F486664

General Info

Members Datasets Scaffolds Average Seq Length
953 446 1906 119

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0848695|Ga0451791_0848695_101_535
Length 144
Sequence MPHFTGDGLLCPIKRRKSLLLYWEISMRDRRESARDKVIYGGVAEIGETGASRECIVRNISDKGASVEFSNVVNLPREQMSLRIARKGRSFLAKVVWWRDNFVGLAFKAETPSEPVSDLEERLRKSEIKKRQLQRKIQELLGER

Samples

Sample ID Description Type Environment
1 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
102 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
207 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
239 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
240 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
241 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
244 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
245 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
246 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
277 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
278 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
288 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
289 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
325 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
326 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
327 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
333 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
375 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
376 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
377 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
378 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
405 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
406 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
407 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
408 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
409 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
410 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
411 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
412 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
413 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
414 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
417 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
418 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
419 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
420 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
421 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
422 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
423 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
424 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
425 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
426 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
427 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
428 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
429 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
430 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
431 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
432 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
433 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
434 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
435 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
436 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
437 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
438 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
439 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
440 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
441 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
442 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
443 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
444 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
445 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
446 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 0
Rhizoplane 6.09
Rhizosphere 76.18
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451791_0848695 3300041451 Bacteria 609
2 Ga0070690_100109329 3300005330 Bacteria 1843
3 Ga0070670_100182377 3300005331 Bacteria 1823
4 Ga0070677_10278443 3300005333 Bacteria 842
5 Ga0068869_100350352 3300005334 Bacteria 1203
6 Ga0070666_10263748 3300005335 Bacteria 1222
7 Ga0070666_10920798 3300005335 Bacteria 647
8 Ga0070680_100099527 3300005336 Bacteria 2412
9 Ga0070680_101027073 3300005336 Bacteria 712
10 Ga0070682_100218536 3300005337 Bacteria 1355
11 Ga0070682_100883087 3300005337 Bacteria 733
12 Ga0068868_100242262 3300005338 Bacteria 1515
13 Ga0068868_100562831 3300005338 Bacteria 1006
14 Ga0068868_100970974 3300005338 Bacteria 776
15 Ga0070660_100237504 3300005339 Bacteria 1484
16 Ga0070660_101254219 3300005339 Bacteria 629
17 Ga0070689_100065110 3300005340 Bacteria 2838
18 Ga0070687_100283548 3300005343 Bacteria 1044
19 Ga0070661_100508856 3300005344 Bacteria 965
20 Ga0070661_100827768 3300005344 Bacteria 761
21 Ga0070692_10403236 3300005345 Bacteria 864
22 Ga0070668_100077166 3300005347 Bacteria 2604
23 Ga0070668_100158439 3300005347 Bacteria 1835
24 Ga0070668_100187514 3300005347 Bacteria 1692
25 Ga0070668_100233416 3300005347 Bacteria 1522
26 Ga0070668_100809731 3300005347 Bacteria 833
27 Ga0070668_101329762 3300005347 Bacteria 654
28 Ga0070669_100673637 3300005353 Bacteria 872
29 Ga0070675_100055216 3300005354 Bacteria 3269
30 Ga0070675_101395679 3300005354 Bacteria 646
31 Ga0070671_100103926 3300005355 Bacteria 2384
32 Ga0070671_100125153 3300005355 Bacteria 2164
33 Ga0070671_100180313 3300005355 Bacteria 1788
34 Ga0070671_100570506 3300005355 Bacteria 977
35 Ga0070674_100193901 3300005356 Bacteria 1564
36 Ga0070674_100344948 3300005356 Bacteria 1201
37 Ga0070688_100570267 3300005365 Bacteria 863
38 Ga0070688_100931067 3300005365 Bacteria 687
39 Ga0070667_100193488 3300005367 Bacteria 1803
40 Ga0070667_100285707 3300005367 Bacteria 1482
41 Ga0070667_101252094 3300005367 Bacteria 695
42 Ga0070714_100030841 3300005435 Bacteria 4467
43 Ga0070713_100001913 3300005436 Bacteria 13423
44 Ga0070710_10001428 3300005437 Bacteria 11278
45 Ga0070701_10042099 3300005438 Bacteria 2330
46 Ga0070711_100002884 3300005439 Bacteria 9901
47 Ga0070705_100692043 3300005440 Bacteria 800
48 Ga0070700_100331560 3300005441 Bacteria 1121
49 Ga0070663_100012415 3300005455 Bacteria 5389
50 Ga0070663_100020934 3300005455 Bacteria 4339
51 Ga0070663_100139749 3300005455 Bacteria 1848
52 Ga0070663_100155533 3300005455 Bacteria 1756
53 Ga0070663_100312881 3300005455 Bacteria 1260
54 Ga0070663_100527125 3300005455 Bacteria 984
55 Ga0070663_101223701 3300005455 Bacteria 660
56 Ga0070678_100038172 3300005456 Bacteria 3379
57 Ga0070678_100327714 3300005456 Bacteria 1310
58 Ga0070678_100827688 3300005456 Bacteria 842
59 Ga0070681_10187328 3300005458 Bacteria 1989
60 Ga0068867_100098613 3300005459 Bacteria 2228
61 Ga0068867_100357346 3300005459 Bacteria 1221
62 Ga0070685_10911383 3300005466 Bacteria 655
63 Ga0070698_100802434 3300005471 Bacteria 885
64 Ga0070679_100010022 3300005530 Bacteria 8973
65 Ga0070679_100832766 3300005530 Unclassified 866
66 Ga0070679_101309184 3300005530 Bacteria 670
67 Ga0070684_101135039 3300005535 Unclassified 735
68 Ga0068853_100086334 3300005539 Bacteria 2752
69 Ga0068853_100264714 3300005539 Bacteria 1581
70 Ga0068853_100311216 3300005539 Bacteria 1458
71 Ga0068853_100345202 3300005539 Bacteria 1384
72 Ga0068853_100788273 3300005539 Bacteria 910
73 Ga0068853_100990839 3300005539 Bacteria 809
74 Ga0070686_100064305 3300005544 Bacteria 2379
75 Ga0070686_100156302 3300005544 Bacteria 1602
76 Ga0070695_100438016 3300005545 Bacteria 999
77 Ga0070693_100882912 3300005547 Bacteria 669
78 Ga0070665_100002761 3300005548 Bacteria 19030
79 Ga0070665_100028064 3300005548 Bacteria 5669
80 Ga0070665_100105968 3300005548 Bacteria 2813
81 Ga0070665_100125844 3300005548 Bacteria 2565
82 Ga0070665_100236808 3300005548 Bacteria 1826
83 Ga0070665_100333856 3300005548 Bacteria 1521
84 Ga0070665_100411663 3300005548 Bacteria 1360
85 Ga0070665_100491317 3300005548 Bacteria 1238
86 Ga0070665_100961294 3300005548 Bacteria 867
87 Ga0070704_100881713 3300005549 Bacteria 804
88 Ga0068855_100005114 3300005563 Bacteria 15990
89 Ga0068855_100058918 3300005563 Bacteria 4495
90 Ga0068855_100088389 3300005563 Bacteria 3579
91 Ga0068855_101251883 3300005563 Bacteria 770
92 Ga0070664_101231400 3300005564 Bacteria 706
93 Ga0068857_100058710 3300005577 Bacteria 3417
94 Ga0068857_100592858 3300005577 Bacteria 1047
95 Ga0068857_101895290 3300005577 Bacteria 584
96 Ga0068854_100303555 3300005578 Bacteria 1292
97 Ga0068854_100857442 3300005578 Bacteria 796
98 Ga0068854_101803693 3300005578 Bacteria 561
99 Ga0068856_100000427 3300005614 Bacteria 46259
100 Ga0068856_100121230 3300005614 Bacteria 2616
101 Ga0068856_100355289 3300005614 Bacteria 1484
102 Ga0068856_100437725 3300005614 Bacteria 1328
103 Ga0068856_101353399 3300005614 Bacteria 727
104 Ga0070702_100641997 3300005615 Bacteria 802
105 Ga0068852_100743571 3300005616 Bacteria 993
106 Ga0068852_101482158 3300005616 Bacteria 701
107 Ga0068859_100036626 3300005617 Bacteria 4925
108 Ga0068859_100581332 3300005617 Bacteria 1214
109 Ga0068859_101984550 3300005617 Bacteria 642
110 Ga0068864_100279235 3300005618 Bacteria 1558
111 Ga0068864_100631184 3300005618 Bacteria 1042
112 Ga0068866_10110863 3300005718 Bacteria 1531
113 Ga0068866_10280632 3300005718 Bacteria 1032
114 Ga0068861_100343808 3300005719 Bacteria 1306
115 Ga0068861_100349492 3300005719 Bacteria 1296
116 Ga0068861_100917289 3300005719 Bacteria 831
117 Ga0068861_100954872 3300005719 Bacteria 815
118 Ga0068870_10119807 3300005840 Bacteria 1514
119 Ga0068870_10548031 3300005840 Bacteria 778
120 Ga0068863_100102716 3300005841 Bacteria 2718
121 Ga0068863_100925751 3300005841 Bacteria 873
122 Ga0068858_100068737 3300005842 Bacteria 3282
123 Ga0068858_100074603 3300005842 Bacteria 3150
124 Ga0068858_100148240 3300005842 Bacteria 2205
125 Ga0068860_100188867 3300005843 Bacteria 1993
126 Ga0068860_100387516 3300005843 Bacteria 1380
127 Ga0068860_100644977 3300005843 Bacteria 1066
128 Ga0068862_100164685 3300005844 Bacteria 1981
129 Ga0068862_100180254 3300005844 Bacteria 1895
130 Ga0068862_100184236 3300005844 Bacteria 1875
131 Ga0068862_100247187 3300005844 Bacteria 1624
132 Ga0068862_101064311 3300005844 Bacteria 802
133 Ga0068862_101549227 3300005844 Bacteria 669
134 Ga0081455_10102757 3300005937 Bacteria 2291
135 Ga0081538_10026312 3300005981 Bacteria 4072
136 Ga0081540_1001309 3300005983 Bacteria 21732
137 Ga0081540_1006165 3300005983 Bacteria 8794
138 Ga0081540_1017082 3300005983 Bacteria 4509
139 Ga0081540_1017644 3300005983 Bacteria 4409
140 Ga0081540_1029705 3300005983 Bacteria 3040
141 Ga0081540_1144444 3300005983 Bacteria 950
142 Ga0081539_10014361 3300005985 Bacteria 5864
143 Ga0081539_10077359 3300005985 Bacteria 1760
144 Ga0070717_10012334 3300006028 Bacteria 6513
145 Ga0075365_10036300 3300006038 Bacteria 3192
146 Ga0075365_10080042 3300006038 Bacteria 2211
147 Ga0075365_10208528 3300006038 Bacteria 1370
148 Ga0075365_10216118 3300006038 Bacteria 1344
149 Ga0075368_10008192 3300006042 Bacteria 3714
150 Ga0075368_10095569 3300006042 Bacteria 1218
151 Ga0075368_10117958 3300006042 Bacteria 1097
152 Ga0075368_10176639 3300006042 Bacteria 899
153 Ga0075368_10189733 3300006042 Bacteria 868
154 Ga0075363_100037113 3300006048 Bacteria 2558
155 Ga0075363_100047074 3300006048 Bacteria 2289
156 Ga0075364_10020407 3300006051 Bacteria 4167
157 Ga0075364_10066207 3300006051 Bacteria 2373
158 Ga0075364_11232294 3300006051 Bacteria 507
159 Ga0070715_10000460 3300006163 Bacteria 10536
160 Ga0070716_100218783 3300006173 Bacteria 1278
161 Ga0070716_100631026 3300006173 Bacteria 810
162 Ga0075362_10085800 3300006177 Bacteria 1456
163 Ga0075367_10009857 3300006178 Bacteria 5004
164 Ga0075367_10047768 3300006178 Bacteria 2519
165 Ga0075367_10062430 3300006178 Bacteria 2225
166 Ga0075367_10153277 3300006178 Bacteria 1431
167 Ga0075367_10162167 3300006178 Bacteria 1390
168 Ga0075367_10221058 3300006178 Bacteria 1185
169 Ga0075367_10390755 3300006178 Bacteria 879
170 Ga0075367_10578137 3300006178 Bacteria 714
171 Ga0075367_10621734 3300006178 Bacteria 686
172 Ga0075369_10016130 3300006186 Bacteria 3008
173 Ga0075369_10147649 3300006186 Bacteria 1074
174 Ga0075366_10016629 3300006195 Bacteria 4229
175 Ga0075366_10055028 3300006195 Bacteria 2363
176 Ga0075366_10055968 3300006195 Bacteria 2342
177 Ga0075366_10253354 3300006195 Bacteria 1074
178 Ga0097621_100345550 3300006237 Bacteria 1322
179 Ga0097621_100542380 3300006237 Bacteria 1058
180 Ga0075370_10054698 3300006353 Bacteria 2267
181 Ga0075370_10392806 3300006353 Bacteria 832
182 Ga0068871_100464241 3300006358 Bacteria 1137
183 Ga0068871_100550822 3300006358 Bacteria 1045
184 Ga0075428_100191657 3300006844 Bacteria 2211
185 Ga0075428_100373668 3300006844 Bacteria 1528
186 Ga0075431_100460065 3300006847 Bacteria 1267
187 Ga0075434_100300523 3300006871 Bacteria 1626
188 Ga0075429_100307478 3300006880 Bacteria 1388
189 Ga0075429_101985520 3300006880 Bacteria 504
190 Ga0068865_100203137 3300006881 Bacteria 1539
191 Ga0068865_100257714 3300006881 Bacteria 1379
192 Ga0068865_100797058 3300006881 Bacteria 815
193 Ga0075436_100654830 3300006914 Bacteria 776
194 Ga0097620_100036626 3300006931 Bacteria 4925
195 Ga0097620_100581392 3300006931 Bacteria 1214
196 Ga0097620_101984458 3300006931 Bacteria 642
197 Ga0075435_100088190 3300007076 Bacteria 2557
198 Ga0099794_10018462 3300007265 Bacteria 3128
199 Ga0099794_10126873 3300007265 Bacteria 1287
200 Ga0105251_10325817 3300009011 Bacteria 698
201 Ga0105240_10128151 3300009093 Bacteria 3047
202 Ga0105240_10280572 3300009093 Bacteria 1914
203 Ga0111539_10060214 3300009094 Bacteria 4500
204 Ga0111539_10386257 3300009094 Bacteria 1630
205 Ga0105245_10100567 3300009098 Bacteria 2674
206 Ga0105245_10352990 3300009098 Bacteria 1458
207 Ga0105245_11273537 3300009098 Bacteria 784
208 Ga0105247_10180890 3300009101 Bacteria 1407
209 Ga0105247_10182790 3300009101 Bacteria 1400
210 Ga0105243_10076186 3300009148 Bacteria 2725
211 Ga0105243_10615425 3300009148 Bacteria 1047
212 Ga0105241_10029062 3300009174 Bacteria 4121
213 Ga0105241_10487208 3300009174 Bacteria 1097
214 Ga0105241_10938905 3300009174 Bacteria 806
215 Ga0105242_10142584 3300009176 Bacteria 2081
216 Ga0105242_10629870 3300009176 Bacteria 1040
217 Ga0105248_10292218 3300009177 Bacteria 1835
218 Ga0105248_10306580 3300009177 Bacteria 1788
219 Ga0105248_10521776 3300009177 Bacteria 1339
220 Ga0105248_12968590 3300009177 Bacteria 540
221 Ga0105237_10146184 3300009545 Bacteria 2359
222 Ga0105237_10266412 3300009545 Bacteria 1716
223 Ga0105238_10245048 3300009551 Bacteria 1770
224 Ga0105238_10382508 3300009551 Bacteria 1399
225 Ga0105238_11232683 3300009551 Bacteria 773
226 Ga0105238_11413426 3300009551 Bacteria 723
227 Ga0105238_12271408 3300009551 Bacteria 577
228 Ga0105249_10718502 3300009553 Bacteria 1060
229 Ga0099796_10052721 3300010159 Bacteria 1417
230 Ga0105239_10093688 3300010375 Bacteria 3317
231 Ga0105239_10111201 3300010375 Bacteria 3037
232 Ga0105239_10610851 3300010375 Bacteria 1244
233 Ga0105246_10719810 3300011119 Bacteria 877
234 Ga0105246_11852942 3300011119 Bacteria 578
235 Ga0105246_12026761 3300011119 Bacteria 556
236 Ga0105246_12227408 3300011119 Bacteria 534
237 Ga0157318_1028937 3300012482 Bacteria 537
238 Ga0157315_1006767 3300012508 Bacteria 908
239 Ga0157371_10062724 3300013102 Bacteria 2634
240 Ga0157370_10027175 3300013104 Bacteria 5642
241 Ga0157369_10290383 3300013105 Bacteria 1702
242 Ga0157374_10057545 3300013296 Bacteria 3631
243 Ga0157378_10027145 3300013297 Bacteria 5052
244 Ga0157378_10072835 3300013297 Bacteria 3088
245 Ga0157378_10875876 3300013297 Bacteria 927
246 Ga0157378_11262980 3300013297 Bacteria 779
247 Ga0157378_13224357 3300013297 Bacteria 507
248 Ga0163162_10345463 3300013306 Bacteria 1620
249 Ga0163162_10845955 3300013306 Bacteria 1030
250 Ga0163162_11162875 3300013306 Bacteria 875
251 Ga0163162_12445734 3300013306 Bacteria 600
252 Ga0157372_10032793 3300013307 Bacteria 5698
253 Ga0157372_11678566 3300013307 Bacteria 731
254 Ga0157375_10017467 3300013308 Bacteria 6475
255 Ga0157375_10386725 3300013308 Bacteria 1566
256 Ga0157375_12116028 3300013308 Bacteria 670
257 Ga0157375_12141013 3300013308 Bacteria 666
258 Ga0157375_12642765 3300013308 Bacteria 600
259 Ga0163163_10170864 3300014325 Bacteria 2220
260 Ga0163163_11032651 3300014325 Bacteria 885
261 Ga0163163_12166798 3300014325 Bacteria 615
262 Ga0157380_10121222 3300014326 Bacteria 2215
263 Ga0157380_10258419 3300014326 Bacteria 1580
264 Ga0157377_10765035 3300014745 Bacteria 708
265 Ga0157379_10316105 3300014968 Bacteria 1425
266 Ga0157379_10737779 3300014968 Bacteria 926
267 Ga0157376_10106086 3300014969 Bacteria 2464
268 Ga0157376_10671273 3300014969 Bacteria 1039
269 Ga0163161_10174445 3300017792 Bacteria 1645
270 Ga0163161_10307470 3300017792 Bacteria 1250
271 Ga0163161_10310146 3300017792 Bacteria 1245
272 Ga0163161_11704034 3300017792 Bacteria 558
273 Ga0163161_12094265 3300017792 Bacteria 503
274 Ga0207666_1007367 3300025271 Bacteria 1447
275 Ga0209758_1055715 3300025297 Bacteria 1340
276 Ga0207692_10001538 3300025898 Bacteria 8667
277 Ga0207642_10070820 3300025899 Bacteria 1659
278 Ga0207642_10187559 3300025899 Bacteria 1132
279 Ga0207710_10072548 3300025900 Bacteria 1581
280 Ga0207688_10027607 3300025901 Bacteria 3122
281 Ga0207688_10108641 3300025901 Bacteria 1608
282 Ga0207688_10175882 3300025901 Bacteria 1275
283 Ga0207680_10126782 3300025903 Bacteria 1677
284 Ga0207680_11189528 3300025903 Bacteria 544
285 Ga0207647_10273640 3300025904 Bacteria 965
286 Ga0207699_10001041 3300025906 Bacteria 13082
287 Ga0207699_10530820 3300025906 Bacteria 852
288 Ga0207643_10650279 3300025908 Bacteria 680
289 Ga0207684_10594106 3300025910 Bacteria 946
290 Ga0207654_10076109 3300025911 Bacteria 2008
291 Ga0207707_10122255 3300025912 Bacteria 2276
292 Ga0207695_10686401 3300025913 Bacteria 905
293 Ga0207671_10125983 3300025914 Bacteria 1962
294 Ga0207671_10253704 3300025914 Bacteria 1383
295 Ga0207671_11120361 3300025914 Bacteria 618
296 Ga0207693_10001357 3300025915 Bacteria 21659
297 Ga0207663_10000873 3300025916 Bacteria 13685
298 Ga0207663_10317633 3300025916 Bacteria 1169
299 Ga0207660_10801854 3300025917 Bacteria 768
300 Ga0207660_11305932 3300025917 Bacteria 589
301 Ga0207657_10947275 3300025919 Bacteria 662
302 Ga0207649_10185939 3300025920 Bacteria 1458
303 Ga0207652_10100402 3300025921 Bacteria 2555
304 Ga0207652_11677394 3300025921 Bacteria 540
305 Ga0207681_10124174 3300025923 Bacteria 1898
306 Ga0207681_10777544 3300025923 Bacteria 799
307 Ga0207694_10381022 3300025924 Bacteria 1171
308 Ga0207694_10487861 3300025924 Bacteria 1031
309 Ga0207694_11175783 3300025924 Bacteria 649
310 Ga0207694_11296571 3300025924 Bacteria 616
311 Ga0207650_11213765 3300025925 Bacteria 642
312 Ga0207659_10479536 3300025926 Bacteria 1051
313 Ga0207687_10065916 3300025927 Bacteria 2573
314 Ga0207687_10390049 3300025927 Bacteria 1143
315 Ga0207700_10219260 3300025928 Bacteria 1612
316 Ga0207700_10503266 3300025928 Bacteria 1072
317 Ga0207664_10266980 3300025929 Bacteria 1498
318 Ga0207644_10376394 3300025931 Bacteria 1157
319 Ga0207644_10735840 3300025931 Bacteria 823
320 Ga0207644_11558761 3300025931 Bacteria 554
321 Ga0207706_10162321 3300025933 Bacteria 1964
322 Ga0207706_10196895 3300025933 Bacteria 1767
323 Ga0207686_10080568 3300025934 Bacteria 2123
324 Ga0207686_10334080 3300025934 Bacteria 1136
325 Ga0207709_10020641 3300025935 Bacteria 3720
326 Ga0207670_10662416 3300025936 Bacteria 861
327 Ga0207670_11007002 3300025936 Bacteria 701
328 Ga0207669_10016092 3300025937 Bacteria 3790
329 Ga0207669_10336589 3300025937 Bacteria 1161
330 Ga0207669_10678646 3300025937 Bacteria 845
331 Ga0207704_10175997 3300025938 Bacteria 1541
332 Ga0207665_10006588 3300025939 Bacteria 7699
333 Ga0207665_10237736 3300025939 Bacteria 1341
334 Ga0207665_10691553 3300025939 Bacteria 801
335 Ga0207691_10199385 3300025940 Bacteria 1742
336 Ga0207691_10720443 3300025940 Bacteria 841
337 Ga0207711_10024524 3300025941 Bacteria 5055
338 Ga0207711_10212265 3300025941 Bacteria 1768
339 Ga0207711_10289338 3300025941 Bacteria 1510
340 Ga0207711_10341222 3300025941 Bacteria 1386
341 Ga0207711_10785109 3300025941 Bacteria 887
342 Ga0207689_10014560 3300025942 Bacteria 6688
343 Ga0207679_11738446 3300025945 Bacteria 570
344 Ga0207667_10016252 3300025949 Bacteria 8408
345 Ga0207667_10060632 3300025949 Bacteria 3960
346 Ga0207667_10988473 3300025949 Bacteria 829
347 Ga0207667_11455364 3300025949 Unclassified 657
348 Ga0207651_10646318 3300025960 Bacteria 928
349 Ga0207712_10643451 3300025961 Bacteria 921
350 Ga0207668_10020366 3300025972 Bacteria 4212
351 Ga0207668_10092350 3300025972 Bacteria 2227
352 Ga0207668_10109108 3300025972 Bacteria 2073
353 Ga0207668_10130034 3300025972 Bacteria 1921
354 Ga0207668_12036849 3300025972 Bacteria 517
355 Ga0207640_10056503 3300025981 Bacteria 2577
356 Ga0207640_10856395 3300025981 Bacteria 791
357 Ga0207640_11874866 3300025981 Bacteria 542
358 Ga0207658_10336700 3300025986 Bacteria 1310
359 Ga0207658_11482619 3300025986 Bacteria 620
360 Ga0207677_10293302 3300026023 Bacteria 1341
361 Ga0207677_10719126 3300026023 Bacteria 888
362 Ga0207677_11244074 3300026023 Bacteria 682
363 Ga0207703_10045095 3300026035 Bacteria 3546
364 Ga0207703_10139608 3300026035 Bacteria 2102
365 Ga0207703_10512952 3300026035 Bacteria 1127
366 Ga0207639_10229204 3300026041 Bacteria 1609
367 Ga0207639_10512586 3300026041 Bacteria 1097
368 Ga0207678_10031203 3300026067 Bacteria 4649
369 Ga0207678_10064057 3300026067 Bacteria 3159
370 Ga0207678_10078598 3300026067 Bacteria 2825
371 Ga0207678_10130990 3300026067 Bacteria 2139
372 Ga0207678_10173295 3300026067 Bacteria 1842
373 Ga0207678_10202645 3300026067 Bacteria 1697
374 Ga0207708_10066000 3300026075 Bacteria 2767
375 Ga0207708_11200342 3300026075 Bacteria 663
376 Ga0207702_10000365 3300026078 Bacteria 51814
377 Ga0207702_10338113 3300026078 Bacteria 1438
378 Ga0207702_10691012 3300026078 Bacteria 1005
379 Ga0207702_11134027 3300026078 Bacteria 776
380 Ga0207641_10263886 3300026088 Bacteria 1614
381 Ga0207641_11964124 3300026088 Bacteria 586
382 Ga0207641_12262851 3300026088 Bacteria 543
383 Ga0207648_10087277 3300026089 Bacteria 2723
384 Ga0207648_10366559 3300026089 Bacteria 1300
385 Ga0207648_10423656 3300026089 Bacteria 1209
386 Ga0207676_10062535 3300026095 Bacteria 2953
387 Ga0207676_10297875 3300026095 Bacteria 1471
388 Ga0207676_10667721 3300026095 Bacteria 1004
389 Ga0207676_11157498 3300026095 Bacteria 766
390 Ga0207674_10051243 3300026116 Bacteria 4213
391 Ga0207674_11273651 3300026116 Bacteria 705
392 Ga0207675_100137686 3300026118 Bacteria 2318
393 Ga0207675_100279041 3300026118 Bacteria 1623
394 Ga0207675_100290149 3300026118 Bacteria 1591
395 Ga0207675_100552243 3300026118 Bacteria 1151
396 Ga0207675_102305607 3300026118 Bacteria 552
397 Ga0207683_10017331 3300026121 Bacteria 6138
398 Ga0207683_10029323 3300026121 Bacteria 4763
399 Ga0207683_10521387 3300026121 Bacteria 1098
400 Ga0207683_10717887 3300026121 Bacteria 927
401 Ga0207683_10742458 3300026121 Bacteria 910
402 Ga0207698_10316980 3300026142 Bacteria 1459
403 Ga0207698_10555824 3300026142 Bacteria 1126
404 Ga0207698_10612664 3300026142 Bacteria 1074
405 Ga0207698_11222493 3300026142 Bacteria 765
406 Ga0209179_1006451 3300027512 Bacteria 1893
407 Ga0209588_1001786 3300027671 Bacteria 5709
408 Ga0209813_10025982 3300027866 Bacteria 1689
409 Ga0209813_10109055 3300027866 Bacteria 951
410 Ga0207428_10213817 3300027907 Bacteria 1448
411 Ga0268266_10002595 3300028379 Bacteria 19142
412 Ga0268266_10006003 3300028379 Bacteria 11209
413 Ga0268266_10309234 3300028379 Bacteria 1476
414 Ga0268266_10386797 3300028379 Bacteria 1320
415 Ga0268266_10410068 3300028379 Bacteria 1282
416 Ga0268266_10976766 3300028379 Bacteria 819
417 Ga0268266_11054535 3300028379 Bacteria 786
418 Ga0268266_11686198 3300028379 Bacteria 609
419 Ga0268265_10097897 3300028380 Bacteria 2361
420 Ga0268265_10363667 3300028380 Bacteria 1325
421 Ga0268265_10503637 3300028380 Bacteria 1141
422 Ga0268265_10929609 3300028380 Bacteria 855
423 Ga0268265_11854955 3300028380 Bacteria 609
424 Ga0268264_10552303 3300028381 Bacteria 1129
425 Ga0268264_11846964 3300028381 Bacteria 614
426 Ga0265334_10164414 3300028573 Bacteria 779
427 Ga0307517_10000369 3300028786 Bacteria 77795
428 Ga0307517_10230763 3300028786 Bacteria 1111
429 Ga0307515_10013420 3300028794 Bacteria 15318
430 Ga0307515_10202781 3300028794 Bacteria 1854
431 Ga0307515_10212186 3300028794 Bacteria 1777
432 Ga0307515_10366595 3300028794 Bacteria 1079
433 Ga0307511_10393325 3300030521 Bacteria 573
434 Ga0265331_10525276 3300031250 Bacteria 533
435 Ga0307513_10147355 3300031456 Bacteria 2269
436 Ga0307513_10349827 3300031456 Bacteria 1226
437 Ga0307513_10532279 3300031456 Bacteria 889
438 Ga0307513_10662599 3300031456 Bacteria 750
439 Ga0307513_11032550 3300031456 Bacteria 532
440 Ga0307509_10394805 3300031507 Bacteria 1092
441 Ga0307509_10472207 3300031507 Bacteria 944
442 Ga0307408_100337341 3300031548 Bacteria 1275
443 Ga0307508_10024680 3300031616 Bacteria 5455
444 Ga0307508_10705172 3300031616 Bacteria 619
445 Ga0307514_10378251 3300031649 Bacteria 737
446 Ga0265314_10016806 3300031711 Bacteria 5765
447 Ga0265342_10356093 3300031712 Bacteria 761
448 Ga0307516_10100254 3300031730 Bacteria 2712
449 Ga0307516_10168231 3300031730 Bacteria 1935
450 Ga0307516_10191917 3300031730 Bacteria 1768
451 Ga0307516_10231273 3300031730 Bacteria 1552
452 Ga0307516_10355046 3300031730 Bacteria 1131
453 Ga0307405_10118968 3300031731 Bacteria 1804
454 Ga0307405_10680977 3300031731 Bacteria 849
455 Ga0307413_10248913 3300031824 Bacteria 1317
456 Ga0307413_10493465 3300031824 Bacteria 982
457 Ga0307410_10170663 3300031852 Bacteria 1639
458 Ga0307406_10139814 3300031901 Bacteria 1712
459 Ga0307406_10946582 3300031901 Bacteria 736
460 Ga0307406_11559896 3300031901 Bacteria 582
461 Ga0307407_10286469 3300031903 Bacteria 1143
462 Ga0307412_10143960 3300031911 Bacteria 1750
463 Ga0307412_10531881 3300031911 Bacteria 984
464 Ga0307412_10921812 3300031911 Bacteria 767
465 Ga0307416_100271181 3300032002 Bacteria 1666
466 Ga0307416_102903579 3300032002 Bacteria 573
467 Ga0307411_10209449 3300032005 Bacteria 1504
468 Ga0307411_12339175 3300032005 Bacteria 502
469 Ga0307415_100047556 3300032126 Bacteria 2888
470 Ga0307415_101335627 3300032126 Bacteria 680
471 Ga0307415_101472354 3300032126 Bacteria 650
472 Ga0307510_10005024 3300033180 Bacteria 15672
473 Ga0307510_10414876 3300033180 Bacteria 789
474 Ga0373930_0006589 3300034816 Bacteria 1971
475 Ga0373948_0107535 3300034817 Bacteria 663
476 Ga0373958_0008906 3300034819 Bacteria 1639
477 Ga0373959_0018884 3300034820 Bacteria 1301
478 Ga0373928_0025560 3300035084 Bacteria 1274
479 Ga0373929_0219213 3300035085 Bacteria 540
480 Ga0373934_0003131 3300035086 Bacteria 6032
481 Ga0373934_0073417 3300035086 Bacteria 1370
482 Ga0373934_0084124 3300035086 Bacteria 1280
483 Ga0373944_0054108 3300035089 Bacteria 1272
484 Ga0373952_0053838 3300035092 Bacteria 966
485 Ga0373923_0026188 3300035111 Bacteria 2318
486 Ga0373936_0381921 3300035113 Bacteria 645
487 Ga0373939_0019817 3300035114 Bacteria 1819
488 Ga0373941_0172245 3300035115 Bacteria 807
489 Ga0373953_0000929 3300035117 Bacteria 8201
490 Ga0373953_0042679 3300035117 Bacteria 1808
491 Ga0373954_0000067 3300035118 Bacteria 37060
492 Ga0373954_0005676 3300035118 Bacteria 5410
493 Ga0373956_0008985 3300035119 Bacteria 4052
494 Ga0373956_0032152 3300035119 Bacteria 2301
495 Ga0373957_0000501 3300035120 Bacteria 9810
496 Ga0373957_0048803 3300035120 Bacteria 1614
497 Ga0373960_0024301 3300035121 Bacteria 1638
498 Ga0373943_0985687 3300035170 Bacteria 505
499 Ga0373955_0000377 3300035172 Bacteria 18785
500 Ga0373955_0026352 3300035172 Bacteria 2993
501 Ga0373955_0221576 3300035172 Bacteria 1130
502 Ga0373955_0409410 3300035172 Bacteria 824
503 Ga0373924_0011393 3300035410 Bacteria 3302
504 Ga0373931_0003188 3300035691 Bacteria 7316
505 Ga0373935_0036939 3300035692 Bacteria 3056
506 Ga0373935_0088170 3300035692 Bacteria 2027
507 Ga0373935_0310213 3300035692 Bacteria 1117
508 Ga0373927_0100074 3300035695 Bacteria 1885
509 Ga0373927_0403895 3300035695 Bacteria 901
510 Ga0373927_0467236 3300035695 Bacteria 833
511 Ga0373933_0000519 3300035724 Bacteria 24082
512 Ga0373933_0029036 3300035724 Bacteria 3194
513 Ga0373933_0320152 3300035724 Bacteria 1006
514 Ga0373947_0328234 3300035725 Bacteria 1024
515 Ga0373937_0001425 3300036401 Bacteria 19991
516 Ga0373937_0047428 3300036401 Bacteria 3931
517 Ga0373937_0418895 3300036401 Bacteria 1271
518 Ga0373937_1858926 3300036401 Bacteria 548
519 Ga0373925_0072581 3300037068 Bacteria 2604
520 Ga0373925_1024439 3300037068 Bacteria 680
521 Ga0395900_0165965 3300037418 Bacteria 2250
522 Ga0395898_1371337 3300037466 Bacteria 635
523 Ga0395905_1208183 3300037471 Bacteria 660
524 Ga0395901_0784889 3300038443 Bacteria 943
525 Ga0439465_0411743 3300041413 Bacteria 515
526 Ga0451793_0514176 3300041452 Bacteria 744
527 Ga0451795_0020734 3300041456 Bacteria 895
528 Ga0451795_0724943 3300041456 Bacteria 591
529 Ga0451798_0236933 3300041458 Bacteria 559
530 Ga0451807_0077524 3300041486 Bacteria 881
531 Ga0451807_1025123 3300041486 Bacteria 575
532 Ga0451833_0558409 3300041491 Bacteria 990
533 Ga0451839_0355379 3300041496 Bacteria 1339
534 Ga0451841_1420533 3300041498 Bacteria 650
535 Ga0451855_0259353 3300041511 Bacteria 849
536 Ga0451853_1121981 3300041512 Unclassified 607
537 Ga0451853_3019586 3300041512 Bacteria 739
538 Ga0466967_0870486 3300045976 Bacteria 896
539 Ga0495617_009319 3300046452 Bacteria 3369
540 Ga0495617_104719 3300046452 Bacteria 918
541 Ga0495592_0002879 3300046454 Bacteria 12246
542 Ga0495592_0052860 3300046454 Bacteria 3014
543 Ga0495603_0017472 3300046455 Bacteria 4339
544 Ga0495603_0089151 3300046455 Bacteria 1805
545 Ga0495603_0137950 3300046455 Bacteria 1419
546 Ga0495603_0776044 3300046455 Bacteria 547
547 Ga0495603_0837790 3300046455 Bacteria 524
548 Ga0495590_0021936 3300046457 Bacteria 2260
549 Ga0495590_0056605 3300046457 Bacteria 1370
550 Ga0495629_0009626 3300046459 Bacteria 7058
551 Ga0495629_0314503 3300046459 Bacteria 1071
552 Ga0495629_0379694 3300046459 Bacteria 962
553 Ga0495629_0496112 3300046459 Bacteria 824
554 Ga0495638_0138659 3300046460 Bacteria 1422
555 Ga0495638_0139183 3300046460 Bacteria 1418
556 Ga0495638_0139794 3300046460 Bacteria 1414
557 Ga0495638_0353604 3300046460 Bacteria 775
558 Ga0495638_0355925 3300046460 Bacteria 771
559 Ga0495638_0650593 3300046460 Bacteria 512
560 Ga0495651_0039568 3300046462 Bacteria 3670
561 Ga0495651_0046151 3300046462 Bacteria 3372
562 Ga0495653_0001052 3300046463 Bacteria 21243
563 Ga0495653_0241248 3300046463 Bacteria 1204
564 Ga0495650_0049919 3300046471 Bacteria 1734
565 Ga0495580_0131246 3300046472 Bacteria 1738
566 Ga0495605_0022673 3300046474 Bacteria 3312
567 Ga0495639_0066941 3300046475 Bacteria 1654
568 Ga0495639_0478762 3300046475 Bacteria 634
569 Ga0495639_0539625 3300046475 Bacteria 597
570 Ga0495639_0584491 3300046475 Bacteria 574
571 Ga0495664_0018600 3300046477 Bacteria 3984
572 Ga0495664_0307860 3300046477 Bacteria 956
573 Ga0495584_0056474 3300046491 Bacteria 1975
574 Ga0495584_0076821 3300046491 Bacteria 1679
575 Ga0495584_0171601 3300046491 Bacteria 1102
576 Ga0495585_0038029 3300046492 Bacteria 2709
577 Ga0495585_0048869 3300046492 Bacteria 2351
578 Ga0495585_0071352 3300046492 Bacteria 1893
579 Ga0495585_0120995 3300046492 Bacteria 1385
580 Ga0495594_0077046 3300046499 Bacteria 1860
581 Ga0495594_0093976 3300046499 Bacteria 1682
582 Ga0495596_0052142 3300046500 Bacteria 1602
583 Ga0495596_0172177 3300046500 Bacteria 842
584 Ga0495596_0258381 3300046500 Bacteria 676
585 Ga0495607_0064566 3300046501 Bacteria 2067
586 Ga0495583_0093890 3300046506 Bacteria 1288
587 Ga0495583_0242426 3300046506 Bacteria 724
588 Ga0495606_0313008 3300046507 Bacteria 846
589 Ga0495606_0497807 3300046507 Bacteria 616
590 Ga0495608_0006072 3300046511 Bacteria 8574
591 Ga0495608_0045424 3300046511 Bacteria 2927
592 Ga0495610_0082944 3300046512 Bacteria 1468
593 Ga0495610_0204355 3300046512 Bacteria 807
594 Ga0495616_0072987 3300046513 Bacteria 1656
595 Ga0495618_0093421 3300046514 Bacteria 1923
596 Ga0495618_0136750 3300046514 Bacteria 1567
597 Ga0495620_0077485 3300046515 Bacteria 1349
598 Ga0495620_0080447 3300046515 Bacteria 1319
599 Ga0495628_0003826 3300046516 Bacteria 13414
600 Ga0495628_0037081 3300046516 Bacteria 3909
601 Ga0495628_0460818 3300046516 Bacteria 922
602 Ga0495630_0105492 3300046517 Bacteria 2134
603 Ga0495630_0312889 3300046517 Bacteria 1200
604 Ga0495630_0583317 3300046517 Bacteria 857
605 Ga0495631_0519213 3300046518 Bacteria 507
606 Ga0495632_0041751 3300046519 Bacteria 2303
607 Ga0495632_0104177 3300046519 Bacteria 1335
608 Ga0495632_0264585 3300046519 Bacteria 768
609 Ga0495637_0117004 3300046520 Bacteria 1029
610 Ga0495643_0266468 3300046522 Bacteria 793
611 Ga0495643_0271163 3300046522 Bacteria 784
612 Ga0495644_0004584 3300046523 Bacteria 5432
613 Ga0495644_0060453 3300046523 Bacteria 1424
614 Ga0495644_0080947 3300046523 Bacteria 1224
615 Ga0495644_0120067 3300046523 Bacteria 999
616 Ga0495644_0173423 3300046523 Bacteria 828
617 Ga0495648_0119611 3300046524 Bacteria 1418
618 Ga0495648_0232948 3300046524 Bacteria 900
619 Ga0495663_0082518 3300046525 Bacteria 1037
620 Ga0495666_0078126 3300046526 Bacteria 1568
621 Ga0495652_0031966 3300046529 Bacteria 4605
622 Ga0495652_1019081 3300046529 Bacteria 541
623 Ga0495640_0014352 3300046533 Bacteria 5998
624 Ga0495640_0055440 3300046533 Bacteria 2711
625 Ga0495640_0530062 3300046533 Bacteria 715
626 Ga0495587_0017387 3300046536 Bacteria 4467
627 Ga0495587_0030982 3300046536 Bacteria 3241
628 Ga0495598_0033118 3300046537 Bacteria 1464
629 Ga0495609_0183154 3300046538 Bacteria 881
630 Ga0495609_0297665 3300046538 Bacteria 657
631 Ga0495609_0311170 3300046538 Bacteria 640
632 Ga0495597_0136702 3300046542 Bacteria 1013
633 Ga0495645_0003011 3300046543 Bacteria 11398
634 Ga0495645_0004900 3300046543 Bacteria 9157
635 Ga0495622_0249876 3300046557 Bacteria 780
636 Ga0495633_0019689 3300046558 Bacteria 3409
637 Ga0495633_0090148 3300046558 Bacteria 1425
638 Ga0495633_0276357 3300046558 Bacteria 764
639 Ga0495667_0000305 3300046559 Bacteria 31224
640 Ga0495667_0039978 3300046559 Bacteria 3115
641 Ga0495667_0623444 3300046559 Bacteria 671
642 Ga0495656_0003560 3300046615 Bacteria 5273
643 Ga0495656_0026086 3300046615 Bacteria 2323
644 Ga0495656_0061686 3300046615 Bacteria 1638
645 Ga0495656_0164003 3300046615 Bacteria 1082
646 Ga0495656_0472383 3300046615 Bacteria 662
647 Ga0495668_0079080 3300046616 Bacteria 1805
648 Ga0495668_0217182 3300046616 Bacteria 1047
649 Ga0495668_0222695 3300046616 Bacteria 1033
650 Ga0495668_0235092 3300046616 Bacteria 1004
651 Ga0495668_0506073 3300046616 Bacteria 666
652 Ga0495668_0522490 3300046616 Bacteria 654
653 Ga0495668_0732992 3300046616 Bacteria 547
654 Ga0495668_0793791 3300046616 Bacteria 524
655 Ga0495668_0805960 3300046616 Bacteria 520
656 Ga0495634_0012645 3300046642 Bacteria 6110
657 Ga0495634_0142694 3300046642 Bacteria 1519
658 Ga0495634_0711985 3300046642 Bacteria 577
659 Ga0495611_0030579 3300046648 Bacteria 2368
660 Ga0495611_0064818 3300046648 Bacteria 1664
661 Ga0495611_0145977 3300046648 Bacteria 1104
662 Ga0495611_0146978 3300046648 Bacteria 1100
663 Ga0495625_0104771 3300046660 Bacteria 1938
664 Ga0495625_0132039 3300046660 Bacteria 1691
665 Ga0495625_0153643 3300046660 Bacteria 1546
666 Ga0495635_0000102 3300046663 Bacteria 50623
667 Ga0495635_0176983 3300046663 Bacteria 1450
668 Ga0495659_0050367 3300046664 Bacteria 1514
669 Ga0495661_0303680 3300046665 Bacteria 798
670 Ga0495588_0129574 3300046674 Bacteria 1330
671 Ga0495657_0021132 3300046675 Bacteria 4672
672 Ga0495657_0052103 3300046675 Bacteria 2745
673 Ga0495599_0002307 3300046678 Bacteria 11094
674 Ga0495599_0127753 3300046678 Bacteria 1579
675 Ga0495623_0011690 3300046679 Bacteria 5687
676 Ga0495623_0053659 3300046679 Bacteria 2544
677 Ga0495646_0023007 3300046680 Bacteria 3924
678 Ga0495646_0045067 3300046680 Bacteria 2695
679 Ga0495658_1039858 3300046683 Bacteria 523
680 Ga0495669_0096978 3300046684 Bacteria 1366
681 Ga0495669_0163016 3300046684 Bacteria 1058
682 Ga0495669_0212859 3300046684 Bacteria 925
683 Ga0495669_0266948 3300046684 Bacteria 822
684 Ga0495613_0032668 3300046689 Bacteria 3867
685 Ga0495624_0840859 3300046690 Bacteria 542
686 Ga0495670_0074186 3300046691 Bacteria 1725
687 Ga0495670_0082033 3300046691 Bacteria 1643
688 Ga0495670_0109970 3300046691 Bacteria 1425
689 Ga0495671_0029845 3300046692 Bacteria 2797
690 Ga0495671_0054983 3300046692 Bacteria 1972
691 Ga0495671_0422851 3300046692 Bacteria 637
692 Ga0495649_0200782 3300046694 Bacteria 1035
693 Ga0495600_0000357 3300046809 Bacteria 24062
694 Ga0495600_0007049 3300046809 Bacteria 6866
695 Ga0495581_0092904 3300047315 Bacteria 1751
696 Ga0495581_0157741 3300047315 Bacteria 1326
697 Ga0495604_0001099 3300047317 Bacteria 22454
698 Ga0495604_0091475 3300047317 Bacteria 2256
699 Ga0495604_0210196 3300047317 Bacteria 1345
700 Ga0495636_0153882 3300047318 Bacteria 1033
701 Ga0495636_0167548 3300047318 Bacteria 992
702 Ga0495636_0373701 3300047318 Bacteria 676
703 Ga0495674_0020074 3300047319 Bacteria 6193
704 Ga0495674_0030740 3300047319 Bacteria 4880
705 Ga0495672_0171554 3300047320 Bacteria 1106
706 Ga0495676_0334250 3300047321 Bacteria 1015
707 Ga0495680_0003585 3300047322 Bacteria 15202
708 Ga0495680_0054109 3300047322 Bacteria 3118
709 Ga0495683_0159721 3300047323 Bacteria 1043
710 Ga0495675_0004354 3300047444 Bacteria 8568
711 Ga0495675_0028407 3300047444 Bacteria 3565
712 Ga0495675_0595385 3300047444 Bacteria 627
713 Ga0495677_0098924 3300047445 Bacteria 1103
714 Ga0495677_0106765 3300047445 Bacteria 1062
715 Ga0495677_0128729 3300047445 Bacteria 968
716 Ga0495685_085600 3300047447 Bacteria 1048
717 Ga0495673_0146435 3300047469 Bacteria 916
718 Ga0495673_0304600 3300047469 Bacteria 570
719 Ga0495681_0186647 3300047470 Bacteria 849
720 Ga0495684_0000088 3300047471 Bacteria 64704
721 Ga0495684_0040201 3300047471 Bacteria 3585
722 Ga0495686_0095080 3300047472 Bacteria 1805
723 Ga0495686_0321070 3300047472 Bacteria 849
724 Ga0495686_0562460 3300047472 Bacteria 594
725 Ga0495593_0000167 3300047673 Bacteria 33674
726 Ga0495593_0162458 3300047673 Bacteria 1127
727 Ga0495593_0256420 3300047673 Bacteria 876
728 Ga0495602_0026534 3300048088 Bacteria 5584
729 Ga0495602_0090321 3300048088 Bacteria 2544
730 Ga0495602_0532474 3300048088 Unclassified 817
731 Ga0495602_0866320 3300048088 Bacteria 603
732 Ga0495615_0052613 3300048090 Bacteria 1052
733 Ga0495626_0286419 3300048091 Bacteria 653
734 Ga0496100_0205222 3300048903 Bacteria 1439
735 Ga0496100_0211967 3300048903 Bacteria 1417
736 Ga0496100_0469151 3300048903 Bacteria 967
737 Ga0496100_0969266 3300048903 Bacteria 669
738 Ga0496101_0169526 3300048904 Bacteria 1677
739 Ga0496101_0184934 3300048904 Bacteria 1606
740 Ga0496101_0270884 3300048904 Bacteria 1325
741 Ga0496102_0028199 3300048905 Bacteria 5014
742 Ga0496102_0044163 3300048905 Bacteria 4044
743 Ga0496102_0066574 3300048905 Bacteria 3302
744 Ga0496102_0093774 3300048905 Bacteria 2781
745 Ga0496103_0078431 3300048906 Bacteria 2074
746 Ga0496103_0417345 3300048906 Bacteria 861
747 Ga0496104_0054635 3300048907 Bacteria 3775
748 Ga0496104_0056884 3300048907 Bacteria 3700
749 Ga0496104_0159659 3300048907 Bacteria 2163
750 Ga0496104_1502148 3300048907 Bacteria 577
751 Ga0496105_0184098 3300048908 Bacteria 1709
752 Ga0496105_1298009 3300048908 Bacteria 532
753 Ga0496106_0002876 3300048909 Bacteria 12793
754 Ga0496106_0030774 3300048909 Bacteria 4000
755 Ga0496106_0287246 3300048909 Bacteria 1318
756 Ga0496106_0351270 3300048909 Bacteria 1184
757 Ga0496107_0016161 3300048910 Bacteria 5237
758 Ga0496107_0032740 3300048910 Bacteria 3716
759 Ga0496107_0081874 3300048910 Bacteria 2354
760 Ga0496108_0004100 3300048911 Bacteria 11699
761 Ga0496108_0066601 3300048911 Bacteria 3037
762 Ga0496108_0580548 3300048911 Bacteria 977
763 Ga0496109_0000399 3300048912 Bacteria 39304
764 Ga0496109_0041781 3300048912 Bacteria 4153
765 Ga0496109_0232120 3300048912 Bacteria 1736
766 Ga0496109_1276180 3300048912 Bacteria 671
767 Ga0496110_0030095 3300048913 Bacteria 4678
768 Ga0496110_0030135 3300048913 Bacteria 4675
769 Ga0496110_0034765 3300048913 Bacteria 4368
770 Ga0496110_0803978 3300048913 Bacteria 845
771 Ga0496111_0042984 3300048914 Bacteria 3246
772 Ga0496111_0101718 3300048914 Bacteria 2112
773 Ga0496111_1323130 3300048914 Bacteria 507
774 Ga0496112_0006192 3300048915 Bacteria 10469
775 Ga0496112_0011883 3300048915 Bacteria 7974
776 Ga0496112_0083319 3300048915 Bacteria 3163
777 Ga0496113_0002999 3300048916 Bacteria 9996
778 Ga0496113_0093650 3300048916 Bacteria 2319
779 Ga0496114_0008397 3300048917 Bacteria 8181
780 Ga0496114_0157164 3300048917 Bacteria 1975
781 Ga0496114_0177409 3300048917 Bacteria 1859
782 Ga0496114_0205069 3300048917 Bacteria 1728
783 Ga0496115_0007981 3300048918 Bacteria 7814
784 Ga0496115_0437270 3300048918 Bacteria 1058
785 Ga0496116_0244381 3300048919 Bacteria 899
786 Ga0496117_0108354 3300048920 Bacteria 1738
787 Ga0496119_0137069 3300048922 Bacteria 1326
788 Ga0496119_0224623 3300048922 Bacteria 959
789 Ga0496121_0006513 3300048924 Bacteria 14441
790 Ga0496121_0171656 3300048924 Bacteria 1574
791 Ga0496121_0248708 3300048924 Bacteria 1234
792 Ga0496124_0194814 3300048927 Bacteria 1547
793 Ga0496124_0577000 3300048927 Bacteria 737
794 Ga0496126_0005960 3300048929 Bacteria 13713
795 Ga0496126_0015347 3300048929 Bacteria 7705
796 Ga0496126_0054336 3300048929 Bacteria 3628
797 Ga0496126_0100608 3300048929 Bacteria 2530
798 Ga0496126_0267332 3300048929 Bacteria 1420
799 Ga0496126_0349130 3300048929 Bacteria 1210
800 Ga0496126_0403701 3300048929 Bacteria 1108
801 Ga0496126_0855556 3300048929 Bacteria 693
802 Ga0496126_1376002 3300048929 Bacteria 510
803 Ga0495678_166248 3300049459 Bacteria 701
804 Ga0495682_0072602 3300049460 Bacteria 1238
805 Ga0495682_0200460 3300049460 Bacteria 708
806 Ga0501031_0000543 3300049568 Bacteria 22072
807 Ga0501032_0000188 3300049569 Bacteria 51273
808 Ga0501033_0000241 3300049570 Bacteria 52500
809 Ga0501034_0000021 3300049571 Bacteria 266023
810 Ga0501036_0003567 3300049572 Bacteria 12433
811 Ga0501036_0095673 3300049572 Bacteria 2511
812 Ga0501037_0000398 3300049573 Bacteria 36170
813 Ga0501038_0003474 3300049574 Bacteria 14682
814 Ga0501038_0567187 3300049574 Bacteria 862
815 Ga0501039_0000849 3300049575 Bacteria 22069
816 Ga0501041_0228326 3300049577 Bacteria 1169
817 Ga0501042_0041334 3300049578 Bacteria 3278
818 Ga0501042_0150010 3300049578 Bacteria 1681
819 Ga0501043_0000033 3300049579 Bacteria 139500
820 Ga0501046_0000452 3300049580 Bacteria 41240
821 Ga0501047_0000574 3300049581 Bacteria 39096
822 Ga0501047_0185199 3300049581 Bacteria 1948
823 Ga0501047_0343737 3300049581 Bacteria 1329
824 Ga0501048_0013746 3300049582 Bacteria 6005
825 Ga0501048_0119544 3300049582 Bacteria 1862
826 Ga0501048_0488512 3300049582 Bacteria 883
827 Ga0501067_0000045 3300049583 Bacteria 73394
828 Ga0501067_0286263 3300049583 Bacteria 917
829 Ga0501068_0000924 3300049584 Bacteria 15403
830 Ga0501068_0848595 3300049584 Bacteria 600
831 Ga0501069_0010839 3300049585 Bacteria 4830
832 Ga0501069_0088087 3300049585 Bacteria 1754
833 Ga0501069_0981926 3300049585 Bacteria 515
834 Ga0501070_0015051 3300049586 Bacteria 6510
835 Ga0501071_0820465 3300049587 Bacteria 717
836 Ga0501072_0009289 3300049588 Bacteria 7474
837 Ga0501073_0000217 3300049589 Bacteria 37553
838 Ga0501074_0000487 3300049590 Bacteria 24178
839 Ga0501076_0517692 3300049592 Bacteria 983
840 Ga0501076_1758016 3300049592 Bacteria 508
841 Ga0501079_0002159 3300049741 Bacteria 14166
842 Ga0501079_0665996 3300049741 Bacteria 819
843 Ga0501080_0051889 3300049742 Bacteria 3817
844 Ga0501083_0001059 3300049744 Bacteria 18351
845 Ga0501035_0000241 3300049822 Bacteria 65546
846 Ga0501044_0000640 3300049823 Bacteria 42246
847 nmdc:mga03683_171328_c2 3300050489 Bacteria 585
848 nmdc:mga03683_213598_c1 3300050489 Bacteria 888
849 nmdc:mga03683_51953_c1 3300050489 Bacteria 1712
850 nmdc:mga03n38_295715_c1 3300050490 Bacteria 868
851 nmdc:mga03n38_299730_c1 3300050490 Bacteria 863
852 nmdc:mga00v17_1040925_c1 3300050491 Bacteria 514
853 nmdc:mga00v17_344246_c1 3300050491 Bacteria 969
854 nmdc:mga00v17_44103_c1 3300050491 Bacteria 2688
855 nmdc:mga0yw44_22144_c1 3300050492 Bacteria 3558
856 nmdc:mga0yw44_65190_c1 3300050492 Bacteria 2244
857 nmdc:mga0yw44_87367_c1 3300050492 Bacteria 1965
858 nmdc:mga0k408_170389_c1 3300050493 Bacteria 1298
859 nmdc:mga06z11_187653_c1 3300050494 Bacteria 1195
860 nmdc:mga06z11_34819_c1 3300050494 Bacteria 2474
861 nmdc:mga06z11_373326_c1 3300050494 Bacteria 856
862 nmdc:mga04h51_105033_c1 3300050495 Bacteria 1034
863 nmdc:mga04h51_326187_c1 3300050495 Bacteria 630
864 nmdc:mga07m45_358882_c1 3300050496 Bacteria 847
865 nmdc:mga07m45_440207_c1 3300050496 Bacteria 756
866 nmdc:mga09592_772676_c1 3300050508 Bacteria 814
867 nmdc:mga06r32_323882_c1 3300050510 Bacteria 1526
868 nmdc:mga08y16_148943_c1 3300050511 Bacteria 2433
869 nmdc:mga08y16_825887_c1 3300050511 Bacteria 918
870 nmdc:mga0sz30_247931_c1 3300050516 Bacteria 793
871 nmdc:mga0sz30_34771_c1 3300050516 Bacteria 1617
872 nmdc:mga0sz30_365951_c1 3300050516 Bacteria 645
873 Ga0495601_0010740 3300053077 Bacteria 5464
874 Ga0495601_0029796 3300053077 Bacteria 3387
875 Ga0495601_0192479 3300053077 Bacteria 1333
876 Ga0495601_0637744 3300053077 Bacteria 682
877 Ga0495612_0027695 3300053078 Bacteria 2279
878 Ga0495612_0155792 3300053078 Bacteria 996
879 Ga0495595_0001173 3300053084 Bacteria 10166
880 Ga0495595_0018479 3300053084 Bacteria 3012
881 Ga0495595_0274571 3300053084 Bacteria 846
882 Ga0495619_0000166 3300053085 Bacteria 48296
883 Ga0495619_0080424 3300053085 Bacteria 2193
884 Ga0495619_0173231 3300053085 Bacteria 1492
885 Ga0500578_0348369 3300053086 Bacteria 866
886 Ga0500643_031330 3300053087 Bacteria 1623
887 Ga0500644_0010946 3300053088 Bacteria 2466
888 Ga0500581_116593 3300053089 Bacteria 1295
889 Ga0500646_0166773 3300053090 Bacteria 738
890 Ga0500583_0019066 3300053092 Bacteria 2804
891 Ga0500583_0052943 3300053092 Bacteria 1890
892 Ga0500651_0009653 3300053093 Bacteria 5748
893 Ga0500651_0429116 3300053093 Bacteria 738
894 Ga0500651_0696879 3300053093 Bacteria 543
895 Ga0500566_0011586 3300053094 Bacteria 5191
896 Ga0500641_0003020 3300053096 Bacteria 5959
897 Ga0500641_0041661 3300053096 Bacteria 1858
898 Ga0500641_0099052 3300053096 Bacteria 1249
899 Ga0500650_0122058 3300053098 Bacteria 1214
900 Ga0500650_0158084 3300053098 Bacteria 1046
901 Ga0500650_0220249 3300053098 Bacteria 859
902 Ga0500650_0516885 3300053098 Bacteria 506
903 Ga0500654_211355 3300053099 Bacteria 568
904 Ga0500554_067487 3300053102 Bacteria 1158
905 Ga0500555_075935 3300053103 Bacteria 880
906 Ga0500562_048220 3300053108 Bacteria 1137
907 Ga0500569_341251 3300053109 Bacteria 500
908 Ga0500592_069579 3300053116 Bacteria 580
909 Ga0500594_0012856 3300053118 Bacteria 1981
910 Ga0500594_0111122 3300053118 Bacteria 852
911 Ga0500595_000454 3300053119 Bacteria 25490
912 Ga0500595_000732 3300053119 Bacteria 19543
913 Ga0500595_003733 3300053119 Bacteria 7022
914 Ga0500595_058260 3300053119 Bacteria 1174
915 Ga0500614_014866 3300053123 Bacteria 1730
916 Ga0500614_029471 3300053123 Bacteria 1333
917 Ga0500621_087091 3300053126 Bacteria 1246
918 Ga0500628_173534 3300053129 Bacteria 613
919 Ga0500642_0005200 3300053130 Bacteria 4175
920 Ga0500642_0125178 3300053130 Bacteria 1203
921 Ga0500642_0339451 3300053130 Bacteria 669
922 Ga0500658_0243224 3300053134 Bacteria 826
923 Ga0500658_0265408 3300053134 Bacteria 789
924 Ga0500559_0148276 3300053136 Bacteria 1100
925 Ga0500568_0192389 3300053139 Bacteria 748
926 Ga0500588_0187890 3300053146 Bacteria 762
927 Ga0500589_106533 3300053147 Bacteria 1209
928 Ga0500603_028776 3300053150 Bacteria 1420
929 Ga0500604_0079050 3300053151 Bacteria 1060
930 Ga0500620_163913 3300053155 Bacteria 770
931 Ga0500622_0076324 3300053156 Bacteria 1685
932 Ga0500627_0233519 3300053158 Bacteria 818
933 Ga0500633_0039912 3300053160 Bacteria 1572
934 Ga0500634_0206442 3300053161 Bacteria 857
935 Ga0500634_0210508 3300053161 Bacteria 844
936 Ga0500638_009338 3300053162 Bacteria 4238
937 Ga0500638_071031 3300053162 Bacteria 1664
938 Ga0500638_116898 3300053162 Bacteria 1225
939 Ga0500636_0162771 3300053177 Bacteria 1214
940 Ga0500636_0403619 3300053177 Bacteria 633
941 Ga0500637_0000106 3300053178 Bacteria 29937
942 Ga0500637_0080082 3300053178 Bacteria 1886
943 Ga0500637_0456817 3300053178 Bacteria 646
944 Ga0500570_073484 3300053724 Bacteria 1582
945 Ga0500611_215249 3300053727 Bacteria 547
946 Ga0500645_089672 3300053730 Bacteria 872
947 Ga0500609_035653 3300053731 Bacteria 686
948 Ga0501084_0463370 3300054114 Bacteria 1071
949 Ga0500661_001505 3300055283 Bacteria 4378
950 Ga0501082_0002281 3300060353 Bacteria 16799
951 Ga0501082_1743299 3300060353 Bacteria 543
952 Ga0501082_1983613 3300060353 Bacteria 507
953 Ga0530510_0836808 3300061734 Bacteria 703
954 Ga0451791_0848695
955 Ga0070690_100109329
956 Ga0070670_100182377
957 Ga0070677_10278443
958 Ga0068869_100350352
959 Ga0070666_10263748
960 Ga0070666_10920798
961 Ga0070680_100099527
962 Ga0070680_101027073
963 Ga0070682_100218536
964 Ga0070682_100883087
965 Ga0068868_100242262
966 Ga0068868_100562831
967 Ga0068868_100970974
968 Ga0070660_100237504
969 Ga0070660_101254219
970 Ga0070689_100065110
971 Ga0070687_100283548
972 Ga0070661_100508856
973 Ga0070661_100827768
974 Ga0070692_10403236
975 Ga0070668_100077166
976 Ga0070668_100158439
977 Ga0070668_100187514
978 Ga0070668_100233416
979 Ga0070668_100809731
980 Ga0070668_101329762
981 Ga0070669_100673637
982 Ga0070675_100055216
983 Ga0070675_101395679
984 Ga0070671_100103926
985 Ga0070671_100125153
986 Ga0070671_100180313
987 Ga0070671_100570506
988 Ga0070674_100193901
989 Ga0070674_100344948
990 Ga0070688_100570267
991 Ga0070688_100931067
992 Ga0070667_100193488
993 Ga0070667_100285707
994 Ga0070667_101252094
995 Ga0070714_100030841
996 Ga0070713_100001913
997 Ga0070710_10001428
998 Ga0070701_10042099
999 Ga0070711_100002884
1000 Ga0070705_100692043
1001 Ga0070700_100331560
1002 Ga0070663_100012415
1003 Ga0070663_100020934
1004 Ga0070663_100139749
1005 Ga0070663_100155533
1006 Ga0070663_100312881
1007 Ga0070663_100527125
1008 Ga0070663_101223701
1009 Ga0070678_100038172
1010 Ga0070678_100327714
1011 Ga0070678_100827688
1012 Ga0070681_10187328
1013 Ga0068867_100098613
1014 Ga0068867_100357346
1015 Ga0070685_10911383
1016 Ga0070698_100802434
1017 Ga0070679_100010022
1018 Ga0070679_100832766
1019 Ga0070679_101309184
1020 Ga0070684_101135039
1021 Ga0068853_100086334
1022 Ga0068853_100264714
1023 Ga0068853_100311216
1024 Ga0068853_100345202
1025 Ga0068853_100788273
1026 Ga0068853_100990839
1027 Ga0070686_100064305
1028 Ga0070686_100156302
1029 Ga0070695_100438016
1030 Ga0070693_100882912
1031 Ga0070665_100002761
1032 Ga0070665_100028064
1033 Ga0070665_100105968
1034 Ga0070665_100125844
1035 Ga0070665_100236808
1036 Ga0070665_100333856
1037 Ga0070665_100411663
1038 Ga0070665_100491317
1039 Ga0070665_100961294
1040 Ga0070704_100881713
1041 Ga0068855_100005114
1042 Ga0068855_100058918
1043 Ga0068855_100088389
1044 Ga0068855_101251883
1045 Ga0070664_101231400
1046 Ga0068857_100058710
1047 Ga0068857_100592858
1048 Ga0068857_101895290
1049 Ga0068854_100303555
1050 Ga0068854_100857442
1051 Ga0068854_101803693
1052 Ga0068856_100000427
1053 Ga0068856_100121230
1054 Ga0068856_100355289
1055 Ga0068856_100437725
1056 Ga0068856_101353399
1057 Ga0070702_100641997
1058 Ga0068852_100743571
1059 Ga0068852_101482158
1060 Ga0068859_100036626
1061 Ga0068859_100581332
1062 Ga0068859_101984550
1063 Ga0068864_100279235
1064 Ga0068864_100631184
1065 Ga0068866_10110863
1066 Ga0068866_10280632
1067 Ga0068861_100343808
1068 Ga0068861_100349492
1069 Ga0068861_100917289
1070 Ga0068861_100954872
1071 Ga0068870_10119807
1072 Ga0068870_10548031
1073 Ga0068863_100102716
1074 Ga0068863_100925751
1075 Ga0068858_100068737
1076 Ga0068858_100074603
1077 Ga0068858_100148240
1078 Ga0068860_100188867
1079 Ga0068860_100387516
1080 Ga0068860_100644977
1081 Ga0068862_100164685
1082 Ga0068862_100180254
1083 Ga0068862_100184236
1084 Ga0068862_100247187
1085 Ga0068862_101064311
1086 Ga0068862_101549227
1087 Ga0081455_10102757
1088 Ga0081538_10026312
1089 Ga0081540_1001309
1090 Ga0081540_1006165
1091 Ga0081540_1017082
1092 Ga0081540_1017644
1093 Ga0081540_1029705
1094 Ga0081540_1144444
1095 Ga0081539_10014361
1096 Ga0081539_10077359
1097 Ga0070717_10012334
1098 Ga0075365_10036300
1099 Ga0075365_10080042
1100 Ga0075365_10208528
1101 Ga0075365_10216118
1102 Ga0075368_10008192
1103 Ga0075368_10095569
1104 Ga0075368_10117958
1105 Ga0075368_10176639
1106 Ga0075368_10189733
1107 Ga0075363_100037113
1108 Ga0075363_100047074
1109 Ga0075364_10020407
1110 Ga0075364_10066207
1111 Ga0075364_11232294
1112 Ga0070715_10000460
1113 Ga0070716_100218783
1114 Ga0070716_100631026
1115 Ga0075362_10085800
1116 Ga0075367_10009857
1117 Ga0075367_10047768
1118 Ga0075367_10062430
1119 Ga0075367_10153277
1120 Ga0075367_10162167
1121 Ga0075367_10221058
1122 Ga0075367_10390755
1123 Ga0075367_10578137
1124 Ga0075367_10621734
1125 Ga0075369_10016130
1126 Ga0075369_10147649
1127 Ga0075366_10016629
1128 Ga0075366_10055028
1129 Ga0075366_10055968
1130 Ga0075366_10253354
1131 Ga0097621_100345550
1132 Ga0097621_100542380
1133 Ga0075370_10054698
1134 Ga0075370_10392806
1135 Ga0068871_100464241
1136 Ga0068871_100550822
1137 Ga0075428_100191657
1138 Ga0075428_100373668
1139 Ga0075431_100460065
1140 Ga0075434_100300523
1141 Ga0075429_100307478
1142 Ga0075429_101985520
1143 Ga0068865_100203137
1144 Ga0068865_100257714
1145 Ga0068865_100797058
1146 Ga0075436_100654830
1147 Ga0097620_100036626
1148 Ga0097620_100581392
1149 Ga0097620_101984458
1150 Ga0075435_100088190
1151 Ga0099794_10018462
1152 Ga0099794_10126873
1153 Ga0105251_10325817
1154 Ga0105240_10128151
1155 Ga0105240_10280572
1156 Ga0111539_10060214
1157 Ga0111539_10386257
1158 Ga0105245_10100567
1159 Ga0105245_10352990
1160 Ga0105245_11273537
1161 Ga0105247_10180890
1162 Ga0105247_10182790
1163 Ga0105243_10076186
1164 Ga0105243_10615425
1165 Ga0105241_10029062
1166 Ga0105241_10487208
1167 Ga0105241_10938905
1168 Ga0105242_10142584
1169 Ga0105242_10629870
1170 Ga0105248_10292218
1171 Ga0105248_10306580
1172 Ga0105248_10521776
1173 Ga0105248_12968590
1174 Ga0105237_10146184
1175 Ga0105237_10266412
1176 Ga0105238_10245048
1177 Ga0105238_10382508
1178 Ga0105238_11232683
1179 Ga0105238_11413426
1180 Ga0105238_12271408
1181 Ga0105249_10718502
1182 Ga0099796_10052721
1183 Ga0105239_10093688
1184 Ga0105239_10111201
1185 Ga0105239_10610851
1186 Ga0105246_10719810
1187 Ga0105246_11852942
1188 Ga0105246_12026761
1189 Ga0105246_12227408
1190 Ga0157318_1028937
1191 Ga0157315_1006767
1192 Ga0157371_10062724
1193 Ga0157370_10027175
1194 Ga0157369_10290383
1195 Ga0157374_10057545
1196 Ga0157378_10027145
1197 Ga0157378_10072835
1198 Ga0157378_10875876
1199 Ga0157378_11262980
1200 Ga0157378_13224357
1201 Ga0163162_10345463
1202 Ga0163162_10845955
1203 Ga0163162_11162875
1204 Ga0163162_12445734
1205 Ga0157372_10032793
1206 Ga0157372_11678566
1207 Ga0157375_10017467
1208 Ga0157375_10386725
1209 Ga0157375_12116028
1210 Ga0157375_12141013
1211 Ga0157375_12642765
1212 Ga0163163_10170864
1213 Ga0163163_11032651
1214 Ga0163163_12166798
1215 Ga0157380_10121222
1216 Ga0157380_10258419
1217 Ga0157377_10765035
1218 Ga0157379_10316105
1219 Ga0157379_10737779
1220 Ga0157376_10106086
1221 Ga0157376_10671273
1222 Ga0163161_10174445
1223 Ga0163161_10307470
1224 Ga0163161_10310146
1225 Ga0163161_11704034
1226 Ga0163161_12094265
1227 Ga0207666_1007367
1228 Ga0209758_1055715
1229 Ga0207692_10001538
1230 Ga0207642_10070820
1231 Ga0207642_10187559
1232 Ga0207710_10072548
1233 Ga0207688_10027607
1234 Ga0207688_10108641
1235 Ga0207688_10175882
1236 Ga0207680_10126782
1237 Ga0207680_11189528
1238 Ga0207647_10273640
1239 Ga0207699_10001041
1240 Ga0207699_10530820
1241 Ga0207643_10650279
1242 Ga0207684_10594106
1243 Ga0207654_10076109
1244 Ga0207707_10122255
1245 Ga0207695_10686401
1246 Ga0207671_10125983
1247 Ga0207671_10253704
1248 Ga0207671_11120361
1249 Ga0207693_10001357
1250 Ga0207663_10000873
1251 Ga0207663_10317633
1252 Ga0207660_10801854
1253 Ga0207660_11305932
1254 Ga0207657_10947275
1255 Ga0207649_10185939
1256 Ga0207652_10100402
1257 Ga0207652_11677394
1258 Ga0207681_10124174
1259 Ga0207681_10777544
1260 Ga0207694_10381022
1261 Ga0207694_10487861
1262 Ga0207694_11175783
1263 Ga0207694_11296571
1264 Ga0207650_11213765
1265 Ga0207659_10479536
1266 Ga0207687_10065916
1267 Ga0207687_10390049
1268 Ga0207700_10219260
1269 Ga0207700_10503266
1270 Ga0207664_10266980
1271 Ga0207644_10376394
1272 Ga0207644_10735840
1273 Ga0207644_11558761
1274 Ga0207706_10162321
1275 Ga0207706_10196895
1276 Ga0207686_10080568
1277 Ga0207686_10334080
1278 Ga0207709_10020641
1279 Ga0207670_10662416
1280 Ga0207670_11007002
1281 Ga0207669_10016092
1282 Ga0207669_10336589
1283 Ga0207669_10678646
1284 Ga0207704_10175997
1285 Ga0207665_10006588
1286 Ga0207665_10237736
1287 Ga0207665_10691553
1288 Ga0207691_10199385
1289 Ga0207691_10720443
1290 Ga0207711_10024524
1291 Ga0207711_10212265
1292 Ga0207711_10289338
1293 Ga0207711_10341222
1294 Ga0207711_10785109
1295 Ga0207689_10014560
1296 Ga0207679_11738446
1297 Ga0207667_10016252
1298 Ga0207667_10060632
1299 Ga0207667_10988473
1300 Ga0207667_11455364
1301 Ga0207651_10646318
1302 Ga0207712_10643451
1303 Ga0207668_10020366
1304 Ga0207668_10092350
1305 Ga0207668_10109108
1306 Ga0207668_10130034
1307 Ga0207668_12036849
1308 Ga0207640_10056503
1309 Ga0207640_10856395
1310 Ga0207640_11874866
1311 Ga0207658_10336700
1312 Ga0207658_11482619
1313 Ga0207677_10293302
1314 Ga0207677_10719126
1315 Ga0207677_11244074
1316 Ga0207703_10045095
1317 Ga0207703_10139608
1318 Ga0207703_10512952
1319 Ga0207639_10229204
1320 Ga0207639_10512586
1321 Ga0207678_10031203
1322 Ga0207678_10064057
1323 Ga0207678_10078598
1324 Ga0207678_10130990
1325 Ga0207678_10173295
1326 Ga0207678_10202645
1327 Ga0207708_10066000
1328 Ga0207708_11200342
1329 Ga0207702_10000365
1330 Ga0207702_10338113
1331 Ga0207702_10691012
1332 Ga0207702_11134027
1333 Ga0207641_10263886
1334 Ga0207641_11964124
1335 Ga0207641_12262851
1336 Ga0207648_10087277
1337 Ga0207648_10366559
1338 Ga0207648_10423656
1339 Ga0207676_10062535
1340 Ga0207676_10297875
1341 Ga0207676_10667721
1342 Ga0207676_11157498
1343 Ga0207674_10051243
1344 Ga0207674_11273651
1345 Ga0207675_100137686
1346 Ga0207675_100279041
1347 Ga0207675_100290149
1348 Ga0207675_100552243
1349 Ga0207675_102305607
1350 Ga0207683_10017331
1351 Ga0207683_10029323
1352 Ga0207683_10521387
1353 Ga0207683_10717887
1354 Ga0207683_10742458
1355 Ga0207698_10316980
1356 Ga0207698_10555824
1357 Ga0207698_10612664
1358 Ga0207698_11222493
1359 Ga0209179_1006451
1360 Ga0209588_1001786
1361 Ga0209813_10025982
1362 Ga0209813_10109055
1363 Ga0207428_10213817
1364 Ga0268266_10002595
1365 Ga0268266_10006003
1366 Ga0268266_10309234
1367 Ga0268266_10386797
1368 Ga0268266_10410068
1369 Ga0268266_10976766
1370 Ga0268266_11054535
1371 Ga0268266_11686198
1372 Ga0268265_10097897
1373 Ga0268265_10363667
1374 Ga0268265_10503637
1375 Ga0268265_10929609
1376 Ga0268265_11854955
1377 Ga0268264_10552303
1378 Ga0268264_11846964
1379 Ga0265334_10164414
1380 Ga0307517_10000369
1381 Ga0307517_10230763
1382 Ga0307515_10013420
1383 Ga0307515_10202781
1384 Ga0307515_10212186
1385 Ga0307515_10366595
1386 Ga0307511_10393325
1387 Ga0265331_10525276
1388 Ga0307513_10147355
1389 Ga0307513_10349827
1390 Ga0307513_10532279
1391 Ga0307513_10662599
1392 Ga0307513_11032550
1393 Ga0307509_10394805
1394 Ga0307509_10472207
1395 Ga0307408_100337341
1396 Ga0307508_10024680
1397 Ga0307508_10705172
1398 Ga0307514_10378251
1399 Ga0265314_10016806
1400 Ga0265342_10356093
1401 Ga0307516_10100254
1402 Ga0307516_10168231
1403 Ga0307516_10191917
1404 Ga0307516_10231273
1405 Ga0307516_10355046
1406 Ga0307405_10118968
1407 Ga0307405_10680977
1408 Ga0307413_10248913
1409 Ga0307413_10493465
1410 Ga0307410_10170663
1411 Ga0307406_10139814
1412 Ga0307406_10946582
1413 Ga0307406_11559896
1414 Ga0307407_10286469
1415 Ga0307412_10143960
1416 Ga0307412_10531881
1417 Ga0307412_10921812
1418 Ga0307416_100271181
1419 Ga0307416_102903579
1420 Ga0307411_10209449
1421 Ga0307411_12339175
1422 Ga0307415_100047556
1423 Ga0307415_101335627
1424 Ga0307415_101472354
1425 Ga0307510_10005024
1426 Ga0307510_10414876
1427 Ga0373930_0006589
1428 Ga0373948_0107535
1429 Ga0373958_0008906
1430 Ga0373959_0018884
1431 Ga0373928_0025560
1432 Ga0373929_0219213
1433 Ga0373934_0003131
1434 Ga0373934_0073417
1435 Ga0373934_0084124
1436 Ga0373944_0054108
1437 Ga0373952_0053838
1438 Ga0373923_0026188
1439 Ga0373936_0381921
1440 Ga0373939_0019817
1441 Ga0373941_0172245
1442 Ga0373953_0000929
1443 Ga0373953_0042679
1444 Ga0373954_0000067
1445 Ga0373954_0005676
1446 Ga0373956_0008985
1447 Ga0373956_0032152
1448 Ga0373957_0000501
1449 Ga0373957_0048803
1450 Ga0373960_0024301
1451 Ga0373943_0985687
1452 Ga0373955_0000377
1453 Ga0373955_0026352
1454 Ga0373955_0221576
1455 Ga0373955_0409410
1456 Ga0373924_0011393
1457 Ga0373931_0003188
1458 Ga0373935_0036939
1459 Ga0373935_0088170
1460 Ga0373935_0310213
1461 Ga0373927_0100074
1462 Ga0373927_0403895
1463 Ga0373927_0467236
1464 Ga0373933_0000519
1465 Ga0373933_0029036
1466 Ga0373933_0320152
1467 Ga0373947_0328234
1468 Ga0373937_0001425
1469 Ga0373937_0047428
1470 Ga0373937_0418895
1471 Ga0373937_1858926
1472 Ga0373925_0072581
1473 Ga0373925_1024439
1474 Ga0395900_0165965
1475 Ga0395898_1371337
1476 Ga0395905_1208183
1477 Ga0395901_0784889
1478 Ga0439465_0411743
1479 Ga0451793_0514176
1480 Ga0451795_0020734
1481 Ga0451795_0724943
1482 Ga0451798_0236933
1483 Ga0451807_0077524
1484 Ga0451807_1025123
1485 Ga0451833_0558409
1486 Ga0451839_0355379
1487 Ga0451841_1420533
1488 Ga0451855_0259353
1489 Ga0451853_1121981
1490 Ga0451853_3019586
1491 Ga0466967_0870486
1492 Ga0495617_009319
1493 Ga0495617_104719
1494 Ga0495592_0002879
1495 Ga0495592_0052860
1496 Ga0495603_0017472
1497 Ga0495603_0089151
1498 Ga0495603_0137950
1499 Ga0495603_0776044
1500 Ga0495603_0837790
1501 Ga0495590_0021936
1502 Ga0495590_0056605
1503 Ga0495629_0009626
1504 Ga0495629_0314503
1505 Ga0495629_0379694
1506 Ga0495629_0496112
1507 Ga0495638_0138659
1508 Ga0495638_0139183
1509 Ga0495638_0139794
1510 Ga0495638_0353604
1511 Ga0495638_0355925
1512 Ga0495638_0650593
1513 Ga0495651_0039568
1514 Ga0495651_0046151
1515 Ga0495653_0001052
1516 Ga0495653_0241248
1517 Ga0495650_0049919
1518 Ga0495580_0131246
1519 Ga0495605_0022673
1520 Ga0495639_0066941
1521 Ga0495639_0478762
1522 Ga0495639_0539625
1523 Ga0495639_0584491
1524 Ga0495664_0018600
1525 Ga0495664_0307860
1526 Ga0495584_0056474
1527 Ga0495584_0076821
1528 Ga0495584_0171601
1529 Ga0495585_0038029
1530 Ga0495585_0048869
1531 Ga0495585_0071352
1532 Ga0495585_0120995
1533 Ga0495594_0077046
1534 Ga0495594_0093976
1535 Ga0495596_0052142
1536 Ga0495596_0172177
1537 Ga0495596_0258381
1538 Ga0495607_0064566
1539 Ga0495583_0093890
1540 Ga0495583_0242426
1541 Ga0495606_0313008
1542 Ga0495606_0497807
1543 Ga0495608_0006072
1544 Ga0495608_0045424
1545 Ga0495610_0082944
1546 Ga0495610_0204355
1547 Ga0495616_0072987
1548 Ga0495618_0093421
1549 Ga0495618_0136750
1550 Ga0495620_0077485
1551 Ga0495620_0080447
1552 Ga0495628_0003826
1553 Ga0495628_0037081
1554 Ga0495628_0460818
1555 Ga0495630_0105492
1556 Ga0495630_0312889
1557 Ga0495630_0583317
1558 Ga0495631_0519213
1559 Ga0495632_0041751
1560 Ga0495632_0104177
1561 Ga0495632_0264585
1562 Ga0495637_0117004
1563 Ga0495643_0266468
1564 Ga0495643_0271163
1565 Ga0495644_0004584
1566 Ga0495644_0060453
1567 Ga0495644_0080947
1568 Ga0495644_0120067
1569 Ga0495644_0173423
1570 Ga0495648_0119611
1571 Ga0495648_0232948
1572 Ga0495663_0082518
1573 Ga0495666_0078126
1574 Ga0495652_0031966
1575 Ga0495652_1019081
1576 Ga0495640_0014352
1577 Ga0495640_0055440
1578 Ga0495640_0530062
1579 Ga0495587_0017387
1580 Ga0495587_0030982
1581 Ga0495598_0033118
1582 Ga0495609_0183154
1583 Ga0495609_0297665
1584 Ga0495609_0311170
1585 Ga0495597_0136702
1586 Ga0495645_0003011
1587 Ga0495645_0004900
1588 Ga0495622_0249876
1589 Ga0495633_0019689
1590 Ga0495633_0090148
1591 Ga0495633_0276357
1592 Ga0495667_0000305
1593 Ga0495667_0039978
1594 Ga0495667_0623444
1595 Ga0495656_0003560
1596 Ga0495656_0026086
1597 Ga0495656_0061686
1598 Ga0495656_0164003
1599 Ga0495656_0472383
1600 Ga0495668_0079080
1601 Ga0495668_0217182
1602 Ga0495668_0222695
1603 Ga0495668_0235092
1604 Ga0495668_0506073
1605 Ga0495668_0522490
1606 Ga0495668_0732992
1607 Ga0495668_0793791
1608 Ga0495668_0805960
1609 Ga0495634_0012645
1610 Ga0495634_0142694
1611 Ga0495634_0711985
1612 Ga0495611_0030579
1613 Ga0495611_0064818
1614 Ga0495611_0145977
1615 Ga0495611_0146978
1616 Ga0495625_0104771
1617 Ga0495625_0132039
1618 Ga0495625_0153643
1619 Ga0495635_0000102
1620 Ga0495635_0176983
1621 Ga0495659_0050367
1622 Ga0495661_0303680
1623 Ga0495588_0129574
1624 Ga0495657_0021132
1625 Ga0495657_0052103
1626 Ga0495599_0002307
1627 Ga0495599_0127753
1628 Ga0495623_0011690
1629 Ga0495623_0053659
1630 Ga0495646_0023007
1631 Ga0495646_0045067
1632 Ga0495658_1039858
1633 Ga0495669_0096978
1634 Ga0495669_0163016
1635 Ga0495669_0212859
1636 Ga0495669_0266948
1637 Ga0495613_0032668
1638 Ga0495624_0840859
1639 Ga0495670_0074186
1640 Ga0495670_0082033
1641 Ga0495670_0109970
1642 Ga0495671_0029845
1643 Ga0495671_0054983
1644 Ga0495671_0422851
1645 Ga0495649_0200782
1646 Ga0495600_0000357
1647 Ga0495600_0007049
1648 Ga0495581_0092904
1649 Ga0495581_0157741
1650 Ga0495604_0001099
1651 Ga0495604_0091475
1652 Ga0495604_0210196
1653 Ga0495636_0153882
1654 Ga0495636_0167548
1655 Ga0495636_0373701
1656 Ga0495674_0020074
1657 Ga0495674_0030740
1658 Ga0495672_0171554
1659 Ga0495676_0334250
1660 Ga0495680_0003585
1661 Ga0495680_0054109
1662 Ga0495683_0159721
1663 Ga0495675_0004354
1664 Ga0495675_0028407
1665 Ga0495675_0595385
1666 Ga0495677_0098924
1667 Ga0495677_0106765
1668 Ga0495677_0128729
1669 Ga0495685_085600
1670 Ga0495673_0146435
1671 Ga0495673_0304600
1672 Ga0495681_0186647
1673 Ga0495684_0000088
1674 Ga0495684_0040201
1675 Ga0495686_0095080
1676 Ga0495686_0321070
1677 Ga0495686_0562460
1678 Ga0495593_0000167
1679 Ga0495593_0162458
1680 Ga0495593_0256420
1681 Ga0495602_0026534
1682 Ga0495602_0090321
1683 Ga0495602_0532474
1684 Ga0495602_0866320
1685 Ga0495615_0052613
1686 Ga0495626_0286419
1687 Ga0496100_0205222
1688 Ga0496100_0211967
1689 Ga0496100_0469151
1690 Ga0496100_0969266
1691 Ga0496101_0169526
1692 Ga0496101_0184934
1693 Ga0496101_0270884
1694 Ga0496102_0028199
1695 Ga0496102_0044163
1696 Ga0496102_0066574
1697 Ga0496102_0093774
1698 Ga0496103_0078431
1699 Ga0496103_0417345
1700 Ga0496104_0054635
1701 Ga0496104_0056884
1702 Ga0496104_0159659
1703 Ga0496104_1502148
1704 Ga0496105_0184098
1705 Ga0496105_1298009
1706 Ga0496106_0002876
1707 Ga0496106_0030774
1708 Ga0496106_0287246
1709 Ga0496106_0351270
1710 Ga0496107_0016161
1711 Ga0496107_0032740
1712 Ga0496107_0081874
1713 Ga0496108_0004100
1714 Ga0496108_0066601
1715 Ga0496108_0580548
1716 Ga0496109_0000399
1717 Ga0496109_0041781
1718 Ga0496109_0232120
1719 Ga0496109_1276180
1720 Ga0496110_0030095
1721 Ga0496110_0030135
1722 Ga0496110_0034765
1723 Ga0496110_0803978
1724 Ga0496111_0042984
1725 Ga0496111_0101718
1726 Ga0496111_1323130
1727 Ga0496112_0006192
1728 Ga0496112_0011883
1729 Ga0496112_0083319
1730 Ga0496113_0002999
1731 Ga0496113_0093650
1732 Ga0496114_0008397
1733 Ga0496114_0157164
1734 Ga0496114_0177409
1735 Ga0496114_0205069
1736 Ga0496115_0007981
1737 Ga0496115_0437270
1738 Ga0496116_0244381
1739 Ga0496117_0108354
1740 Ga0496119_0137069
1741 Ga0496119_0224623
1742 Ga0496121_0006513
1743 Ga0496121_0171656
1744 Ga0496121_0248708
1745 Ga0496124_0194814
1746 Ga0496124_0577000
1747 Ga0496126_0005960
1748 Ga0496126_0015347
1749 Ga0496126_0054336
1750 Ga0496126_0100608
1751 Ga0496126_0267332
1752 Ga0496126_0349130
1753 Ga0496126_0403701
1754 Ga0496126_0855556
1755 Ga0496126_1376002
1756 Ga0495678_166248
1757 Ga0495682_0072602
1758 Ga0495682_0200460
1759 Ga0501031_0000543
1760 Ga0501032_0000188
1761 Ga0501033_0000241
1762 Ga0501034_0000021
1763 Ga0501036_0003567
1764 Ga0501036_0095673
1765 Ga0501037_0000398
1766 Ga0501038_0003474
1767 Ga0501038_0567187
1768 Ga0501039_0000849
1769 Ga0501041_0228326
1770 Ga0501042_0041334
1771 Ga0501042_0150010
1772 Ga0501043_0000033
1773 Ga0501046_0000452
1774 Ga0501047_0000574
1775 Ga0501047_0185199
1776 Ga0501047_0343737
1777 Ga0501048_0013746
1778 Ga0501048_0119544
1779 Ga0501048_0488512
1780 Ga0501067_0000045
1781 Ga0501067_0286263
1782 Ga0501068_0000924
1783 Ga0501068_0848595
1784 Ga0501069_0010839
1785 Ga0501069_0088087
1786 Ga0501069_0981926
1787 Ga0501070_0015051
1788 Ga0501071_0820465
1789 Ga0501072_0009289
1790 Ga0501073_0000217
1791 Ga0501074_0000487
1792 Ga0501076_0517692
1793 Ga0501076_1758016
1794 Ga0501079_0002159
1795 Ga0501079_0665996
1796 Ga0501080_0051889
1797 Ga0501083_0001059
1798 Ga0501035_0000241
1799 Ga0501044_0000640
1800 nmdc:mga03683_171328_c2
1801 nmdc:mga03683_213598_c1
1802 nmdc:mga03683_51953_c1
1803 nmdc:mga03n38_295715_c1
1804 nmdc:mga03n38_299730_c1
1805 nmdc:mga00v17_1040925_c1
1806 nmdc:mga00v17_344246_c1
1807 nmdc:mga00v17_44103_c1
1808 nmdc:mga0yw44_22144_c1
1809 nmdc:mga0yw44_65190_c1
1810 nmdc:mga0yw44_87367_c1
1811 nmdc:mga0k408_170389_c1
1812 nmdc:mga06z11_187653_c1
1813 nmdc:mga06z11_34819_c1
1814 nmdc:mga06z11_373326_c1
1815 nmdc:mga04h51_105033_c1
1816 nmdc:mga04h51_326187_c1
1817 nmdc:mga07m45_358882_c1
1818 nmdc:mga07m45_440207_c1
1819 nmdc:mga09592_772676_c1
1820 nmdc:mga06r32_323882_c1
1821 nmdc:mga08y16_148943_c1
1822 nmdc:mga08y16_825887_c1
1823 nmdc:mga0sz30_247931_c1
1824 nmdc:mga0sz30_34771_c1
1825 nmdc:mga0sz30_365951_c1
1826 Ga0495601_0010740
1827 Ga0495601_0029796
1828 Ga0495601_0192479
1829 Ga0495601_0637744
1830 Ga0495612_0027695
1831 Ga0495612_0155792
1832 Ga0495595_0001173
1833 Ga0495595_0018479
1834 Ga0495595_0274571
1835 Ga0495619_0000166
1836 Ga0495619_0080424
1837 Ga0495619_0173231
1838 Ga0500578_0348369
1839 Ga0500643_031330
1840 Ga0500644_0010946
1841 Ga0500581_116593
1842 Ga0500646_0166773
1843 Ga0500583_0019066
1844 Ga0500583_0052943
1845 Ga0500651_0009653
1846 Ga0500651_0429116
1847 Ga0500651_0696879
1848 Ga0500566_0011586
1849 Ga0500641_0003020
1850 Ga0500641_0041661
1851 Ga0500641_0099052
1852 Ga0500650_0122058
1853 Ga0500650_0158084
1854 Ga0500650_0220249
1855 Ga0500650_0516885
1856 Ga0500654_211355
1857 Ga0500554_067487
1858 Ga0500555_075935
1859 Ga0500562_048220
1860 Ga0500569_341251
1861 Ga0500592_069579
1862 Ga0500594_0012856
1863 Ga0500594_0111122
1864 Ga0500595_000454
1865 Ga0500595_000732
1866 Ga0500595_003733
1867 Ga0500595_058260
1868 Ga0500614_014866
1869 Ga0500614_029471
1870 Ga0500621_087091
1871 Ga0500628_173534
1872 Ga0500642_0005200
1873 Ga0500642_0125178
1874 Ga0500642_0339451
1875 Ga0500658_0243224
1876 Ga0500658_0265408
1877 Ga0500559_0148276
1878 Ga0500568_0192389
1879 Ga0500588_0187890
1880 Ga0500589_106533
1881 Ga0500603_028776
1882 Ga0500604_0079050
1883 Ga0500620_163913
1884 Ga0500622_0076324
1885 Ga0500627_0233519
1886 Ga0500633_0039912
1887 Ga0500634_0206442
1888 Ga0500634_0210508
1889 Ga0500638_009338
1890 Ga0500638_071031
1891 Ga0500638_116898
1892 Ga0500636_0162771
1893 Ga0500636_0403619
1894 Ga0500637_0000106
1895 Ga0500637_0080082
1896 Ga0500637_0456817
1897 Ga0500570_073484
1898 Ga0500611_215249
1899 Ga0500645_089672
1900 Ga0500609_035653
1901 Ga0501084_0463370
1902 Ga0500661_001505
1903 Ga0501082_0002281
1904 Ga0501082_1743299
1905 Ga0501082_1983613
1906 Ga0530510_0836808

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

29

125

0.86

Map