
807 3300025941 Ga0207711_10445663 Ga0207711_104456632 154
808 3300025949 Ga0207667_10043146 Ga0207667_100431466 154
809 3300026078 Ga0207702_10058187 Ga0207702_100581871 154
810 3300027312 Ga0209371_1023301 Ga0209371_10233012 154
811 3300027866 Ga0209813_10121670 Ga0209813_101216702 154
812 3300028379 Ga0268266_10455844 Ga0268266_104558442 154
813 3300028379 Ga0268266_10808225 Ga0268266_108082252 154
814 3300030500 Ga0268256_1026424 Ga0268256_10264242 154
815 3300031456 Ga0307513_10125578 Ga0307513_101255783 154
816 3300031995 Ga0307409_100241764 Ga0307409_1002417641 154
817 3300041491 Ga0451833_0262727 Ga0451833_0262727_31_498 154
818 3300041494 Ga0451837_1418875 Ga0451837_1418875_249_716 154
819 3300041501 Ga0451845_0362302 Ga0451845_0362302_73_540 154
820 3300041503 Ga0451847_0884533 Ga0451847_0884533_178_645 154
821 3300041505 Ga0451849_0921126 Ga0451849_0921126_73_540 154
822 3300041505 Ga0451849_1069185 Ga0451849_1069185_264_731 154
823 3300041507 Ga0451851_0100692 Ga0451851_0100692_208_675 154
824 3300041509 Ga0451843_0307744 Ga0451843_0307744_327_794 154
825 3300041509 Ga0451843_0379233 Ga0451843_0379233_73_540 154
826 3300041511 Ga0451855_1109988 Ga0451855_1109988_176_643 154
827 3300041512 Ga0451853_0486423 Ga0451853_0486423_443_910 154
828 3300042006 Ga0439432_041695 Ga0439432_041695_427_894 154
829 3300042015 Ga0439462_0092616 Ga0439462_0092616_63_530 154
830 3300044694 Ga0466963_0060459 Ga0466963_0060459_227_724 154
831 3300044706 Ga0466964_0458142 Ga0466964_0458142_21_518 154
832 3300044765 Ga0466970_0028377 Ga0466970_0028377_2255_2752 154
833 3300044842 Ga0466957_0012593 Ga0466957_0012593_3523_4020 154
834 3300045836 Ga0466958_0117429 Ga0466958_0117429_1069_1566 154
835 3300046459 Ga0495629_0098719 Ga0495629_0098719_1493_1960 154
836 3300046460 Ga0495638_0076499 Ga0495638_0076499_128_595 154
837 3300046462 Ga0495651_0184285 Ga0495651_0184285_222_689 154
838 3300046471 Ga0495650_0118366 Ga0495650_0118366_394_861 154
839 3300046474 Ga0495605_0013569 Ga0495605_0013569_68_535 154
840 3300046474 Ga0495605_0051434 Ga0495605_0051434_859_1326 154
841 3300046476 Ga0495662_0018810 Ga0495662_0018810_2172_2639 154
842 3300046477 Ga0495664_0046653 Ga0495664_0046653_812_1279 154
843 3300046492 Ga0495585_0048353 Ga0495585_0048353_762_1229 154
844 3300046501 Ga0495607_0030720 Ga0495607_0030720_1281_1745 154
845 3300046501 Ga0495607_0045550 Ga0495607_0045550_688_1155 154
846 3300046501 Ga0495607_0192458 Ga0495607_0192458_318_785 154
847 3300046506 Ga0495583_0033165 Ga0495583_0033165_430_897 154
848 3300046507 Ga0495606_0001192 Ga0495606_0001192_12274_12741 154
849 3300046507 Ga0495606_0076611 Ga0495606_0076611_82_546 154
850 3300046515 Ga0495620_0006073 Ga0495620_0006073_6152_6619 154
851 3300046518 Ga0495631_0046658 Ga0495631_0046658_99_566 154
852 3300046519 Ga0495632_0111593 Ga0495632_0111593_767_1234 154
853 3300046522 Ga0495643_0011245 Ga0495643_0011245_884_1351 154
854 3300046524 Ga0495648_0057131 Ga0495648_0057131_727_1194 154
855 3300046524 Ga0495648_0316537 Ga0495648_0316537_28_495 154
856 3300046529 Ga0495652_0142173 Ga0495652_0142173_1162_1629 154
857 3300046530 Ga0495654_0064442 Ga0495654_0064442_982_1449 154
858 3300046538 Ga0495609_0079329 Ga0495609_0079329_23_490 154
859 3300046542 Ga0495597_0029169 Ga0495597_0029169_1482_1949 154
860 3300046557 Ga0495622_0043711 Ga0495622_0043711_565_1032 154
861 3300046558 Ga0495633_0028714 Ga0495633_0028714_1139_1606 154
862 3300046615 Ga0495656_0330769 Ga0495656_0330769_237_704 154
863 3300046642 Ga0495634_0171675 Ga0495634_0171675_815_1282 154
864 3300046660 Ga0495625_0077229 Ga0495625_0077229_411_878 154
865 3300046660 Ga0495625_0371144 Ga0495625_0371144_334_798 154
866 3300046660 Ga0495625_0377928 Ga0495625_0377928_116_583 154
867 3300046663 Ga0495635_0050271 Ga0495635_0050271_1005_1472 154
868 3300046665 Ga0495661_0140196 Ga0495661_0140196_237_704 154
869 3300046665 Ga0495661_0348037 Ga0495661_0348037_223_690 154
870 3300046675 Ga0495657_0153862 Ga0495657_0153862_877_1344 154
871 3300046679 Ga0495623_0287379 Ga0495623_0287379_91_558 154
872 3300046692 Ga0495671_0095229 Ga0495671_0095229_782_1249 154
873 3300046694 Ga0495649_0075632 Ga0495649_0075632_64_531 154
874 3300046809 Ga0495600_0050256 Ga0495600_0050256_735_1202 154
875 3300046810 Ga0495660_0030658 Ga0495660_0030658_759_1226 154
876 3300047317 Ga0495604_0031398 Ga0495604_0031398_3282_3749 154
877 3300047319 Ga0495674_0273722 Ga0495674_0273722_363_830 154
878 3300047443 Ga0495687_015347 Ga0495687_015347_1835_2326 154
879 3300047472 Ga0495686_0002335 Ga0495686_0002335_4971_5438 154
880 3300047472 Ga0495686_0077913 Ga0495686_0077913_780_1247 154
881 3300047472 Ga0495686_0101056 Ga0495686_0101056_422_889 154
882 3300047472 Ga0495686_0129781 Ga0495686_0129781_503_970 154
883 3300048090 Ga0495615_0006352 Ga0495615_0006352_472_939 154
884 3300048091 Ga0495626_0073189 Ga0495626_0073189_288_755 154
885 3300048903 Ga0496100_0531199 Ga0496100_0531199_337_804 154
886 3300048904 Ga0496101_0069668 Ga0496101_0069668_1803_2270 154
887 3300048905 Ga0496102_0058633 Ga0496102_0058633_2177_2644 154
888 3300048906 Ga0496103_0018642 Ga0496103_0018642_994_1461 154
889 3300048913 Ga0496110_1234985 Ga0496110_1234985_65_532 154
890 3300048917 Ga0496114_0112998 Ga0496114_0112998_1647_2114 154
891 3300048918 Ga0496115_0296152 Ga0496115_0296152_334_801 154
892 3300048919 Ga0496116_0004156 Ga0496116_0004156_6042_6509 154
893 3300048919 Ga0496116_0299765 Ga0496116_0299765_25_492 154
894 3300048920 Ga0496117_0000641 Ga0496117_0000641_15660_16127 154
895 3300048920 Ga0496117_0029474 Ga0496117_0029474_1814_2278 154
896 3300048920 Ga0496117_0444789 Ga0496117_0444789_36_503 154
897 3300048921 Ga0496118_0002328 Ga0496118_0002328_8436_8903 154
898 3300048921 Ga0496118_0004090 Ga0496118_0004090_7123_7590 154
899 3300048921 Ga0496118_0120492 Ga0496118_0120492_295_759 154
900 3300048922 Ga0496119_0004718 Ga0496119_0004718_7257_7724 154
901 3300048923 Ga0496120_0005142 Ga0496120_0005142_5953_6420 154
902 3300048923 Ga0496120_0108883 Ga0496120_0108883_956_1420 154
903 3300048924 Ga0496121_0007234 Ga0496121_0007234_3366_3833 154
904 3300048924 Ga0496121_0019385 Ga0496121_0019385_4853_5317 154
905 3300048924 Ga0496121_0026221 Ga0496121_0026221_4479_4946 154
906 3300048925 Ga0496122_0004504 Ga0496122_0004504_6124_6591 154
907 3300048925 Ga0496122_0038154 Ga0496122_0038154_2261_2725 154
908 3300048926 Ga0496123_0010645 Ga0496123_0010645_2082_2549 154
909 3300048926 Ga0496123_0015808 Ga0496123_0015808_3480_3944 154
910 3300048927 Ga0496124_0001513 Ga0496124_0001513_1431_1910 154
911 3300048927 Ga0496124_0003090 Ga0496124_0003090_16749_17216 154
912 3300048927 Ga0496124_0208169 Ga0496124_0208169_293_757 154
913 3300048927 Ga0496124_0875200 Ga0496124_0875200_61_528 154
914 3300048928 Ga0496125_0045121 Ga0496125_0045121_2990_3457 154
915 3300048929 Ga0496126_0068850 Ga0496126_0068850_47_514 154
916 3300049571 Ga0501034_0235066 Ga0501034_0235066_680_1147 154
917 3300049571 Ga0501034_0600154 Ga0501034_0600154_50_517 154
918 3300049573 Ga0501037_0264360 Ga0501037_0264360_383_850 154
919 3300049581 Ga0501047_0333288 Ga0501047_0333288_601_1068 154
920 3300049582 Ga0501048_0112436 Ga0501048_0112436_467_934 154
921 3300049584 Ga0501068_0068507 Ga0501068_0068507_1389_1856 154
922 3300050489 nmdc:mga03683_31677_c1 nmdc:mga03683_31677_c1_940_1407 154
923 3300050490 nmdc:mga03n38_129773_c1 nmdc:mga03n38_129773_c1_178_645 154
924 3300050492 nmdc:mga0yw44_56775_c1 nmdc:mga0yw44_56775_c1_286_753 154
925 3300050493 nmdc:mga0k408_3640_c1 nmdc:mga0k408_3640_c1_993_1460 154
926 3300050493 nmdc:mga0k408_576737_c1 nmdc:mga0k408_576737_c1_109_576 154
927 3300050495 nmdc:mga04h51_176772_c1 nmdc:mga04h51_176772_c1_197_664 154
928 3300050496 nmdc:mga07m45_75383_c1 nmdc:mga07m45_75383_c1_940_1407 154
929 3300050516 nmdc:mga0sz30_2989_c1 nmdc:mga0sz30_2989_c1_5212_5679 154
930 3300053077 Ga0495601_0037256 Ga0495601_0037256_1507_1974 154
931 3300053085 Ga0495619_0037758 Ga0495619_0037758_1776_2243 154
932 3300053091 Ga0500647_0268268 Ga0500647_0268268_51_518 154
933 3300053109 Ga0500569_014651 Ga0500569_014651_751_1218 154
934 3300053118 Ga0500594_0007064 Ga0500594_0007064_787_1254 154
935 3300053122 Ga0500608_210095 Ga0500608_210095_117_584 154
936 3300053125 Ga0500618_051950 Ga0500618_051950_223_690 154
937 3300053134 Ga0500658_0004632 Ga0500658_0004632_3901_4368 154
938 3300053140 Ga0500573_0013502 Ga0500573_0013502_3435_3902 154
939 3300053148 Ga0500590_000180 Ga0500590_000180_1931_2398 154
940 3300053153 Ga0500616_0106846 Ga0500616_0106846_593_1060 154
941 3300053154 Ga0500619_184233 Ga0500619_184233_39_506 154
942 3300053158 Ga0500627_0060789 Ga0500627_0060789_980_1447 154
943 3300053160 Ga0500633_0089975 Ga0500633_0089975_176_643 154
944 3300053177 Ga0500636_0125301 Ga0500636_0125301_199_666 154
945 iso_pu_bacteria 2582581308 2585277113 154
946 iso_pu_bacteria 2582581315 2585323879 154
947 iso_pu_bacteria 2582581316 2585331857 154
948 iso_pu_bacteria 2585427527 2585534151 154
949 iso_pu_bacteria 2585427530 2585551997 154
950 iso_pu_bacteria 2585427608 2585897852 154
951 iso_pu_bacteria 2615840626 2616308490 154
952 iso_pu_bacteria 2818991453 2819637999 154
953 iso_pu_bacteria 8046767195 8046773885 154
954 iso_pu_bacteria 8057575449 8057576738 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02639

DUF188

Uncharacterized BCR, YaiI/YqxD family COG1671

36

165

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.6532 2 88
3mbo-assembly1.cif.gz_A crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.6476 2 88
6th2-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis coab in complex with ctp 0.6431 14 69
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.6418 2 88
6khr-assembly1.cif.gz_A structure of glycinamide-rnase-transformylase t from mycobacterium tuberculosis 0.6406 2 86
ID Description Score Start End Superfamily
af_P0A8D3_17_146_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9179 15 141 3.40.50.1010
af_Q2G0B6_16_147_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.914 15 143 3.40.50.1010
af_P0A8D3_17_146_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8918 15 141 3.40.50.1010
af_Q2G0B6_16_147_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8881 15 143 3.40.50.1010
3qvrA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7127 2 46 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A512HHW8-F1-model_v4 UPF0178 protein RNA01_19860 1.001 1 145
AF-A0A7X0IR89-F1-model_v4 UPF0178 protein GGD46_002587 0.9985 1 145
AF-A0A4Q3YRC8-F1-model_v4 YaiI/YqxD family protein 0.9956 2 100
AF-A0A4R1XY47-F1-model_v4 UPF0178 protein EV291_1263 0.9952 1 144
AF-A0A5E7ZTA6-F1-model_v4 deleted 0.9942 2 148

Feature Viewer

pLDDT pTM Quality
89.71 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map