F486627

General Info

Members Datasets Scaffolds Average Seq Length
952 755 564 284

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100014853|Ga0307415_1000148533
Length 325
Sequence MIDGERGDRMSEPSGAAPAATLAVDERVPAARPAVVVRRRRPLRPARVVLHVFLTLAMLGFLAPLALAVYASLRPYAETSELGYFSLPRKLTLHYYVQVFREGDLQKYFLNTLYVAVPAVLLTLFLASFVAFCIARLRVRGGLALLVVFTAGNLLPPQVLVTPLYQMYKSIPLPESLSSSLTLYDSYLGLVAIHVAFQVGFCVFVLTNYMHTIPDEITEAAVMDGAGAFRQYWQVTLPLCRPALAALATLEFTFIYNDFLYALVLMSTGDKLPVTSALNNLRGQFFTDYNLLAAGSVVVALPTVLVFLLLQRHFIAGLTLGANKG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
13 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
14 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
15 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
18 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
19 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
20 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
21 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
24 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
25 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
26 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
27 2516143018 Ensifer sp. BR816 Isolate Nodule
28 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
29 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
30 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
31 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
32 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
33 2519899620 Rhizobium sp. Pop5 Isolate Nodule
34 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
35 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
36 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
37 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
38 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
39 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
40 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
41 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
42 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
43 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
44 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
45 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
46 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
47 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
48 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
49 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
50 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
51 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
52 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
53 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
54 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
55 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
56 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
57 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
58 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
59 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
60 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
61 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
62 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
63 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
64 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
65 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
66 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
67 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
68 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
69 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
70 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
71 2643221591 Devosia sp. Root685 Isolate Unclassified
72 2643221599 Rhizobium sp. Root708 Isolate Unclassified
73 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
74 2643221698 Ensifer sp. Root142 Isolate Unclassified
75 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
76 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
77 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
78 2718217882 Rhizobium sp. N741 Isolate Nodule
79 2718217927 Rhizobium sp. N324 Isolate Nodule
80 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
81 2718218009 Rhizobium sp. N561 Isolate Nodule
82 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
83 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
84 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
85 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
86 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
87 2718218363 Rhizobium sp. N113 Isolate Nodule
88 2718218365 Rhizobium sp. N731 Isolate Nodule
89 2718218366 Rhizobium sp. N621 Isolate Nodule
90 2718218423 Rhizobium sp. N941 Isolate Nodule
91 2721755514 Rhizobium sp. N6212 Isolate Nodule
92 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
93 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
94 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
95 2721755809 Rhizobium sp. N541 Isolate Nodule
96 2721755810 Rhizobium sp. N871 Isolate Nodule
97 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
98 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
99 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
100 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
101 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
102 2728369365 Rhizobium sp. N1341 Isolate Nodule
103 2728369397 Rhizobium sp. N1314 Isolate Nodule
104 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
105 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
106 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
107 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
108 2791355256 Rhizobium sp. M10 Isolate Nodule
109 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
110 2791355261 Rhizobium sp. J15 Isolate Nodule
111 2791355262 Rhizobium sp. M1 Isolate Nodule
112 2791355263 Rhizobium chutanense C5 Isolate Nodule
113 2791355264 Rhizobium sp. S9 Isolate Nodule
114 2791355266 Rhizobium sp. L43 Isolate Nodule
115 2791355267 Rhizobium sp. L18 Isolate Nodule
116 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
117 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
118 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
119 2802429633 Rhizobium anhuiense J3 Isolate Nodule
120 2802429634 Rhizobium anhuiense S10 Isolate Nodule
121 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
122 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
123 2802429637 Rhizobium anhuiense C15 Isolate Nodule
124 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
125 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
126 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
127 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
128 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
129 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
130 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
131 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
132 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
133 2838048938 Rhizobium pisi 27/80 Isolate Nodule
134 2838061910 Rhizobium phaseoli L15 Isolate Nodule
135 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
136 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
137 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
138 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
139 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
140 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
141 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
142 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
143 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
144 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
145 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
146 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
147 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
148 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
149 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
150 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
151 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
152 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
153 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
154 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
155 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
156 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
157 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
158 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
159 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
160 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
161 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
162 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
163 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
164 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
165 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
166 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
167 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
168 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
169 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
170 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
171 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
172 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
173 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
174 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
175 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
176 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
177 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
178 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
179 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
180 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
181 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
182 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
183 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
184 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
185 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
186 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
187 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
188 2854911287 Brucella lupini LUP21 Isolate Unclassified
189 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
190 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
191 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
192 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
193 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
194 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
195 2862574272 Streptomyces sp. AcE210 Isolate Nodule
196 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
197 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
198 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
199 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
200 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
201 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
202 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
203 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
204 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
205 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
206 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
207 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
208 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
209 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
210 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
211 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
212 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
213 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
214 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
215 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
216 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
217 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
218 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
219 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
220 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
221 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
222 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
223 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
224 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
225 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
226 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
227 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
228 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
229 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
230 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
231 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
232 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
233 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
234 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
235 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
236 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
237 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
238 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
239 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
240 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
241 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
242 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
243 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
244 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
245 2933599457 Rhizobium phaseoli M3 Isolate Nodule
246 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
247 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
248 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
249 2936381700 Rhizobium chutanense C16 Isolate Unclassified
250 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
251 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
252 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
253 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
254 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
255 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
256 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
257 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
258 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
259 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
260 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
261 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
262 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
263 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
264 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
265 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
266 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
267 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
268 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
269 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
270 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
271 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
272 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
273 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
274 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
275 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
276 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
277 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
278 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
279 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
280 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
281 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
282 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
283 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
284 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
285 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
286 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
287 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
288 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
289 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
290 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
291 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
292 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
293 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
294 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
295 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
296 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
297 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
298 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
299 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
300 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
301 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
302 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
303 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
304 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
305 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
306 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
307 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
308 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
309 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
310 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
311 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
312 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
313 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
314 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
315 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
316 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
317 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
318 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
319 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
320 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
321 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
322 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
323 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
324 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
325 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
326 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
327 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
328 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
329 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
330 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
331 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
332 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
333 2996887358 Rhizobium sp. R711 Isolate Nodule
334 2996893221 Rhizobium sp. R635 Isolate Nodule
335 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
336 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
337 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
338 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
339 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
340 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
341 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
342 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
343 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
344 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
345 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
346 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
347 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
348 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
349 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
350 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
351 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
352 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
353 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
354 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
355 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
356 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
357 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
358 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
359 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
360 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
361 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
362 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
363 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
364 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
365 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
366 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
367 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
368 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
369 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
370 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
371 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
372 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
373 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
374 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
375 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
376 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
377 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
378 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
379 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
380 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
381 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
382 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
383 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
384 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
385 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
386 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
387 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
388 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
389 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
390 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
391 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
392 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
393 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
394 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
395 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
396 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
397 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
398 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
399 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
400 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
401 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
402 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
403 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
404 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
405 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
406 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
407 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
408 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
409 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
410 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
411 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
412 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
413 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
414 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
415 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
416 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
417 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
418 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
419 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
420 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
421 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
422 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
423 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
424 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
425 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
426 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
427 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
428 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
429 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
430 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
431 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
432 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
433 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
434 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
435 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
436 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
437 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
438 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
439 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
440 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
441 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
442 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
443 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
444 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
445 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
446 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
447 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
448 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
449 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
450 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
451 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
452 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
453 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
454 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
455 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
456 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
457 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
458 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
459 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
460 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
461 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
462 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
463 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
464 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
465 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
466 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
467 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
468 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
469 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
470 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
471 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
472 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
473 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
474 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
475 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
476 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
477 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
478 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
479 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
480 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
481 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
482 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
483 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
484 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
485 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
486 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
487 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
488 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
489 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
490 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
528 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
530 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
531 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
532 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
533 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
534 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
535 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
537 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
538 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
539 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
540 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
541 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
542 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
543 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
544 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
545 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
546 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
547 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
548 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
549 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
550 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
551 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
552 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
553 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
554 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
555 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
556 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
557 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
558 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
559 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
560 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
561 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
562 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
563 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
564 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
565 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
566 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
567 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
568 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
569 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
570 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
571 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
572 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
573 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
574 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
575 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
576 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
577 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
578 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
579 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
580 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
581 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
582 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
583 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
584 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
585 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
586 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
587 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
588 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
589 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
590 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
591 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
592 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
593 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
594 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
595 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
596 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
597 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
598 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
599 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
600 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
601 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
602 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
603 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
604 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
605 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
606 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
607 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
608 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
609 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
610 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
611 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
612 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
613 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
614 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
615 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
616 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
617 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
618 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
619 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
620 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
621 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
622 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
623 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
624 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
625 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
626 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
627 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
628 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
629 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
630 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
631 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
632 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
633 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
634 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
635 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
636 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
637 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
638 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
639 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
640 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
641 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
642 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
643 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
644 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
645 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
646 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
647 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
648 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
649 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
650 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
651 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
652 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
653 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
654 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
655 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
656 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
657 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
658 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
659 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
660 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
661 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
662 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
663 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
664 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
665 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
666 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
667 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
668 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
669 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
670 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
671 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
672 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
673 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
674 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
675 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
676 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
677 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
678 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
679 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
680 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
681 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
682 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
683 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
684 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
685 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
686 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
687 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
688 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
689 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
690 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
691 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
692 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
693 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
694 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
695 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
696 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
697 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
698 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
699 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
700 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
701 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
702 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
703 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
704 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
705 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
706 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
707 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
708 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
709 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
710 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
711 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
712 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
713 8005258706 Rhizobium sp. R693 Isolate Nodule
714 8005275841 Rhizobium sp. N4311 Isolate Nodule
715 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
716 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
717 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
718 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
719 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
720 8005321885 Rhizobium sp. R72 Isolate Nodule
721 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
722 8005382845 Rhizobium sp. R634 Isolate Nodule
723 8005395548 Rhizobium sp. R339 Isolate Nodule
724 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
725 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
726 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
727 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
728 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
729 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
730 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
731 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
732 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
733 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
734 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
735 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
736 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
737 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
738 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
739 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
740 8018176218 Rhizobium sp. N122 Isolate Nodule
741 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
742 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
743 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
744 8024501048 Rhizobium sp. H4 Isolate Nodule
745 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
746 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
747 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
748 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
749 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
750 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
751 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
752 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
753 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
754 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
755 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.03
Metatranscriptomes 0.21
Isolates 40.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.13
Nodule 32.25
Rhizoplane 2
Rhizosphere 40.86
Stem 0
Stem Tuber 0
Unclassified 11.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1015059 3300001915 Bacteria 1282
2 JGI24740J21852_10000485 3300001979 Bacteria 17069
3 JGI24740J21852_10061639 3300001979 Bacteria 1032
4 JGI24033J26618_1010437 3300002155 Bacteria 1094
5 JGI24751J29686_10008949 3300002459 Bacteria 2053
6 JGI25155J39150_1000034 3300002704 Bacteria 105264
7 JGI25156J39149_1000008 3300002705 Bacteria 229035
8 JGI25162J39368_1000074 3300002737 Bacteria 121066
9 JGI25154J39366_1000063 3300002738 Bacteria 104538
10 JGI25157J39369_1000062 3300002741 Bacteria 104644
11 JGI25152J39213_1001055 3300002773 Bacteria 13078
12 JGI25152J39213_1001109 3300002773 Bacteria 12572
13 JGI25152J39213_1014996 3300002773 Bacteria 1546
14 JGI25150J39212_1001160 3300002774 Bacteria 7880
15 JGI25159J45721_1000787 3300002987 Bacteria 13801
16 JGI25151J46595_10000306 3300003187 Bacteria 53632
17 JGI25151J46595_10001290 3300003187 Bacteria 17618
18 JGI25165J46597_1000201 3300003214 Bacteria 87622
19 JGI25153J46596_10000693 3300003215 Bacteria 20590
20 JGI25153J46596_10005249 3300003215 Bacteria 6811
21 JGI25153J46596_10006734 3300003215 Bacteria 5765
22 rootH1_10010012 3300003316 Bacteria 13961
23 rootH2_10045083 3300003320 Bacteria 13758
24 rootL2_10001175 3300003322 Bacteria 27263
25 rootL2_10271270 3300003322 Bacteria 1633
26 rootL2_10314341 3300003322 Bacteria 1208
27 rootH1_10113604 3300003323 Bacteria 5833
28 rootH1_10169375 3300003323 Bacteria 4525
29 rootH1_10270503 3300003323 Bacteria 2073
30 JGI25160J50197_1002241 3300003354 Bacteria 9077
31 JGI25160J50197_1006870 3300003354 Bacteria 4544
32 JGI25160J50197_1027872 3300003354 Bacteria 1528
33 JGI25160J50197_1032862 3300003354 Bacteria 1313
34 JGI25407J50210_10023741 3300003373 Bacteria 1591
35 JGI25161J50226_1000084 3300003374 Bacteria 76415
36 Ga0055526_1003954 3300003771 Bacteria 9150
37 Ga0055526_1008917 3300003771 Bacteria 4919
38 Ga0055524_1003157 3300003775 Bacteria 8114
39 Ga0055524_1009862 3300003775 Bacteria 3845
40 Ga0055524_1049203 3300003775 Bacteria 974
41 Ga0055528_1000168 3300003790 Bacteria 55151
42 Ga0055528_1007067 3300003790 Bacteria 5016
43 Ga0055528_1010970 3300003790 Bacteria 3635
44 Ga0055528_1026867 3300003790 Bacteria 1638
45 Ga0055540_1000109 3300003792 Bacteria 89131
46 Ga0058692_1005828 3300003856 Bacteria 3457
47 JGI25405J52794_10032364 3300003911 Bacteria 1089
48 Ga0055543_1000017 3300004625 Bacteria 170255
49 Ga0055543_1000652 3300004625 Bacteria 18430
50 Ga0065165_1008542 3300005262 Bacteria 4765
51 Ga0065165_1009458 3300005262 Bacteria 4367
52 Ga0065704_10132899 3300005289 Bacteria 1607
53 Ga0070676_10135405 3300005328 Bacteria 1562
54 Ga0070683_100048475 3300005329 Bacteria 3928
55 Ga0070690_100188917 3300005330 Bacteria 1427
56 Ga0070670_100065672 3300005331 Bacteria 3113
57 Ga0068869_100005743 3300005334 Bacteria 7834
58 Ga0070666_10153959 3300005335 Bacteria 1605
59 Ga0070680_100023858 3300005336 Bacteria 4882
60 Ga0068868_100019414 3300005338 Bacteria 5093
61 Ga0070689_100021590 3300005340 Bacteria 4796
62 Ga0070691_10029681 3300005341 Bacteria 2559
63 Ga0070661_100021113 3300005344 Bacteria 4649
64 Ga0070669_100244920 3300005353 Bacteria 1425
65 Ga0070675_100042440 3300005354 Bacteria 3716
66 Ga0070671_100002576 3300005355 Bacteria 14058
67 Ga0070674_100656192 3300005356 Bacteria 892
68 Ga0070673_100316965 3300005364 Bacteria 1376
69 Ga0070688_100022559 3300005365 Bacteria 3692
70 Ga0070659_100078716 3300005366 Bacteria 2630
71 Ga0070713_100003468 3300005436 Bacteria 10415
72 Ga0070710_10124741 3300005437 Bacteria 1563
73 Ga0070700_100011533 3300005441 Bacteria 4898
74 Ga0070700_100042001 3300005441 Bacteria 2806
75 Ga0070700_100336132 3300005441 Bacteria 1115
76 Ga0070708_100010194 3300005445 Bacteria 7605
77 Ga0070663_100006974 3300005455 Bacteria 6842
78 Ga0070663_100013791 3300005455 Bacteria 5169
79 Ga0070678_100000440 3300005456 Bacteria 19631
80 Ga0070681_10108783 3300005458 Bacteria 2712
81 Ga0070685_10011517 3300005466 Bacteria 4629
82 Ga0070698_100001143 3300005471 Bacteria 29381
83 Ga0070699_100141834 3300005518 Bacteria 2122
84 Ga0070684_100005576 3300005535 Bacteria 9665
85 Ga0070697_100168247 3300005536 Bacteria 1854
86 Ga0070695_100407485 3300005545 Bacteria 1032
87 Ga0070693_100003314 3300005547 Bacteria 7487
88 Ga0070693_100127514 3300005547 Bacteria 1586
89 Ga0070665_100041189 3300005548 Bacteria 4642
90 Ga0070665_100441317 3300005548 Bacteria 1311
91 Ga0070664_100008484 3300005564 Bacteria 8309
92 Ga0068854_100247058 3300005578 Bacteria 1423
93 Ga0068856_100014297 3300005614 Bacteria 7676
94 Ga0068856_100327914 3300005614 Bacteria 1548
95 Ga0070702_100004596 3300005615 Bacteria 6323
96 Ga0068852_100049477 3300005616 Bacteria 3596
97 Ga0068859_100062839 3300005617 Bacteria 3744
98 Ga0068864_100037161 3300005618 Bacteria 4154
99 Ga0068861_100107802 3300005719 Bacteria 2227
100 Ga0068870_10001400 3300005840 Bacteria 9726
101 Ga0068870_10110250 3300005840 Bacteria 1570
102 Ga0068863_100106765 3300005841 Bacteria 2664
103 Ga0068863_100515007 3300005841 Bacteria 1179
104 Ga0068858_100012004 3300005842 Bacteria 8166
105 Ga0068858_100057359 3300005842 Bacteria 3599
106 Ga0068860_100052160 3300005843 Bacteria 3890
107 Ga0068862_100122801 3300005844 Bacteria 2291
108 Ga0081455_10004804 3300005937 Bacteria 15008
109 Ga0081538_10000512 3300005981 Bacteria 43332
110 Ga0081538_10000552 3300005981 Bacteria 41376
111 Ga0081540_1046671 3300005983 Bacteria 2185
112 Ga0075365_10000942 3300006038 Bacteria 12330
113 Ga0075365_10006367 3300006038 Bacteria 6490
114 Ga0075365_10043661 3300006038 Bacteria 2935
115 Ga0075368_10002275 3300006042 Bacteria 6243
116 Ga0075368_10016224 3300006042 Bacteria 2775
117 Ga0075363_100035976 3300006048 Bacteria 2595
118 Ga0075364_10004665 3300006051 Bacteria 7906
119 Ga0075364_10083456 3300006051 Bacteria 2115
120 Ga0075362_10125770 3300006177 Bacteria 1216
121 Ga0075367_10001560 3300006178 Bacteria 9905
122 Ga0075367_10033316 3300006178 Bacteria 2968
123 Ga0075369_10025582 3300006186 Bacteria 2455
124 Ga0075369_10031780 3300006186 Bacteria 2230
125 Ga0075369_10049829 3300006186 Bacteria 1810
126 Ga0075366_10014399 3300006195 Bacteria 4516
127 Ga0075366_10017101 3300006195 Bacteria 4169
128 Ga0075366_10048178 3300006195 Bacteria 2526
129 Ga0097621_100022705 3300006237 Bacteria 4874
130 Ga0075370_10005366 3300006353 Bacteria 6362
131 Ga0068871_100049946 3300006358 Bacteria 3382
132 Ga0075428_100169589 3300006844 Bacteria 2367
133 Ga0075430_100166488 3300006846 Bacteria 1834
134 Ga0075431_100066750 3300006847 Bacteria 3714
135 Ga0075433_10022955 3300006852 Bacteria 5245
136 Ga0075434_100029891 3300006871 Bacteria 5363
137 Ga0075429_100055355 3300006880 Bacteria 3452
138 Ga0075436_100001750 3300006914 Bacteria 14878
139 Ga0097620_100062839 3300006931 Bacteria 3744
140 Ga0075435_100031775 3300007076 Bacteria 4163
141 Ga0075435_100408169 3300007076 Bacteria 1169
142 Ga0105251_10011535 3300009011 Bacteria 5043
143 Ga0105240_10000217 3300009093 Bacteria 115649
144 Ga0111539_10002276 3300009094 Bacteria 25548
145 Ga0105247_10024836 3300009101 Bacteria 3612
146 Ga0114129_10044078 3300009147 Bacteria 6276
147 Ga0114129_10130524 3300009147 Bacteria 3451
148 Ga0114129_10858000 3300009147 Bacteria 1154
149 Ga0105243_10233375 3300009148 Bacteria 1633
150 Ga0105243_10520590 3300009148 Bacteria 1131
151 Ga0105241_10460268 3300009174 Bacteria 1127
152 Ga0105242_10464408 3300009176 Bacteria 1196
153 Ga0105248_10008444 3300009177 Bacteria 11302
154 Ga0105237_10001458 3300009545 Bacteria 31192
155 Ga0105237_10404796 3300009545 Bacteria 1369
156 Ga0105238_10212409 3300009551 Bacteria 1911
157 Ga0105249_10368466 3300009553 Bacteria 1459
158 Ga0123341_1000072 3300009765 Bacteria 42781
159 Ga0123342_1005378 3300009766 Bacteria 18606
160 Ga0105239_10001164 3300010375 Bacteria 36154
161 Ga0105239_10135254 3300010375 Bacteria 2744
162 Ga0105246_10017305 3300011119 Bacteria 4579
163 Ga0157373_10029252 3300013100 Bacteria 3970
164 Ga0157373_10058924 3300013100 Bacteria 2721
165 Ga0157371_10007454 3300013102 Bacteria 8857
166 Ga0157370_10000768 3300013104 Bacteria 40191
167 Ga0157374_10068086 3300013296 Bacteria 3348
168 Ga0163162_10638523 3300013306 Bacteria 1189
169 Ga0163163_10289204 3300014325 Bacteria 1691
170 Ga0163163_10791404 3300014325 Bacteria 1012
171 Ga0157377_10004331 3300014745 Bacteria 6517
172 Ga0157377_10043374 3300014745 Bacteria 2503
173 Ga0157379_10030051 3300014968 Bacteria 4833
174 Ga0157376_10444180 3300014969 Bacteria 1264
175 Ga0182007_10004351 3300015262 Bacteria 6435
176 Ga0182005_1019519 3300015265 Bacteria 1868
177 Ga0163161_10245881 3300017792 Bacteria 1393
178 Ga0206356_10934920 3300020070 Bacteria 3934
179 Ga0209435_100020 3300025206 Bacteria 229105
180 Ga0209436_100012 3300025208 Bacteria 136927
181 Ga0209672_107087 3300025228 Bacteria 1760
182 Ga0209437_100067 3300025233 Bacteria 317685
183 Ga0207425_1000316 3300025245 Bacteria 34779
184 Ga0207425_1008705 3300025245 Bacteria 2574
185 Ga0209646_1000070 3300025246 Bacteria 229105
186 Ga0209646_1009041 3300025246 Bacteria 1587
187 Ga0209646_1015218 3300025246 Bacteria 1150
188 Ga0209026_1000057 3300025250 Bacteria 229105
189 Ga0209677_100295 3300025253 Bacteria 32620
190 Ga0209759_1000047 3300025256 Bacteria 229105
191 Ga0209129_1000235 3300025258 Bacteria 60351
192 Ga0209129_1000268 3300025258 Bacteria 51242
193 Ga0209129_1001842 3300025258 Bacteria 11226
194 Ga0209233_1000088 3300025261 Bacteria 317980
195 Ga0209233_1000288 3300025261 Bacteria 66882
196 Ga0209673_1000444 3300025273 Bacteria 71044
197 Ga0209673_1001803 3300025273 Bacteria 17641
198 Ga0209673_1001878 3300025273 Bacteria 16950
199 Ga0209673_1003837 3300025273 Bacteria 8493
200 Ga0209673_1005954 3300025273 Bacteria 6012
201 Ga0209130_1000022 3300025284 Bacteria 361244
202 Ga0209675_1033537 3300025291 Bacteria 1189
203 Ga0209025_1000058 3300025294 Bacteria 311398
204 Ga0209025_1000609 3300025294 Bacteria 64308
205 Ga0209025_1005676 3300025294 Bacteria 10053
206 Ga0209025_1011931 3300025294 Bacteria 5650
207 Ga0209025_1046804 3300025294 Bacteria 1774
208 Ga0209564_1000167 3300025295 Bacteria 159653
209 Ga0209564_1000458 3300025295 Bacteria 68749
210 Ga0209564_1012997 3300025295 Bacteria 3574
211 Ga0209758_1000151 3300025297 Bacteria 162732
212 Ga0209758_1000398 3300025297 Bacteria 75220
213 Ga0209758_1000847 3300025297 Bacteria 42599
214 Ga0209758_1002658 3300025297 Bacteria 17685
215 Ga0209758_1002983 3300025297 Bacteria 16225
216 Ga0209050_1000278 3300025298 Bacteria 109088
217 Ga0209050_1009047 3300025298 Bacteria 5180
218 Ga0209256_1000511 3300025299 Bacteria 57006
219 Ga0209256_1006815 3300025299 Bacteria 5891
220 Ga0209256_1011158 3300025299 Bacteria 3634
221 Ga0209256_1015252 3300025299 Bacteria 2700
222 Ga0207426_1000005 3300025302 Bacteria 1037188
223 Ga0207426_1000147 3300025302 Bacteria 190586
224 Ga0207426_1006621 3300025302 Bacteria 4986
225 Ga0207426_1006660 3300025302 Bacteria 4965
226 Ga0209051_1000224 3300025303 Bacteria 95355
227 Ga0209051_1000687 3300025303 Bacteria 37475
228 Ga0209257_1002671 3300025304 Bacteria 17104
229 Ga0207688_10028434 3300025901 Bacteria 3075
230 Ga0207680_10261290 3300025903 Bacteria 1198
231 Ga0207647_10032231 3300025904 Bacteria 3369
232 Ga0207699_10013155 3300025906 Bacteria 4226
233 Ga0207645_10028267 3300025907 Bacteria 3621
234 Ga0207643_10002531 3300025908 Bacteria 9891
235 Ga0207643_10095072 3300025908 Bacteria 1741
236 Ga0207705_10072980 3300025909 Bacteria 2489
237 Ga0207684_10055707 3300025910 Bacteria 3354
238 Ga0207654_10344102 3300025911 Bacteria 1025
239 Ga0207707_10039857 3300025912 Bacteria 4104
240 Ga0207695_10000613 3300025913 Bacteria 71568
241 Ga0207671_10001160 3300025914 Bacteria 31428
242 Ga0207660_10006936 3300025917 Bacteria 7335
243 Ga0207662_10032593 3300025918 Bacteria 3034
244 Ga0207657_10037812 3300025919 Bacteria 4305
245 Ga0207649_10006970 3300025920 Bacteria 6141
246 Ga0207649_10089809 3300025920 Bacteria 2009
247 Ga0207652_10014958 3300025921 Bacteria 6294
248 Ga0207646_10372445 3300025922 Bacteria 1290
249 Ga0207681_10099406 3300025923 Bacteria 2095
250 Ga0207694_10016355 3300025924 Bacteria 5601
251 Ga0207694_10206879 3300025924 Bacteria 1598
252 Ga0207650_10004010 3300025925 Bacteria 10072
253 Ga0207659_10011026 3300025926 Bacteria 5696
254 Ga0207687_10019474 3300025927 Bacteria 4496
255 Ga0207687_10033088 3300025927 Bacteria 3505
256 Ga0207700_10035281 3300025928 Bacteria 3601
257 Ga0207644_10025410 3300025931 Bacteria 4073
258 Ga0207690_10018390 3300025932 Bacteria 4287
259 Ga0207706_10038508 3300025933 Bacteria 4241
260 Ga0207670_10009665 3300025936 Bacteria 5514
261 Ga0207691_10214464 3300025940 Bacteria 1671
262 Ga0207711_10117335 3300025941 Bacteria 2373
263 Ga0207689_10006061 3300025942 Bacteria 10693
264 Ga0207661_10003072 3300025944 Bacteria 11553
265 Ga0207661_10017218 3300025944 Bacteria 5345
266 Ga0207679_10012743 3300025945 Bacteria 5492
267 Ga0207651_10042876 3300025960 Bacteria 3015
268 Ga0207712_10246682 3300025961 Bacteria 1441
269 Ga0207668_10081749 3300025972 Bacteria 2345
270 Ga0207677_10133858 3300026023 Bacteria 1887
271 Ga0207677_10409375 3300026023 Bacteria 1152
272 Ga0207639_10221858 3300026041 Bacteria 1633
273 Ga0207678_10000416 3300026067 Bacteria 38515
274 Ga0207678_10036822 3300026067 Bacteria 4259
275 Ga0207708_10001936 3300026075 Bacteria 15258
276 Ga0207708_10008215 3300026075 Bacteria 7732
277 Ga0207708_10190012 3300026075 Bacteria 1634
278 Ga0207702_10005172 3300026078 Bacteria 11476
279 Ga0207702_10023386 3300026078 Bacteria 5124
280 Ga0207641_10013488 3300026088 Bacteria 6702
281 Ga0207676_10011074 3300026095 Bacteria 6435
282 Ga0207674_10007586 3300026116 Bacteria 12643
283 Ga0207674_10035497 3300026116 Bacteria 5203
284 Ga0207675_100064880 3300026118 Bacteria 3413
285 Ga0207683_10003598 3300026121 Bacteria 13507
286 Ga0209281_1002138 3300027111 Bacteria 8697
287 Ga0209371_1000174 3300027312 Bacteria 96051
288 Ga0209371_1000222 3300027312 Bacteria 75507
289 Ga0209813_10001911 3300027866 Bacteria 4696
290 Ga0207428_10017270 3300027907 Bacteria 6196
291 Ga0268266_10051972 3300028379 Bacteria 3518
292 Ga0268265_10117137 3300028380 Bacteria 2187
293 Ga0268264_10065203 3300028381 Bacteria 3068
294 Ga0265326_10004051 3300028558 Bacteria 4736
295 Ga0265334_10019009 3300028573 Bacteria 2830
296 Ga0265322_10001821 3300028654 Bacteria 6762
297 Ga0307515_10000130 3300028794 Bacteria 179263
298 Ga0307515_10022393 3300028794 Bacteria 11136
299 Ga0268256_1000028 3300030500 Bacteria 433179
300 Ga0268256_1003712 3300030500 Bacteria 6724
301 Ga0265327_10006474 3300031251 Bacteria 9354
302 Ga0265316_10024107 3300031344 Bacteria 5107
303 Ga0307513_10013508 3300031456 Bacteria 10020
304 Ga0307513_10068528 3300031456 Bacteria 3716
305 Ga0307508_10029301 3300031616 Bacteria 4976
306 Ga0307514_10040289 3300031649 Bacteria 3685
307 Ga0307406_10004162 3300031901 Bacteria 7878
308 Ga0307414_10145621 3300032004 Bacteria 1861
309 Ga0307415_100014853 3300032126 Bacteria 4593
310 Ga0307510_10141695 3300033180 Bacteria 2046
311 Ga0307510_10196034 3300033180 Bacteria 1561
312 Ga0373927_0001338 3300035695 Bacteria 18600
313 Ga0316584_0215676 3300036712 Bacteria 1412
314 Ga0373925_0001079 3300037068 Bacteria 24530
315 Ga0395900_0500824 3300037418 Bacteria 1165
316 Ga0395900_0680115 3300037418 Bacteria 964
317 Ga0395898_0020235 3300037466 Bacteria 6761
318 Ga0395898_0241149 3300037466 Bacteria 1724
319 Ga0395898_0364793 3300037466 Bacteria 1377
320 Ga0395905_0000663 3300037471 Bacteria 45751
321 Ga0395905_0001510 3300037471 Bacteria 27815
322 Ga0395905_0093060 3300037471 Bacteria 2827
323 Ga0395901_0238207 3300038443 Bacteria 1898
324 Ga0395901_0407709 3300038443 Bacteria 1396
325 Ga0400483_036442 3300039062 Bacteria 2241
326 Ga0400483_056151 3300039062 Bacteria 1674
327 Ga0400483_089304 3300039062 Bacteria 1649
328 Ga0400483_120435 3300039062 Bacteria 6382
329 Ga0400483_146044 3300039062 Bacteria 5564
330 Ga0400483_192659 3300039062 Bacteria 7312
331 Ga0400483_195580 3300039062 Bacteria 8615
332 Ga0400483_212948 3300039062 Bacteria 4840
333 Ga0400483_249541 3300039062 Bacteria 1765
334 Ga0451791_1287689 3300041451 Bacteria 1348
335 Ga0451807_0827308 3300041486 Bacteria 1016
336 Ga0451833_1420109 3300041491 Bacteria 907
337 Ga0451835_0478060 3300041492 Bacteria 2566
338 Ga0451839_0300679 3300041496 Bacteria 2373
339 Ga0451839_0662414 3300041496 Bacteria 1252
340 Ga0451841_0719137 3300041498 Bacteria 1471
341 Ga0451849_0546724 3300041505 Bacteria 1277
342 Ga0451851_0158030 3300041507 Bacteria 1772
343 Ga0451843_0422144 3300041509 Bacteria 1728
344 Ga0439448_0002687 3300042005 Bacteria 4857
345 Ga0439455_0023391 3300042012 Bacteria 1487
346 Ga0450902_008696 3300042137 Bacteria 1588
347 Ga0439458_0033809 3300042157 Bacteria 1225
348 Ga0466969_0013952 3300044656 Bacteria 4230
349 Ga0466966_0020412 3300044684 Bacteria 4356
350 Ga0466966_0179816 3300044684 Bacteria 1284
351 Ga0466963_0011432 3300044694 Bacteria 5406
352 Ga0466963_0184538 3300044694 Bacteria 1457
353 Ga0466964_0029921 3300044706 Bacteria 2153
354 Ga0466970_0001023 3300044765 Bacteria 13499
355 Ga0466970_0137425 3300044765 Bacteria 1345
356 Ga0466957_0078419 3300044842 Bacteria 2054
357 Ga0466957_0112681 3300044842 Bacteria 1726
358 Ga0466959_0004980 3300045049 Bacteria 9007
359 Ga0466959_0066626 3300045049 Bacteria 2612
360 Ga0451576_0000728 3300045051 Bacteria 66112
361 Ga0466958_0001498 3300045836 Bacteria 11165
362 Ga0466967_0008489 3300045976 Bacteria 7538
363 Ga0466967_0020180 3300045976 Bacteria 5378
364 Ga0466967_0056104 3300045976 Bacteria 3472
365 Ga0466967_0137853 3300045976 Bacteria 2270
366 Ga0495617_005101 3300046452 Bacteria 4694
367 Ga0495592_0115536 3300046454 Bacteria 1894
368 Ga0495603_0001084 3300046455 Bacteria 15790
369 Ga0495603_0009808 3300046455 Bacteria 5793
370 Ga0495603_0011999 3300046455 Bacteria 5244
371 Ga0495603_0125839 3300046455 Bacteria 1493
372 Ga0495629_0000969 3300046459 Bacteria 23133
373 Ga0495629_0005661 3300046459 Bacteria 9330
374 Ga0495629_0063156 3300046459 Bacteria 2586
375 Ga0495638_0221150 3300046460 Bacteria 1058
376 Ga0495580_0029036 3300046472 Bacteria 4017
377 Ga0495605_0007199 3300046474 Bacteria 6328
378 Ga0495605_0020213 3300046474 Bacteria 3541
379 Ga0495664_0089873 3300046477 Bacteria 1846
380 Ga0495585_0010652 3300046492 Bacteria 5463
381 Ga0495585_0014469 3300046492 Bacteria 4596
382 Ga0495594_0006953 3300046499 Bacteria 5819
383 Ga0495594_0046622 3300046499 Bacteria 2380
384 Ga0495594_0088487 3300046499 Bacteria 1734
385 Ga0495607_0010357 3300046501 Bacteria 6273
386 Ga0495607_0061799 3300046501 Bacteria 2127
387 Ga0495607_0069230 3300046501 Bacteria 1976
388 Ga0495583_0000957 3300046506 Bacteria 33535
389 Ga0495583_0049069 3300046506 Bacteria 1935
390 Ga0495583_0086514 3300046506 Bacteria 1355
391 Ga0495606_0000629 3300046507 Bacteria 55524
392 Ga0495606_0007570 3300046507 Bacteria 9674
393 Ga0495606_0018560 3300046507 Bacteria 5209
394 Ga0495608_0352884 3300046511 Bacteria 905
395 Ga0495610_0078468 3300046512 Bacteria 1522
396 Ga0495610_0113460 3300046512 Bacteria 1197
397 Ga0495616_0062694 3300046513 Bacteria 1819
398 Ga0495620_0032466 3300046515 Bacteria 2378
399 Ga0495620_0086981 3300046515 Bacteria 1257
400 Ga0495628_0142566 3300046516 Bacteria 1828
401 Ga0495631_0006341 3300046518 Bacteria 6116
402 Ga0495631_0008404 3300046518 Bacteria 5203
403 Ga0495631_0022726 3300046518 Bacteria 2915
404 Ga0495632_0149825 3300046519 Bacteria 1079
405 Ga0495643_0002781 3300046522 Bacteria 13374
406 Ga0495643_0007574 3300046522 Bacteria 6985
407 Ga0495640_0019978 3300046533 Bacteria 4938
408 Ga0495609_0016992 3300046538 Bacteria 3385
409 Ga0495597_0078407 3300046542 Bacteria 1415
410 Ga0495645_0369096 3300046543 Bacteria 921
411 Ga0495622_0002853 3300046557 Bacteria 8247
412 Ga0495633_0017216 3300046558 Bacteria 3703
413 Ga0495633_0068885 3300046558 Bacteria 1651
414 Ga0495668_0065114 3300046616 Bacteria 2006
415 Ga0495611_0020459 3300046648 Bacteria 2848
416 Ga0495611_0101322 3300046648 Bacteria 1337
417 Ga0495611_0118875 3300046648 Bacteria 1232
418 Ga0495625_0004033 3300046660 Bacteria 14035
419 Ga0495625_0040600 3300046660 Bacteria 3391
420 Ga0495625_0044687 3300046660 Bacteria 3205
421 Ga0495635_0008411 3300046663 Bacteria 7203
422 Ga0495661_0173043 3300046665 Bacteria 1150
423 Ga0495588_0012531 3300046674 Bacteria 4011
424 Ga0495623_0162739 3300046679 Bacteria 1310
425 Ga0495613_0003773 3300046689 Bacteria 11354
426 Ga0495613_0030790 3300046689 Bacteria 3985
427 Ga0495613_0071021 3300046689 Bacteria 2538
428 Ga0495624_0191909 3300046690 Bacteria 1242
429 Ga0495589_0009836 3300046794 Bacteria 4966
430 Ga0495589_0017999 3300046794 Bacteria 3625
431 Ga0495589_0034934 3300046794 Bacteria 2521
432 Ga0495660_0136064 3300046810 Bacteria 1227
433 Ga0495604_0050921 3300047317 Bacteria 3213
434 Ga0495636_0012997 3300047318 Bacteria 3300
435 Ga0495676_0001692 3300047321 Bacteria 19269
436 Ga0495676_0016892 3300047321 Bacteria 6461
437 Ga0495676_0023609 3300047321 Bacteria 5333
438 Ga0495676_0062232 3300047321 Bacteria 2914
439 Ga0495676_0143510 3300047321 Bacteria 1708
440 Ga0495680_0005861 3300047322 Bacteria 11494
441 Ga0495687_017921 3300047443 Bacteria 3514
442 Ga0495687_027715 3300047443 Bacteria 2647
443 Ga0495685_003784 3300047447 Bacteria 4845
444 Ga0495685_049462 3300047447 Bacteria 1428
445 Ga0495686_0027328 3300047472 Bacteria 3727
446 Ga0495593_0013554 3300047673 Bacteria 4647
447 Ga0495614_0000140 3300048089 Bacteria 25879
448 Ga0495614_0033185 3300048089 Bacteria 2220
449 Ga0495626_0039871 3300048091 Bacteria 2220
450 Ga0496101_0155207 3300048904 Bacteria 1753
451 Ga0496102_0028385 3300048905 Bacteria 4997
452 Ga0496103_0017891 3300048906 Bacteria 4247
453 Ga0496104_0013612 3300048907 Bacteria 7333
454 Ga0496104_0017153 3300048907 Bacteria 6586
455 Ga0496105_0019233 3300048908 Bacteria 5507
456 Ga0496105_0067328 3300048908 Bacteria 2957
457 Ga0496106_0013309 3300048909 Bacteria 6072
458 Ga0496109_0044452 3300048912 Bacteria 4029
459 Ga0496110_0029256 3300048913 Bacteria 4739
460 Ga0496111_0085558 3300048914 Bacteria 2305
461 Ga0496112_0127004 3300048915 Bacteria 2520
462 Ga0496113_0014458 3300048916 Bacteria 5385
463 Ga0496114_0077243 3300048917 Bacteria 2807
464 Ga0496116_0010532 3300048919 Bacteria 7733
465 Ga0496116_0049741 3300048919 Bacteria 2799
466 Ga0496116_0144546 3300048919 Bacteria 1331
467 Ga0496117_0000490 3300048920 Bacteria 65377
468 Ga0496117_0006361 3300048920 Bacteria 11999
469 Ga0496118_0001723 3300048921 Bacteria 31871
470 Ga0496118_0010730 3300048921 Bacteria 9032
471 Ga0496118_0032523 3300048921 Bacteria 4295
472 Ga0496119_0004038 3300048922 Bacteria 14823
473 Ga0496119_0021845 3300048922 Bacteria 4606
474 Ga0496120_0109519 3300048923 Bacteria 1445
475 Ga0496121_0000005 3300048924 Bacteria 1034486
476 Ga0496121_0064241 3300048924 Bacteria 2994
477 Ga0496121_0068655 3300048924 Bacteria 2866
478 Ga0496121_0315917 3300048924 Bacteria 1054
479 Ga0496122_0000713 3300048925 Bacteria 65631
480 Ga0496122_0000889 3300048925 Bacteria 55661
481 Ga0496122_0006813 3300048925 Bacteria 12965
482 Ga0496122_0021866 3300048925 Bacteria 5706
483 Ga0496123_0000530 3300048926 Bacteria 65631
484 Ga0496123_0001604 3300048926 Bacteria 30647
485 Ga0496123_0030341 3300048926 Bacteria 3959
486 Ga0496124_0000023 3300048927 Bacteria 415226
487 Ga0496124_0018647 3300048927 Bacteria 6492
488 Ga0496124_0020905 3300048927 Bacteria 6038
489 Ga0496124_0026422 3300048927 Bacteria 5234
490 Ga0496125_0000034 3300048928 Bacteria 348231
491 Ga0496125_0074187 3300048928 Bacteria 2639
492 Ga0496126_0040009 3300048929 Bacteria 4347
493 Ga0496126_0068197 3300048929 Bacteria 3176
494 Ga0495678_048866 3300049459 Bacteria 1647
495 Ga0495682_0089660 3300049460 Bacteria 1105
496 Ga0501033_0051998 3300049570 Bacteria 3036
497 Ga0501034_0314043 3300049571 Bacteria 1501
498 Ga0501036_0233797 3300049572 Bacteria 1542
499 Ga0501037_0034694 3300049573 Bacteria 3722
500 Ga0501037_0208391 3300049573 Bacteria 1379
501 Ga0501038_0176072 3300049574 Bacteria 1729
502 Ga0501040_0332878 3300049576 Bacteria 1087
503 Ga0501043_0111379 3300049579 Bacteria 2149
504 Ga0501047_0061127 3300049581 Bacteria 3635
505 Ga0501067_0154650 3300049583 Bacteria 1278
506 Ga0501070_0001012 3300049586 Bacteria 25214
507 Ga0501070_0070206 3300049586 Bacteria 2900
508 Ga0501073_0037477 3300049589 Bacteria 3443
509 Ga0501073_0284697 3300049589 Bacteria 1140
510 Ga0501080_0002221 3300049742 Bacteria 16875
511 Ga0501080_0038967 3300049742 Bacteria 4435
512 Ga0501080_0065598 3300049742 Bacteria 3377
513 Ga0501035_0001616 3300049822 Bacteria 22785
514 Ga0501035_0003264 3300049822 Bacteria 15543
515 Ga0501035_0229987 3300049822 Bacteria 1580
516 Ga0501044_0029725 3300049823 Bacteria 5761
517 Ga0501044_0334503 3300049823 Bacteria 1436
518 nmdc:mga03683_111860_c1 3300050489 Bacteria 1208
519 nmdc:mga03683_121977_c1 3300050489 Bacteria 1159
520 nmdc:mga03n38_138273_c1 3300050490 Bacteria 1214
521 nmdc:mga03n38_62682_c1 3300050490 Bacteria 1697
522 nmdc:mga00v17_203108_c1 3300050491 Bacteria 1281
523 nmdc:mga00v17_646_c1 3300050491 Bacteria 13371
524 nmdc:mga0yw44_238510_c1 3300050492 Bacteria 1208
525 nmdc:mga0yw44_3758_c1 3300050492 Bacteria 6805
526 nmdc:mga0yw44_94297_c1 3300050492 Bacteria 1897
527 nmdc:mga0k408_18904_c2 3300050493 Bacteria 3488
528 nmdc:mga0k408_23600_c1 3300050493 Bacteria 3472
529 nmdc:mga06z11_43556_c1 3300050494 Bacteria 2259
530 nmdc:mga06z11_805_c1 3300050494 Bacteria 11453
531 nmdc:mga07m45_21616_c1 3300050496 Bacteria 3505
532 nmdc:mga07m45_78130_c1 3300050496 Bacteria 1888
533 nmdc:mga05p37_150855_c1 3300050507 Bacteria 2843
534 nmdc:mga05p37_200365_c1 3300050507 Bacteria 2418
535 nmdc:mga05p37_754224_c1 3300050507 Bacteria 1072
536 nmdc:mga09592_139574_c1 3300050508 Bacteria 2088
537 nmdc:mga06r32_95386_c1 3300050510 Bacteria 2911
538 nmdc:mga08y16_15812_c1 3300050511 Bacteria 7934
539 nmdc:mga08y16_61313_c1 3300050511 Bacteria 3928
540 nmdc:mga0n895_16561_c1 3300050512 Bacteria 6769
541 nmdc:mga0rr50_251722_c1 3300050513 Bacteria 1467
542 nmdc:mga0rr50_30669_c1 3300050513 Bacteria 3810
543 nmdc:mga08x19_48419_c1 3300050514 Bacteria 2724
544 nmdc:mga0a205_4097_c1 3300050515 Bacteria 13041
545 nmdc:mga0sz30_13108_c1 3300050516 Bacteria 3239
546 Ga0500560_000280 3300053107 Bacteria 6426
547 Ga0500569_000732 3300053109 Bacteria 5719
548 Ga0500569_016177 3300053109 Bacteria 1884
549 Ga0500572_002453 3300053111 Bacteria 4460
550 Ga0500607_086890 3300053121 Bacteria 1582
551 Ga0500658_0001505 3300053134 Bacteria 9334
552 Ga0500559_0102027 3300053136 Bacteria 1322
553 Ga0500568_0000524 3300053139 Bacteria 28340
554 Ga0500604_0012916 3300053151 Bacteria 2260
555 Ga0500616_0007896 3300053153 Bacteria 6687
556 Ga0500622_0004526 3300053156 Bacteria 8683
557 Ga0500624_000670 3300053157 Bacteria 8829
558 Ga0500634_0000014 3300053161 Bacteria 114625
559 Ga0500634_0001933 3300053161 Bacteria 8434
560 Ga0500634_0014395 3300053161 Bacteria 4174
561 Ga0501084_0292848 3300054114 Bacteria 1375
562 Ga0587107_000520 3300059652 Bacteria 2570
563 Ga0501082_0286147 3300060353 Bacteria 1435
564 Ga0466962_0110345 3300061719 Bacteria 1324

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0176072 Ga0501038_0176072_621_1310 214
2 3300014969 Ga0157376_10444180 Ga0157376_104441802 215
3 3300050492 nmdc:mga0yw44_238510_c1 nmdc:mga0yw44_238510_c1_18_731 221
4 3300038443 Ga0395901_0407709 Ga0395901_0407709_589_1344 224
5 3300048923 Ga0496120_0109519 Ga0496120_0109519_664_1410 232
6 3300009766 Ga0123342_1005378 Ga0123342_100537814 243
7 3300009545 Ga0105237_10404796 Ga0105237_104047962 245
8 3300025911 Ga0207654_10344102 Ga0207654_103441022 245
9 3300047443 Ga0495687_027715 Ga0495687_027715_1031_1882 245
10 3300046512 Ga0495610_0113460 Ga0495610_0113460_152_1003 246
11 3300003322 rootL2_10314341 rootL2_103143412 247
12 3300053107 Ga0500560_000280 Ga0500560_000280_4325_5119 248
13 3300053157 Ga0500624_000670 Ga0500624_000670_525_1319 248
14 3300053161 Ga0500634_0014395 Ga0500634_0014395_946_1740 248
15 3300007076 Ga0075435_100408169 Ga0075435_1004081691 249
16 3300050513 nmdc:mga0rr50_251722_c1 nmdc:mga0rr50_251722_c1_85_1038 249
17 3300050514 nmdc:mga08x19_48419_c1 nmdc:mga08x19_48419_c1_714_1667 249
18 3300005471 Ga0070698_100001143 Ga0070698_1000011433 250
19 3300005518 Ga0070699_100141834 Ga0070699_1001418342 250
20 3300050496 nmdc:mga07m45_78130_c1 nmdc:mga07m45_78130_c1_1059_1859 250
21 3300003322 rootL2_10271270 rootL2_102712702 251
22 3300005445 Ga0070708_100010194 Ga0070708_1000101945 251
23 3300005536 Ga0070697_100168247 Ga0070697_1001682472 251
24 3300025910 Ga0207684_10055707 Ga0207684_100557072 251
25 3300025922 Ga0207646_10372445 Ga0207646_103724452 251
26 3300033180 Ga0307510_10141695 Ga0307510_101416952 251
27 3300041486 Ga0451807_0827308 Ga0451807_0827308_80_880 251
28 3300014325 Ga0163163_10791404 Ga0163163_107914041 252
29 3300037471 Ga0395905_0001510 Ga0395905_0001510_15641_16492 252
30 3300049572 Ga0501036_0233797 Ga0501036_0233797_132_980 252
31 3300049573 Ga0501037_0208391 Ga0501037_0208391_229_1077 252
32 3300049579 Ga0501043_0111379 Ga0501043_0111379_696_1544 252
33 3300049581 Ga0501047_0061127 Ga0501047_0061127_323_1171 252
34 3300049583 Ga0501067_0154650 Ga0501067_0154650_106_954 252
35 3300049586 Ga0501070_0070206 Ga0501070_0070206_484_1332 252
36 3300049589 Ga0501073_0284697 Ga0501073_0284697_143_991 252
37 3300049742 Ga0501080_0038967 Ga0501080_0038967_1468_2316 252
38 3300049822 Ga0501035_0003264 Ga0501035_0003264_613_1461 252
39 3300049822 Ga0501035_0229987 Ga0501035_0229987_37_885 252
40 3300049823 Ga0501044_0334503 Ga0501044_0334503_422_1270 252
41 3300060353 Ga0501082_0286147 Ga0501082_0286147_487_1335 252
42 3300031901 Ga0307406_10004162 Ga0307406_100041624 253
43 3300048919 Ga0496116_0010532 Ga0496116_0010532_4778_5629 253
44 3300048920 Ga0496117_0006361 Ga0496117_0006361_1638_2489 253
45 3300048921 Ga0496118_0010730 Ga0496118_0010730_3088_3939 253
46 3300048924 Ga0496121_0068655 Ga0496121_0068655_743_1594 253
47 3300048925 Ga0496122_0000889 Ga0496122_0000889_18782_19633 253
48 3300048926 Ga0496123_0030341 Ga0496123_0030341_1788_2639 253
49 3300048927 Ga0496124_0000023 Ga0496124_0000023_281033_281884 253
50 3300046460 Ga0495638_0221150 Ga0495638_0221150_188_1003 254
51 3300046511 Ga0495608_0352884 Ga0495608_0352884_68_883 254
52 3300046519 Ga0495632_0149825 Ga0495632_0149825_24_839 254
53 3300046665 Ga0495661_0173043 Ga0495661_0173043_265_1080 254
54 3300046690 Ga0495624_0191909 Ga0495624_0191909_405_1220 254
55 3300049460 Ga0495682_0089660 Ga0495682_0089660_237_1052 254
56 3300053161 Ga0500634_0000014 Ga0500634_0000014_93351_94202 254
57 3300003775 Ga0055524_1009862 Ga0055524_10098622 257
58 3300006038 Ga0075365_10000942 Ga0075365_100009422 257
59 3300009101 Ga0105247_10024836 Ga0105247_100248362 257
60 3300025273 Ga0209673_1001803 Ga0209673_10018032 257
61 3300025291 Ga0209675_1033537 Ga0209675_10335372 257
62 3300025295 Ga0209564_1000458 Ga0209564_100045870 257
63 3300025299 Ga0209256_1011158 Ga0209256_10111583 257
64 3300050492 nmdc:mga0yw44_94297_c1 nmdc:mga0yw44_94297_c1_911_1762 257
65 3300037418 Ga0395900_0500824 Ga0395900_0500824_302_1129 258
66 3300046543 Ga0495645_0369096 Ga0495645_0369096_61_891 259
67 3300046648 Ga0495611_0118875 Ga0495611_0118875_387_1217 259
68 iso_pu_bacteria 2871488783 2871494251 260
69 iso_pu_bacteria 2968003550 2968009334 260
70 iso_pu_bacteria 2818991472 2819745251 261
71 iso_pu_bacteria 2899275550 2899275643 261
72 3300036712 Ga0316584_0215676 Ga0316584_0215676_514_1359 262
73 3300039062 Ga0400483_036442 Ga0400483_036442_349_1197 262
74 3300039062 Ga0400483_056151 Ga0400483_056151_91_939 262
75 3300039062 Ga0400483_089304 Ga0400483_089304_602_1450 262
76 3300039062 Ga0400483_249541 Ga0400483_249541_189_1037 262
77 3300045051 Ga0451576_0000728 Ga0451576_0000728_38305_39150 262
78 iso_pu_bacteria 2508501122 2509111123 262
79 iso_pu_bacteria 2509276021 2509392261 262
80 iso_pu_bacteria 2509276033 2509446787 262
81 iso_pu_bacteria 2510065019 2510133731 262
82 iso_pu_bacteria 2510065057 2510304872 262
83 iso_pu_bacteria 2510461076 2510895162 262
84 iso_pu_bacteria 2510917022 2511135686 262
85 iso_pu_bacteria 2510917028 2511181341 262
86 iso_pu_bacteria 2510917030 2511199881 262
87 iso_pu_bacteria 2511231052 2511499246 262
88 iso_pu_bacteria 2512047086 2512530401 262
89 iso_pu_bacteria 2513237084 2513574024 262
90 iso_pu_bacteria 2513237085 2513576750 262
91 iso_pu_bacteria 2513237091 2513618671 262
92 iso_pu_bacteria 2513237093 2513629617 262
93 iso_pu_bacteria 2513237103 2513708268 262
94 iso_pu_bacteria 2513237138 2513869804 262
95 iso_pu_bacteria 2513237140 2513883262 262
96 iso_pu_bacteria 2513237143 2513902714 262
97 iso_pu_bacteria 2513237144 2513911691 262
98 iso_pu_bacteria 2513237162 2514020216 262
99 iso_pu_bacteria 2515075009 2515112766 262
100 iso_pu_bacteria 2515154113 2515634076 262
101 iso_pu_bacteria 2515154114 2515640743 262
102 iso_pu_bacteria 2515154116 2515655566 262
103 iso_pu_bacteria 2515154134 2515744048 262
104 iso_pu_bacteria 2516143018 2516205079 262
105 iso_pu_bacteria 2516653046 2516897985 262
106 iso_pu_bacteria 2516653077 2517036483 262
107 iso_pu_bacteria 2516653085 2517076872 262
108 iso_pu_bacteria 2517093000 2517095617 262
109 iso_pu_bacteria 2517287029 2517407188 262
110 iso_pu_bacteria 2519899620 2520381582 262
111 iso_pu_bacteria 2523231067 2523468490 262
112 iso_pu_bacteria 2524023207 2524452272 262
113 iso_pu_bacteria 2524023209 2524457484 262
114 iso_pu_bacteria 2529292951 2530646206 262
115 iso_pu_bacteria 2551306089 2551715667 262
116 iso_pu_bacteria 2551306091 2551729307 262
117 iso_pu_bacteria 2582581298 2585227354 262
118 iso_pu_bacteria 2582581299 2585229475 262
119 iso_pu_bacteria 2582581306 2585265235 262
120 iso_pu_bacteria 2582581307 2585272761 262
121 iso_pu_bacteria 2582581308 2585281262 262
122 iso_pu_bacteria 2582581315 2585327370 262
123 iso_pu_bacteria 2582581865 2585385631 262
124 iso_pu_bacteria 2582581866 2585395063 262
125 iso_pu_bacteria 2582581867 2585404423 262
126 iso_pu_bacteria 2585427526 2585527248 262
127 iso_pu_bacteria 2585427527 2585536077 262
128 iso_pu_bacteria 2585427528 2585537979 262
129 iso_pu_bacteria 2585427529 2585550768 262
130 iso_pu_bacteria 2585427530 2585557388 262
131 iso_pu_bacteria 2585427531 2585562429 262
132 iso_pu_bacteria 2585427590 2585824741 262
133 iso_pu_bacteria 2585427593 2585835927 262
134 iso_pu_bacteria 2585427594 2585846094 262
135 iso_pu_bacteria 2585427608 2585896877 262
136 iso_pu_bacteria 2585427609 2585906404 262
137 iso_pu_bacteria 2585428062 2587758567 262
138 iso_pu_bacteria 2585428125 2587981826 262
139 iso_pu_bacteria 2599185156 2599336226 262
140 iso_pu_bacteria 2615840624 2616297973 262
141 iso_pu_bacteria 2615840626 2616310936 262
142 iso_pu_bacteria 2615840698 2616555617 262
143 iso_pu_bacteria 2617270742 2617385554 262
144 iso_pu_bacteria 2643221591 2643965447 262
145 iso_pu_bacteria 2643221599 2644005432 262
146 iso_pu_bacteria 2643221644 2644245895 262
147 iso_pu_bacteria 2643221698 2644542304 262
148 iso_pu_bacteria 2667528174 2671114395 262
149 iso_pu_bacteria 2690316117 2692318002 262
150 iso_pu_bacteria 2718217882 2719181607 262
151 iso_pu_bacteria 2718217927 2719386136 262
152 iso_pu_bacteria 2718217997 2719665951 262
153 iso_pu_bacteria 2718218009 2719732271 262
154 iso_pu_bacteria 2718218199 2720492371 262
155 iso_pu_bacteria 2718218232 2720613723 262
156 iso_pu_bacteria 2718218233 2720620513 262
157 iso_pu_bacteria 2718218235 2720631933 262
158 iso_pu_bacteria 2718218269 2720775661 262
159 iso_pu_bacteria 2718218363 2721147699 262
160 iso_pu_bacteria 2718218365 2721159149 262
161 iso_pu_bacteria 2718218366 2721164534 262
162 iso_pu_bacteria 2718218423 2721399918 262
163 iso_pu_bacteria 2721755514 2722840704 262
164 iso_pu_bacteria 2721755556 2723027271 262
165 iso_pu_bacteria 2721755684 2723560887 262
166 iso_pu_bacteria 2721755685 2723567480 262
167 iso_pu_bacteria 2721755809 2724038731 262
168 iso_pu_bacteria 2721755810 2724045027 262
169 iso_pu_bacteria 2721755819 2724090268 262
170 iso_pu_bacteria 2721755822 2724104745 262
171 iso_pu_bacteria 2721755823 2724110552 262
172 iso_pu_bacteria 2724679232 2725949985 262
173 iso_pu_bacteria 2728369352 2730108207 262
174 iso_pu_bacteria 2728369365 2730164842 262
175 iso_pu_bacteria 2728369397 2730298781 262
176 iso_pu_bacteria 2738541333 2739032638 262
177 iso_pu_bacteria 2738543031 2739348292 262
178 iso_pu_bacteria 2765235942 2766066671 262
179 iso_pu_bacteria 2775507266 2778176614 262
180 iso_pu_bacteria 2791355256 2793298772 262
181 iso_pu_bacteria 2791355259 2793318836 262
182 iso_pu_bacteria 2791355261 2793331888 262
183 iso_pu_bacteria 2791355262 2793337619 262
184 iso_pu_bacteria 2791355263 2793344331 262
185 iso_pu_bacteria 2791355264 2793351063 262
186 iso_pu_bacteria 2791355266 2793363884 262
187 iso_pu_bacteria 2791355267 2793367143 262
188 iso_pu_bacteria 2802429605 2805932092 262
189 iso_pu_bacteria 2802429606 2805935963 262
190 iso_pu_bacteria 2802429633 2806043617 262
191 iso_pu_bacteria 2802429634 2806050452 262
192 iso_pu_bacteria 2802429635 2806057269 262
193 iso_pu_bacteria 2802429636 2806064648 262
194 iso_pu_bacteria 2802429637 2806071915 262
195 iso_pu_bacteria 2808606387 2808990071 262
196 iso_pu_bacteria 2818991448 2819610181 262
197 iso_pu_bacteria 2818991453 2819643947 262
198 iso_pu_bacteria 2838016132 2838017861 262
199 iso_pu_bacteria 2838022645 2838028711 262
200 iso_pu_bacteria 2838029111 2838030484 262
201 iso_pu_bacteria 2838042994 2838043778 262
202 iso_pu_bacteria 2838048938 2838051841 262
203 iso_pu_bacteria 2838061910 2838066265 262
204 iso_pu_bacteria 2838068647 2838074508 262
205 iso_pu_bacteria 2838668709 2838674219 262
206 iso_pu_bacteria 2838686498 2838687250 262
207 iso_pu_bacteria 2838701080 2838706535 262
208 iso_pu_bacteria 2838729681 2838729778 262
209 iso_pu_bacteria 2838742623 2838743207 262
210 iso_pu_bacteria 2841851746 2841852693 262
211 iso_pu_bacteria 2841864319 2841869997 262
212 iso_pu_bacteria 2842110456 2842114758 262
213 iso_pu_bacteria 2842146304 2842151270 262
214 iso_pu_bacteria 2842156927 2842156952 262
215 iso_pu_bacteria 2842163707 2842167609 262
216 iso_pu_bacteria 2842180545 2842181465 262
217 iso_pu_bacteria 2842192696 2842198770 262
218 iso_pu_bacteria 2842198810 2842204939 262
219 iso_pu_bacteria 2842205361 2842205695 262
220 iso_pu_bacteria 2842217011 2842217708 262
221 iso_pu_bacteria 2842229732 2842230483 262
222 iso_pu_bacteria 2842243621 2842244385 262
223 iso_pu_bacteria 2842250916 2842256413 262
224 iso_pu_bacteria 2842257432 2842257529 262
225 iso_pu_bacteria 2842264693 2842265694 262
226 iso_pu_bacteria 2842271015 2842271212 262
227 iso_pu_bacteria 2842278818 2842279152 262
228 iso_pu_bacteria 2842285085 2842285805 262
229 iso_pu_bacteria 2842298080 2842298958 262
230 iso_pu_bacteria 2842304105 2842304837 262
231 iso_pu_bacteria 2842311132 2842316630 262
232 iso_pu_bacteria 2842317721 2842320493 262
233 iso_pu_bacteria 2842341865 2842348620 262
234 iso_pu_bacteria 2842357229 2842358423 262
235 iso_pu_bacteria 2842363717 2842369768 262
236 iso_pu_bacteria 2842395702 2842401402 262
237 iso_pu_bacteria 2842402390 2842403165 262
238 iso_pu_bacteria 2842409023 2842409462 262
239 iso_pu_bacteria 2842415677 2842416115 262
240 iso_pu_bacteria 2842422224 2842428239 262
241 iso_pu_bacteria 2842428310 2842429669 262
242 iso_pu_bacteria 2842434925 2842436282 262
243 iso_pu_bacteria 2842441272 2842442629 262
244 iso_pu_bacteria 2842447887 2842452984 262
245 iso_pu_bacteria 2842462802 2842464090 262
246 iso_pu_bacteria 2842469257 2842470611 262
247 iso_pu_bacteria 2842475841 2842477235 262
248 iso_pu_bacteria 2842489311 2842490363 262
249 iso_pu_bacteria 2842495871 2842497043 262
250 iso_pu_bacteria 2842502639 2842504032 262
251 iso_pu_bacteria 2842509118 2842513664 262
252 iso_pu_bacteria 2844454524 2844458616 262
253 iso_pu_bacteria 2847417321 2847423495 262
254 iso_pu_bacteria 2847670302 2847670318 262
255 iso_pu_bacteria 2847686936 2847691987 262
256 iso_pu_bacteria 2852387548 2852395161 262
257 iso_pu_bacteria 2854911287 2854915964 262
258 iso_pu_bacteria 2855839649 2855844879 262
259 iso_pu_bacteria 2856314179 2856320214 262
260 iso_pu_bacteria 2857349434 2857357323 262
261 iso_pu_bacteria 2857516855 2857517649 262
262 iso_pu_bacteria 2858800743 2858804763 262
263 iso_pu_bacteria 2871444079 2871444281 262
264 iso_pu_bacteria 2874102143 2874102484 262
265 iso_pu_bacteria 2876392853 2876399837 262
266 iso_pu_bacteria 2878035449 2878042522 262
267 iso_pu_bacteria 2878753008 2878759086 262
268 iso_pu_bacteria 2881845957 2881848793 262
269 iso_pu_bacteria 2881861095 2881865300 262
270 iso_pu_bacteria 2882912400 2882912769 262
271 iso_pu_bacteria 2885318864 2885320131 262
272 iso_pu_bacteria 2885342637 2885344669 262
273 iso_pu_bacteria 2903492973 2903503673 262
274 iso_pu_bacteria 2904659560 2904666360 262
275 iso_pu_bacteria 2906328253 2906330278 262
276 iso_pu_bacteria 2906414383 2906421007 262
277 iso_pu_bacteria 2915986958 2915987229 262
278 iso_pu_bacteria 2916000859 2916004302 262
279 iso_pu_bacteria 2916021584 2916025544 262
280 iso_pu_bacteria 2916028427 2916032401 262
281 iso_pu_bacteria 2916041962 2916047461 262
282 iso_pu_bacteria 2916048683 2916049470 262
283 iso_pu_bacteria 2916055098 2916056443 262
284 iso_pu_bacteria 2916076590 2916076709 262
285 iso_pu_bacteria 2919100787 2919108225 262
286 iso_pu_bacteria 2919408235 2919412274 262
287 iso_pu_bacteria 2921201388 2921204487 262
288 iso_pu_bacteria 2921208531 2921208535 262
289 iso_pu_bacteria 2921244191 2921248154 262
290 iso_pu_bacteria 2921257292 2921262873 262
291 iso_pu_bacteria 2921263974 2921265472 262
292 iso_pu_bacteria 2921282425 2921285732 262
293 iso_pu_bacteria 2922158528 2922165253 262
294 iso_pu_bacteria 2923556063 2923559865 262
295 iso_pu_bacteria 2924144063 2924145217 262
296 iso_pu_bacteria 2924172951 2924173989 262
297 iso_pu_bacteria 2924179722 2924181767 262
298 iso_pu_bacteria 2924193448 2924195592 262
299 iso_pu_bacteria 2924200457 2924201918 262
300 iso_pu_bacteria 2924207177 2924208559 262
301 iso_pu_bacteria 2924228884 2924231011 262
302 iso_pu_bacteria 2924726620 2924727526 262
303 iso_pu_bacteria 2924784321 2924789291 262
304 iso_pu_bacteria 2929138655 2929142624 262
305 iso_pu_bacteria 2933570622 2933570646 262
306 iso_pu_bacteria 2933586486 2933591131 262
307 iso_pu_bacteria 2933599457 2933604964 262
308 iso_pu_bacteria 2935901341 2935902157 262
309 iso_pu_bacteria 2936367885 2936372265 262
310 iso_pu_bacteria 2936375103 2936380929 262
311 iso_pu_bacteria 2936381700 2936386765 262
312 iso_pu_bacteria 2937009748 2937012005 262
313 iso_pu_bacteria 2937023124 2937027861 262
314 iso_pu_bacteria 2937042894 2937044230 262
315 iso_pu_bacteria 2937063883 2937065254 262
316 iso_pu_bacteria 2937071275 2937075572 262
317 iso_pu_bacteria 2937106411 2937106893 262
318 iso_pu_bacteria 2937113482 2937113860 262
319 iso_pu_bacteria 2937119839 2937121334 262
320 iso_pu_bacteria 2937126314 2937126358 262
321 iso_pu_bacteria 2937891427 2937893897 262
322 iso_pu_bacteria 2957382221 2957383964 262
323 iso_pu_bacteria 2957388812 2957391007 262
324 iso_pu_bacteria 2957395598 2957401001 262
325 iso_pu_bacteria 2957402308 2957405305 262
326 iso_pu_bacteria 2957408893 2957412651 262
327 iso_pu_bacteria 2957415311 2957415816 262
328 iso_pu_bacteria 2957443900 2957448200 262
329 iso_pu_bacteria 2957450854 2957453438 262
330 iso_pu_bacteria 2957457609 2957462391 262
331 iso_pu_bacteria 2957464669 2957468545 262
332 iso_pu_bacteria 2957478035 2957478040 262
333 iso_pu_bacteria 2957491536 2957493466 262
334 iso_pu_bacteria 2958115193 2958118193 262
335 iso_pu_bacteria 2960584000 2960588167 262
336 iso_pu_bacteria 2960597568 2960599035 262
337 iso_pu_bacteria 2960603979 2960606157 262
338 iso_pu_bacteria 2960610863 2960611452 262
339 iso_pu_bacteria 2960617483 2960620606 262
340 iso_pu_bacteria 2960637947 2960642986 262
341 iso_pu_bacteria 2960660292 2960665915 262
342 iso_pu_bacteria 2960667422 2960673685 262
343 iso_pu_bacteria 2960674078 2960680038 262
344 iso_pu_bacteria 2960687367 2960691175 262
345 iso_pu_bacteria 2961114664 2961114830 262
346 iso_pu_bacteria 2961170736 2961175742 262
347 iso_pu_bacteria 2964615318 2964621017 262
348 iso_pu_bacteria 2964621998 2964625764 262
349 iso_pu_bacteria 2964636051 2964640027 262
350 iso_pu_bacteria 2964663802 2964664618 262
351 iso_pu_bacteria 2964670856 2964676397 262
352 iso_pu_bacteria 2964685014 2964688644 262
353 iso_pu_bacteria 2964691889 2964694524 262
354 iso_pu_bacteria 2964698721 2964701028 262
355 iso_pu_bacteria 2964705432 2964705476 262
356 iso_pu_bacteria 2964712639 2964718324 262
357 iso_pu_bacteria 2964719344 2964726394 262
358 iso_pu_bacteria 2967664464 2967667908 262
359 iso_pu_bacteria 2967693043 2967693964 262
360 iso_pu_bacteria 2967699805 2967701492 262
361 iso_pu_bacteria 2967735183 2967737998 262
362 iso_pu_bacteria 2967748971 2967751279 262
363 iso_pu_bacteria 2967755722 2967762318 262
364 iso_pu_bacteria 2967769361 2967773689 262
365 iso_pu_bacteria 2967775926 2967776512 262
366 iso_pu_bacteria 2967996073 2968001722 262
367 iso_pu_bacteria 2968091066 2968092098 262
368 iso_pu_bacteria 2968097103 2968098599 262
369 iso_pu_bacteria 2968110612 2968117859 262
370 iso_pu_bacteria 2970033650 2970036543 262
371 iso_pu_bacteria 2970068827 2970072167 262
372 iso_pu_bacteria 2970076120 2970079978 262
373 iso_pu_bacteria 2970082768 2970085573 262
374 iso_pu_bacteria 2970095765 2970098115 262
375 iso_pu_bacteria 2970102677 2970107620 262
376 iso_pu_bacteria 2970129317 2970130739 262
377 iso_pu_bacteria 2970156795 2970157453 262
378 iso_pu_bacteria 2970164137 2970164173 262
379 iso_pu_bacteria 2970177841 2970180753 262
380 iso_pu_bacteria 2970503327 2970508407 262
381 iso_pu_bacteria 2977516862 2977518690 262
382 iso_pu_bacteria 2977523885 2977529672 262
383 iso_pu_bacteria 2977558990 2977562473 262
384 iso_pu_bacteria 2977565890 2977571132 262
385 iso_pu_bacteria 2977821940 2977827626 262
386 iso_pu_bacteria 2977828996 2977830644 262
387 iso_pu_bacteria 2977858184 2977863818 262
388 iso_pu_bacteria 2977864932 2977871466 262
389 iso_pu_bacteria 2977864932 2977872628 262
390 iso_pu_bacteria 2977942078 2977949335 262
391 iso_pu_bacteria 2979779861 2979781021 262
392 iso_pu_bacteria 2979808191 2979811944 262
393 iso_pu_bacteria 2987636660 2987644713 262
394 iso_pu_bacteria 2996341866 2996348769 262
395 iso_pu_bacteria 2996887358 2996888520 262
396 iso_pu_bacteria 2996893221 2996898637 262
397 iso_pu_bacteria 3000135777 3000140377 262
398 iso_pu_bacteria 3004203850 3004210826 262
399 iso_pu_bacteria 3005416602 3005416670 262
400 iso_pu_bacteria 639633055 639648981 262
401 iso_pu_bacteria 648276728 648736339 262
402 iso_pu_bacteria 8003992118 8003997423 262
403 iso_pu_bacteria 8004374579 8004380607 262
404 iso_pu_bacteria 8004445564 8004446864 262
405 iso_pu_bacteria 8004703790 8004709096 262
406 iso_pu_bacteria 8005258706 8005264539 262
407 iso_pu_bacteria 8005275841 8005280922 262
408 iso_pu_bacteria 8005282627 8005285199 262
409 iso_pu_bacteria 8005289223 8005293425 262
410 iso_pu_bacteria 8005301065 8005302906 262
411 iso_pu_bacteria 8005307578 8005312630 262
412 iso_pu_bacteria 8005314921 8005320687 262
413 iso_pu_bacteria 8005321885 8005323047 262
414 iso_pu_bacteria 8005376324 8005379653 262
415 iso_pu_bacteria 8005382845 8005386337 262
416 iso_pu_bacteria 8005395548 8005396337 262
417 iso_pu_bacteria 8005430974 8005434945 262
418 iso_pu_bacteria 8005460587 8005463438 262
419 iso_pu_bacteria 8005484373 8005487596 262
420 iso_pu_bacteria 8005497431 8005500682 262
421 iso_pu_bacteria 8005556819 8005557238 262
422 iso_pu_bacteria 8005563573 8005567625 262
423 iso_pu_bacteria 8005570704 8005574704 262
424 iso_pu_bacteria 8005619151 8005622060 262
425 iso_pu_bacteria 8005626139 8005632463 262
426 iso_pu_bacteria 8005645114 8005647954 262
427 iso_pu_bacteria 8005668836 8005672101 262
428 iso_pu_bacteria 8005682033 8005686011 262
429 iso_pu_bacteria 8005688590 8005692326 262
430 iso_pu_bacteria 8005695170 8005696478 262
431 iso_pu_bacteria 8018127388 8018133875 262
432 iso_pu_bacteria 8018163183 8018166318 262
433 iso_pu_bacteria 8018176218 8018181524 262
434 iso_pu_bacteria 8023680758 8023683370 262
435 iso_pu_bacteria 8024479707 8024483084 262
436 iso_pu_bacteria 8024486573 8024491087 262
437 iso_pu_bacteria 8024501048 8024503855 262
438 iso_pu_bacteria 8046767195 8046769083 262
439 iso_pu_bacteria 8056375014 8056378801 262
440 iso_pu_bacteria 8057575449 8057576444 262
441 iso_pu_bacteria 8057874678 8057878780 262
442 3300001979 JGI24740J21852_10000485 JGI24740J21852_1000048512 263
443 3300002704 JGI25155J39150_1000034 JGI25155J39150_100003449 263
444 3300002705 JGI25156J39149_1000008 JGI25156J39149_1000008181 263
445 3300002737 JGI25162J39368_1000074 JGI25162J39368_1000074112 263
446 3300002738 JGI25154J39366_1000063 JGI25154J39366_100006349 263
447 3300002741 JGI25157J39369_1000062 JGI25157J39369_100006258 263
448 3300002773 JGI25152J39213_1001055 JGI25152J39213_100105510 263
449 3300002773 JGI25152J39213_1001109 JGI25152J39213_10011093 263
450 3300002773 JGI25152J39213_1014996 JGI25152J39213_10149962 263
451 3300002774 JGI25150J39212_1001160 JGI25150J39212_10011604 263
452 3300002987 JGI25159J45721_1000787 JGI25159J45721_100078719 263
453 3300003187 JGI25151J46595_10000306 JGI25151J46595_100003062 263
454 3300003187 JGI25151J46595_10001290 JGI25151J46595_100012905 263
455 3300003214 JGI25165J46597_1000201 JGI25165J46597_10002015 263
456 3300003215 JGI25153J46596_10000693 JGI25153J46596_1000069314 263
457 3300003215 JGI25153J46596_10005249 JGI25153J46596_100052496 263
458 3300003215 JGI25153J46596_10006734 JGI25153J46596_100067344 263
459 3300003316 rootH1_10010012 rootH1_100100122 263
460 3300003320 rootH2_10045083 rootH2_1004508315 263
461 3300003322 rootL2_10001175 rootL2_100011758 263
462 3300003323 rootH1_10113604 rootH1_101136045 263
463 3300003323 rootH1_10270503 rootH1_102705033 263
464 3300003354 JGI25160J50197_1002241 JGI25160J50197_10022418 263
465 3300003354 JGI25160J50197_1006870 JGI25160J50197_10068703 263
466 3300003374 JGI25161J50226_1000084 JGI25161J50226_100008463 263
467 3300003771 Ga0055526_1003954 Ga0055526_10039544 263
468 3300003771 Ga0055526_1008917 Ga0055526_10089172 263
469 3300003775 Ga0055524_1003157 Ga0055524_10031574 263
470 3300003775 Ga0055524_1049203 Ga0055524_10492031 263
471 3300003790 Ga0055528_1000168 Ga0055528_100016832 263
472 3300003790 Ga0055528_1007067 Ga0055528_10070673 263
473 3300003790 Ga0055528_1010970 Ga0055528_10109704 263
474 3300003790 Ga0055528_1026867 Ga0055528_10268671 263
475 3300003792 Ga0055540_1000109 Ga0055540_100010949 263
476 3300003856 Ga0058692_1005828 Ga0058692_10058283 263
477 3300004625 Ga0055543_1000017 Ga0055543_1000017157 263
478 3300004625 Ga0055543_1000652 Ga0055543_100065217 263
479 3300005262 Ga0065165_1008542 Ga0065165_10085423 263
480 3300005262 Ga0065165_1009458 Ga0065165_10094583 263
481 3300005289 Ga0065704_10132899 Ga0065704_101328992 263
482 3300005356 Ga0070674_100656192 Ga0070674_1006561921 263
483 3300005441 Ga0070700_100336132 Ga0070700_1003361321 263
484 3300005548 Ga0070665_100441317 Ga0070665_1004413172 263
485 3300005578 Ga0068854_100247058 Ga0068854_1002470582 263
486 3300005614 Ga0068856_100014297 Ga0068856_1000142973 263
487 3300006038 Ga0075365_10006367 Ga0075365_100063677 263
488 3300006038 Ga0075365_10043661 Ga0075365_100436612 263
489 3300006042 Ga0075368_10016224 Ga0075368_100162241 263
490 3300006048 Ga0075363_100035976 Ga0075363_1000359762 263
491 3300006051 Ga0075364_10004665 Ga0075364_100046654 263
492 3300006051 Ga0075364_10083456 Ga0075364_100834562 263
493 3300006177 Ga0075362_10125770 Ga0075362_101257701 263
494 3300006178 Ga0075367_10033316 Ga0075367_100333162 263
495 3300006186 Ga0075369_10025582 Ga0075369_100255822 263
496 3300006186 Ga0075369_10031780 Ga0075369_100317803 263
497 3300006186 Ga0075369_10049829 Ga0075369_100498292 263
498 3300006195 Ga0075366_10014399 Ga0075366_100143993 263
499 3300006195 Ga0075366_10017101 Ga0075366_100171014 263
500 3300006195 Ga0075366_10048178 Ga0075366_100481781 263
501 3300006353 Ga0075370_10005366 Ga0075370_100053661 263
502 3300009093 Ga0105240_10000217 Ga0105240_1000021789 263
503 3300009148 Ga0105243_10520590 Ga0105243_105205902 263
504 3300009545 Ga0105237_10001458 Ga0105237_100014583 263
505 3300009551 Ga0105238_10212409 Ga0105238_102124092 263
506 3300009765 Ga0123341_1000072 Ga0123341_100007212 263
507 3300010375 Ga0105239_10001164 Ga0105239_1000116427 263
508 3300010375 Ga0105239_10135254 Ga0105239_101352543 263
509 3300013100 Ga0157373_10058924 Ga0157373_100589243 263
510 3300013104 Ga0157370_10000768 Ga0157370_1000076815 263
511 3300013306 Ga0163162_10638523 Ga0163162_106385232 263
512 3300015262 Ga0182007_10004351 Ga0182007_100043512 263
513 3300015265 Ga0182005_1019519 Ga0182005_10195192 263
514 3300025206 Ga0209435_100020 Ga0209435_100020171 263
515 3300025208 Ga0209436_100012 Ga0209436_10001285 263
516 3300025228 Ga0209672_107087 Ga0209672_1070872 263
517 3300025233 Ga0209437_100067 Ga0209437_10006710 263
518 3300025245 Ga0207425_1000316 Ga0207425_100031612 263
519 3300025245 Ga0207425_1008705 Ga0207425_10087052 263
520 3300025246 Ga0209646_1000070 Ga0209646_1000070171 263
521 3300025246 Ga0209646_1009041 Ga0209646_10090412 263
522 3300025246 Ga0209646_1015218 Ga0209646_10152182 263
523 3300025250 Ga0209026_1000057 Ga0209026_100005750 263
524 3300025253 Ga0209677_100295 Ga0209677_10029518 263
525 3300025256 Ga0209759_1000047 Ga0209759_100004750 263
526 3300025258 Ga0209129_1000235 Ga0209129_100023515 263
527 3300025258 Ga0209129_1000268 Ga0209129_100026813 263
528 3300025258 Ga0209129_1001842 Ga0209129_10018424 263
529 3300025261 Ga0209233_1000088 Ga0209233_100008810 263
530 3300025261 Ga0209233_1000288 Ga0209233_100028840 263
531 3300025273 Ga0209673_1000444 Ga0209673_100044443 263
532 3300025273 Ga0209673_1001878 Ga0209673_100187812 263
533 3300025273 Ga0209673_1003837 Ga0209673_10038374 263
534 3300025273 Ga0209673_1005954 Ga0209673_10059543 263
535 3300025284 Ga0209130_1000022 Ga0209130_1000022183 263
536 3300025294 Ga0209025_1000058 Ga0209025_1000058135 263
537 3300025294 Ga0209025_1000609 Ga0209025_100060960 263
538 3300025294 Ga0209025_1005676 Ga0209025_10056763 263
539 3300025294 Ga0209025_1011931 Ga0209025_10119313 263
540 3300025294 Ga0209025_1046804 Ga0209025_10468042 263
541 3300025295 Ga0209564_1000167 Ga0209564_100016731 263
542 3300025295 Ga0209564_1012997 Ga0209564_10129972 263
543 3300025297 Ga0209758_1000151 Ga0209758_1000151169 263
544 3300025297 Ga0209758_1000398 Ga0209758_100039815 263
545 3300025297 Ga0209758_1000847 Ga0209758_100084711 263
546 3300025297 Ga0209758_1002658 Ga0209758_10026587 263
547 3300025297 Ga0209758_1002983 Ga0209758_10029833 263
548 3300025298 Ga0209050_1000278 Ga0209050_100027865 263
549 3300025298 Ga0209050_1009047 Ga0209050_10090472 263
550 3300025299 Ga0209256_1000511 Ga0209256_100051131 263
551 3300025299 Ga0209256_1006815 Ga0209256_10068154 263
552 3300025299 Ga0209256_1015252 Ga0209256_10152524 263
553 3300025302 Ga0207426_1000005 Ga0207426_100000563 263
554 3300025302 Ga0207426_1000147 Ga0207426_100014761 263
555 3300025303 Ga0209051_1000224 Ga0209051_100022448 263
556 3300025303 Ga0209051_1000687 Ga0209051_10006873 263
557 3300025304 Ga0209257_1002671 Ga0209257_100267110 263
558 3300025913 Ga0207695_10000613 Ga0207695_1000061324 263
559 3300025914 Ga0207671_10001160 Ga0207671_1000116027 263
560 3300025924 Ga0207694_10206879 Ga0207694_102068792 263
561 3300026075 Ga0207708_10190012 Ga0207708_101900122 263
562 3300026078 Ga0207702_10005172 Ga0207702_100051728 263
563 3300027111 Ga0209281_1002138 Ga0209281_10021383 263
564 3300027312 Ga0209371_1000174 Ga0209371_100017424 263
565 3300027312 Ga0209371_1000222 Ga0209371_10002224 263
566 3300028794 Ga0307515_10000130 Ga0307515_1000013040 263
567 3300028794 Ga0307515_10022393 Ga0307515_1002239311 263
568 3300030500 Ga0268256_1000028 Ga0268256_100002897 263
569 3300030500 Ga0268256_1003712 Ga0268256_10037125 263
570 3300031251 Ga0265327_10006474 Ga0265327_100064743 263
571 3300031456 Ga0307513_10013508 Ga0307513_100135086 263
572 3300031456 Ga0307513_10068528 Ga0307513_100685283 263
573 3300032004 Ga0307414_10145621 Ga0307414_101456212 263
574 3300033180 Ga0307510_10196034 Ga0307510_101960342 263
575 3300035695 Ga0373927_0001338 Ga0373927_0001338_7969_8820 263
576 3300037068 Ga0373925_0001079 Ga0373925_0001079_19483_20334 263
577 3300037418 Ga0395900_0680115 Ga0395900_0680115_58_909 263
578 3300037471 Ga0395905_0000663 Ga0395905_0000663_12270_13121 263
579 3300039062 Ga0400483_120435 Ga0400483_120435_1652_2503 263
580 3300039062 Ga0400483_146044 Ga0400483_146044_1901_2752 263
581 3300039062 Ga0400483_192659 Ga0400483_192659_3305_4156 263
582 3300039062 Ga0400483_195580 Ga0400483_195580_6960_7811 263
583 3300039062 Ga0400483_212948 Ga0400483_212948_204_1055 263
584 3300041451 Ga0451791_1287689 Ga0451791_1287689_410_1261 263
585 3300041491 Ga0451833_1420109 Ga0451833_1420109_25_876 263
586 3300041492 Ga0451835_0478060 Ga0451835_0478060_1302_2153 263
587 3300041496 Ga0451839_0300679 Ga0451839_0300679_32_883 263
588 3300041496 Ga0451839_0662414 Ga0451839_0662414_32_883 263
589 3300041498 Ga0451841_0719137 Ga0451841_0719137_106_957 263
590 3300041505 Ga0451849_0546724 Ga0451849_0546724_262_1113 263
591 3300041507 Ga0451851_0158030 Ga0451851_0158030_552_1403 263
592 3300041509 Ga0451843_0422144 Ga0451843_0422144_183_1034 263
593 3300044684 Ga0466966_0179816 Ga0466966_0179816_355_1206 263
594 3300044694 Ga0466963_0011432 Ga0466963_0011432_1199_2050 263
595 3300044765 Ga0466970_0001023 Ga0466970_0001023_3895_4746 263
596 3300044842 Ga0466957_0112681 Ga0466957_0112681_399_1250 263
597 3300045049 Ga0466959_0066626 Ga0466959_0066626_967_1818 263
598 3300045836 Ga0466958_0001498 Ga0466958_0001498_3699_4550 263
599 3300045976 Ga0466967_0008489 Ga0466967_0008489_20_871 263
600 3300045976 Ga0466967_0137853 Ga0466967_0137853_1057_1908 263
601 3300046459 Ga0495629_0063156 Ga0495629_0063156_1091_1942 263
602 3300046474 Ga0495605_0020213 Ga0495605_0020213_199_1050 263
603 3300046492 Ga0495585_0010652 Ga0495585_0010652_4047_4898 263
604 3300046492 Ga0495585_0014469 Ga0495585_0014469_1757_2608 263
605 3300046501 Ga0495607_0061799 Ga0495607_0061799_239_1090 263
606 3300046506 Ga0495583_0000957 Ga0495583_0000957_26462_27313 263
607 3300046506 Ga0495583_0049069 Ga0495583_0049069_114_965 263
608 3300046507 Ga0495606_0000629 Ga0495606_0000629_47977_48828 263
609 3300046507 Ga0495606_0018560 Ga0495606_0018560_1418_2269 263
610 3300046515 Ga0495620_0086981 Ga0495620_0086981_235_1086 263
611 3300046518 Ga0495631_0008404 Ga0495631_0008404_1665_2516 263
612 3300046518 Ga0495631_0022726 Ga0495631_0022726_67_918 263
613 3300046522 Ga0495643_0002781 Ga0495643_0002781_9375_10226 263
614 3300046542 Ga0495597_0078407 Ga0495597_0078407_89_940 263
615 3300046558 Ga0495633_0017216 Ga0495633_0017216_2066_2917 263
616 3300046616 Ga0495668_0065114 Ga0495668_0065114_818_1669 263
617 3300046660 Ga0495625_0004033 Ga0495625_0004033_12120_12971 263
618 3300046660 Ga0495625_0040600 Ga0495625_0040600_49_900 263
619 3300046660 Ga0495625_0044687 Ga0495625_0044687_2273_3124 263
620 3300047472 Ga0495686_0027328 Ga0495686_0027328_649_1500 263
621 3300048907 Ga0496104_0017153 Ga0496104_0017153_2543_3394 263
622 3300048908 Ga0496105_0067328 Ga0496105_0067328_1698_2549 263
623 3300048919 Ga0496116_0049741 Ga0496116_0049741_780_1631 263
624 3300048919 Ga0496116_0144546 Ga0496116_0144546_173_1024 263
625 3300048920 Ga0496117_0000490 Ga0496117_0000490_36744_37595 263
626 3300048921 Ga0496118_0001723 Ga0496118_0001723_27910_28761 263
627 3300048921 Ga0496118_0032523 Ga0496118_0032523_345_1196 263
628 3300048922 Ga0496119_0004038 Ga0496119_0004038_11342_12193 263
629 3300048922 Ga0496119_0021845 Ga0496119_0021845_1625_2476 263
630 3300048924 Ga0496121_0000005 Ga0496121_0000005_40510_41361 263
631 3300048924 Ga0496121_0064241 Ga0496121_0064241_2118_2969 263
632 3300048924 Ga0496121_0315917 Ga0496121_0315917_119_970 263
633 3300048925 Ga0496122_0000713 Ga0496122_0000713_27910_28761 263
634 3300048925 Ga0496122_0006813 Ga0496122_0006813_8399_9250 263
635 3300048925 Ga0496122_0021866 Ga0496122_0021866_1913_2764 263
636 3300048926 Ga0496123_0000530 Ga0496123_0000530_36871_37722 263
637 3300048926 Ga0496123_0001604 Ga0496123_0001604_8488_9339 263
638 3300048927 Ga0496124_0018647 Ga0496124_0018647_4680_5531 263
639 3300048927 Ga0496124_0020905 Ga0496124_0020905_3864_4715 263
640 3300048927 Ga0496124_0026422 Ga0496124_0026422_863_1714 263
641 3300048928 Ga0496125_0000034 Ga0496125_0000034_167101_167952 263
642 3300048928 Ga0496125_0074187 Ga0496125_0074187_164_1015 263
643 3300048929 Ga0496126_0040009 Ga0496126_0040009_3226_4077 263
644 3300048929 Ga0496126_0068197 Ga0496126_0068197_13_864 263
645 3300049570 Ga0501033_0051998 Ga0501033_0051998_1396_2244 263
646 3300049571 Ga0501034_0314043 Ga0501034_0314043_320_1168 263
647 3300049573 Ga0501037_0034694 Ga0501037_0034694_1193_2041 263
648 3300049586 Ga0501070_0001012 Ga0501070_0001012_10485_11333 263
649 3300049589 Ga0501073_0037477 Ga0501073_0037477_991_1839 263
650 3300049742 Ga0501080_0002221 Ga0501080_0002221_12027_12875 263
651 3300049822 Ga0501035_0001616 Ga0501035_0001616_17107_17955 263
652 3300049823 Ga0501044_0029725 Ga0501044_0029725_314_1162 263
653 3300050489 nmdc:mga03683_111860_c1 nmdc:mga03683_111860_c1_83_934 263
654 3300050489 nmdc:mga03683_121977_c1 nmdc:mga03683_121977_c1_115_966 263
655 3300050490 nmdc:mga03n38_138273_c1 nmdc:mga03n38_138273_c1_46_897 263
656 3300050490 nmdc:mga03n38_62682_c1 nmdc:mga03n38_62682_c1_89_940 263
657 3300050491 nmdc:mga00v17_203108_c1 nmdc:mga00v17_203108_c1_207_1058 263
658 3300050491 nmdc:mga00v17_646_c1 nmdc:mga00v17_646_c1_6881_7732 263
659 3300050492 nmdc:mga0yw44_3758_c1 nmdc:mga0yw44_3758_c1_2247_3098 263
660 3300050493 nmdc:mga0k408_18904_c2 nmdc:mga0k408_18904_c2_1622_2473 263
661 3300050493 nmdc:mga0k408_23600_c1 nmdc:mga0k408_23600_c1_1559_2410 263
662 3300050494 nmdc:mga06z11_43556_c1 nmdc:mga06z11_43556_c1_202_1053 263
663 3300050496 nmdc:mga07m45_21616_c1 nmdc:mga07m45_21616_c1_2516_3367 263
664 3300050516 nmdc:mga0sz30_13108_c1 nmdc:mga0sz30_13108_c1_108_959 263
665 3300053109 Ga0500569_000732 Ga0500569_000732_3496_4347 263
666 3300053109 Ga0500569_016177 Ga0500569_016177_408_1259 263
667 3300053111 Ga0500572_002453 Ga0500572_002453_3489_4340 263
668 3300053121 Ga0500607_086890 Ga0500607_086890_83_934 263
669 3300053134 Ga0500658_0001505 Ga0500658_0001505_6034_6885 263
670 3300053136 Ga0500559_0102027 Ga0500559_0102027_296_1147 263
671 3300053139 Ga0500568_0000524 Ga0500568_0000524_14718_15569 263
672 3300053151 Ga0500604_0012916 Ga0500604_0012916_655_1506 263
673 3300053153 Ga0500616_0007896 Ga0500616_0007896_131_982 263
674 3300053156 Ga0500622_0004526 Ga0500622_0004526_3838_4689 263
675 3300053161 Ga0500634_0001933 Ga0500634_0001933_5841_6692 263
676 3300059652 Ga0587107_000520 Ga0587107_000520_135_986 263
677 3300061719 Ga0466962_0110345 Ga0466962_0110345_346_1197 263
678 3300005329 Ga0070683_100048475 Ga0070683_1000484753 265
679 3300005353 Ga0070669_100244920 Ga0070669_1002449202 265
680 3300005441 Ga0070700_100011533 Ga0070700_1000115334 265
681 3300005455 Ga0070663_100013791 Ga0070663_1000137914 265
682 3300005535 Ga0070684_100005576 Ga0070684_10000557610 265
683 3300005547 Ga0070693_100127514 Ga0070693_1001275142 265
684 3300005564 Ga0070664_100008484 Ga0070664_1000084846 265
685 3300005840 Ga0068870_10110250 Ga0068870_101102502 265
686 3300005841 Ga0068863_100515007 Ga0068863_1005150072 265
687 3300005842 Ga0068858_100057359 Ga0068858_1000573592 265
688 3300005844 Ga0068862_100122801 Ga0068862_1001228012 265
689 3300009094 Ga0111539_10002276 Ga0111539_1000227618 265
690 3300014745 Ga0157377_10004331 Ga0157377_100043317 265
691 3300025907 Ga0207645_10028267 Ga0207645_100282673 265
692 3300025908 Ga0207643_10095072 Ga0207643_100950722 265
693 3300025918 Ga0207662_10032593 Ga0207662_100325933 265
694 3300025920 Ga0207649_10089809 Ga0207649_100898092 265
695 3300025923 Ga0207681_10099406 Ga0207681_100994062 265
696 3300025927 Ga0207687_10033088 Ga0207687_100330883 265
697 3300025932 Ga0207690_10018390 Ga0207690_100183902 265
698 3300025940 Ga0207691_10214464 Ga0207691_102144642 265
699 3300025944 Ga0207661_10017218 Ga0207661_100172183 265
700 3300025945 Ga0207679_10012743 Ga0207679_100127432 265
701 3300025972 Ga0207668_10081749 Ga0207668_100817493 265
702 3300026023 Ga0207677_10133858 Ga0207677_101338582 265
703 3300026067 Ga0207678_10036822 Ga0207678_100368223 265
704 3300026075 Ga0207708_10001936 Ga0207708_100019366 265
705 3300026116 Ga0207674_10007586 Ga0207674_100075864 265
706 3300028380 Ga0268265_10117137 Ga0268265_101171373 265
707 3300050511 nmdc:mga08y16_15812_c1 nmdc:mga08y16_15812_c1_6232_7164 265
708 3300044842 Ga0466957_0078419 Ga0466957_0078419_813_1664 266
709 3300046472 Ga0495580_0029036 Ga0495580_0029036_1405_2334 267
710 3300046533 Ga0495640_0019978 Ga0495640_0019978_2303_3232 267
711 3300046689 Ga0495613_0030790 Ga0495613_0030790_2350_3279 267
712 3300047317 Ga0495604_0050921 Ga0495604_0050921_1525_2454 267
713 iso_pu_bacteria 2884693830 2884697440 269
714 iso_pu_bacteria 2895442618 2895452947 269
715 3300048917 Ga0496114_0077243 Ga0496114_0077243_1558_2487 270
716 3300046454 Ga0495592_0115536 Ga0495592_0115536_517_1446 271
717 3300046455 Ga0495603_0125839 Ga0495603_0125839_111_1040 271
718 3300046474 Ga0495605_0007199 Ga0495605_0007199_3198_4127 271
719 3300046477 Ga0495664_0089873 Ga0495664_0089873_124_1053 271
720 3300046499 Ga0495594_0046622 Ga0495594_0046622_651_1580 271
721 3300046501 Ga0495607_0010357 Ga0495607_0010357_5106_6035 271
722 3300046506 Ga0495583_0086514 Ga0495583_0086514_409_1338 271
723 3300046507 Ga0495606_0007570 Ga0495606_0007570_597_1526 271
724 3300046512 Ga0495610_0078468 Ga0495610_0078468_544_1473 271
725 3300046513 Ga0495616_0062694 Ga0495616_0062694_137_1066 271
726 3300046515 Ga0495620_0032466 Ga0495620_0032466_1104_2033 271
727 3300046516 Ga0495628_0142566 Ga0495628_0142566_819_1748 271
728 3300046518 Ga0495631_0006341 Ga0495631_0006341_3326_4255 271
729 3300046522 Ga0495643_0007574 Ga0495643_0007574_1720_2649 271
730 3300046557 Ga0495622_0002853 Ga0495622_0002853_5227_6156 271
731 3300046558 Ga0495633_0068885 Ga0495633_0068885_430_1359 271
732 3300046648 Ga0495611_0101322 Ga0495611_0101322_13_942 271
733 3300046663 Ga0495635_0008411 Ga0495635_0008411_1809_2738 271
734 3300046679 Ga0495623_0162739 Ga0495623_0162739_336_1265 271
735 3300046794 Ga0495589_0034934 Ga0495589_0034934_1582_2511 271
736 3300046810 Ga0495660_0136064 Ga0495660_0136064_209_1138 271
737 3300047321 Ga0495676_0143510 Ga0495676_0143510_141_1070 271
738 3300047322 Ga0495680_0005861 Ga0495680_0005861_2122_3051 271
739 3300047443 Ga0495687_017921 Ga0495687_017921_1024_1953 271
740 3300047673 Ga0495593_0013554 Ga0495593_0013554_1304_2233 271
741 3300048089 Ga0495614_0033185 Ga0495614_0033185_1002_1931 271
742 3300048091 Ga0495626_0039871 Ga0495626_0039871_497_1426 271
743 3300031649 Ga0307514_10040289 Ga0307514_100402894 272
744 3300046499 Ga0495594_0088487 Ga0495594_0088487_793_1662 272
745 3300046538 Ga0495609_0016992 Ga0495609_0016992_270_1199 272
746 3300009147 Ga0114129_10130524 Ga0114129_101305242 273
747 3300049459 Ga0495678_048866 Ga0495678_048866_313_1242 273
748 iso_pu_bacteria 2675903060 2676488010 273
749 3300046455 Ga0495603_0009808 Ga0495603_0009808_921_1847 274
750 3300046459 Ga0495629_0005661 Ga0495629_0005661_4522_5448 274
751 3300046499 Ga0495594_0006953 Ga0495594_0006953_1028_1954 274
752 3300046674 Ga0495588_0012531 Ga0495588_0012531_2241_3167 274
753 3300047321 Ga0495676_0001692 Ga0495676_0001692_12335_13261 274
754 3300028558 Ga0265326_10004051 Ga0265326_100040512 276
755 3300028573 Ga0265334_10019009 Ga0265334_100190093 276
756 3300028654 Ga0265322_10001821 Ga0265322_100018212 276
757 3300031344 Ga0265316_10024107 Ga0265316_100241074 276
758 3300046452 Ga0495617_005101 Ga0495617_005101_2355_3284 276
759 3300046648 Ga0495611_0020459 Ga0495611_0020459_105_1034 276
760 3300046689 Ga0495613_0071021 Ga0495613_0071021_487_1407 276
761 3300047447 Ga0495685_049462 Ga0495685_049462_279_1208 276
762 3300003354 JGI25160J50197_1027872 JGI25160J50197_10278721 277
763 3300025302 Ga0207426_1006621 Ga0207426_10066214 277
764 3300031616 Ga0307508_10029301 Ga0307508_100293012 277
765 3300044694 Ga0466963_0184538 Ga0466963_0184538_383_1297 277
766 3300006042 Ga0075368_10002275 Ga0075368_100022755 278
767 3300006178 Ga0075367_10001560 Ga0075367_100015602 278
768 3300027866 Ga0209813_10001911 Ga0209813_100019111 278
769 3300050494 nmdc:mga06z11_805_c1 nmdc:mga06z11_805_c1_2610_3536 278
770 iso_pu_bacteria 2791355406 2793975977 278
771 iso_pu_bacteria 2808606982 2811846663 278
772 iso_pu_bacteria 8025530807 8025534931 278
773 iso_pu_bacteria 8047893842 8047901080 278
774 iso_pu_bacteria 8048127548 8048133838 278
775 iso_pu_bacteria 8048356638 8048357821 278
776 iso_pu_bacteria 8048369669 8048378019 278
777 iso_pu_bacteria 8048379754 8048387117 278
778 3300045976 Ga0466967_0020180 Ga0466967_0020180_3611_4534 279
779 3300046455 Ga0495603_0001084 Ga0495603_0001084_9049_9975 279
780 3300046459 Ga0495629_0000969 Ga0495629_0000969_15292_16218 279
781 3300046689 Ga0495613_0003773 Ga0495613_0003773_7847_8773 279
782 3300047321 Ga0495676_0016892 Ga0495676_0016892_993_1919 279
783 3300048089 Ga0495614_0000140 Ga0495614_0000140_15291_16217 279
784 iso_pu_bacteria 2582581314 2585320018 279
785 iso_pu_bacteria 2862178590 2862181219 279
786 3300006846 Ga0075430_100166488 Ga0075430_1001664882 280
787 3300050508 nmdc:mga09592_139574_c1 nmdc:mga09592_139574_c1_724_1647 280
788 iso_pu_bacteria 2582581312 2585300657 280
789 iso_pu_bacteria 2616644814 2616693316 280
790 iso_pu_bacteria 2616644941 2616901548 280
791 3300003354 JGI25160J50197_1032862 JGI25160J50197_10328621 281
792 3300044656 Ga0466969_0013952 Ga0466969_0013952_2515_3432 281
793 3300044684 Ga0466966_0020412 Ga0466966_0020412_2927_3844 281
794 3300044765 Ga0466970_0137425 Ga0466970_0137425_312_1229 281
795 3300045049 Ga0466959_0004980 Ga0466959_0004980_961_1878 281
796 iso_pu_bacteria 2862574272 2862580452 281
797 iso_pu_bacteria 2895427314 2895431013 281
798 iso_pu_bacteria 2997600082 2997605867 281
799 iso_pu_bacteria 8033684223 8033687433 281
800 3300003373 JGI25407J50210_10023741 JGI25407J50210_100237412 282
801 3300003911 JGI25405J52794_10032364 JGI25405J52794_100323641 282
802 3300005937 Ga0081455_10004804 Ga0081455_1000480413 282
803 3300005981 Ga0081538_10000552 Ga0081538_1000055226 282
804 3300025302 Ga0207426_1006660 Ga0207426_10066602 282
805 3300037466 Ga0395898_0364793 Ga0395898_0364793_156_1082 282
806 3300038443 Ga0395901_0238207 Ga0395901_0238207_187_1113 282
807 3300049576 Ga0501040_0332878 Ga0501040_0332878_137_1075 282
808 3300003323 rootH1_10169375 rootH1_101693753 283
809 3300032126 Ga0307415_100014853 Ga0307415_1000148533 283
810 3300037466 Ga0395898_0241149 Ga0395898_0241149_306_1235 283
811 3300037471 Ga0395905_0093060 Ga0395905_0093060_811_1740 283
812 3300049742 Ga0501080_0065598 Ga0501080_0065598_1621_2526 283
813 3300050507 nmdc:mga05p37_200365_c1 nmdc:mga05p37_200365_c1_533_1462 283
814 3300054114 Ga0501084_0292848 Ga0501084_0292848_226_1131 283
815 3300005545 Ga0070695_100407485 Ga0070695_1004074851 284
816 3300005981 Ga0081538_10000512 Ga0081538_1000051228 284
817 3300009148 Ga0105243_10233375 Ga0105243_102333752 284
818 3300037466 Ga0395898_0020235 Ga0395898_0020235_3609_4538 284
819 3300044706 Ga0466964_0029921 Ga0466964_0029921_987_1913 284
820 3300045976 Ga0466967_0056104 Ga0466967_0056104_2297_3223 284
821 3300046455 Ga0495603_0011999 Ga0495603_0011999_2355_3287 285
822 3300046501 Ga0495607_0069230 Ga0495607_0069230_300_1232 285
823 3300046794 Ga0495589_0009836 Ga0495589_0009836_3125_4057 285
824 3300046794 Ga0495589_0017999 Ga0495589_0017999_399_1331 285
825 3300047318 Ga0495636_0012997 Ga0495636_0012997_1513_2445 285
826 3300047321 Ga0495676_0023609 Ga0495676_0023609_3956_4888 285
827 3300047321 Ga0495676_0062232 Ga0495676_0062232_842_1774 285
828 3300047447 Ga0495685_003784 Ga0495685_003784_1678_2610 285
829 3300009147 Ga0114129_10858000 Ga0114129_108580002 286
830 3300050507 nmdc:mga05p37_754224_c1 nmdc:mga05p37_754224_c1_11_976 286
831 3300005983 Ga0081540_1046671 Ga0081540_10466712 289
832 3300001915 JGI24741J21665_1015059 JGI24741J21665_10150592 292
833 3300001979 JGI24740J21852_10061639 JGI24740J21852_100616392 292
834 3300002155 JGI24033J26618_1010437 JGI24033J26618_10104372 292
835 3300002459 JGI24751J29686_10008949 JGI24751J29686_100089492 292
836 3300005328 Ga0070676_10135405 Ga0070676_101354052 292
837 3300005330 Ga0070690_100188917 Ga0070690_1001889172 292
838 3300005331 Ga0070670_100065672 Ga0070670_1000656722 292
839 3300005334 Ga0068869_100005743 Ga0068869_1000057435 292
840 3300005335 Ga0070666_10153959 Ga0070666_101539592 292
841 3300005336 Ga0070680_100023858 Ga0070680_1000238582 292
842 3300005338 Ga0068868_100019414 Ga0068868_1000194144 292
843 3300005340 Ga0070689_100021590 Ga0070689_1000215903 292
844 3300005341 Ga0070691_10029681 Ga0070691_100296812 292
845 3300005344 Ga0070661_100021113 Ga0070661_1000211133 292
846 3300005354 Ga0070675_100042440 Ga0070675_1000424402 292
847 3300005355 Ga0070671_100002576 Ga0070671_1000025769 292
848 3300005364 Ga0070673_100316965 Ga0070673_1003169652 292
849 3300005365 Ga0070688_100022559 Ga0070688_1000225593 292
850 3300005366 Ga0070659_100078716 Ga0070659_1000787162 292
851 3300005436 Ga0070713_100003468 Ga0070713_1000034682 292
852 3300005437 Ga0070710_10124741 Ga0070710_101247412 292
853 3300005441 Ga0070700_100042001 Ga0070700_1000420012 292
854 3300005455 Ga0070663_100006974 Ga0070663_1000069745 292
855 3300005456 Ga0070678_100000440 Ga0070678_1000004404 292
856 3300005458 Ga0070681_10108783 Ga0070681_101087832 292
857 3300005466 Ga0070685_10011517 Ga0070685_100115172 292
858 3300005547 Ga0070693_100003314 Ga0070693_1000033146 292
859 3300005548 Ga0070665_100041189 Ga0070665_1000411893 292
860 3300005614 Ga0068856_100327914 Ga0068856_1003279141 292
861 3300005615 Ga0070702_100004596 Ga0070702_1000045965 292
862 3300005616 Ga0068852_100049477 Ga0068852_1000494773 292
863 3300005617 Ga0068859_100062839 Ga0068859_1000628393 292
864 3300005618 Ga0068864_100037161 Ga0068864_1000371614 292
865 3300005719 Ga0068861_100107802 Ga0068861_1001078022 292
866 3300005840 Ga0068870_10001400 Ga0068870_100014005 292
867 3300005841 Ga0068863_100106765 Ga0068863_1001067652 292
868 3300005842 Ga0068858_100012004 Ga0068858_1000120046 292
869 3300005843 Ga0068860_100052160 Ga0068860_1000521603 292
870 3300006237 Ga0097621_100022705 Ga0097621_1000227052 292
871 3300006358 Ga0068871_100049946 Ga0068871_1000499463 292
872 3300006844 Ga0075428_100169589 Ga0075428_1001695892 292
873 3300006847 Ga0075431_100066750 Ga0075431_1000667502 292
874 3300006852 Ga0075433_10022955 Ga0075433_100229552 292
875 3300006871 Ga0075434_100029891 Ga0075434_1000298912 292
876 3300006880 Ga0075429_100055355 Ga0075429_1000553552 292
877 3300006914 Ga0075436_100001750 Ga0075436_1000017504 292
878 3300006931 Ga0097620_100062839 Ga0097620_1000628393 292
879 3300007076 Ga0075435_100031775 Ga0075435_1000317753 292
880 3300009011 Ga0105251_10011535 Ga0105251_100115352 292
881 3300009147 Ga0114129_10044078 Ga0114129_100440784 292
882 3300009174 Ga0105241_10460268 Ga0105241_104602682 292
883 3300009176 Ga0105242_10464408 Ga0105242_104644082 292
884 3300009177 Ga0105248_10008444 Ga0105248_100084444 292
885 3300009553 Ga0105249_10368466 Ga0105249_103684662 292
886 3300011119 Ga0105246_10017305 Ga0105246_100173052 292
887 3300013100 Ga0157373_10029252 Ga0157373_100292524 292
888 3300013102 Ga0157371_10007454 Ga0157371_100074544 292
889 3300013296 Ga0157374_10068086 Ga0157374_100680863 292
890 3300014325 Ga0163163_10289204 Ga0163163_102892042 292
891 3300014745 Ga0157377_10043374 Ga0157377_100433742 292
892 3300014968 Ga0157379_10030051 Ga0157379_100300514 292
893 3300017792 Ga0163161_10245881 Ga0163161_102458812 292
894 3300020070 Ga0206356_10934920 Ga0206356_109349203 292
895 3300025901 Ga0207688_10028434 Ga0207688_100284342 292
896 3300025903 Ga0207680_10261290 Ga0207680_102612901 292
897 3300025904 Ga0207647_10032231 Ga0207647_100322311 292
898 3300025906 Ga0207699_10013155 Ga0207699_100131554 292
899 3300025908 Ga0207643_10002531 Ga0207643_100025314 292
900 3300025909 Ga0207705_10072980 Ga0207705_100729802 292
901 3300025912 Ga0207707_10039857 Ga0207707_100398573 292
902 3300025917 Ga0207660_10006936 Ga0207660_100069364 292
903 3300025919 Ga0207657_10037812 Ga0207657_100378122 292
904 3300025920 Ga0207649_10006970 Ga0207649_100069704 292
905 3300025921 Ga0207652_10014958 Ga0207652_100149582 292
906 3300025924 Ga0207694_10016355 Ga0207694_100163552 292
907 3300025925 Ga0207650_10004010 Ga0207650_100040105 292
908 3300025926 Ga0207659_10011026 Ga0207659_100110263 292
909 3300025927 Ga0207687_10019474 Ga0207687_100194744 292
910 3300025928 Ga0207700_10035281 Ga0207700_100352813 292
911 3300025931 Ga0207644_10025410 Ga0207644_100254104 292
912 3300025933 Ga0207706_10038508 Ga0207706_100385082 292
913 3300025936 Ga0207670_10009665 Ga0207670_100096653 292
914 3300025941 Ga0207711_10117335 Ga0207711_101173352 292
915 3300025942 Ga0207689_10006061 Ga0207689_100060614 292
916 3300025944 Ga0207661_10003072 Ga0207661_100030722 292
917 3300025960 Ga0207651_10042876 Ga0207651_100428762 292
918 3300025961 Ga0207712_10246682 Ga0207712_102466822 292
919 3300026023 Ga0207677_10409375 Ga0207677_104093751 292
920 3300026041 Ga0207639_10221858 Ga0207639_102218582 292
921 3300026067 Ga0207678_10000416 Ga0207678_1000041625 292
922 3300026075 Ga0207708_10008215 Ga0207708_100082153 292
923 3300026078 Ga0207702_10023386 Ga0207702_100233863 292
924 3300026088 Ga0207641_10013488 Ga0207641_100134882 292
925 3300026095 Ga0207676_10011074 Ga0207676_100110744 292
926 3300026116 Ga0207674_10035497 Ga0207674_100354972 292
927 3300026118 Ga0207675_100064880 Ga0207675_1000648803 292
928 3300026121 Ga0207683_10003598 Ga0207683_100035984 292
929 3300027907 Ga0207428_10017270 Ga0207428_100172705 292
930 3300028379 Ga0268266_10051972 Ga0268266_100519722 292
931 3300028381 Ga0268264_10065203 Ga0268264_100652033 292
932 3300042005 Ga0439448_0002687 Ga0439448_0002687_3690_4613 292
933 3300042012 Ga0439455_0023391 Ga0439455_0023391_378_1301 292
934 3300042137 Ga0450902_008696 Ga0450902_008696_468_1391 292
935 3300042157 Ga0439458_0033809 Ga0439458_0033809_190_1113 292
936 3300048904 Ga0496101_0155207 Ga0496101_0155207_660_1583 292
937 3300048905 Ga0496102_0028385 Ga0496102_0028385_279_1202 292
938 3300048906 Ga0496103_0017891 Ga0496103_0017891_132_1055 292
939 3300048907 Ga0496104_0013612 Ga0496104_0013612_2320_3243 292
940 3300048908 Ga0496105_0019233 Ga0496105_0019233_3823_4746 292
941 3300048909 Ga0496106_0013309 Ga0496106_0013309_3817_4740 292
942 3300048912 Ga0496109_0044452 Ga0496109_0044452_2156_3079 292
943 3300048913 Ga0496110_0029256 Ga0496110_0029256_1086_2009 292
944 3300048914 Ga0496111_0085558 Ga0496111_0085558_297_1220 292
945 3300048915 Ga0496112_0127004 Ga0496112_0127004_57_980 292
946 3300048916 Ga0496113_0014458 Ga0496113_0014458_1765_2688 292
947 3300050507 nmdc:mga05p37_150855_c1 nmdc:mga05p37_150855_c1_850_1773 292
948 3300050510 nmdc:mga06r32_95386_c1 nmdc:mga06r32_95386_c1_1196_2119 292
949 3300050511 nmdc:mga08y16_61313_c1 nmdc:mga08y16_61313_c1_794_1717 292
950 3300050512 nmdc:mga0n895_16561_c1 nmdc:mga0n895_16561_c1_1490_2413 292
951 3300050513 nmdc:mga0rr50_30669_c1 nmdc:mga0rr50_30669_c1_1176_2099 292
952 3300050515 nmdc:mga0a205_4097_c1 nmdc:mga0a205_4097_c1_5008_5931 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

119

319

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.3527 76 285
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.3454 26 284
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.3396 27 277
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.3379 26 284
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.3194 25 279
ID Description Score Start End Superfamily
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3923 26 282 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3881 75 280 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3835 74 281 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3808 26 282 1.10.3720.10
af_P0AE34_6_232_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3794 75 290 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0A1D584-F1-model_v4 ABC-type maltose/maltodextrin transport system, permease component 0.5447 123 292 GO:0005886
GO:0015423
GO:0042956
AF-A0A382B3P7-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.5412 121 284 GO:0005886
GO:0055085
AF-A0A7K0TD85-F1-model_v4 ABC transporter permease subunit 0.5407 126 281 GO:0005886
GO:0055085
AF-X1QYW3-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.5256 150 292 GO:0016020
GO:0055085
AF-A0A645AIT5-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.5109 124 291 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
59.38 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map