F486627
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 952 | 755 | 564 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300032126|Ga0307415_100014853|Ga0307415_1000148533 |
| Length | 325 |
| Sequence | MIDGERGDRMSEPSGAAPAATLAVDERVPAARPAVVVRRRRPLRPARVVLHVFLTLAMLGFLAPLALAVYASLRPYAETSELGYFSLPRKLTLHYYVQVFREGDLQKYFLNTLYVAVPAVLLTLFLASFVAFCIARLRVRGGLALLVVFTAGNLLPPQVLVTPLYQMYKSIPLPESLSSSLTLYDSYLGLVAIHVAFQVGFCVFVLTNYMHTIPDEITEAAVMDGAGAFRQYWQVTLPLCRPALAALATLEFTFIYNDFLYALVLMSTGDKLPVTSALNNLRGQFFTDYNLLAAGSVVVALPTVLVFLLLQRHFIAGLTLGANKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 3 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 4 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 5 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 6 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 7 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 8 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 9 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 10 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 11 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 12 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 13 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 14 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 15 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 16 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 17 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 18 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 19 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 20 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 21 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 22 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 23 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 24 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 25 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 26 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 27 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 28 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 29 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 30 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 31 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 32 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 33 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 34 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 35 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 36 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 37 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 38 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 39 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 40 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 41 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 42 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 43 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 44 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 45 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 46 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 47 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 48 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 49 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 50 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 51 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 52 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 53 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 54 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 55 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 56 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 57 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 58 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 59 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 60 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 61 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 62 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 63 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 64 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 65 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 66 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 67 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 68 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 69 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 70 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 71 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 72 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 73 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 74 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 75 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 76 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 77 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 78 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 79 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 80 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 81 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 82 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 83 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 84 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 85 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 86 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 87 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 88 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 89 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 90 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 91 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 92 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 93 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 94 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 95 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 96 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 97 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 98 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 99 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 100 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 101 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 102 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 103 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 104 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 105 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 106 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 107 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 108 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 109 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 110 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 111 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 112 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 113 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 114 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 115 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 116 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 117 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 118 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 119 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 120 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 121 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 122 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 123 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 124 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 125 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 126 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 127 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 128 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 129 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 130 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 131 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 132 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 133 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 134 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 135 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 136 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 137 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 138 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 139 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 140 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 141 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 142 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 143 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 144 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 145 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 146 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 147 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 148 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 149 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 150 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 151 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 152 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 153 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 154 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 155 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 156 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 157 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 158 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 159 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 160 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 161 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 162 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 163 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 164 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 165 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 166 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 167 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 168 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 169 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 170 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 171 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 172 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 173 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 174 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 175 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 176 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 177 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 178 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 179 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 180 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 181 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 182 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 183 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 184 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 185 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 186 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 187 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 188 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 189 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 190 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 191 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 192 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 193 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 194 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 195 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 196 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 197 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 198 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 199 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 200 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 201 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 202 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 203 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 204 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 205 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 206 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 207 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 208 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 209 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 210 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 211 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 212 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 213 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 214 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 215 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 216 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 217 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 218 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 219 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 220 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 221 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 222 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 223 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 224 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 225 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 226 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 227 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 228 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 229 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 230 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 231 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 232 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 233 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 234 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 235 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 236 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 237 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 238 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 239 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 240 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 241 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 242 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 243 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 244 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 245 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 246 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 247 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 248 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 249 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 250 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 251 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 252 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 253 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 254 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 255 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 256 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 257 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 258 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 259 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 260 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 261 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 262 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 263 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 264 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 265 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 266 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 267 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 268 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 269 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 270 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 271 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 272 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 273 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 274 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 275 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 276 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 277 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 278 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 279 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 280 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 281 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 282 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 283 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 284 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 285 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 286 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 287 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 288 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 289 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 290 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 291 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 292 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 293 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 294 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 295 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 296 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 297 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 298 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 299 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 300 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 301 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 302 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 303 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 304 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 305 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 306 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 307 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 308 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 309 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 310 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 311 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 312 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 313 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 314 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 315 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 316 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 317 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 318 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 319 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 320 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 321 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 322 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 323 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 324 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 325 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 326 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 327 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 328 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 329 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 330 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 331 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 332 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 333 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 334 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 335 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 336 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 337 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 338 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 339 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 340 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 341 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 342 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 343 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 344 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 345 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 346 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 347 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 348 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 349 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 350 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 351 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 352 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 353 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 354 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 355 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 356 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 357 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 358 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 359 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 360 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 361 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 362 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 363 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 364 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 365 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 366 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 367 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 368 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 369 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 370 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 371 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 372 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 373 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 374 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 375 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 376 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 377 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 378 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 379 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 380 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 381 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 382 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 383 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 384 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 385 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 386 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 387 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 388 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 389 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 390 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 391 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 392 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 393 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 394 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 395 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 396 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 397 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 398 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 399 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 400 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 401 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 402 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 403 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 404 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 405 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 406 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 407 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 408 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 409 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 410 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 411 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 412 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 413 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 414 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 415 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 416 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 417 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 418 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 419 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 420 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 421 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 422 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 423 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 424 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 425 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 426 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 427 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 429 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 430 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 431 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 432 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 433 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 434 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 435 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 436 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 437 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 439 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 440 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 441 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 443 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 445 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 446 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 447 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 448 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 449 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 450 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 451 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 452 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 453 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 454 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 455 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 456 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 457 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 458 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 459 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 460 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 461 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 462 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 463 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 464 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 465 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 466 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 467 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 468 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 469 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 470 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 471 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 472 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 473 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 474 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 475 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 476 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 477 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 478 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 479 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 480 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 481 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 482 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 483 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 484 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 485 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 486 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 487 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 488 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 489 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 490 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 518 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 527 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 529 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 530 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 531 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 532 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 533 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 534 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 535 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 537 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 539 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 540 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 544 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 545 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 546 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 547 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 548 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 549 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 550 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 551 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 552 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 553 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 554 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 555 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 556 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 557 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 558 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 559 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 560 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 561 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 562 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 563 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 564 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 565 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 566 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 567 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 568 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 569 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 570 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 571 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 572 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 573 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 574 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 575 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 576 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 577 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 578 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 579 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 580 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 581 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 582 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 583 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 584 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 585 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 586 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 587 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 588 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 637 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 638 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 639 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 640 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 641 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 642 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 643 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 644 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 645 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 646 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 647 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 648 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 649 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 650 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 651 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 652 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 653 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 654 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 655 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 656 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 657 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 658 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 659 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 662 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 663 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 664 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 665 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 667 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 668 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 669 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 670 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 671 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 672 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 673 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 674 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 675 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 676 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 677 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 678 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 679 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 680 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 681 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 682 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 683 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 684 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 685 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 686 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 687 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 688 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 689 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 690 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 691 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 692 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 693 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 694 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 695 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 696 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 697 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 698 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 699 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 700 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 701 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 702 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 703 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 704 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 705 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 706 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 707 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 708 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 709 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 710 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 711 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 712 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 713 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 714 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 715 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 716 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 717 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 718 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 719 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 720 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 721 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 722 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 723 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 724 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 725 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 726 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 727 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 728 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 729 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 730 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 731 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 732 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 733 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 734 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 735 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 736 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 737 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 738 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 739 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 740 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 741 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 742 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 743 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 744 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 745 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 746 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 747 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 748 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 749 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 750 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 751 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 752 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 753 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 754 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 755 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 59.03 |
| Metatranscriptomes | 0.21 |
| Isolates | 40.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.13 |
| Nodule | 32.25 |
| Rhizoplane | 2 |
| Rhizosphere | 40.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1015059 | 3300001915 | Bacteria | 1282 |
| 2 | JGI24740J21852_10000485 | 3300001979 | Bacteria | 17069 |
| 3 | JGI24740J21852_10061639 | 3300001979 | Bacteria | 1032 |
| 4 | JGI24033J26618_1010437 | 3300002155 | Bacteria | 1094 |
| 5 | JGI24751J29686_10008949 | 3300002459 | Bacteria | 2053 |
| 6 | JGI25155J39150_1000034 | 3300002704 | Bacteria | 105264 |
| 7 | JGI25156J39149_1000008 | 3300002705 | Bacteria | 229035 |
| 8 | JGI25162J39368_1000074 | 3300002737 | Bacteria | 121066 |
| 9 | JGI25154J39366_1000063 | 3300002738 | Bacteria | 104538 |
| 10 | JGI25157J39369_1000062 | 3300002741 | Bacteria | 104644 |
| 11 | JGI25152J39213_1001055 | 3300002773 | Bacteria | 13078 |
| 12 | JGI25152J39213_1001109 | 3300002773 | Bacteria | 12572 |
| 13 | JGI25152J39213_1014996 | 3300002773 | Bacteria | 1546 |
| 14 | JGI25150J39212_1001160 | 3300002774 | Bacteria | 7880 |
| 15 | JGI25159J45721_1000787 | 3300002987 | Bacteria | 13801 |
| 16 | JGI25151J46595_10000306 | 3300003187 | Bacteria | 53632 |
| 17 | JGI25151J46595_10001290 | 3300003187 | Bacteria | 17618 |
| 18 | JGI25165J46597_1000201 | 3300003214 | Bacteria | 87622 |
| 19 | JGI25153J46596_10000693 | 3300003215 | Bacteria | 20590 |
| 20 | JGI25153J46596_10005249 | 3300003215 | Bacteria | 6811 |
| 21 | JGI25153J46596_10006734 | 3300003215 | Bacteria | 5765 |
| 22 | rootH1_10010012 | 3300003316 | Bacteria | 13961 |
| 23 | rootH2_10045083 | 3300003320 | Bacteria | 13758 |
| 24 | rootL2_10001175 | 3300003322 | Bacteria | 27263 |
| 25 | rootL2_10271270 | 3300003322 | Bacteria | 1633 |
| 26 | rootL2_10314341 | 3300003322 | Bacteria | 1208 |
| 27 | rootH1_10113604 | 3300003323 | Bacteria | 5833 |
| 28 | rootH1_10169375 | 3300003323 | Bacteria | 4525 |
| 29 | rootH1_10270503 | 3300003323 | Bacteria | 2073 |
| 30 | JGI25160J50197_1002241 | 3300003354 | Bacteria | 9077 |
| 31 | JGI25160J50197_1006870 | 3300003354 | Bacteria | 4544 |
| 32 | JGI25160J50197_1027872 | 3300003354 | Bacteria | 1528 |
| 33 | JGI25160J50197_1032862 | 3300003354 | Bacteria | 1313 |
| 34 | JGI25407J50210_10023741 | 3300003373 | Bacteria | 1591 |
| 35 | JGI25161J50226_1000084 | 3300003374 | Bacteria | 76415 |
| 36 | Ga0055526_1003954 | 3300003771 | Bacteria | 9150 |
| 37 | Ga0055526_1008917 | 3300003771 | Bacteria | 4919 |
| 38 | Ga0055524_1003157 | 3300003775 | Bacteria | 8114 |
| 39 | Ga0055524_1009862 | 3300003775 | Bacteria | 3845 |
| 40 | Ga0055524_1049203 | 3300003775 | Bacteria | 974 |
| 41 | Ga0055528_1000168 | 3300003790 | Bacteria | 55151 |
| 42 | Ga0055528_1007067 | 3300003790 | Bacteria | 5016 |
| 43 | Ga0055528_1010970 | 3300003790 | Bacteria | 3635 |
| 44 | Ga0055528_1026867 | 3300003790 | Bacteria | 1638 |
| 45 | Ga0055540_1000109 | 3300003792 | Bacteria | 89131 |
| 46 | Ga0058692_1005828 | 3300003856 | Bacteria | 3457 |
| 47 | JGI25405J52794_10032364 | 3300003911 | Bacteria | 1089 |
| 48 | Ga0055543_1000017 | 3300004625 | Bacteria | 170255 |
| 49 | Ga0055543_1000652 | 3300004625 | Bacteria | 18430 |
| 50 | Ga0065165_1008542 | 3300005262 | Bacteria | 4765 |
| 51 | Ga0065165_1009458 | 3300005262 | Bacteria | 4367 |
| 52 | Ga0065704_10132899 | 3300005289 | Bacteria | 1607 |
| 53 | Ga0070676_10135405 | 3300005328 | Bacteria | 1562 |
| 54 | Ga0070683_100048475 | 3300005329 | Bacteria | 3928 |
| 55 | Ga0070690_100188917 | 3300005330 | Bacteria | 1427 |
| 56 | Ga0070670_100065672 | 3300005331 | Bacteria | 3113 |
| 57 | Ga0068869_100005743 | 3300005334 | Bacteria | 7834 |
| 58 | Ga0070666_10153959 | 3300005335 | Bacteria | 1605 |
| 59 | Ga0070680_100023858 | 3300005336 | Bacteria | 4882 |
| 60 | Ga0068868_100019414 | 3300005338 | Bacteria | 5093 |
| 61 | Ga0070689_100021590 | 3300005340 | Bacteria | 4796 |
| 62 | Ga0070691_10029681 | 3300005341 | Bacteria | 2559 |
| 63 | Ga0070661_100021113 | 3300005344 | Bacteria | 4649 |
| 64 | Ga0070669_100244920 | 3300005353 | Bacteria | 1425 |
| 65 | Ga0070675_100042440 | 3300005354 | Bacteria | 3716 |
| 66 | Ga0070671_100002576 | 3300005355 | Bacteria | 14058 |
| 67 | Ga0070674_100656192 | 3300005356 | Bacteria | 892 |
| 68 | Ga0070673_100316965 | 3300005364 | Bacteria | 1376 |
| 69 | Ga0070688_100022559 | 3300005365 | Bacteria | 3692 |
| 70 | Ga0070659_100078716 | 3300005366 | Bacteria | 2630 |
| 71 | Ga0070713_100003468 | 3300005436 | Bacteria | 10415 |
| 72 | Ga0070710_10124741 | 3300005437 | Bacteria | 1563 |
| 73 | Ga0070700_100011533 | 3300005441 | Bacteria | 4898 |
| 74 | Ga0070700_100042001 | 3300005441 | Bacteria | 2806 |
| 75 | Ga0070700_100336132 | 3300005441 | Bacteria | 1115 |
| 76 | Ga0070708_100010194 | 3300005445 | Bacteria | 7605 |
| 77 | Ga0070663_100006974 | 3300005455 | Bacteria | 6842 |
| 78 | Ga0070663_100013791 | 3300005455 | Bacteria | 5169 |
| 79 | Ga0070678_100000440 | 3300005456 | Bacteria | 19631 |
| 80 | Ga0070681_10108783 | 3300005458 | Bacteria | 2712 |
| 81 | Ga0070685_10011517 | 3300005466 | Bacteria | 4629 |
| 82 | Ga0070698_100001143 | 3300005471 | Bacteria | 29381 |
| 83 | Ga0070699_100141834 | 3300005518 | Bacteria | 2122 |
| 84 | Ga0070684_100005576 | 3300005535 | Bacteria | 9665 |
| 85 | Ga0070697_100168247 | 3300005536 | Bacteria | 1854 |
| 86 | Ga0070695_100407485 | 3300005545 | Bacteria | 1032 |
| 87 | Ga0070693_100003314 | 3300005547 | Bacteria | 7487 |
| 88 | Ga0070693_100127514 | 3300005547 | Bacteria | 1586 |
| 89 | Ga0070665_100041189 | 3300005548 | Bacteria | 4642 |
| 90 | Ga0070665_100441317 | 3300005548 | Bacteria | 1311 |
| 91 | Ga0070664_100008484 | 3300005564 | Bacteria | 8309 |
| 92 | Ga0068854_100247058 | 3300005578 | Bacteria | 1423 |
| 93 | Ga0068856_100014297 | 3300005614 | Bacteria | 7676 |
| 94 | Ga0068856_100327914 | 3300005614 | Bacteria | 1548 |
| 95 | Ga0070702_100004596 | 3300005615 | Bacteria | 6323 |
| 96 | Ga0068852_100049477 | 3300005616 | Bacteria | 3596 |
| 97 | Ga0068859_100062839 | 3300005617 | Bacteria | 3744 |
| 98 | Ga0068864_100037161 | 3300005618 | Bacteria | 4154 |
| 99 | Ga0068861_100107802 | 3300005719 | Bacteria | 2227 |
| 100 | Ga0068870_10001400 | 3300005840 | Bacteria | 9726 |
| 101 | Ga0068870_10110250 | 3300005840 | Bacteria | 1570 |
| 102 | Ga0068863_100106765 | 3300005841 | Bacteria | 2664 |
| 103 | Ga0068863_100515007 | 3300005841 | Bacteria | 1179 |
| 104 | Ga0068858_100012004 | 3300005842 | Bacteria | 8166 |
| 105 | Ga0068858_100057359 | 3300005842 | Bacteria | 3599 |
| 106 | Ga0068860_100052160 | 3300005843 | Bacteria | 3890 |
| 107 | Ga0068862_100122801 | 3300005844 | Bacteria | 2291 |
| 108 | Ga0081455_10004804 | 3300005937 | Bacteria | 15008 |
| 109 | Ga0081538_10000512 | 3300005981 | Bacteria | 43332 |
| 110 | Ga0081538_10000552 | 3300005981 | Bacteria | 41376 |
| 111 | Ga0081540_1046671 | 3300005983 | Bacteria | 2185 |
| 112 | Ga0075365_10000942 | 3300006038 | Bacteria | 12330 |
| 113 | Ga0075365_10006367 | 3300006038 | Bacteria | 6490 |
| 114 | Ga0075365_10043661 | 3300006038 | Bacteria | 2935 |
| 115 | Ga0075368_10002275 | 3300006042 | Bacteria | 6243 |
| 116 | Ga0075368_10016224 | 3300006042 | Bacteria | 2775 |
| 117 | Ga0075363_100035976 | 3300006048 | Bacteria | 2595 |
| 118 | Ga0075364_10004665 | 3300006051 | Bacteria | 7906 |
| 119 | Ga0075364_10083456 | 3300006051 | Bacteria | 2115 |
| 120 | Ga0075362_10125770 | 3300006177 | Bacteria | 1216 |
| 121 | Ga0075367_10001560 | 3300006178 | Bacteria | 9905 |
| 122 | Ga0075367_10033316 | 3300006178 | Bacteria | 2968 |
| 123 | Ga0075369_10025582 | 3300006186 | Bacteria | 2455 |
| 124 | Ga0075369_10031780 | 3300006186 | Bacteria | 2230 |
| 125 | Ga0075369_10049829 | 3300006186 | Bacteria | 1810 |
| 126 | Ga0075366_10014399 | 3300006195 | Bacteria | 4516 |
| 127 | Ga0075366_10017101 | 3300006195 | Bacteria | 4169 |
| 128 | Ga0075366_10048178 | 3300006195 | Bacteria | 2526 |
| 129 | Ga0097621_100022705 | 3300006237 | Bacteria | 4874 |
| 130 | Ga0075370_10005366 | 3300006353 | Bacteria | 6362 |
| 131 | Ga0068871_100049946 | 3300006358 | Bacteria | 3382 |
| 132 | Ga0075428_100169589 | 3300006844 | Bacteria | 2367 |
| 133 | Ga0075430_100166488 | 3300006846 | Bacteria | 1834 |
| 134 | Ga0075431_100066750 | 3300006847 | Bacteria | 3714 |
| 135 | Ga0075433_10022955 | 3300006852 | Bacteria | 5245 |
| 136 | Ga0075434_100029891 | 3300006871 | Bacteria | 5363 |
| 137 | Ga0075429_100055355 | 3300006880 | Bacteria | 3452 |
| 138 | Ga0075436_100001750 | 3300006914 | Bacteria | 14878 |
| 139 | Ga0097620_100062839 | 3300006931 | Bacteria | 3744 |
| 140 | Ga0075435_100031775 | 3300007076 | Bacteria | 4163 |
| 141 | Ga0075435_100408169 | 3300007076 | Bacteria | 1169 |
| 142 | Ga0105251_10011535 | 3300009011 | Bacteria | 5043 |
| 143 | Ga0105240_10000217 | 3300009093 | Bacteria | 115649 |
| 144 | Ga0111539_10002276 | 3300009094 | Bacteria | 25548 |
| 145 | Ga0105247_10024836 | 3300009101 | Bacteria | 3612 |
| 146 | Ga0114129_10044078 | 3300009147 | Bacteria | 6276 |
| 147 | Ga0114129_10130524 | 3300009147 | Bacteria | 3451 |
| 148 | Ga0114129_10858000 | 3300009147 | Bacteria | 1154 |
| 149 | Ga0105243_10233375 | 3300009148 | Bacteria | 1633 |
| 150 | Ga0105243_10520590 | 3300009148 | Bacteria | 1131 |
| 151 | Ga0105241_10460268 | 3300009174 | Bacteria | 1127 |
| 152 | Ga0105242_10464408 | 3300009176 | Bacteria | 1196 |
| 153 | Ga0105248_10008444 | 3300009177 | Bacteria | 11302 |
| 154 | Ga0105237_10001458 | 3300009545 | Bacteria | 31192 |
| 155 | Ga0105237_10404796 | 3300009545 | Bacteria | 1369 |
| 156 | Ga0105238_10212409 | 3300009551 | Bacteria | 1911 |
| 157 | Ga0105249_10368466 | 3300009553 | Bacteria | 1459 |
| 158 | Ga0123341_1000072 | 3300009765 | Bacteria | 42781 |
| 159 | Ga0123342_1005378 | 3300009766 | Bacteria | 18606 |
| 160 | Ga0105239_10001164 | 3300010375 | Bacteria | 36154 |
| 161 | Ga0105239_10135254 | 3300010375 | Bacteria | 2744 |
| 162 | Ga0105246_10017305 | 3300011119 | Bacteria | 4579 |
| 163 | Ga0157373_10029252 | 3300013100 | Bacteria | 3970 |
| 164 | Ga0157373_10058924 | 3300013100 | Bacteria | 2721 |
| 165 | Ga0157371_10007454 | 3300013102 | Bacteria | 8857 |
| 166 | Ga0157370_10000768 | 3300013104 | Bacteria | 40191 |
| 167 | Ga0157374_10068086 | 3300013296 | Bacteria | 3348 |
| 168 | Ga0163162_10638523 | 3300013306 | Bacteria | 1189 |
| 169 | Ga0163163_10289204 | 3300014325 | Bacteria | 1691 |
| 170 | Ga0163163_10791404 | 3300014325 | Bacteria | 1012 |
| 171 | Ga0157377_10004331 | 3300014745 | Bacteria | 6517 |
| 172 | Ga0157377_10043374 | 3300014745 | Bacteria | 2503 |
| 173 | Ga0157379_10030051 | 3300014968 | Bacteria | 4833 |
| 174 | Ga0157376_10444180 | 3300014969 | Bacteria | 1264 |
| 175 | Ga0182007_10004351 | 3300015262 | Bacteria | 6435 |
| 176 | Ga0182005_1019519 | 3300015265 | Bacteria | 1868 |
| 177 | Ga0163161_10245881 | 3300017792 | Bacteria | 1393 |
| 178 | Ga0206356_10934920 | 3300020070 | Bacteria | 3934 |
| 179 | Ga0209435_100020 | 3300025206 | Bacteria | 229105 |
| 180 | Ga0209436_100012 | 3300025208 | Bacteria | 136927 |
| 181 | Ga0209672_107087 | 3300025228 | Bacteria | 1760 |
| 182 | Ga0209437_100067 | 3300025233 | Bacteria | 317685 |
| 183 | Ga0207425_1000316 | 3300025245 | Bacteria | 34779 |
| 184 | Ga0207425_1008705 | 3300025245 | Bacteria | 2574 |
| 185 | Ga0209646_1000070 | 3300025246 | Bacteria | 229105 |
| 186 | Ga0209646_1009041 | 3300025246 | Bacteria | 1587 |
| 187 | Ga0209646_1015218 | 3300025246 | Bacteria | 1150 |
| 188 | Ga0209026_1000057 | 3300025250 | Bacteria | 229105 |
| 189 | Ga0209677_100295 | 3300025253 | Bacteria | 32620 |
| 190 | Ga0209759_1000047 | 3300025256 | Bacteria | 229105 |
| 191 | Ga0209129_1000235 | 3300025258 | Bacteria | 60351 |
| 192 | Ga0209129_1000268 | 3300025258 | Bacteria | 51242 |
| 193 | Ga0209129_1001842 | 3300025258 | Bacteria | 11226 |
| 194 | Ga0209233_1000088 | 3300025261 | Bacteria | 317980 |
| 195 | Ga0209233_1000288 | 3300025261 | Bacteria | 66882 |
| 196 | Ga0209673_1000444 | 3300025273 | Bacteria | 71044 |
| 197 | Ga0209673_1001803 | 3300025273 | Bacteria | 17641 |
| 198 | Ga0209673_1001878 | 3300025273 | Bacteria | 16950 |
| 199 | Ga0209673_1003837 | 3300025273 | Bacteria | 8493 |
| 200 | Ga0209673_1005954 | 3300025273 | Bacteria | 6012 |
| 201 | Ga0209130_1000022 | 3300025284 | Bacteria | 361244 |
| 202 | Ga0209675_1033537 | 3300025291 | Bacteria | 1189 |
| 203 | Ga0209025_1000058 | 3300025294 | Bacteria | 311398 |
| 204 | Ga0209025_1000609 | 3300025294 | Bacteria | 64308 |
| 205 | Ga0209025_1005676 | 3300025294 | Bacteria | 10053 |
| 206 | Ga0209025_1011931 | 3300025294 | Bacteria | 5650 |
| 207 | Ga0209025_1046804 | 3300025294 | Bacteria | 1774 |
| 208 | Ga0209564_1000167 | 3300025295 | Bacteria | 159653 |
| 209 | Ga0209564_1000458 | 3300025295 | Bacteria | 68749 |
| 210 | Ga0209564_1012997 | 3300025295 | Bacteria | 3574 |
| 211 | Ga0209758_1000151 | 3300025297 | Bacteria | 162732 |
| 212 | Ga0209758_1000398 | 3300025297 | Bacteria | 75220 |
| 213 | Ga0209758_1000847 | 3300025297 | Bacteria | 42599 |
| 214 | Ga0209758_1002658 | 3300025297 | Bacteria | 17685 |
| 215 | Ga0209758_1002983 | 3300025297 | Bacteria | 16225 |
| 216 | Ga0209050_1000278 | 3300025298 | Bacteria | 109088 |
| 217 | Ga0209050_1009047 | 3300025298 | Bacteria | 5180 |
| 218 | Ga0209256_1000511 | 3300025299 | Bacteria | 57006 |
| 219 | Ga0209256_1006815 | 3300025299 | Bacteria | 5891 |
| 220 | Ga0209256_1011158 | 3300025299 | Bacteria | 3634 |
| 221 | Ga0209256_1015252 | 3300025299 | Bacteria | 2700 |
| 222 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 223 | Ga0207426_1000147 | 3300025302 | Bacteria | 190586 |
| 224 | Ga0207426_1006621 | 3300025302 | Bacteria | 4986 |
| 225 | Ga0207426_1006660 | 3300025302 | Bacteria | 4965 |
| 226 | Ga0209051_1000224 | 3300025303 | Bacteria | 95355 |
| 227 | Ga0209051_1000687 | 3300025303 | Bacteria | 37475 |
| 228 | Ga0209257_1002671 | 3300025304 | Bacteria | 17104 |
| 229 | Ga0207688_10028434 | 3300025901 | Bacteria | 3075 |
| 230 | Ga0207680_10261290 | 3300025903 | Bacteria | 1198 |
| 231 | Ga0207647_10032231 | 3300025904 | Bacteria | 3369 |
| 232 | Ga0207699_10013155 | 3300025906 | Bacteria | 4226 |
| 233 | Ga0207645_10028267 | 3300025907 | Bacteria | 3621 |
| 234 | Ga0207643_10002531 | 3300025908 | Bacteria | 9891 |
| 235 | Ga0207643_10095072 | 3300025908 | Bacteria | 1741 |
| 236 | Ga0207705_10072980 | 3300025909 | Bacteria | 2489 |
| 237 | Ga0207684_10055707 | 3300025910 | Bacteria | 3354 |
| 238 | Ga0207654_10344102 | 3300025911 | Bacteria | 1025 |
| 239 | Ga0207707_10039857 | 3300025912 | Bacteria | 4104 |
| 240 | Ga0207695_10000613 | 3300025913 | Bacteria | 71568 |
| 241 | Ga0207671_10001160 | 3300025914 | Bacteria | 31428 |
| 242 | Ga0207660_10006936 | 3300025917 | Bacteria | 7335 |
| 243 | Ga0207662_10032593 | 3300025918 | Bacteria | 3034 |
| 244 | Ga0207657_10037812 | 3300025919 | Bacteria | 4305 |
| 245 | Ga0207649_10006970 | 3300025920 | Bacteria | 6141 |
| 246 | Ga0207649_10089809 | 3300025920 | Bacteria | 2009 |
| 247 | Ga0207652_10014958 | 3300025921 | Bacteria | 6294 |
| 248 | Ga0207646_10372445 | 3300025922 | Bacteria | 1290 |
| 249 | Ga0207681_10099406 | 3300025923 | Bacteria | 2095 |
| 250 | Ga0207694_10016355 | 3300025924 | Bacteria | 5601 |
| 251 | Ga0207694_10206879 | 3300025924 | Bacteria | 1598 |
| 252 | Ga0207650_10004010 | 3300025925 | Bacteria | 10072 |
| 253 | Ga0207659_10011026 | 3300025926 | Bacteria | 5696 |
| 254 | Ga0207687_10019474 | 3300025927 | Bacteria | 4496 |
| 255 | Ga0207687_10033088 | 3300025927 | Bacteria | 3505 |
| 256 | Ga0207700_10035281 | 3300025928 | Bacteria | 3601 |
| 257 | Ga0207644_10025410 | 3300025931 | Bacteria | 4073 |
| 258 | Ga0207690_10018390 | 3300025932 | Bacteria | 4287 |
| 259 | Ga0207706_10038508 | 3300025933 | Bacteria | 4241 |
| 260 | Ga0207670_10009665 | 3300025936 | Bacteria | 5514 |
| 261 | Ga0207691_10214464 | 3300025940 | Bacteria | 1671 |
| 262 | Ga0207711_10117335 | 3300025941 | Bacteria | 2373 |
| 263 | Ga0207689_10006061 | 3300025942 | Bacteria | 10693 |
| 264 | Ga0207661_10003072 | 3300025944 | Bacteria | 11553 |
| 265 | Ga0207661_10017218 | 3300025944 | Bacteria | 5345 |
| 266 | Ga0207679_10012743 | 3300025945 | Bacteria | 5492 |
| 267 | Ga0207651_10042876 | 3300025960 | Bacteria | 3015 |
| 268 | Ga0207712_10246682 | 3300025961 | Bacteria | 1441 |
| 269 | Ga0207668_10081749 | 3300025972 | Bacteria | 2345 |
| 270 | Ga0207677_10133858 | 3300026023 | Bacteria | 1887 |
| 271 | Ga0207677_10409375 | 3300026023 | Bacteria | 1152 |
| 272 | Ga0207639_10221858 | 3300026041 | Bacteria | 1633 |
| 273 | Ga0207678_10000416 | 3300026067 | Bacteria | 38515 |
| 274 | Ga0207678_10036822 | 3300026067 | Bacteria | 4259 |
| 275 | Ga0207708_10001936 | 3300026075 | Bacteria | 15258 |
| 276 | Ga0207708_10008215 | 3300026075 | Bacteria | 7732 |
| 277 | Ga0207708_10190012 | 3300026075 | Bacteria | 1634 |
| 278 | Ga0207702_10005172 | 3300026078 | Bacteria | 11476 |
| 279 | Ga0207702_10023386 | 3300026078 | Bacteria | 5124 |
| 280 | Ga0207641_10013488 | 3300026088 | Bacteria | 6702 |
| 281 | Ga0207676_10011074 | 3300026095 | Bacteria | 6435 |
| 282 | Ga0207674_10007586 | 3300026116 | Bacteria | 12643 |
| 283 | Ga0207674_10035497 | 3300026116 | Bacteria | 5203 |
| 284 | Ga0207675_100064880 | 3300026118 | Bacteria | 3413 |
| 285 | Ga0207683_10003598 | 3300026121 | Bacteria | 13507 |
| 286 | Ga0209281_1002138 | 3300027111 | Bacteria | 8697 |
| 287 | Ga0209371_1000174 | 3300027312 | Bacteria | 96051 |
| 288 | Ga0209371_1000222 | 3300027312 | Bacteria | 75507 |
| 289 | Ga0209813_10001911 | 3300027866 | Bacteria | 4696 |
| 290 | Ga0207428_10017270 | 3300027907 | Bacteria | 6196 |
| 291 | Ga0268266_10051972 | 3300028379 | Bacteria | 3518 |
| 292 | Ga0268265_10117137 | 3300028380 | Bacteria | 2187 |
| 293 | Ga0268264_10065203 | 3300028381 | Bacteria | 3068 |
| 294 | Ga0265326_10004051 | 3300028558 | Bacteria | 4736 |
| 295 | Ga0265334_10019009 | 3300028573 | Bacteria | 2830 |
| 296 | Ga0265322_10001821 | 3300028654 | Bacteria | 6762 |
| 297 | Ga0307515_10000130 | 3300028794 | Bacteria | 179263 |
| 298 | Ga0307515_10022393 | 3300028794 | Bacteria | 11136 |
| 299 | Ga0268256_1000028 | 3300030500 | Bacteria | 433179 |
| 300 | Ga0268256_1003712 | 3300030500 | Bacteria | 6724 |
| 301 | Ga0265327_10006474 | 3300031251 | Bacteria | 9354 |
| 302 | Ga0265316_10024107 | 3300031344 | Bacteria | 5107 |
| 303 | Ga0307513_10013508 | 3300031456 | Bacteria | 10020 |
| 304 | Ga0307513_10068528 | 3300031456 | Bacteria | 3716 |
| 305 | Ga0307508_10029301 | 3300031616 | Bacteria | 4976 |
| 306 | Ga0307514_10040289 | 3300031649 | Bacteria | 3685 |
| 307 | Ga0307406_10004162 | 3300031901 | Bacteria | 7878 |
| 308 | Ga0307414_10145621 | 3300032004 | Bacteria | 1861 |
| 309 | Ga0307415_100014853 | 3300032126 | Bacteria | 4593 |
| 310 | Ga0307510_10141695 | 3300033180 | Bacteria | 2046 |
| 311 | Ga0307510_10196034 | 3300033180 | Bacteria | 1561 |
| 312 | Ga0373927_0001338 | 3300035695 | Bacteria | 18600 |
| 313 | Ga0316584_0215676 | 3300036712 | Bacteria | 1412 |
| 314 | Ga0373925_0001079 | 3300037068 | Bacteria | 24530 |
| 315 | Ga0395900_0500824 | 3300037418 | Bacteria | 1165 |
| 316 | Ga0395900_0680115 | 3300037418 | Bacteria | 964 |
| 317 | Ga0395898_0020235 | 3300037466 | Bacteria | 6761 |
| 318 | Ga0395898_0241149 | 3300037466 | Bacteria | 1724 |
| 319 | Ga0395898_0364793 | 3300037466 | Bacteria | 1377 |
| 320 | Ga0395905_0000663 | 3300037471 | Bacteria | 45751 |
| 321 | Ga0395905_0001510 | 3300037471 | Bacteria | 27815 |
| 322 | Ga0395905_0093060 | 3300037471 | Bacteria | 2827 |
| 323 | Ga0395901_0238207 | 3300038443 | Bacteria | 1898 |
| 324 | Ga0395901_0407709 | 3300038443 | Bacteria | 1396 |
| 325 | Ga0400483_036442 | 3300039062 | Bacteria | 2241 |
| 326 | Ga0400483_056151 | 3300039062 | Bacteria | 1674 |
| 327 | Ga0400483_089304 | 3300039062 | Bacteria | 1649 |
| 328 | Ga0400483_120435 | 3300039062 | Bacteria | 6382 |
| 329 | Ga0400483_146044 | 3300039062 | Bacteria | 5564 |
| 330 | Ga0400483_192659 | 3300039062 | Bacteria | 7312 |
| 331 | Ga0400483_195580 | 3300039062 | Bacteria | 8615 |
| 332 | Ga0400483_212948 | 3300039062 | Bacteria | 4840 |
| 333 | Ga0400483_249541 | 3300039062 | Bacteria | 1765 |
| 334 | Ga0451791_1287689 | 3300041451 | Bacteria | 1348 |
| 335 | Ga0451807_0827308 | 3300041486 | Bacteria | 1016 |
| 336 | Ga0451833_1420109 | 3300041491 | Bacteria | 907 |
| 337 | Ga0451835_0478060 | 3300041492 | Bacteria | 2566 |
| 338 | Ga0451839_0300679 | 3300041496 | Bacteria | 2373 |
| 339 | Ga0451839_0662414 | 3300041496 | Bacteria | 1252 |
| 340 | Ga0451841_0719137 | 3300041498 | Bacteria | 1471 |
| 341 | Ga0451849_0546724 | 3300041505 | Bacteria | 1277 |
| 342 | Ga0451851_0158030 | 3300041507 | Bacteria | 1772 |
| 343 | Ga0451843_0422144 | 3300041509 | Bacteria | 1728 |
| 344 | Ga0439448_0002687 | 3300042005 | Bacteria | 4857 |
| 345 | Ga0439455_0023391 | 3300042012 | Bacteria | 1487 |
| 346 | Ga0450902_008696 | 3300042137 | Bacteria | 1588 |
| 347 | Ga0439458_0033809 | 3300042157 | Bacteria | 1225 |
| 348 | Ga0466969_0013952 | 3300044656 | Bacteria | 4230 |
| 349 | Ga0466966_0020412 | 3300044684 | Bacteria | 4356 |
| 350 | Ga0466966_0179816 | 3300044684 | Bacteria | 1284 |
| 351 | Ga0466963_0011432 | 3300044694 | Bacteria | 5406 |
| 352 | Ga0466963_0184538 | 3300044694 | Bacteria | 1457 |
| 353 | Ga0466964_0029921 | 3300044706 | Bacteria | 2153 |
| 354 | Ga0466970_0001023 | 3300044765 | Bacteria | 13499 |
| 355 | Ga0466970_0137425 | 3300044765 | Bacteria | 1345 |
| 356 | Ga0466957_0078419 | 3300044842 | Bacteria | 2054 |
| 357 | Ga0466957_0112681 | 3300044842 | Bacteria | 1726 |
| 358 | Ga0466959_0004980 | 3300045049 | Bacteria | 9007 |
| 359 | Ga0466959_0066626 | 3300045049 | Bacteria | 2612 |
| 360 | Ga0451576_0000728 | 3300045051 | Bacteria | 66112 |
| 361 | Ga0466958_0001498 | 3300045836 | Bacteria | 11165 |
| 362 | Ga0466967_0008489 | 3300045976 | Bacteria | 7538 |
| 363 | Ga0466967_0020180 | 3300045976 | Bacteria | 5378 |
| 364 | Ga0466967_0056104 | 3300045976 | Bacteria | 3472 |
| 365 | Ga0466967_0137853 | 3300045976 | Bacteria | 2270 |
| 366 | Ga0495617_005101 | 3300046452 | Bacteria | 4694 |
| 367 | Ga0495592_0115536 | 3300046454 | Bacteria | 1894 |
| 368 | Ga0495603_0001084 | 3300046455 | Bacteria | 15790 |
| 369 | Ga0495603_0009808 | 3300046455 | Bacteria | 5793 |
| 370 | Ga0495603_0011999 | 3300046455 | Bacteria | 5244 |
| 371 | Ga0495603_0125839 | 3300046455 | Bacteria | 1493 |
| 372 | Ga0495629_0000969 | 3300046459 | Bacteria | 23133 |
| 373 | Ga0495629_0005661 | 3300046459 | Bacteria | 9330 |
| 374 | Ga0495629_0063156 | 3300046459 | Bacteria | 2586 |
| 375 | Ga0495638_0221150 | 3300046460 | Bacteria | 1058 |
| 376 | Ga0495580_0029036 | 3300046472 | Bacteria | 4017 |
| 377 | Ga0495605_0007199 | 3300046474 | Bacteria | 6328 |
| 378 | Ga0495605_0020213 | 3300046474 | Bacteria | 3541 |
| 379 | Ga0495664_0089873 | 3300046477 | Bacteria | 1846 |
| 380 | Ga0495585_0010652 | 3300046492 | Bacteria | 5463 |
| 381 | Ga0495585_0014469 | 3300046492 | Bacteria | 4596 |
| 382 | Ga0495594_0006953 | 3300046499 | Bacteria | 5819 |
| 383 | Ga0495594_0046622 | 3300046499 | Bacteria | 2380 |
| 384 | Ga0495594_0088487 | 3300046499 | Bacteria | 1734 |
| 385 | Ga0495607_0010357 | 3300046501 | Bacteria | 6273 |
| 386 | Ga0495607_0061799 | 3300046501 | Bacteria | 2127 |
| 387 | Ga0495607_0069230 | 3300046501 | Bacteria | 1976 |
| 388 | Ga0495583_0000957 | 3300046506 | Bacteria | 33535 |
| 389 | Ga0495583_0049069 | 3300046506 | Bacteria | 1935 |
| 390 | Ga0495583_0086514 | 3300046506 | Bacteria | 1355 |
| 391 | Ga0495606_0000629 | 3300046507 | Bacteria | 55524 |
| 392 | Ga0495606_0007570 | 3300046507 | Bacteria | 9674 |
| 393 | Ga0495606_0018560 | 3300046507 | Bacteria | 5209 |
| 394 | Ga0495608_0352884 | 3300046511 | Bacteria | 905 |
| 395 | Ga0495610_0078468 | 3300046512 | Bacteria | 1522 |
| 396 | Ga0495610_0113460 | 3300046512 | Bacteria | 1197 |
| 397 | Ga0495616_0062694 | 3300046513 | Bacteria | 1819 |
| 398 | Ga0495620_0032466 | 3300046515 | Bacteria | 2378 |
| 399 | Ga0495620_0086981 | 3300046515 | Bacteria | 1257 |
| 400 | Ga0495628_0142566 | 3300046516 | Bacteria | 1828 |
| 401 | Ga0495631_0006341 | 3300046518 | Bacteria | 6116 |
| 402 | Ga0495631_0008404 | 3300046518 | Bacteria | 5203 |
| 403 | Ga0495631_0022726 | 3300046518 | Bacteria | 2915 |
| 404 | Ga0495632_0149825 | 3300046519 | Bacteria | 1079 |
| 405 | Ga0495643_0002781 | 3300046522 | Bacteria | 13374 |
| 406 | Ga0495643_0007574 | 3300046522 | Bacteria | 6985 |
| 407 | Ga0495640_0019978 | 3300046533 | Bacteria | 4938 |
| 408 | Ga0495609_0016992 | 3300046538 | Bacteria | 3385 |
| 409 | Ga0495597_0078407 | 3300046542 | Bacteria | 1415 |
| 410 | Ga0495645_0369096 | 3300046543 | Bacteria | 921 |
| 411 | Ga0495622_0002853 | 3300046557 | Bacteria | 8247 |
| 412 | Ga0495633_0017216 | 3300046558 | Bacteria | 3703 |
| 413 | Ga0495633_0068885 | 3300046558 | Bacteria | 1651 |
| 414 | Ga0495668_0065114 | 3300046616 | Bacteria | 2006 |
| 415 | Ga0495611_0020459 | 3300046648 | Bacteria | 2848 |
| 416 | Ga0495611_0101322 | 3300046648 | Bacteria | 1337 |
| 417 | Ga0495611_0118875 | 3300046648 | Bacteria | 1232 |
| 418 | Ga0495625_0004033 | 3300046660 | Bacteria | 14035 |
| 419 | Ga0495625_0040600 | 3300046660 | Bacteria | 3391 |
| 420 | Ga0495625_0044687 | 3300046660 | Bacteria | 3205 |
| 421 | Ga0495635_0008411 | 3300046663 | Bacteria | 7203 |
| 422 | Ga0495661_0173043 | 3300046665 | Bacteria | 1150 |
| 423 | Ga0495588_0012531 | 3300046674 | Bacteria | 4011 |
| 424 | Ga0495623_0162739 | 3300046679 | Bacteria | 1310 |
| 425 | Ga0495613_0003773 | 3300046689 | Bacteria | 11354 |
| 426 | Ga0495613_0030790 | 3300046689 | Bacteria | 3985 |
| 427 | Ga0495613_0071021 | 3300046689 | Bacteria | 2538 |
| 428 | Ga0495624_0191909 | 3300046690 | Bacteria | 1242 |
| 429 | Ga0495589_0009836 | 3300046794 | Bacteria | 4966 |
| 430 | Ga0495589_0017999 | 3300046794 | Bacteria | 3625 |
| 431 | Ga0495589_0034934 | 3300046794 | Bacteria | 2521 |
| 432 | Ga0495660_0136064 | 3300046810 | Bacteria | 1227 |
| 433 | Ga0495604_0050921 | 3300047317 | Bacteria | 3213 |
| 434 | Ga0495636_0012997 | 3300047318 | Bacteria | 3300 |
| 435 | Ga0495676_0001692 | 3300047321 | Bacteria | 19269 |
| 436 | Ga0495676_0016892 | 3300047321 | Bacteria | 6461 |
| 437 | Ga0495676_0023609 | 3300047321 | Bacteria | 5333 |
| 438 | Ga0495676_0062232 | 3300047321 | Bacteria | 2914 |
| 439 | Ga0495676_0143510 | 3300047321 | Bacteria | 1708 |
| 440 | Ga0495680_0005861 | 3300047322 | Bacteria | 11494 |
| 441 | Ga0495687_017921 | 3300047443 | Bacteria | 3514 |
| 442 | Ga0495687_027715 | 3300047443 | Bacteria | 2647 |
| 443 | Ga0495685_003784 | 3300047447 | Bacteria | 4845 |
| 444 | Ga0495685_049462 | 3300047447 | Bacteria | 1428 |
| 445 | Ga0495686_0027328 | 3300047472 | Bacteria | 3727 |
| 446 | Ga0495593_0013554 | 3300047673 | Bacteria | 4647 |
| 447 | Ga0495614_0000140 | 3300048089 | Bacteria | 25879 |
| 448 | Ga0495614_0033185 | 3300048089 | Bacteria | 2220 |
| 449 | Ga0495626_0039871 | 3300048091 | Bacteria | 2220 |
| 450 | Ga0496101_0155207 | 3300048904 | Bacteria | 1753 |
| 451 | Ga0496102_0028385 | 3300048905 | Bacteria | 4997 |
| 452 | Ga0496103_0017891 | 3300048906 | Bacteria | 4247 |
| 453 | Ga0496104_0013612 | 3300048907 | Bacteria | 7333 |
| 454 | Ga0496104_0017153 | 3300048907 | Bacteria | 6586 |
| 455 | Ga0496105_0019233 | 3300048908 | Bacteria | 5507 |
| 456 | Ga0496105_0067328 | 3300048908 | Bacteria | 2957 |
| 457 | Ga0496106_0013309 | 3300048909 | Bacteria | 6072 |
| 458 | Ga0496109_0044452 | 3300048912 | Bacteria | 4029 |
| 459 | Ga0496110_0029256 | 3300048913 | Bacteria | 4739 |
| 460 | Ga0496111_0085558 | 3300048914 | Bacteria | 2305 |
| 461 | Ga0496112_0127004 | 3300048915 | Bacteria | 2520 |
| 462 | Ga0496113_0014458 | 3300048916 | Bacteria | 5385 |
| 463 | Ga0496114_0077243 | 3300048917 | Bacteria | 2807 |
| 464 | Ga0496116_0010532 | 3300048919 | Bacteria | 7733 |
| 465 | Ga0496116_0049741 | 3300048919 | Bacteria | 2799 |
| 466 | Ga0496116_0144546 | 3300048919 | Bacteria | 1331 |
| 467 | Ga0496117_0000490 | 3300048920 | Bacteria | 65377 |
| 468 | Ga0496117_0006361 | 3300048920 | Bacteria | 11999 |
| 469 | Ga0496118_0001723 | 3300048921 | Bacteria | 31871 |
| 470 | Ga0496118_0010730 | 3300048921 | Bacteria | 9032 |
| 471 | Ga0496118_0032523 | 3300048921 | Bacteria | 4295 |
| 472 | Ga0496119_0004038 | 3300048922 | Bacteria | 14823 |
| 473 | Ga0496119_0021845 | 3300048922 | Bacteria | 4606 |
| 474 | Ga0496120_0109519 | 3300048923 | Bacteria | 1445 |
| 475 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 476 | Ga0496121_0064241 | 3300048924 | Bacteria | 2994 |
| 477 | Ga0496121_0068655 | 3300048924 | Bacteria | 2866 |
| 478 | Ga0496121_0315917 | 3300048924 | Bacteria | 1054 |
| 479 | Ga0496122_0000713 | 3300048925 | Bacteria | 65631 |
| 480 | Ga0496122_0000889 | 3300048925 | Bacteria | 55661 |
| 481 | Ga0496122_0006813 | 3300048925 | Bacteria | 12965 |
| 482 | Ga0496122_0021866 | 3300048925 | Bacteria | 5706 |
| 483 | Ga0496123_0000530 | 3300048926 | Bacteria | 65631 |
| 484 | Ga0496123_0001604 | 3300048926 | Bacteria | 30647 |
| 485 | Ga0496123_0030341 | 3300048926 | Bacteria | 3959 |
| 486 | Ga0496124_0000023 | 3300048927 | Bacteria | 415226 |
| 487 | Ga0496124_0018647 | 3300048927 | Bacteria | 6492 |
| 488 | Ga0496124_0020905 | 3300048927 | Bacteria | 6038 |
| 489 | Ga0496124_0026422 | 3300048927 | Bacteria | 5234 |
| 490 | Ga0496125_0000034 | 3300048928 | Bacteria | 348231 |
| 491 | Ga0496125_0074187 | 3300048928 | Bacteria | 2639 |
| 492 | Ga0496126_0040009 | 3300048929 | Bacteria | 4347 |
| 493 | Ga0496126_0068197 | 3300048929 | Bacteria | 3176 |
| 494 | Ga0495678_048866 | 3300049459 | Bacteria | 1647 |
| 495 | Ga0495682_0089660 | 3300049460 | Bacteria | 1105 |
| 496 | Ga0501033_0051998 | 3300049570 | Bacteria | 3036 |
| 497 | Ga0501034_0314043 | 3300049571 | Bacteria | 1501 |
| 498 | Ga0501036_0233797 | 3300049572 | Bacteria | 1542 |
| 499 | Ga0501037_0034694 | 3300049573 | Bacteria | 3722 |
| 500 | Ga0501037_0208391 | 3300049573 | Bacteria | 1379 |
| 501 | Ga0501038_0176072 | 3300049574 | Bacteria | 1729 |
| 502 | Ga0501040_0332878 | 3300049576 | Bacteria | 1087 |
| 503 | Ga0501043_0111379 | 3300049579 | Bacteria | 2149 |
| 504 | Ga0501047_0061127 | 3300049581 | Bacteria | 3635 |
| 505 | Ga0501067_0154650 | 3300049583 | Bacteria | 1278 |
| 506 | Ga0501070_0001012 | 3300049586 | Bacteria | 25214 |
| 507 | Ga0501070_0070206 | 3300049586 | Bacteria | 2900 |
| 508 | Ga0501073_0037477 | 3300049589 | Bacteria | 3443 |
| 509 | Ga0501073_0284697 | 3300049589 | Bacteria | 1140 |
| 510 | Ga0501080_0002221 | 3300049742 | Bacteria | 16875 |
| 511 | Ga0501080_0038967 | 3300049742 | Bacteria | 4435 |
| 512 | Ga0501080_0065598 | 3300049742 | Bacteria | 3377 |
| 513 | Ga0501035_0001616 | 3300049822 | Bacteria | 22785 |
| 514 | Ga0501035_0003264 | 3300049822 | Bacteria | 15543 |
| 515 | Ga0501035_0229987 | 3300049822 | Bacteria | 1580 |
| 516 | Ga0501044_0029725 | 3300049823 | Bacteria | 5761 |
| 517 | Ga0501044_0334503 | 3300049823 | Bacteria | 1436 |
| 518 | nmdc:mga03683_111860_c1 | 3300050489 | Bacteria | 1208 |
| 519 | nmdc:mga03683_121977_c1 | 3300050489 | Bacteria | 1159 |
| 520 | nmdc:mga03n38_138273_c1 | 3300050490 | Bacteria | 1214 |
| 521 | nmdc:mga03n38_62682_c1 | 3300050490 | Bacteria | 1697 |
| 522 | nmdc:mga00v17_203108_c1 | 3300050491 | Bacteria | 1281 |
| 523 | nmdc:mga00v17_646_c1 | 3300050491 | Bacteria | 13371 |
| 524 | nmdc:mga0yw44_238510_c1 | 3300050492 | Bacteria | 1208 |
| 525 | nmdc:mga0yw44_3758_c1 | 3300050492 | Bacteria | 6805 |
| 526 | nmdc:mga0yw44_94297_c1 | 3300050492 | Bacteria | 1897 |
| 527 | nmdc:mga0k408_18904_c2 | 3300050493 | Bacteria | 3488 |
| 528 | nmdc:mga0k408_23600_c1 | 3300050493 | Bacteria | 3472 |
| 529 | nmdc:mga06z11_43556_c1 | 3300050494 | Bacteria | 2259 |
| 530 | nmdc:mga06z11_805_c1 | 3300050494 | Bacteria | 11453 |
| 531 | nmdc:mga07m45_21616_c1 | 3300050496 | Bacteria | 3505 |
| 532 | nmdc:mga07m45_78130_c1 | 3300050496 | Bacteria | 1888 |
| 533 | nmdc:mga05p37_150855_c1 | 3300050507 | Bacteria | 2843 |
| 534 | nmdc:mga05p37_200365_c1 | 3300050507 | Bacteria | 2418 |
| 535 | nmdc:mga05p37_754224_c1 | 3300050507 | Bacteria | 1072 |
| 536 | nmdc:mga09592_139574_c1 | 3300050508 | Bacteria | 2088 |
| 537 | nmdc:mga06r32_95386_c1 | 3300050510 | Bacteria | 2911 |
| 538 | nmdc:mga08y16_15812_c1 | 3300050511 | Bacteria | 7934 |
| 539 | nmdc:mga08y16_61313_c1 | 3300050511 | Bacteria | 3928 |
| 540 | nmdc:mga0n895_16561_c1 | 3300050512 | Bacteria | 6769 |
| 541 | nmdc:mga0rr50_251722_c1 | 3300050513 | Bacteria | 1467 |
| 542 | nmdc:mga0rr50_30669_c1 | 3300050513 | Bacteria | 3810 |
| 543 | nmdc:mga08x19_48419_c1 | 3300050514 | Bacteria | 2724 |
| 544 | nmdc:mga0a205_4097_c1 | 3300050515 | Bacteria | 13041 |
| 545 | nmdc:mga0sz30_13108_c1 | 3300050516 | Bacteria | 3239 |
| 546 | Ga0500560_000280 | 3300053107 | Bacteria | 6426 |
| 547 | Ga0500569_000732 | 3300053109 | Bacteria | 5719 |
| 548 | Ga0500569_016177 | 3300053109 | Bacteria | 1884 |
| 549 | Ga0500572_002453 | 3300053111 | Bacteria | 4460 |
| 550 | Ga0500607_086890 | 3300053121 | Bacteria | 1582 |
| 551 | Ga0500658_0001505 | 3300053134 | Bacteria | 9334 |
| 552 | Ga0500559_0102027 | 3300053136 | Bacteria | 1322 |
| 553 | Ga0500568_0000524 | 3300053139 | Bacteria | 28340 |
| 554 | Ga0500604_0012916 | 3300053151 | Bacteria | 2260 |
| 555 | Ga0500616_0007896 | 3300053153 | Bacteria | 6687 |
| 556 | Ga0500622_0004526 | 3300053156 | Bacteria | 8683 |
| 557 | Ga0500624_000670 | 3300053157 | Bacteria | 8829 |
| 558 | Ga0500634_0000014 | 3300053161 | Bacteria | 114625 |
| 559 | Ga0500634_0001933 | 3300053161 | Bacteria | 8434 |
| 560 | Ga0500634_0014395 | 3300053161 | Bacteria | 4174 |
| 561 | Ga0501084_0292848 | 3300054114 | Bacteria | 1375 |
| 562 | Ga0587107_000520 | 3300059652 | Bacteria | 2570 |
| 563 | Ga0501082_0286147 | 3300060353 | Bacteria | 1435 |
| 564 | Ga0466962_0110345 | 3300061719 | Bacteria | 1324 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0176072 | Ga0501038_0176072_621_1310 | 214 |
| 2 | 3300014969 | Ga0157376_10444180 | Ga0157376_104441802 | 215 |
| 3 | 3300050492 | nmdc:mga0yw44_238510_c1 | nmdc:mga0yw44_238510_c1_18_731 | 221 |
| 4 | 3300038443 | Ga0395901_0407709 | Ga0395901_0407709_589_1344 | 224 |
| 5 | 3300048923 | Ga0496120_0109519 | Ga0496120_0109519_664_1410 | 232 |
| 6 | 3300009766 | Ga0123342_1005378 | Ga0123342_100537814 | 243 |
| 7 | 3300009545 | Ga0105237_10404796 | Ga0105237_104047962 | 245 |
| 8 | 3300025911 | Ga0207654_10344102 | Ga0207654_103441022 | 245 |
| 9 | 3300047443 | Ga0495687_027715 | Ga0495687_027715_1031_1882 | 245 |
| 10 | 3300046512 | Ga0495610_0113460 | Ga0495610_0113460_152_1003 | 246 |
| 11 | 3300003322 | rootL2_10314341 | rootL2_103143412 | 247 |
| 12 | 3300053107 | Ga0500560_000280 | Ga0500560_000280_4325_5119 | 248 |
| 13 | 3300053157 | Ga0500624_000670 | Ga0500624_000670_525_1319 | 248 |
| 14 | 3300053161 | Ga0500634_0014395 | Ga0500634_0014395_946_1740 | 248 |
| 15 | 3300007076 | Ga0075435_100408169 | Ga0075435_1004081691 | 249 |
| 16 | 3300050513 | nmdc:mga0rr50_251722_c1 | nmdc:mga0rr50_251722_c1_85_1038 | 249 |
| 17 | 3300050514 | nmdc:mga08x19_48419_c1 | nmdc:mga08x19_48419_c1_714_1667 | 249 |
| 18 | 3300005471 | Ga0070698_100001143 | Ga0070698_1000011433 | 250 |
| 19 | 3300005518 | Ga0070699_100141834 | Ga0070699_1001418342 | 250 |
| 20 | 3300050496 | nmdc:mga07m45_78130_c1 | nmdc:mga07m45_78130_c1_1059_1859 | 250 |
| 21 | 3300003322 | rootL2_10271270 | rootL2_102712702 | 251 |
| 22 | 3300005445 | Ga0070708_100010194 | Ga0070708_1000101945 | 251 |
| 23 | 3300005536 | Ga0070697_100168247 | Ga0070697_1001682472 | 251 |
| 24 | 3300025910 | Ga0207684_10055707 | Ga0207684_100557072 | 251 |
| 25 | 3300025922 | Ga0207646_10372445 | Ga0207646_103724452 | 251 |
| 26 | 3300033180 | Ga0307510_10141695 | Ga0307510_101416952 | 251 |
| 27 | 3300041486 | Ga0451807_0827308 | Ga0451807_0827308_80_880 | 251 |
| 28 | 3300014325 | Ga0163163_10791404 | Ga0163163_107914041 | 252 |
| 29 | 3300037471 | Ga0395905_0001510 | Ga0395905_0001510_15641_16492 | 252 |
| 30 | 3300049572 | Ga0501036_0233797 | Ga0501036_0233797_132_980 | 252 |
| 31 | 3300049573 | Ga0501037_0208391 | Ga0501037_0208391_229_1077 | 252 |
| 32 | 3300049579 | Ga0501043_0111379 | Ga0501043_0111379_696_1544 | 252 |
| 33 | 3300049581 | Ga0501047_0061127 | Ga0501047_0061127_323_1171 | 252 |
| 34 | 3300049583 | Ga0501067_0154650 | Ga0501067_0154650_106_954 | 252 |
| 35 | 3300049586 | Ga0501070_0070206 | Ga0501070_0070206_484_1332 | 252 |
| 36 | 3300049589 | Ga0501073_0284697 | Ga0501073_0284697_143_991 | 252 |
| 37 | 3300049742 | Ga0501080_0038967 | Ga0501080_0038967_1468_2316 | 252 |
| 38 | 3300049822 | Ga0501035_0003264 | Ga0501035_0003264_613_1461 | 252 |
| 39 | 3300049822 | Ga0501035_0229987 | Ga0501035_0229987_37_885 | 252 |
| 40 | 3300049823 | Ga0501044_0334503 | Ga0501044_0334503_422_1270 | 252 |
| 41 | 3300060353 | Ga0501082_0286147 | Ga0501082_0286147_487_1335 | 252 |
| 42 | 3300031901 | Ga0307406_10004162 | Ga0307406_100041624 | 253 |
| 43 | 3300048919 | Ga0496116_0010532 | Ga0496116_0010532_4778_5629 | 253 |
| 44 | 3300048920 | Ga0496117_0006361 | Ga0496117_0006361_1638_2489 | 253 |
| 45 | 3300048921 | Ga0496118_0010730 | Ga0496118_0010730_3088_3939 | 253 |
| 46 | 3300048924 | Ga0496121_0068655 | Ga0496121_0068655_743_1594 | 253 |
| 47 | 3300048925 | Ga0496122_0000889 | Ga0496122_0000889_18782_19633 | 253 |
| 48 | 3300048926 | Ga0496123_0030341 | Ga0496123_0030341_1788_2639 | 253 |
| 49 | 3300048927 | Ga0496124_0000023 | Ga0496124_0000023_281033_281884 | 253 |
| 50 | 3300046460 | Ga0495638_0221150 | Ga0495638_0221150_188_1003 | 254 |
| 51 | 3300046511 | Ga0495608_0352884 | Ga0495608_0352884_68_883 | 254 |
| 52 | 3300046519 | Ga0495632_0149825 | Ga0495632_0149825_24_839 | 254 |
| 53 | 3300046665 | Ga0495661_0173043 | Ga0495661_0173043_265_1080 | 254 |
| 54 | 3300046690 | Ga0495624_0191909 | Ga0495624_0191909_405_1220 | 254 |
| 55 | 3300049460 | Ga0495682_0089660 | Ga0495682_0089660_237_1052 | 254 |
| 56 | 3300053161 | Ga0500634_0000014 | Ga0500634_0000014_93351_94202 | 254 |
| 57 | 3300003775 | Ga0055524_1009862 | Ga0055524_10098622 | 257 |
| 58 | 3300006038 | Ga0075365_10000942 | Ga0075365_100009422 | 257 |
| 59 | 3300009101 | Ga0105247_10024836 | Ga0105247_100248362 | 257 |
| 60 | 3300025273 | Ga0209673_1001803 | Ga0209673_10018032 | 257 |
| 61 | 3300025291 | Ga0209675_1033537 | Ga0209675_10335372 | 257 |
| 62 | 3300025295 | Ga0209564_1000458 | Ga0209564_100045870 | 257 |
| 63 | 3300025299 | Ga0209256_1011158 | Ga0209256_10111583 | 257 |
| 64 | 3300050492 | nmdc:mga0yw44_94297_c1 | nmdc:mga0yw44_94297_c1_911_1762 | 257 |
| 65 | 3300037418 | Ga0395900_0500824 | Ga0395900_0500824_302_1129 | 258 |
| 66 | 3300046543 | Ga0495645_0369096 | Ga0495645_0369096_61_891 | 259 |
| 67 | 3300046648 | Ga0495611_0118875 | Ga0495611_0118875_387_1217 | 259 |
| 68 | iso_pu_bacteria | 2871488783 | 2871494251 | 260 |
| 69 | iso_pu_bacteria | 2968003550 | 2968009334 | 260 |
| 70 | iso_pu_bacteria | 2818991472 | 2819745251 | 261 |
| 71 | iso_pu_bacteria | 2899275550 | 2899275643 | 261 |
| 72 | 3300036712 | Ga0316584_0215676 | Ga0316584_0215676_514_1359 | 262 |
| 73 | 3300039062 | Ga0400483_036442 | Ga0400483_036442_349_1197 | 262 |
| 74 | 3300039062 | Ga0400483_056151 | Ga0400483_056151_91_939 | 262 |
| 75 | 3300039062 | Ga0400483_089304 | Ga0400483_089304_602_1450 | 262 |
| 76 | 3300039062 | Ga0400483_249541 | Ga0400483_249541_189_1037 | 262 |
| 77 | 3300045051 | Ga0451576_0000728 | Ga0451576_0000728_38305_39150 | 262 |
| 78 | iso_pu_bacteria | 2508501122 | 2509111123 | 262 |
| 79 | iso_pu_bacteria | 2509276021 | 2509392261 | 262 |
| 80 | iso_pu_bacteria | 2509276033 | 2509446787 | 262 |
| 81 | iso_pu_bacteria | 2510065019 | 2510133731 | 262 |
| 82 | iso_pu_bacteria | 2510065057 | 2510304872 | 262 |
| 83 | iso_pu_bacteria | 2510461076 | 2510895162 | 262 |
| 84 | iso_pu_bacteria | 2510917022 | 2511135686 | 262 |
| 85 | iso_pu_bacteria | 2510917028 | 2511181341 | 262 |
| 86 | iso_pu_bacteria | 2510917030 | 2511199881 | 262 |
| 87 | iso_pu_bacteria | 2511231052 | 2511499246 | 262 |
| 88 | iso_pu_bacteria | 2512047086 | 2512530401 | 262 |
| 89 | iso_pu_bacteria | 2513237084 | 2513574024 | 262 |
| 90 | iso_pu_bacteria | 2513237085 | 2513576750 | 262 |
| 91 | iso_pu_bacteria | 2513237091 | 2513618671 | 262 |
| 92 | iso_pu_bacteria | 2513237093 | 2513629617 | 262 |
| 93 | iso_pu_bacteria | 2513237103 | 2513708268 | 262 |
| 94 | iso_pu_bacteria | 2513237138 | 2513869804 | 262 |
| 95 | iso_pu_bacteria | 2513237140 | 2513883262 | 262 |
| 96 | iso_pu_bacteria | 2513237143 | 2513902714 | 262 |
| 97 | iso_pu_bacteria | 2513237144 | 2513911691 | 262 |
| 98 | iso_pu_bacteria | 2513237162 | 2514020216 | 262 |
| 99 | iso_pu_bacteria | 2515075009 | 2515112766 | 262 |
| 100 | iso_pu_bacteria | 2515154113 | 2515634076 | 262 |
| 101 | iso_pu_bacteria | 2515154114 | 2515640743 | 262 |
| 102 | iso_pu_bacteria | 2515154116 | 2515655566 | 262 |
| 103 | iso_pu_bacteria | 2515154134 | 2515744048 | 262 |
| 104 | iso_pu_bacteria | 2516143018 | 2516205079 | 262 |
| 105 | iso_pu_bacteria | 2516653046 | 2516897985 | 262 |
| 106 | iso_pu_bacteria | 2516653077 | 2517036483 | 262 |
| 107 | iso_pu_bacteria | 2516653085 | 2517076872 | 262 |
| 108 | iso_pu_bacteria | 2517093000 | 2517095617 | 262 |
| 109 | iso_pu_bacteria | 2517287029 | 2517407188 | 262 |
| 110 | iso_pu_bacteria | 2519899620 | 2520381582 | 262 |
| 111 | iso_pu_bacteria | 2523231067 | 2523468490 | 262 |
| 112 | iso_pu_bacteria | 2524023207 | 2524452272 | 262 |
| 113 | iso_pu_bacteria | 2524023209 | 2524457484 | 262 |
| 114 | iso_pu_bacteria | 2529292951 | 2530646206 | 262 |
| 115 | iso_pu_bacteria | 2551306089 | 2551715667 | 262 |
| 116 | iso_pu_bacteria | 2551306091 | 2551729307 | 262 |
| 117 | iso_pu_bacteria | 2582581298 | 2585227354 | 262 |
| 118 | iso_pu_bacteria | 2582581299 | 2585229475 | 262 |
| 119 | iso_pu_bacteria | 2582581306 | 2585265235 | 262 |
| 120 | iso_pu_bacteria | 2582581307 | 2585272761 | 262 |
| 121 | iso_pu_bacteria | 2582581308 | 2585281262 | 262 |
| 122 | iso_pu_bacteria | 2582581315 | 2585327370 | 262 |
| 123 | iso_pu_bacteria | 2582581865 | 2585385631 | 262 |
| 124 | iso_pu_bacteria | 2582581866 | 2585395063 | 262 |
| 125 | iso_pu_bacteria | 2582581867 | 2585404423 | 262 |
| 126 | iso_pu_bacteria | 2585427526 | 2585527248 | 262 |
| 127 | iso_pu_bacteria | 2585427527 | 2585536077 | 262 |
| 128 | iso_pu_bacteria | 2585427528 | 2585537979 | 262 |
| 129 | iso_pu_bacteria | 2585427529 | 2585550768 | 262 |
| 130 | iso_pu_bacteria | 2585427530 | 2585557388 | 262 |
| 131 | iso_pu_bacteria | 2585427531 | 2585562429 | 262 |
| 132 | iso_pu_bacteria | 2585427590 | 2585824741 | 262 |
| 133 | iso_pu_bacteria | 2585427593 | 2585835927 | 262 |
| 134 | iso_pu_bacteria | 2585427594 | 2585846094 | 262 |
| 135 | iso_pu_bacteria | 2585427608 | 2585896877 | 262 |
| 136 | iso_pu_bacteria | 2585427609 | 2585906404 | 262 |
| 137 | iso_pu_bacteria | 2585428062 | 2587758567 | 262 |
| 138 | iso_pu_bacteria | 2585428125 | 2587981826 | 262 |
| 139 | iso_pu_bacteria | 2599185156 | 2599336226 | 262 |
| 140 | iso_pu_bacteria | 2615840624 | 2616297973 | 262 |
| 141 | iso_pu_bacteria | 2615840626 | 2616310936 | 262 |
| 142 | iso_pu_bacteria | 2615840698 | 2616555617 | 262 |
| 143 | iso_pu_bacteria | 2617270742 | 2617385554 | 262 |
| 144 | iso_pu_bacteria | 2643221591 | 2643965447 | 262 |
| 145 | iso_pu_bacteria | 2643221599 | 2644005432 | 262 |
| 146 | iso_pu_bacteria | 2643221644 | 2644245895 | 262 |
| 147 | iso_pu_bacteria | 2643221698 | 2644542304 | 262 |
| 148 | iso_pu_bacteria | 2667528174 | 2671114395 | 262 |
| 149 | iso_pu_bacteria | 2690316117 | 2692318002 | 262 |
| 150 | iso_pu_bacteria | 2718217882 | 2719181607 | 262 |
| 151 | iso_pu_bacteria | 2718217927 | 2719386136 | 262 |
| 152 | iso_pu_bacteria | 2718217997 | 2719665951 | 262 |
| 153 | iso_pu_bacteria | 2718218009 | 2719732271 | 262 |
| 154 | iso_pu_bacteria | 2718218199 | 2720492371 | 262 |
| 155 | iso_pu_bacteria | 2718218232 | 2720613723 | 262 |
| 156 | iso_pu_bacteria | 2718218233 | 2720620513 | 262 |
| 157 | iso_pu_bacteria | 2718218235 | 2720631933 | 262 |
| 158 | iso_pu_bacteria | 2718218269 | 2720775661 | 262 |
| 159 | iso_pu_bacteria | 2718218363 | 2721147699 | 262 |
| 160 | iso_pu_bacteria | 2718218365 | 2721159149 | 262 |
| 161 | iso_pu_bacteria | 2718218366 | 2721164534 | 262 |
| 162 | iso_pu_bacteria | 2718218423 | 2721399918 | 262 |
| 163 | iso_pu_bacteria | 2721755514 | 2722840704 | 262 |
| 164 | iso_pu_bacteria | 2721755556 | 2723027271 | 262 |
| 165 | iso_pu_bacteria | 2721755684 | 2723560887 | 262 |
| 166 | iso_pu_bacteria | 2721755685 | 2723567480 | 262 |
| 167 | iso_pu_bacteria | 2721755809 | 2724038731 | 262 |
| 168 | iso_pu_bacteria | 2721755810 | 2724045027 | 262 |
| 169 | iso_pu_bacteria | 2721755819 | 2724090268 | 262 |
| 170 | iso_pu_bacteria | 2721755822 | 2724104745 | 262 |
| 171 | iso_pu_bacteria | 2721755823 | 2724110552 | 262 |
| 172 | iso_pu_bacteria | 2724679232 | 2725949985 | 262 |
| 173 | iso_pu_bacteria | 2728369352 | 2730108207 | 262 |
| 174 | iso_pu_bacteria | 2728369365 | 2730164842 | 262 |
| 175 | iso_pu_bacteria | 2728369397 | 2730298781 | 262 |
| 176 | iso_pu_bacteria | 2738541333 | 2739032638 | 262 |
| 177 | iso_pu_bacteria | 2738543031 | 2739348292 | 262 |
| 178 | iso_pu_bacteria | 2765235942 | 2766066671 | 262 |
| 179 | iso_pu_bacteria | 2775507266 | 2778176614 | 262 |
| 180 | iso_pu_bacteria | 2791355256 | 2793298772 | 262 |
| 181 | iso_pu_bacteria | 2791355259 | 2793318836 | 262 |
| 182 | iso_pu_bacteria | 2791355261 | 2793331888 | 262 |
| 183 | iso_pu_bacteria | 2791355262 | 2793337619 | 262 |
| 184 | iso_pu_bacteria | 2791355263 | 2793344331 | 262 |
| 185 | iso_pu_bacteria | 2791355264 | 2793351063 | 262 |
| 186 | iso_pu_bacteria | 2791355266 | 2793363884 | 262 |
| 187 | iso_pu_bacteria | 2791355267 | 2793367143 | 262 |
| 188 | iso_pu_bacteria | 2802429605 | 2805932092 | 262 |
| 189 | iso_pu_bacteria | 2802429606 | 2805935963 | 262 |
| 190 | iso_pu_bacteria | 2802429633 | 2806043617 | 262 |
| 191 | iso_pu_bacteria | 2802429634 | 2806050452 | 262 |
| 192 | iso_pu_bacteria | 2802429635 | 2806057269 | 262 |
| 193 | iso_pu_bacteria | 2802429636 | 2806064648 | 262 |
| 194 | iso_pu_bacteria | 2802429637 | 2806071915 | 262 |
| 195 | iso_pu_bacteria | 2808606387 | 2808990071 | 262 |
| 196 | iso_pu_bacteria | 2818991448 | 2819610181 | 262 |
| 197 | iso_pu_bacteria | 2818991453 | 2819643947 | 262 |
| 198 | iso_pu_bacteria | 2838016132 | 2838017861 | 262 |
| 199 | iso_pu_bacteria | 2838022645 | 2838028711 | 262 |
| 200 | iso_pu_bacteria | 2838029111 | 2838030484 | 262 |
| 201 | iso_pu_bacteria | 2838042994 | 2838043778 | 262 |
| 202 | iso_pu_bacteria | 2838048938 | 2838051841 | 262 |
| 203 | iso_pu_bacteria | 2838061910 | 2838066265 | 262 |
| 204 | iso_pu_bacteria | 2838068647 | 2838074508 | 262 |
| 205 | iso_pu_bacteria | 2838668709 | 2838674219 | 262 |
| 206 | iso_pu_bacteria | 2838686498 | 2838687250 | 262 |
| 207 | iso_pu_bacteria | 2838701080 | 2838706535 | 262 |
| 208 | iso_pu_bacteria | 2838729681 | 2838729778 | 262 |
| 209 | iso_pu_bacteria | 2838742623 | 2838743207 | 262 |
| 210 | iso_pu_bacteria | 2841851746 | 2841852693 | 262 |
| 211 | iso_pu_bacteria | 2841864319 | 2841869997 | 262 |
| 212 | iso_pu_bacteria | 2842110456 | 2842114758 | 262 |
| 213 | iso_pu_bacteria | 2842146304 | 2842151270 | 262 |
| 214 | iso_pu_bacteria | 2842156927 | 2842156952 | 262 |
| 215 | iso_pu_bacteria | 2842163707 | 2842167609 | 262 |
| 216 | iso_pu_bacteria | 2842180545 | 2842181465 | 262 |
| 217 | iso_pu_bacteria | 2842192696 | 2842198770 | 262 |
| 218 | iso_pu_bacteria | 2842198810 | 2842204939 | 262 |
| 219 | iso_pu_bacteria | 2842205361 | 2842205695 | 262 |
| 220 | iso_pu_bacteria | 2842217011 | 2842217708 | 262 |
| 221 | iso_pu_bacteria | 2842229732 | 2842230483 | 262 |
| 222 | iso_pu_bacteria | 2842243621 | 2842244385 | 262 |
| 223 | iso_pu_bacteria | 2842250916 | 2842256413 | 262 |
| 224 | iso_pu_bacteria | 2842257432 | 2842257529 | 262 |
| 225 | iso_pu_bacteria | 2842264693 | 2842265694 | 262 |
| 226 | iso_pu_bacteria | 2842271015 | 2842271212 | 262 |
| 227 | iso_pu_bacteria | 2842278818 | 2842279152 | 262 |
| 228 | iso_pu_bacteria | 2842285085 | 2842285805 | 262 |
| 229 | iso_pu_bacteria | 2842298080 | 2842298958 | 262 |
| 230 | iso_pu_bacteria | 2842304105 | 2842304837 | 262 |
| 231 | iso_pu_bacteria | 2842311132 | 2842316630 | 262 |
| 232 | iso_pu_bacteria | 2842317721 | 2842320493 | 262 |
| 233 | iso_pu_bacteria | 2842341865 | 2842348620 | 262 |
| 234 | iso_pu_bacteria | 2842357229 | 2842358423 | 262 |
| 235 | iso_pu_bacteria | 2842363717 | 2842369768 | 262 |
| 236 | iso_pu_bacteria | 2842395702 | 2842401402 | 262 |
| 237 | iso_pu_bacteria | 2842402390 | 2842403165 | 262 |
| 238 | iso_pu_bacteria | 2842409023 | 2842409462 | 262 |
| 239 | iso_pu_bacteria | 2842415677 | 2842416115 | 262 |
| 240 | iso_pu_bacteria | 2842422224 | 2842428239 | 262 |
| 241 | iso_pu_bacteria | 2842428310 | 2842429669 | 262 |
| 242 | iso_pu_bacteria | 2842434925 | 2842436282 | 262 |
| 243 | iso_pu_bacteria | 2842441272 | 2842442629 | 262 |
| 244 | iso_pu_bacteria | 2842447887 | 2842452984 | 262 |
| 245 | iso_pu_bacteria | 2842462802 | 2842464090 | 262 |
| 246 | iso_pu_bacteria | 2842469257 | 2842470611 | 262 |
| 247 | iso_pu_bacteria | 2842475841 | 2842477235 | 262 |
| 248 | iso_pu_bacteria | 2842489311 | 2842490363 | 262 |
| 249 | iso_pu_bacteria | 2842495871 | 2842497043 | 262 |
| 250 | iso_pu_bacteria | 2842502639 | 2842504032 | 262 |
| 251 | iso_pu_bacteria | 2842509118 | 2842513664 | 262 |
| 252 | iso_pu_bacteria | 2844454524 | 2844458616 | 262 |
| 253 | iso_pu_bacteria | 2847417321 | 2847423495 | 262 |
| 254 | iso_pu_bacteria | 2847670302 | 2847670318 | 262 |
| 255 | iso_pu_bacteria | 2847686936 | 2847691987 | 262 |
| 256 | iso_pu_bacteria | 2852387548 | 2852395161 | 262 |
| 257 | iso_pu_bacteria | 2854911287 | 2854915964 | 262 |
| 258 | iso_pu_bacteria | 2855839649 | 2855844879 | 262 |
| 259 | iso_pu_bacteria | 2856314179 | 2856320214 | 262 |
| 260 | iso_pu_bacteria | 2857349434 | 2857357323 | 262 |
| 261 | iso_pu_bacteria | 2857516855 | 2857517649 | 262 |
| 262 | iso_pu_bacteria | 2858800743 | 2858804763 | 262 |
| 263 | iso_pu_bacteria | 2871444079 | 2871444281 | 262 |
| 264 | iso_pu_bacteria | 2874102143 | 2874102484 | 262 |
| 265 | iso_pu_bacteria | 2876392853 | 2876399837 | 262 |
| 266 | iso_pu_bacteria | 2878035449 | 2878042522 | 262 |
| 267 | iso_pu_bacteria | 2878753008 | 2878759086 | 262 |
| 268 | iso_pu_bacteria | 2881845957 | 2881848793 | 262 |
| 269 | iso_pu_bacteria | 2881861095 | 2881865300 | 262 |
| 270 | iso_pu_bacteria | 2882912400 | 2882912769 | 262 |
| 271 | iso_pu_bacteria | 2885318864 | 2885320131 | 262 |
| 272 | iso_pu_bacteria | 2885342637 | 2885344669 | 262 |
| 273 | iso_pu_bacteria | 2903492973 | 2903503673 | 262 |
| 274 | iso_pu_bacteria | 2904659560 | 2904666360 | 262 |
| 275 | iso_pu_bacteria | 2906328253 | 2906330278 | 262 |
| 276 | iso_pu_bacteria | 2906414383 | 2906421007 | 262 |
| 277 | iso_pu_bacteria | 2915986958 | 2915987229 | 262 |
| 278 | iso_pu_bacteria | 2916000859 | 2916004302 | 262 |
| 279 | iso_pu_bacteria | 2916021584 | 2916025544 | 262 |
| 280 | iso_pu_bacteria | 2916028427 | 2916032401 | 262 |
| 281 | iso_pu_bacteria | 2916041962 | 2916047461 | 262 |
| 282 | iso_pu_bacteria | 2916048683 | 2916049470 | 262 |
| 283 | iso_pu_bacteria | 2916055098 | 2916056443 | 262 |
| 284 | iso_pu_bacteria | 2916076590 | 2916076709 | 262 |
| 285 | iso_pu_bacteria | 2919100787 | 2919108225 | 262 |
| 286 | iso_pu_bacteria | 2919408235 | 2919412274 | 262 |
| 287 | iso_pu_bacteria | 2921201388 | 2921204487 | 262 |
| 288 | iso_pu_bacteria | 2921208531 | 2921208535 | 262 |
| 289 | iso_pu_bacteria | 2921244191 | 2921248154 | 262 |
| 290 | iso_pu_bacteria | 2921257292 | 2921262873 | 262 |
| 291 | iso_pu_bacteria | 2921263974 | 2921265472 | 262 |
| 292 | iso_pu_bacteria | 2921282425 | 2921285732 | 262 |
| 293 | iso_pu_bacteria | 2922158528 | 2922165253 | 262 |
| 294 | iso_pu_bacteria | 2923556063 | 2923559865 | 262 |
| 295 | iso_pu_bacteria | 2924144063 | 2924145217 | 262 |
| 296 | iso_pu_bacteria | 2924172951 | 2924173989 | 262 |
| 297 | iso_pu_bacteria | 2924179722 | 2924181767 | 262 |
| 298 | iso_pu_bacteria | 2924193448 | 2924195592 | 262 |
| 299 | iso_pu_bacteria | 2924200457 | 2924201918 | 262 |
| 300 | iso_pu_bacteria | 2924207177 | 2924208559 | 262 |
| 301 | iso_pu_bacteria | 2924228884 | 2924231011 | 262 |
| 302 | iso_pu_bacteria | 2924726620 | 2924727526 | 262 |
| 303 | iso_pu_bacteria | 2924784321 | 2924789291 | 262 |
| 304 | iso_pu_bacteria | 2929138655 | 2929142624 | 262 |
| 305 | iso_pu_bacteria | 2933570622 | 2933570646 | 262 |
| 306 | iso_pu_bacteria | 2933586486 | 2933591131 | 262 |
| 307 | iso_pu_bacteria | 2933599457 | 2933604964 | 262 |
| 308 | iso_pu_bacteria | 2935901341 | 2935902157 | 262 |
| 309 | iso_pu_bacteria | 2936367885 | 2936372265 | 262 |
| 310 | iso_pu_bacteria | 2936375103 | 2936380929 | 262 |
| 311 | iso_pu_bacteria | 2936381700 | 2936386765 | 262 |
| 312 | iso_pu_bacteria | 2937009748 | 2937012005 | 262 |
| 313 | iso_pu_bacteria | 2937023124 | 2937027861 | 262 |
| 314 | iso_pu_bacteria | 2937042894 | 2937044230 | 262 |
| 315 | iso_pu_bacteria | 2937063883 | 2937065254 | 262 |
| 316 | iso_pu_bacteria | 2937071275 | 2937075572 | 262 |
| 317 | iso_pu_bacteria | 2937106411 | 2937106893 | 262 |
| 318 | iso_pu_bacteria | 2937113482 | 2937113860 | 262 |
| 319 | iso_pu_bacteria | 2937119839 | 2937121334 | 262 |
| 320 | iso_pu_bacteria | 2937126314 | 2937126358 | 262 |
| 321 | iso_pu_bacteria | 2937891427 | 2937893897 | 262 |
| 322 | iso_pu_bacteria | 2957382221 | 2957383964 | 262 |
| 323 | iso_pu_bacteria | 2957388812 | 2957391007 | 262 |
| 324 | iso_pu_bacteria | 2957395598 | 2957401001 | 262 |
| 325 | iso_pu_bacteria | 2957402308 | 2957405305 | 262 |
| 326 | iso_pu_bacteria | 2957408893 | 2957412651 | 262 |
| 327 | iso_pu_bacteria | 2957415311 | 2957415816 | 262 |
| 328 | iso_pu_bacteria | 2957443900 | 2957448200 | 262 |
| 329 | iso_pu_bacteria | 2957450854 | 2957453438 | 262 |
| 330 | iso_pu_bacteria | 2957457609 | 2957462391 | 262 |
| 331 | iso_pu_bacteria | 2957464669 | 2957468545 | 262 |
| 332 | iso_pu_bacteria | 2957478035 | 2957478040 | 262 |
| 333 | iso_pu_bacteria | 2957491536 | 2957493466 | 262 |
| 334 | iso_pu_bacteria | 2958115193 | 2958118193 | 262 |
| 335 | iso_pu_bacteria | 2960584000 | 2960588167 | 262 |
| 336 | iso_pu_bacteria | 2960597568 | 2960599035 | 262 |
| 337 | iso_pu_bacteria | 2960603979 | 2960606157 | 262 |
| 338 | iso_pu_bacteria | 2960610863 | 2960611452 | 262 |
| 339 | iso_pu_bacteria | 2960617483 | 2960620606 | 262 |
| 340 | iso_pu_bacteria | 2960637947 | 2960642986 | 262 |
| 341 | iso_pu_bacteria | 2960660292 | 2960665915 | 262 |
| 342 | iso_pu_bacteria | 2960667422 | 2960673685 | 262 |
| 343 | iso_pu_bacteria | 2960674078 | 2960680038 | 262 |
| 344 | iso_pu_bacteria | 2960687367 | 2960691175 | 262 |
| 345 | iso_pu_bacteria | 2961114664 | 2961114830 | 262 |
| 346 | iso_pu_bacteria | 2961170736 | 2961175742 | 262 |
| 347 | iso_pu_bacteria | 2964615318 | 2964621017 | 262 |
| 348 | iso_pu_bacteria | 2964621998 | 2964625764 | 262 |
| 349 | iso_pu_bacteria | 2964636051 | 2964640027 | 262 |
| 350 | iso_pu_bacteria | 2964663802 | 2964664618 | 262 |
| 351 | iso_pu_bacteria | 2964670856 | 2964676397 | 262 |
| 352 | iso_pu_bacteria | 2964685014 | 2964688644 | 262 |
| 353 | iso_pu_bacteria | 2964691889 | 2964694524 | 262 |
| 354 | iso_pu_bacteria | 2964698721 | 2964701028 | 262 |
| 355 | iso_pu_bacteria | 2964705432 | 2964705476 | 262 |
| 356 | iso_pu_bacteria | 2964712639 | 2964718324 | 262 |
| 357 | iso_pu_bacteria | 2964719344 | 2964726394 | 262 |
| 358 | iso_pu_bacteria | 2967664464 | 2967667908 | 262 |
| 359 | iso_pu_bacteria | 2967693043 | 2967693964 | 262 |
| 360 | iso_pu_bacteria | 2967699805 | 2967701492 | 262 |
| 361 | iso_pu_bacteria | 2967735183 | 2967737998 | 262 |
| 362 | iso_pu_bacteria | 2967748971 | 2967751279 | 262 |
| 363 | iso_pu_bacteria | 2967755722 | 2967762318 | 262 |
| 364 | iso_pu_bacteria | 2967769361 | 2967773689 | 262 |
| 365 | iso_pu_bacteria | 2967775926 | 2967776512 | 262 |
| 366 | iso_pu_bacteria | 2967996073 | 2968001722 | 262 |
| 367 | iso_pu_bacteria | 2968091066 | 2968092098 | 262 |
| 368 | iso_pu_bacteria | 2968097103 | 2968098599 | 262 |
| 369 | iso_pu_bacteria | 2968110612 | 2968117859 | 262 |
| 370 | iso_pu_bacteria | 2970033650 | 2970036543 | 262 |
| 371 | iso_pu_bacteria | 2970068827 | 2970072167 | 262 |
| 372 | iso_pu_bacteria | 2970076120 | 2970079978 | 262 |
| 373 | iso_pu_bacteria | 2970082768 | 2970085573 | 262 |
| 374 | iso_pu_bacteria | 2970095765 | 2970098115 | 262 |
| 375 | iso_pu_bacteria | 2970102677 | 2970107620 | 262 |
| 376 | iso_pu_bacteria | 2970129317 | 2970130739 | 262 |
| 377 | iso_pu_bacteria | 2970156795 | 2970157453 | 262 |
| 378 | iso_pu_bacteria | 2970164137 | 2970164173 | 262 |
| 379 | iso_pu_bacteria | 2970177841 | 2970180753 | 262 |
| 380 | iso_pu_bacteria | 2970503327 | 2970508407 | 262 |
| 381 | iso_pu_bacteria | 2977516862 | 2977518690 | 262 |
| 382 | iso_pu_bacteria | 2977523885 | 2977529672 | 262 |
| 383 | iso_pu_bacteria | 2977558990 | 2977562473 | 262 |
| 384 | iso_pu_bacteria | 2977565890 | 2977571132 | 262 |
| 385 | iso_pu_bacteria | 2977821940 | 2977827626 | 262 |
| 386 | iso_pu_bacteria | 2977828996 | 2977830644 | 262 |
| 387 | iso_pu_bacteria | 2977858184 | 2977863818 | 262 |
| 388 | iso_pu_bacteria | 2977864932 | 2977871466 | 262 |
| 389 | iso_pu_bacteria | 2977864932 | 2977872628 | 262 |
| 390 | iso_pu_bacteria | 2977942078 | 2977949335 | 262 |
| 391 | iso_pu_bacteria | 2979779861 | 2979781021 | 262 |
| 392 | iso_pu_bacteria | 2979808191 | 2979811944 | 262 |
| 393 | iso_pu_bacteria | 2987636660 | 2987644713 | 262 |
| 394 | iso_pu_bacteria | 2996341866 | 2996348769 | 262 |
| 395 | iso_pu_bacteria | 2996887358 | 2996888520 | 262 |
| 396 | iso_pu_bacteria | 2996893221 | 2996898637 | 262 |
| 397 | iso_pu_bacteria | 3000135777 | 3000140377 | 262 |
| 398 | iso_pu_bacteria | 3004203850 | 3004210826 | 262 |
| 399 | iso_pu_bacteria | 3005416602 | 3005416670 | 262 |
| 400 | iso_pu_bacteria | 639633055 | 639648981 | 262 |
| 401 | iso_pu_bacteria | 648276728 | 648736339 | 262 |
| 402 | iso_pu_bacteria | 8003992118 | 8003997423 | 262 |
| 403 | iso_pu_bacteria | 8004374579 | 8004380607 | 262 |
| 404 | iso_pu_bacteria | 8004445564 | 8004446864 | 262 |
| 405 | iso_pu_bacteria | 8004703790 | 8004709096 | 262 |
| 406 | iso_pu_bacteria | 8005258706 | 8005264539 | 262 |
| 407 | iso_pu_bacteria | 8005275841 | 8005280922 | 262 |
| 408 | iso_pu_bacteria | 8005282627 | 8005285199 | 262 |
| 409 | iso_pu_bacteria | 8005289223 | 8005293425 | 262 |
| 410 | iso_pu_bacteria | 8005301065 | 8005302906 | 262 |
| 411 | iso_pu_bacteria | 8005307578 | 8005312630 | 262 |
| 412 | iso_pu_bacteria | 8005314921 | 8005320687 | 262 |
| 413 | iso_pu_bacteria | 8005321885 | 8005323047 | 262 |
| 414 | iso_pu_bacteria | 8005376324 | 8005379653 | 262 |
| 415 | iso_pu_bacteria | 8005382845 | 8005386337 | 262 |
| 416 | iso_pu_bacteria | 8005395548 | 8005396337 | 262 |
| 417 | iso_pu_bacteria | 8005430974 | 8005434945 | 262 |
| 418 | iso_pu_bacteria | 8005460587 | 8005463438 | 262 |
| 419 | iso_pu_bacteria | 8005484373 | 8005487596 | 262 |
| 420 | iso_pu_bacteria | 8005497431 | 8005500682 | 262 |
| 421 | iso_pu_bacteria | 8005556819 | 8005557238 | 262 |
| 422 | iso_pu_bacteria | 8005563573 | 8005567625 | 262 |
| 423 | iso_pu_bacteria | 8005570704 | 8005574704 | 262 |
| 424 | iso_pu_bacteria | 8005619151 | 8005622060 | 262 |
| 425 | iso_pu_bacteria | 8005626139 | 8005632463 | 262 |
| 426 | iso_pu_bacteria | 8005645114 | 8005647954 | 262 |
| 427 | iso_pu_bacteria | 8005668836 | 8005672101 | 262 |
| 428 | iso_pu_bacteria | 8005682033 | 8005686011 | 262 |
| 429 | iso_pu_bacteria | 8005688590 | 8005692326 | 262 |
| 430 | iso_pu_bacteria | 8005695170 | 8005696478 | 262 |
| 431 | iso_pu_bacteria | 8018127388 | 8018133875 | 262 |
| 432 | iso_pu_bacteria | 8018163183 | 8018166318 | 262 |
| 433 | iso_pu_bacteria | 8018176218 | 8018181524 | 262 |
| 434 | iso_pu_bacteria | 8023680758 | 8023683370 | 262 |
| 435 | iso_pu_bacteria | 8024479707 | 8024483084 | 262 |
| 436 | iso_pu_bacteria | 8024486573 | 8024491087 | 262 |
| 437 | iso_pu_bacteria | 8024501048 | 8024503855 | 262 |
| 438 | iso_pu_bacteria | 8046767195 | 8046769083 | 262 |
| 439 | iso_pu_bacteria | 8056375014 | 8056378801 | 262 |
| 440 | iso_pu_bacteria | 8057575449 | 8057576444 | 262 |
| 441 | iso_pu_bacteria | 8057874678 | 8057878780 | 262 |
| 442 | 3300001979 | JGI24740J21852_10000485 | JGI24740J21852_1000048512 | 263 |
| 443 | 3300002704 | JGI25155J39150_1000034 | JGI25155J39150_100003449 | 263 |
| 444 | 3300002705 | JGI25156J39149_1000008 | JGI25156J39149_1000008181 | 263 |
| 445 | 3300002737 | JGI25162J39368_1000074 | JGI25162J39368_1000074112 | 263 |
| 446 | 3300002738 | JGI25154J39366_1000063 | JGI25154J39366_100006349 | 263 |
| 447 | 3300002741 | JGI25157J39369_1000062 | JGI25157J39369_100006258 | 263 |
| 448 | 3300002773 | JGI25152J39213_1001055 | JGI25152J39213_100105510 | 263 |
| 449 | 3300002773 | JGI25152J39213_1001109 | JGI25152J39213_10011093 | 263 |
| 450 | 3300002773 | JGI25152J39213_1014996 | JGI25152J39213_10149962 | 263 |
| 451 | 3300002774 | JGI25150J39212_1001160 | JGI25150J39212_10011604 | 263 |
| 452 | 3300002987 | JGI25159J45721_1000787 | JGI25159J45721_100078719 | 263 |
| 453 | 3300003187 | JGI25151J46595_10000306 | JGI25151J46595_100003062 | 263 |
| 454 | 3300003187 | JGI25151J46595_10001290 | JGI25151J46595_100012905 | 263 |
| 455 | 3300003214 | JGI25165J46597_1000201 | JGI25165J46597_10002015 | 263 |
| 456 | 3300003215 | JGI25153J46596_10000693 | JGI25153J46596_1000069314 | 263 |
| 457 | 3300003215 | JGI25153J46596_10005249 | JGI25153J46596_100052496 | 263 |
| 458 | 3300003215 | JGI25153J46596_10006734 | JGI25153J46596_100067344 | 263 |
| 459 | 3300003316 | rootH1_10010012 | rootH1_100100122 | 263 |
| 460 | 3300003320 | rootH2_10045083 | rootH2_1004508315 | 263 |
| 461 | 3300003322 | rootL2_10001175 | rootL2_100011758 | 263 |
| 462 | 3300003323 | rootH1_10113604 | rootH1_101136045 | 263 |
| 463 | 3300003323 | rootH1_10270503 | rootH1_102705033 | 263 |
| 464 | 3300003354 | JGI25160J50197_1002241 | JGI25160J50197_10022418 | 263 |
| 465 | 3300003354 | JGI25160J50197_1006870 | JGI25160J50197_10068703 | 263 |
| 466 | 3300003374 | JGI25161J50226_1000084 | JGI25161J50226_100008463 | 263 |
| 467 | 3300003771 | Ga0055526_1003954 | Ga0055526_10039544 | 263 |
| 468 | 3300003771 | Ga0055526_1008917 | Ga0055526_10089172 | 263 |
| 469 | 3300003775 | Ga0055524_1003157 | Ga0055524_10031574 | 263 |
| 470 | 3300003775 | Ga0055524_1049203 | Ga0055524_10492031 | 263 |
| 471 | 3300003790 | Ga0055528_1000168 | Ga0055528_100016832 | 263 |
| 472 | 3300003790 | Ga0055528_1007067 | Ga0055528_10070673 | 263 |
| 473 | 3300003790 | Ga0055528_1010970 | Ga0055528_10109704 | 263 |
| 474 | 3300003790 | Ga0055528_1026867 | Ga0055528_10268671 | 263 |
| 475 | 3300003792 | Ga0055540_1000109 | Ga0055540_100010949 | 263 |
| 476 | 3300003856 | Ga0058692_1005828 | Ga0058692_10058283 | 263 |
| 477 | 3300004625 | Ga0055543_1000017 | Ga0055543_1000017157 | 263 |
| 478 | 3300004625 | Ga0055543_1000652 | Ga0055543_100065217 | 263 |
| 479 | 3300005262 | Ga0065165_1008542 | Ga0065165_10085423 | 263 |
| 480 | 3300005262 | Ga0065165_1009458 | Ga0065165_10094583 | 263 |
| 481 | 3300005289 | Ga0065704_10132899 | Ga0065704_101328992 | 263 |
| 482 | 3300005356 | Ga0070674_100656192 | Ga0070674_1006561921 | 263 |
| 483 | 3300005441 | Ga0070700_100336132 | Ga0070700_1003361321 | 263 |
| 484 | 3300005548 | Ga0070665_100441317 | Ga0070665_1004413172 | 263 |
| 485 | 3300005578 | Ga0068854_100247058 | Ga0068854_1002470582 | 263 |
| 486 | 3300005614 | Ga0068856_100014297 | Ga0068856_1000142973 | 263 |
| 487 | 3300006038 | Ga0075365_10006367 | Ga0075365_100063677 | 263 |
| 488 | 3300006038 | Ga0075365_10043661 | Ga0075365_100436612 | 263 |
| 489 | 3300006042 | Ga0075368_10016224 | Ga0075368_100162241 | 263 |
| 490 | 3300006048 | Ga0075363_100035976 | Ga0075363_1000359762 | 263 |
| 491 | 3300006051 | Ga0075364_10004665 | Ga0075364_100046654 | 263 |
| 492 | 3300006051 | Ga0075364_10083456 | Ga0075364_100834562 | 263 |
| 493 | 3300006177 | Ga0075362_10125770 | Ga0075362_101257701 | 263 |
| 494 | 3300006178 | Ga0075367_10033316 | Ga0075367_100333162 | 263 |
| 495 | 3300006186 | Ga0075369_10025582 | Ga0075369_100255822 | 263 |
| 496 | 3300006186 | Ga0075369_10031780 | Ga0075369_100317803 | 263 |
| 497 | 3300006186 | Ga0075369_10049829 | Ga0075369_100498292 | 263 |
| 498 | 3300006195 | Ga0075366_10014399 | Ga0075366_100143993 | 263 |
| 499 | 3300006195 | Ga0075366_10017101 | Ga0075366_100171014 | 263 |
| 500 | 3300006195 | Ga0075366_10048178 | Ga0075366_100481781 | 263 |
| 501 | 3300006353 | Ga0075370_10005366 | Ga0075370_100053661 | 263 |
| 502 | 3300009093 | Ga0105240_10000217 | Ga0105240_1000021789 | 263 |
| 503 | 3300009148 | Ga0105243_10520590 | Ga0105243_105205902 | 263 |
| 504 | 3300009545 | Ga0105237_10001458 | Ga0105237_100014583 | 263 |
| 505 | 3300009551 | Ga0105238_10212409 | Ga0105238_102124092 | 263 |
| 506 | 3300009765 | Ga0123341_1000072 | Ga0123341_100007212 | 263 |
| 507 | 3300010375 | Ga0105239_10001164 | Ga0105239_1000116427 | 263 |
| 508 | 3300010375 | Ga0105239_10135254 | Ga0105239_101352543 | 263 |
| 509 | 3300013100 | Ga0157373_10058924 | Ga0157373_100589243 | 263 |
| 510 | 3300013104 | Ga0157370_10000768 | Ga0157370_1000076815 | 263 |
| 511 | 3300013306 | Ga0163162_10638523 | Ga0163162_106385232 | 263 |
| 512 | 3300015262 | Ga0182007_10004351 | Ga0182007_100043512 | 263 |
| 513 | 3300015265 | Ga0182005_1019519 | Ga0182005_10195192 | 263 |
| 514 | 3300025206 | Ga0209435_100020 | Ga0209435_100020171 | 263 |
| 515 | 3300025208 | Ga0209436_100012 | Ga0209436_10001285 | 263 |
| 516 | 3300025228 | Ga0209672_107087 | Ga0209672_1070872 | 263 |
| 517 | 3300025233 | Ga0209437_100067 | Ga0209437_10006710 | 263 |
| 518 | 3300025245 | Ga0207425_1000316 | Ga0207425_100031612 | 263 |
| 519 | 3300025245 | Ga0207425_1008705 | Ga0207425_10087052 | 263 |
| 520 | 3300025246 | Ga0209646_1000070 | Ga0209646_1000070171 | 263 |
| 521 | 3300025246 | Ga0209646_1009041 | Ga0209646_10090412 | 263 |
| 522 | 3300025246 | Ga0209646_1015218 | Ga0209646_10152182 | 263 |
| 523 | 3300025250 | Ga0209026_1000057 | Ga0209026_100005750 | 263 |
| 524 | 3300025253 | Ga0209677_100295 | Ga0209677_10029518 | 263 |
| 525 | 3300025256 | Ga0209759_1000047 | Ga0209759_100004750 | 263 |
| 526 | 3300025258 | Ga0209129_1000235 | Ga0209129_100023515 | 263 |
| 527 | 3300025258 | Ga0209129_1000268 | Ga0209129_100026813 | 263 |
| 528 | 3300025258 | Ga0209129_1001842 | Ga0209129_10018424 | 263 |
| 529 | 3300025261 | Ga0209233_1000088 | Ga0209233_100008810 | 263 |
| 530 | 3300025261 | Ga0209233_1000288 | Ga0209233_100028840 | 263 |
| 531 | 3300025273 | Ga0209673_1000444 | Ga0209673_100044443 | 263 |
| 532 | 3300025273 | Ga0209673_1001878 | Ga0209673_100187812 | 263 |
| 533 | 3300025273 | Ga0209673_1003837 | Ga0209673_10038374 | 263 |
| 534 | 3300025273 | Ga0209673_1005954 | Ga0209673_10059543 | 263 |
| 535 | 3300025284 | Ga0209130_1000022 | Ga0209130_1000022183 | 263 |
| 536 | 3300025294 | Ga0209025_1000058 | Ga0209025_1000058135 | 263 |
| 537 | 3300025294 | Ga0209025_1000609 | Ga0209025_100060960 | 263 |
| 538 | 3300025294 | Ga0209025_1005676 | Ga0209025_10056763 | 263 |
| 539 | 3300025294 | Ga0209025_1011931 | Ga0209025_10119313 | 263 |
| 540 | 3300025294 | Ga0209025_1046804 | Ga0209025_10468042 | 263 |
| 541 | 3300025295 | Ga0209564_1000167 | Ga0209564_100016731 | 263 |
| 542 | 3300025295 | Ga0209564_1012997 | Ga0209564_10129972 | 263 |
| 543 | 3300025297 | Ga0209758_1000151 | Ga0209758_1000151169 | 263 |
| 544 | 3300025297 | Ga0209758_1000398 | Ga0209758_100039815 | 263 |
| 545 | 3300025297 | Ga0209758_1000847 | Ga0209758_100084711 | 263 |
| 546 | 3300025297 | Ga0209758_1002658 | Ga0209758_10026587 | 263 |
| 547 | 3300025297 | Ga0209758_1002983 | Ga0209758_10029833 | 263 |
| 548 | 3300025298 | Ga0209050_1000278 | Ga0209050_100027865 | 263 |
| 549 | 3300025298 | Ga0209050_1009047 | Ga0209050_10090472 | 263 |
| 550 | 3300025299 | Ga0209256_1000511 | Ga0209256_100051131 | 263 |
| 551 | 3300025299 | Ga0209256_1006815 | Ga0209256_10068154 | 263 |
| 552 | 3300025299 | Ga0209256_1015252 | Ga0209256_10152524 | 263 |
| 553 | 3300025302 | Ga0207426_1000005 | Ga0207426_100000563 | 263 |
| 554 | 3300025302 | Ga0207426_1000147 | Ga0207426_100014761 | 263 |
| 555 | 3300025303 | Ga0209051_1000224 | Ga0209051_100022448 | 263 |
| 556 | 3300025303 | Ga0209051_1000687 | Ga0209051_10006873 | 263 |
| 557 | 3300025304 | Ga0209257_1002671 | Ga0209257_100267110 | 263 |
| 558 | 3300025913 | Ga0207695_10000613 | Ga0207695_1000061324 | 263 |
| 559 | 3300025914 | Ga0207671_10001160 | Ga0207671_1000116027 | 263 |
| 560 | 3300025924 | Ga0207694_10206879 | Ga0207694_102068792 | 263 |
| 561 | 3300026075 | Ga0207708_10190012 | Ga0207708_101900122 | 263 |
| 562 | 3300026078 | Ga0207702_10005172 | Ga0207702_100051728 | 263 |
| 563 | 3300027111 | Ga0209281_1002138 | Ga0209281_10021383 | 263 |
| 564 | 3300027312 | Ga0209371_1000174 | Ga0209371_100017424 | 263 |
| 565 | 3300027312 | Ga0209371_1000222 | Ga0209371_10002224 | 263 |
| 566 | 3300028794 | Ga0307515_10000130 | Ga0307515_1000013040 | 263 |
| 567 | 3300028794 | Ga0307515_10022393 | Ga0307515_1002239311 | 263 |
| 568 | 3300030500 | Ga0268256_1000028 | Ga0268256_100002897 | 263 |
| 569 | 3300030500 | Ga0268256_1003712 | Ga0268256_10037125 | 263 |
| 570 | 3300031251 | Ga0265327_10006474 | Ga0265327_100064743 | 263 |
| 571 | 3300031456 | Ga0307513_10013508 | Ga0307513_100135086 | 263 |
| 572 | 3300031456 | Ga0307513_10068528 | Ga0307513_100685283 | 263 |
| 573 | 3300032004 | Ga0307414_10145621 | Ga0307414_101456212 | 263 |
| 574 | 3300033180 | Ga0307510_10196034 | Ga0307510_101960342 | 263 |
| 575 | 3300035695 | Ga0373927_0001338 | Ga0373927_0001338_7969_8820 | 263 |
| 576 | 3300037068 | Ga0373925_0001079 | Ga0373925_0001079_19483_20334 | 263 |
| 577 | 3300037418 | Ga0395900_0680115 | Ga0395900_0680115_58_909 | 263 |
| 578 | 3300037471 | Ga0395905_0000663 | Ga0395905_0000663_12270_13121 | 263 |
| 579 | 3300039062 | Ga0400483_120435 | Ga0400483_120435_1652_2503 | 263 |
| 580 | 3300039062 | Ga0400483_146044 | Ga0400483_146044_1901_2752 | 263 |
| 581 | 3300039062 | Ga0400483_192659 | Ga0400483_192659_3305_4156 | 263 |
| 582 | 3300039062 | Ga0400483_195580 | Ga0400483_195580_6960_7811 | 263 |
| 583 | 3300039062 | Ga0400483_212948 | Ga0400483_212948_204_1055 | 263 |
| 584 | 3300041451 | Ga0451791_1287689 | Ga0451791_1287689_410_1261 | 263 |
| 585 | 3300041491 | Ga0451833_1420109 | Ga0451833_1420109_25_876 | 263 |
| 586 | 3300041492 | Ga0451835_0478060 | Ga0451835_0478060_1302_2153 | 263 |
| 587 | 3300041496 | Ga0451839_0300679 | Ga0451839_0300679_32_883 | 263 |
| 588 | 3300041496 | Ga0451839_0662414 | Ga0451839_0662414_32_883 | 263 |
| 589 | 3300041498 | Ga0451841_0719137 | Ga0451841_0719137_106_957 | 263 |
| 590 | 3300041505 | Ga0451849_0546724 | Ga0451849_0546724_262_1113 | 263 |
| 591 | 3300041507 | Ga0451851_0158030 | Ga0451851_0158030_552_1403 | 263 |
| 592 | 3300041509 | Ga0451843_0422144 | Ga0451843_0422144_183_1034 | 263 |
| 593 | 3300044684 | Ga0466966_0179816 | Ga0466966_0179816_355_1206 | 263 |
| 594 | 3300044694 | Ga0466963_0011432 | Ga0466963_0011432_1199_2050 | 263 |
| 595 | 3300044765 | Ga0466970_0001023 | Ga0466970_0001023_3895_4746 | 263 |
| 596 | 3300044842 | Ga0466957_0112681 | Ga0466957_0112681_399_1250 | 263 |
| 597 | 3300045049 | Ga0466959_0066626 | Ga0466959_0066626_967_1818 | 263 |
| 598 | 3300045836 | Ga0466958_0001498 | Ga0466958_0001498_3699_4550 | 263 |
| 599 | 3300045976 | Ga0466967_0008489 | Ga0466967_0008489_20_871 | 263 |
| 600 | 3300045976 | Ga0466967_0137853 | Ga0466967_0137853_1057_1908 | 263 |
| 601 | 3300046459 | Ga0495629_0063156 | Ga0495629_0063156_1091_1942 | 263 |
| 602 | 3300046474 | Ga0495605_0020213 | Ga0495605_0020213_199_1050 | 263 |
| 603 | 3300046492 | Ga0495585_0010652 | Ga0495585_0010652_4047_4898 | 263 |
| 604 | 3300046492 | Ga0495585_0014469 | Ga0495585_0014469_1757_2608 | 263 |
| 605 | 3300046501 | Ga0495607_0061799 | Ga0495607_0061799_239_1090 | 263 |
| 606 | 3300046506 | Ga0495583_0000957 | Ga0495583_0000957_26462_27313 | 263 |
| 607 | 3300046506 | Ga0495583_0049069 | Ga0495583_0049069_114_965 | 263 |
| 608 | 3300046507 | Ga0495606_0000629 | Ga0495606_0000629_47977_48828 | 263 |
| 609 | 3300046507 | Ga0495606_0018560 | Ga0495606_0018560_1418_2269 | 263 |
| 610 | 3300046515 | Ga0495620_0086981 | Ga0495620_0086981_235_1086 | 263 |
| 611 | 3300046518 | Ga0495631_0008404 | Ga0495631_0008404_1665_2516 | 263 |
| 612 | 3300046518 | Ga0495631_0022726 | Ga0495631_0022726_67_918 | 263 |
| 613 | 3300046522 | Ga0495643_0002781 | Ga0495643_0002781_9375_10226 | 263 |
| 614 | 3300046542 | Ga0495597_0078407 | Ga0495597_0078407_89_940 | 263 |
| 615 | 3300046558 | Ga0495633_0017216 | Ga0495633_0017216_2066_2917 | 263 |
| 616 | 3300046616 | Ga0495668_0065114 | Ga0495668_0065114_818_1669 | 263 |
| 617 | 3300046660 | Ga0495625_0004033 | Ga0495625_0004033_12120_12971 | 263 |
| 618 | 3300046660 | Ga0495625_0040600 | Ga0495625_0040600_49_900 | 263 |
| 619 | 3300046660 | Ga0495625_0044687 | Ga0495625_0044687_2273_3124 | 263 |
| 620 | 3300047472 | Ga0495686_0027328 | Ga0495686_0027328_649_1500 | 263 |
| 621 | 3300048907 | Ga0496104_0017153 | Ga0496104_0017153_2543_3394 | 263 |
| 622 | 3300048908 | Ga0496105_0067328 | Ga0496105_0067328_1698_2549 | 263 |
| 623 | 3300048919 | Ga0496116_0049741 | Ga0496116_0049741_780_1631 | 263 |
| 624 | 3300048919 | Ga0496116_0144546 | Ga0496116_0144546_173_1024 | 263 |
| 625 | 3300048920 | Ga0496117_0000490 | Ga0496117_0000490_36744_37595 | 263 |
| 626 | 3300048921 | Ga0496118_0001723 | Ga0496118_0001723_27910_28761 | 263 |
| 627 | 3300048921 | Ga0496118_0032523 | Ga0496118_0032523_345_1196 | 263 |
| 628 | 3300048922 | Ga0496119_0004038 | Ga0496119_0004038_11342_12193 | 263 |
| 629 | 3300048922 | Ga0496119_0021845 | Ga0496119_0021845_1625_2476 | 263 |
| 630 | 3300048924 | Ga0496121_0000005 | Ga0496121_0000005_40510_41361 | 263 |
| 631 | 3300048924 | Ga0496121_0064241 | Ga0496121_0064241_2118_2969 | 263 |
| 632 | 3300048924 | Ga0496121_0315917 | Ga0496121_0315917_119_970 | 263 |
| 633 | 3300048925 | Ga0496122_0000713 | Ga0496122_0000713_27910_28761 | 263 |
| 634 | 3300048925 | Ga0496122_0006813 | Ga0496122_0006813_8399_9250 | 263 |
| 635 | 3300048925 | Ga0496122_0021866 | Ga0496122_0021866_1913_2764 | 263 |
| 636 | 3300048926 | Ga0496123_0000530 | Ga0496123_0000530_36871_37722 | 263 |
| 637 | 3300048926 | Ga0496123_0001604 | Ga0496123_0001604_8488_9339 | 263 |
| 638 | 3300048927 | Ga0496124_0018647 | Ga0496124_0018647_4680_5531 | 263 |
| 639 | 3300048927 | Ga0496124_0020905 | Ga0496124_0020905_3864_4715 | 263 |
| 640 | 3300048927 | Ga0496124_0026422 | Ga0496124_0026422_863_1714 | 263 |
| 641 | 3300048928 | Ga0496125_0000034 | Ga0496125_0000034_167101_167952 | 263 |
| 642 | 3300048928 | Ga0496125_0074187 | Ga0496125_0074187_164_1015 | 263 |
| 643 | 3300048929 | Ga0496126_0040009 | Ga0496126_0040009_3226_4077 | 263 |
| 644 | 3300048929 | Ga0496126_0068197 | Ga0496126_0068197_13_864 | 263 |
| 645 | 3300049570 | Ga0501033_0051998 | Ga0501033_0051998_1396_2244 | 263 |
| 646 | 3300049571 | Ga0501034_0314043 | Ga0501034_0314043_320_1168 | 263 |
| 647 | 3300049573 | Ga0501037_0034694 | Ga0501037_0034694_1193_2041 | 263 |
| 648 | 3300049586 | Ga0501070_0001012 | Ga0501070_0001012_10485_11333 | 263 |
| 649 | 3300049589 | Ga0501073_0037477 | Ga0501073_0037477_991_1839 | 263 |
| 650 | 3300049742 | Ga0501080_0002221 | Ga0501080_0002221_12027_12875 | 263 |
| 651 | 3300049822 | Ga0501035_0001616 | Ga0501035_0001616_17107_17955 | 263 |
| 652 | 3300049823 | Ga0501044_0029725 | Ga0501044_0029725_314_1162 | 263 |
| 653 | 3300050489 | nmdc:mga03683_111860_c1 | nmdc:mga03683_111860_c1_83_934 | 263 |
| 654 | 3300050489 | nmdc:mga03683_121977_c1 | nmdc:mga03683_121977_c1_115_966 | 263 |
| 655 | 3300050490 | nmdc:mga03n38_138273_c1 | nmdc:mga03n38_138273_c1_46_897 | 263 |
| 656 | 3300050490 | nmdc:mga03n38_62682_c1 | nmdc:mga03n38_62682_c1_89_940 | 263 |
| 657 | 3300050491 | nmdc:mga00v17_203108_c1 | nmdc:mga00v17_203108_c1_207_1058 | 263 |
| 658 | 3300050491 | nmdc:mga00v17_646_c1 | nmdc:mga00v17_646_c1_6881_7732 | 263 |
| 659 | 3300050492 | nmdc:mga0yw44_3758_c1 | nmdc:mga0yw44_3758_c1_2247_3098 | 263 |
| 660 | 3300050493 | nmdc:mga0k408_18904_c2 | nmdc:mga0k408_18904_c2_1622_2473 | 263 |
| 661 | 3300050493 | nmdc:mga0k408_23600_c1 | nmdc:mga0k408_23600_c1_1559_2410 | 263 |
| 662 | 3300050494 | nmdc:mga06z11_43556_c1 | nmdc:mga06z11_43556_c1_202_1053 | 263 |
| 663 | 3300050496 | nmdc:mga07m45_21616_c1 | nmdc:mga07m45_21616_c1_2516_3367 | 263 |
| 664 | 3300050516 | nmdc:mga0sz30_13108_c1 | nmdc:mga0sz30_13108_c1_108_959 | 263 |
| 665 | 3300053109 | Ga0500569_000732 | Ga0500569_000732_3496_4347 | 263 |
| 666 | 3300053109 | Ga0500569_016177 | Ga0500569_016177_408_1259 | 263 |
| 667 | 3300053111 | Ga0500572_002453 | Ga0500572_002453_3489_4340 | 263 |
| 668 | 3300053121 | Ga0500607_086890 | Ga0500607_086890_83_934 | 263 |
| 669 | 3300053134 | Ga0500658_0001505 | Ga0500658_0001505_6034_6885 | 263 |
| 670 | 3300053136 | Ga0500559_0102027 | Ga0500559_0102027_296_1147 | 263 |
| 671 | 3300053139 | Ga0500568_0000524 | Ga0500568_0000524_14718_15569 | 263 |
| 672 | 3300053151 | Ga0500604_0012916 | Ga0500604_0012916_655_1506 | 263 |
| 673 | 3300053153 | Ga0500616_0007896 | Ga0500616_0007896_131_982 | 263 |
| 674 | 3300053156 | Ga0500622_0004526 | Ga0500622_0004526_3838_4689 | 263 |
| 675 | 3300053161 | Ga0500634_0001933 | Ga0500634_0001933_5841_6692 | 263 |
| 676 | 3300059652 | Ga0587107_000520 | Ga0587107_000520_135_986 | 263 |
| 677 | 3300061719 | Ga0466962_0110345 | Ga0466962_0110345_346_1197 | 263 |
| 678 | 3300005329 | Ga0070683_100048475 | Ga0070683_1000484753 | 265 |
| 679 | 3300005353 | Ga0070669_100244920 | Ga0070669_1002449202 | 265 |
| 680 | 3300005441 | Ga0070700_100011533 | Ga0070700_1000115334 | 265 |
| 681 | 3300005455 | Ga0070663_100013791 | Ga0070663_1000137914 | 265 |
| 682 | 3300005535 | Ga0070684_100005576 | Ga0070684_10000557610 | 265 |
| 683 | 3300005547 | Ga0070693_100127514 | Ga0070693_1001275142 | 265 |
| 684 | 3300005564 | Ga0070664_100008484 | Ga0070664_1000084846 | 265 |
| 685 | 3300005840 | Ga0068870_10110250 | Ga0068870_101102502 | 265 |
| 686 | 3300005841 | Ga0068863_100515007 | Ga0068863_1005150072 | 265 |
| 687 | 3300005842 | Ga0068858_100057359 | Ga0068858_1000573592 | 265 |
| 688 | 3300005844 | Ga0068862_100122801 | Ga0068862_1001228012 | 265 |
| 689 | 3300009094 | Ga0111539_10002276 | Ga0111539_1000227618 | 265 |
| 690 | 3300014745 | Ga0157377_10004331 | Ga0157377_100043317 | 265 |
| 691 | 3300025907 | Ga0207645_10028267 | Ga0207645_100282673 | 265 |
| 692 | 3300025908 | Ga0207643_10095072 | Ga0207643_100950722 | 265 |
| 693 | 3300025918 | Ga0207662_10032593 | Ga0207662_100325933 | 265 |
| 694 | 3300025920 | Ga0207649_10089809 | Ga0207649_100898092 | 265 |
| 695 | 3300025923 | Ga0207681_10099406 | Ga0207681_100994062 | 265 |
| 696 | 3300025927 | Ga0207687_10033088 | Ga0207687_100330883 | 265 |
| 697 | 3300025932 | Ga0207690_10018390 | Ga0207690_100183902 | 265 |
| 698 | 3300025940 | Ga0207691_10214464 | Ga0207691_102144642 | 265 |
| 699 | 3300025944 | Ga0207661_10017218 | Ga0207661_100172183 | 265 |
| 700 | 3300025945 | Ga0207679_10012743 | Ga0207679_100127432 | 265 |
| 701 | 3300025972 | Ga0207668_10081749 | Ga0207668_100817493 | 265 |
| 702 | 3300026023 | Ga0207677_10133858 | Ga0207677_101338582 | 265 |
| 703 | 3300026067 | Ga0207678_10036822 | Ga0207678_100368223 | 265 |
| 704 | 3300026075 | Ga0207708_10001936 | Ga0207708_100019366 | 265 |
| 705 | 3300026116 | Ga0207674_10007586 | Ga0207674_100075864 | 265 |
| 706 | 3300028380 | Ga0268265_10117137 | Ga0268265_101171373 | 265 |
| 707 | 3300050511 | nmdc:mga08y16_15812_c1 | nmdc:mga08y16_15812_c1_6232_7164 | 265 |
| 708 | 3300044842 | Ga0466957_0078419 | Ga0466957_0078419_813_1664 | 266 |
| 709 | 3300046472 | Ga0495580_0029036 | Ga0495580_0029036_1405_2334 | 267 |
| 710 | 3300046533 | Ga0495640_0019978 | Ga0495640_0019978_2303_3232 | 267 |
| 711 | 3300046689 | Ga0495613_0030790 | Ga0495613_0030790_2350_3279 | 267 |
| 712 | 3300047317 | Ga0495604_0050921 | Ga0495604_0050921_1525_2454 | 267 |
| 713 | iso_pu_bacteria | 2884693830 | 2884697440 | 269 |
| 714 | iso_pu_bacteria | 2895442618 | 2895452947 | 269 |
| 715 | 3300048917 | Ga0496114_0077243 | Ga0496114_0077243_1558_2487 | 270 |
| 716 | 3300046454 | Ga0495592_0115536 | Ga0495592_0115536_517_1446 | 271 |
| 717 | 3300046455 | Ga0495603_0125839 | Ga0495603_0125839_111_1040 | 271 |
| 718 | 3300046474 | Ga0495605_0007199 | Ga0495605_0007199_3198_4127 | 271 |
| 719 | 3300046477 | Ga0495664_0089873 | Ga0495664_0089873_124_1053 | 271 |
| 720 | 3300046499 | Ga0495594_0046622 | Ga0495594_0046622_651_1580 | 271 |
| 721 | 3300046501 | Ga0495607_0010357 | Ga0495607_0010357_5106_6035 | 271 |
| 722 | 3300046506 | Ga0495583_0086514 | Ga0495583_0086514_409_1338 | 271 |
| 723 | 3300046507 | Ga0495606_0007570 | Ga0495606_0007570_597_1526 | 271 |
| 724 | 3300046512 | Ga0495610_0078468 | Ga0495610_0078468_544_1473 | 271 |
| 725 | 3300046513 | Ga0495616_0062694 | Ga0495616_0062694_137_1066 | 271 |
| 726 | 3300046515 | Ga0495620_0032466 | Ga0495620_0032466_1104_2033 | 271 |
| 727 | 3300046516 | Ga0495628_0142566 | Ga0495628_0142566_819_1748 | 271 |
| 728 | 3300046518 | Ga0495631_0006341 | Ga0495631_0006341_3326_4255 | 271 |
| 729 | 3300046522 | Ga0495643_0007574 | Ga0495643_0007574_1720_2649 | 271 |
| 730 | 3300046557 | Ga0495622_0002853 | Ga0495622_0002853_5227_6156 | 271 |
| 731 | 3300046558 | Ga0495633_0068885 | Ga0495633_0068885_430_1359 | 271 |
| 732 | 3300046648 | Ga0495611_0101322 | Ga0495611_0101322_13_942 | 271 |
| 733 | 3300046663 | Ga0495635_0008411 | Ga0495635_0008411_1809_2738 | 271 |
| 734 | 3300046679 | Ga0495623_0162739 | Ga0495623_0162739_336_1265 | 271 |
| 735 | 3300046794 | Ga0495589_0034934 | Ga0495589_0034934_1582_2511 | 271 |
| 736 | 3300046810 | Ga0495660_0136064 | Ga0495660_0136064_209_1138 | 271 |
| 737 | 3300047321 | Ga0495676_0143510 | Ga0495676_0143510_141_1070 | 271 |
| 738 | 3300047322 | Ga0495680_0005861 | Ga0495680_0005861_2122_3051 | 271 |
| 739 | 3300047443 | Ga0495687_017921 | Ga0495687_017921_1024_1953 | 271 |
| 740 | 3300047673 | Ga0495593_0013554 | Ga0495593_0013554_1304_2233 | 271 |
| 741 | 3300048089 | Ga0495614_0033185 | Ga0495614_0033185_1002_1931 | 271 |
| 742 | 3300048091 | Ga0495626_0039871 | Ga0495626_0039871_497_1426 | 271 |
| 743 | 3300031649 | Ga0307514_10040289 | Ga0307514_100402894 | 272 |
| 744 | 3300046499 | Ga0495594_0088487 | Ga0495594_0088487_793_1662 | 272 |
| 745 | 3300046538 | Ga0495609_0016992 | Ga0495609_0016992_270_1199 | 272 |
| 746 | 3300009147 | Ga0114129_10130524 | Ga0114129_101305242 | 273 |
| 747 | 3300049459 | Ga0495678_048866 | Ga0495678_048866_313_1242 | 273 |
| 748 | iso_pu_bacteria | 2675903060 | 2676488010 | 273 |
| 749 | 3300046455 | Ga0495603_0009808 | Ga0495603_0009808_921_1847 | 274 |
| 750 | 3300046459 | Ga0495629_0005661 | Ga0495629_0005661_4522_5448 | 274 |
| 751 | 3300046499 | Ga0495594_0006953 | Ga0495594_0006953_1028_1954 | 274 |
| 752 | 3300046674 | Ga0495588_0012531 | Ga0495588_0012531_2241_3167 | 274 |
| 753 | 3300047321 | Ga0495676_0001692 | Ga0495676_0001692_12335_13261 | 274 |
| 754 | 3300028558 | Ga0265326_10004051 | Ga0265326_100040512 | 276 |
| 755 | 3300028573 | Ga0265334_10019009 | Ga0265334_100190093 | 276 |
| 756 | 3300028654 | Ga0265322_10001821 | Ga0265322_100018212 | 276 |
| 757 | 3300031344 | Ga0265316_10024107 | Ga0265316_100241074 | 276 |
| 758 | 3300046452 | Ga0495617_005101 | Ga0495617_005101_2355_3284 | 276 |
| 759 | 3300046648 | Ga0495611_0020459 | Ga0495611_0020459_105_1034 | 276 |
| 760 | 3300046689 | Ga0495613_0071021 | Ga0495613_0071021_487_1407 | 276 |
| 761 | 3300047447 | Ga0495685_049462 | Ga0495685_049462_279_1208 | 276 |
| 762 | 3300003354 | JGI25160J50197_1027872 | JGI25160J50197_10278721 | 277 |
| 763 | 3300025302 | Ga0207426_1006621 | Ga0207426_10066214 | 277 |
| 764 | 3300031616 | Ga0307508_10029301 | Ga0307508_100293012 | 277 |
| 765 | 3300044694 | Ga0466963_0184538 | Ga0466963_0184538_383_1297 | 277 |
| 766 | 3300006042 | Ga0075368_10002275 | Ga0075368_100022755 | 278 |
| 767 | 3300006178 | Ga0075367_10001560 | Ga0075367_100015602 | 278 |
| 768 | 3300027866 | Ga0209813_10001911 | Ga0209813_100019111 | 278 |
| 769 | 3300050494 | nmdc:mga06z11_805_c1 | nmdc:mga06z11_805_c1_2610_3536 | 278 |
| 770 | iso_pu_bacteria | 2791355406 | 2793975977 | 278 |
| 771 | iso_pu_bacteria | 2808606982 | 2811846663 | 278 |
| 772 | iso_pu_bacteria | 8025530807 | 8025534931 | 278 |
| 773 | iso_pu_bacteria | 8047893842 | 8047901080 | 278 |
| 774 | iso_pu_bacteria | 8048127548 | 8048133838 | 278 |
| 775 | iso_pu_bacteria | 8048356638 | 8048357821 | 278 |
| 776 | iso_pu_bacteria | 8048369669 | 8048378019 | 278 |
| 777 | iso_pu_bacteria | 8048379754 | 8048387117 | 278 |
| 778 | 3300045976 | Ga0466967_0020180 | Ga0466967_0020180_3611_4534 | 279 |
| 779 | 3300046455 | Ga0495603_0001084 | Ga0495603_0001084_9049_9975 | 279 |
| 780 | 3300046459 | Ga0495629_0000969 | Ga0495629_0000969_15292_16218 | 279 |
| 781 | 3300046689 | Ga0495613_0003773 | Ga0495613_0003773_7847_8773 | 279 |
| 782 | 3300047321 | Ga0495676_0016892 | Ga0495676_0016892_993_1919 | 279 |
| 783 | 3300048089 | Ga0495614_0000140 | Ga0495614_0000140_15291_16217 | 279 |
| 784 | iso_pu_bacteria | 2582581314 | 2585320018 | 279 |
| 785 | iso_pu_bacteria | 2862178590 | 2862181219 | 279 |
| 786 | 3300006846 | Ga0075430_100166488 | Ga0075430_1001664882 | 280 |
| 787 | 3300050508 | nmdc:mga09592_139574_c1 | nmdc:mga09592_139574_c1_724_1647 | 280 |
| 788 | iso_pu_bacteria | 2582581312 | 2585300657 | 280 |
| 789 | iso_pu_bacteria | 2616644814 | 2616693316 | 280 |
| 790 | iso_pu_bacteria | 2616644941 | 2616901548 | 280 |
| 791 | 3300003354 | JGI25160J50197_1032862 | JGI25160J50197_10328621 | 281 |
| 792 | 3300044656 | Ga0466969_0013952 | Ga0466969_0013952_2515_3432 | 281 |
| 793 | 3300044684 | Ga0466966_0020412 | Ga0466966_0020412_2927_3844 | 281 |
| 794 | 3300044765 | Ga0466970_0137425 | Ga0466970_0137425_312_1229 | 281 |
| 795 | 3300045049 | Ga0466959_0004980 | Ga0466959_0004980_961_1878 | 281 |
| 796 | iso_pu_bacteria | 2862574272 | 2862580452 | 281 |
| 797 | iso_pu_bacteria | 2895427314 | 2895431013 | 281 |
| 798 | iso_pu_bacteria | 2997600082 | 2997605867 | 281 |
| 799 | iso_pu_bacteria | 8033684223 | 8033687433 | 281 |
| 800 | 3300003373 | JGI25407J50210_10023741 | JGI25407J50210_100237412 | 282 |
| 801 | 3300003911 | JGI25405J52794_10032364 | JGI25405J52794_100323641 | 282 |
| 802 | 3300005937 | Ga0081455_10004804 | Ga0081455_1000480413 | 282 |
| 803 | 3300005981 | Ga0081538_10000552 | Ga0081538_1000055226 | 282 |
| 804 | 3300025302 | Ga0207426_1006660 | Ga0207426_10066602 | 282 |
| 805 | 3300037466 | Ga0395898_0364793 | Ga0395898_0364793_156_1082 | 282 |
| 806 | 3300038443 | Ga0395901_0238207 | Ga0395901_0238207_187_1113 | 282 |
| 807 | 3300049576 | Ga0501040_0332878 | Ga0501040_0332878_137_1075 | 282 |
| 808 | 3300003323 | rootH1_10169375 | rootH1_101693753 | 283 |
| 809 | 3300032126 | Ga0307415_100014853 | Ga0307415_1000148533 | 283 |
| 810 | 3300037466 | Ga0395898_0241149 | Ga0395898_0241149_306_1235 | 283 |
| 811 | 3300037471 | Ga0395905_0093060 | Ga0395905_0093060_811_1740 | 283 |
| 812 | 3300049742 | Ga0501080_0065598 | Ga0501080_0065598_1621_2526 | 283 |
| 813 | 3300050507 | nmdc:mga05p37_200365_c1 | nmdc:mga05p37_200365_c1_533_1462 | 283 |
| 814 | 3300054114 | Ga0501084_0292848 | Ga0501084_0292848_226_1131 | 283 |
| 815 | 3300005545 | Ga0070695_100407485 | Ga0070695_1004074851 | 284 |
| 816 | 3300005981 | Ga0081538_10000512 | Ga0081538_1000051228 | 284 |
| 817 | 3300009148 | Ga0105243_10233375 | Ga0105243_102333752 | 284 |
| 818 | 3300037466 | Ga0395898_0020235 | Ga0395898_0020235_3609_4538 | 284 |
| 819 | 3300044706 | Ga0466964_0029921 | Ga0466964_0029921_987_1913 | 284 |
| 820 | 3300045976 | Ga0466967_0056104 | Ga0466967_0056104_2297_3223 | 284 |
| 821 | 3300046455 | Ga0495603_0011999 | Ga0495603_0011999_2355_3287 | 285 |
| 822 | 3300046501 | Ga0495607_0069230 | Ga0495607_0069230_300_1232 | 285 |
| 823 | 3300046794 | Ga0495589_0009836 | Ga0495589_0009836_3125_4057 | 285 |
| 824 | 3300046794 | Ga0495589_0017999 | Ga0495589_0017999_399_1331 | 285 |
| 825 | 3300047318 | Ga0495636_0012997 | Ga0495636_0012997_1513_2445 | 285 |
| 826 | 3300047321 | Ga0495676_0023609 | Ga0495676_0023609_3956_4888 | 285 |
| 827 | 3300047321 | Ga0495676_0062232 | Ga0495676_0062232_842_1774 | 285 |
| 828 | 3300047447 | Ga0495685_003784 | Ga0495685_003784_1678_2610 | 285 |
| 829 | 3300009147 | Ga0114129_10858000 | Ga0114129_108580002 | 286 |
| 830 | 3300050507 | nmdc:mga05p37_754224_c1 | nmdc:mga05p37_754224_c1_11_976 | 286 |
| 831 | 3300005983 | Ga0081540_1046671 | Ga0081540_10466712 | 289 |
| 832 | 3300001915 | JGI24741J21665_1015059 | JGI24741J21665_10150592 | 292 |
| 833 | 3300001979 | JGI24740J21852_10061639 | JGI24740J21852_100616392 | 292 |
| 834 | 3300002155 | JGI24033J26618_1010437 | JGI24033J26618_10104372 | 292 |
| 835 | 3300002459 | JGI24751J29686_10008949 | JGI24751J29686_100089492 | 292 |
| 836 | 3300005328 | Ga0070676_10135405 | Ga0070676_101354052 | 292 |
| 837 | 3300005330 | Ga0070690_100188917 | Ga0070690_1001889172 | 292 |
| 838 | 3300005331 | Ga0070670_100065672 | Ga0070670_1000656722 | 292 |
| 839 | 3300005334 | Ga0068869_100005743 | Ga0068869_1000057435 | 292 |
| 840 | 3300005335 | Ga0070666_10153959 | Ga0070666_101539592 | 292 |
| 841 | 3300005336 | Ga0070680_100023858 | Ga0070680_1000238582 | 292 |
| 842 | 3300005338 | Ga0068868_100019414 | Ga0068868_1000194144 | 292 |
| 843 | 3300005340 | Ga0070689_100021590 | Ga0070689_1000215903 | 292 |
| 844 | 3300005341 | Ga0070691_10029681 | Ga0070691_100296812 | 292 |
| 845 | 3300005344 | Ga0070661_100021113 | Ga0070661_1000211133 | 292 |
| 846 | 3300005354 | Ga0070675_100042440 | Ga0070675_1000424402 | 292 |
| 847 | 3300005355 | Ga0070671_100002576 | Ga0070671_1000025769 | 292 |
| 848 | 3300005364 | Ga0070673_100316965 | Ga0070673_1003169652 | 292 |
| 849 | 3300005365 | Ga0070688_100022559 | Ga0070688_1000225593 | 292 |
| 850 | 3300005366 | Ga0070659_100078716 | Ga0070659_1000787162 | 292 |
| 851 | 3300005436 | Ga0070713_100003468 | Ga0070713_1000034682 | 292 |
| 852 | 3300005437 | Ga0070710_10124741 | Ga0070710_101247412 | 292 |
| 853 | 3300005441 | Ga0070700_100042001 | Ga0070700_1000420012 | 292 |
| 854 | 3300005455 | Ga0070663_100006974 | Ga0070663_1000069745 | 292 |
| 855 | 3300005456 | Ga0070678_100000440 | Ga0070678_1000004404 | 292 |
| 856 | 3300005458 | Ga0070681_10108783 | Ga0070681_101087832 | 292 |
| 857 | 3300005466 | Ga0070685_10011517 | Ga0070685_100115172 | 292 |
| 858 | 3300005547 | Ga0070693_100003314 | Ga0070693_1000033146 | 292 |
| 859 | 3300005548 | Ga0070665_100041189 | Ga0070665_1000411893 | 292 |
| 860 | 3300005614 | Ga0068856_100327914 | Ga0068856_1003279141 | 292 |
| 861 | 3300005615 | Ga0070702_100004596 | Ga0070702_1000045965 | 292 |
| 862 | 3300005616 | Ga0068852_100049477 | Ga0068852_1000494773 | 292 |
| 863 | 3300005617 | Ga0068859_100062839 | Ga0068859_1000628393 | 292 |
| 864 | 3300005618 | Ga0068864_100037161 | Ga0068864_1000371614 | 292 |
| 865 | 3300005719 | Ga0068861_100107802 | Ga0068861_1001078022 | 292 |
| 866 | 3300005840 | Ga0068870_10001400 | Ga0068870_100014005 | 292 |
| 867 | 3300005841 | Ga0068863_100106765 | Ga0068863_1001067652 | 292 |
| 868 | 3300005842 | Ga0068858_100012004 | Ga0068858_1000120046 | 292 |
| 869 | 3300005843 | Ga0068860_100052160 | Ga0068860_1000521603 | 292 |
| 870 | 3300006237 | Ga0097621_100022705 | Ga0097621_1000227052 | 292 |
| 871 | 3300006358 | Ga0068871_100049946 | Ga0068871_1000499463 | 292 |
| 872 | 3300006844 | Ga0075428_100169589 | Ga0075428_1001695892 | 292 |
| 873 | 3300006847 | Ga0075431_100066750 | Ga0075431_1000667502 | 292 |
| 874 | 3300006852 | Ga0075433_10022955 | Ga0075433_100229552 | 292 |
| 875 | 3300006871 | Ga0075434_100029891 | Ga0075434_1000298912 | 292 |
| 876 | 3300006880 | Ga0075429_100055355 | Ga0075429_1000553552 | 292 |
| 877 | 3300006914 | Ga0075436_100001750 | Ga0075436_1000017504 | 292 |
| 878 | 3300006931 | Ga0097620_100062839 | Ga0097620_1000628393 | 292 |
| 879 | 3300007076 | Ga0075435_100031775 | Ga0075435_1000317753 | 292 |
| 880 | 3300009011 | Ga0105251_10011535 | Ga0105251_100115352 | 292 |
| 881 | 3300009147 | Ga0114129_10044078 | Ga0114129_100440784 | 292 |
| 882 | 3300009174 | Ga0105241_10460268 | Ga0105241_104602682 | 292 |
| 883 | 3300009176 | Ga0105242_10464408 | Ga0105242_104644082 | 292 |
| 884 | 3300009177 | Ga0105248_10008444 | Ga0105248_100084444 | 292 |
| 885 | 3300009553 | Ga0105249_10368466 | Ga0105249_103684662 | 292 |
| 886 | 3300011119 | Ga0105246_10017305 | Ga0105246_100173052 | 292 |
| 887 | 3300013100 | Ga0157373_10029252 | Ga0157373_100292524 | 292 |
| 888 | 3300013102 | Ga0157371_10007454 | Ga0157371_100074544 | 292 |
| 889 | 3300013296 | Ga0157374_10068086 | Ga0157374_100680863 | 292 |
| 890 | 3300014325 | Ga0163163_10289204 | Ga0163163_102892042 | 292 |
| 891 | 3300014745 | Ga0157377_10043374 | Ga0157377_100433742 | 292 |
| 892 | 3300014968 | Ga0157379_10030051 | Ga0157379_100300514 | 292 |
| 893 | 3300017792 | Ga0163161_10245881 | Ga0163161_102458812 | 292 |
| 894 | 3300020070 | Ga0206356_10934920 | Ga0206356_109349203 | 292 |
| 895 | 3300025901 | Ga0207688_10028434 | Ga0207688_100284342 | 292 |
| 896 | 3300025903 | Ga0207680_10261290 | Ga0207680_102612901 | 292 |
| 897 | 3300025904 | Ga0207647_10032231 | Ga0207647_100322311 | 292 |
| 898 | 3300025906 | Ga0207699_10013155 | Ga0207699_100131554 | 292 |
| 899 | 3300025908 | Ga0207643_10002531 | Ga0207643_100025314 | 292 |
| 900 | 3300025909 | Ga0207705_10072980 | Ga0207705_100729802 | 292 |
| 901 | 3300025912 | Ga0207707_10039857 | Ga0207707_100398573 | 292 |
| 902 | 3300025917 | Ga0207660_10006936 | Ga0207660_100069364 | 292 |
| 903 | 3300025919 | Ga0207657_10037812 | Ga0207657_100378122 | 292 |
| 904 | 3300025920 | Ga0207649_10006970 | Ga0207649_100069704 | 292 |
| 905 | 3300025921 | Ga0207652_10014958 | Ga0207652_100149582 | 292 |
| 906 | 3300025924 | Ga0207694_10016355 | Ga0207694_100163552 | 292 |
| 907 | 3300025925 | Ga0207650_10004010 | Ga0207650_100040105 | 292 |
| 908 | 3300025926 | Ga0207659_10011026 | Ga0207659_100110263 | 292 |
| 909 | 3300025927 | Ga0207687_10019474 | Ga0207687_100194744 | 292 |
| 910 | 3300025928 | Ga0207700_10035281 | Ga0207700_100352813 | 292 |
| 911 | 3300025931 | Ga0207644_10025410 | Ga0207644_100254104 | 292 |
| 912 | 3300025933 | Ga0207706_10038508 | Ga0207706_100385082 | 292 |
| 913 | 3300025936 | Ga0207670_10009665 | Ga0207670_100096653 | 292 |
| 914 | 3300025941 | Ga0207711_10117335 | Ga0207711_101173352 | 292 |
| 915 | 3300025942 | Ga0207689_10006061 | Ga0207689_100060614 | 292 |
| 916 | 3300025944 | Ga0207661_10003072 | Ga0207661_100030722 | 292 |
| 917 | 3300025960 | Ga0207651_10042876 | Ga0207651_100428762 | 292 |
| 918 | 3300025961 | Ga0207712_10246682 | Ga0207712_102466822 | 292 |
| 919 | 3300026023 | Ga0207677_10409375 | Ga0207677_104093751 | 292 |
| 920 | 3300026041 | Ga0207639_10221858 | Ga0207639_102218582 | 292 |
| 921 | 3300026067 | Ga0207678_10000416 | Ga0207678_1000041625 | 292 |
| 922 | 3300026075 | Ga0207708_10008215 | Ga0207708_100082153 | 292 |
| 923 | 3300026078 | Ga0207702_10023386 | Ga0207702_100233863 | 292 |
| 924 | 3300026088 | Ga0207641_10013488 | Ga0207641_100134882 | 292 |
| 925 | 3300026095 | Ga0207676_10011074 | Ga0207676_100110744 | 292 |
| 926 | 3300026116 | Ga0207674_10035497 | Ga0207674_100354972 | 292 |
| 927 | 3300026118 | Ga0207675_100064880 | Ga0207675_1000648803 | 292 |
| 928 | 3300026121 | Ga0207683_10003598 | Ga0207683_100035984 | 292 |
| 929 | 3300027907 | Ga0207428_10017270 | Ga0207428_100172705 | 292 |
| 930 | 3300028379 | Ga0268266_10051972 | Ga0268266_100519722 | 292 |
| 931 | 3300028381 | Ga0268264_10065203 | Ga0268264_100652033 | 292 |
| 932 | 3300042005 | Ga0439448_0002687 | Ga0439448_0002687_3690_4613 | 292 |
| 933 | 3300042012 | Ga0439455_0023391 | Ga0439455_0023391_378_1301 | 292 |
| 934 | 3300042137 | Ga0450902_008696 | Ga0450902_008696_468_1391 | 292 |
| 935 | 3300042157 | Ga0439458_0033809 | Ga0439458_0033809_190_1113 | 292 |
| 936 | 3300048904 | Ga0496101_0155207 | Ga0496101_0155207_660_1583 | 292 |
| 937 | 3300048905 | Ga0496102_0028385 | Ga0496102_0028385_279_1202 | 292 |
| 938 | 3300048906 | Ga0496103_0017891 | Ga0496103_0017891_132_1055 | 292 |
| 939 | 3300048907 | Ga0496104_0013612 | Ga0496104_0013612_2320_3243 | 292 |
| 940 | 3300048908 | Ga0496105_0019233 | Ga0496105_0019233_3823_4746 | 292 |
| 941 | 3300048909 | Ga0496106_0013309 | Ga0496106_0013309_3817_4740 | 292 |
| 942 | 3300048912 | Ga0496109_0044452 | Ga0496109_0044452_2156_3079 | 292 |
| 943 | 3300048913 | Ga0496110_0029256 | Ga0496110_0029256_1086_2009 | 292 |
| 944 | 3300048914 | Ga0496111_0085558 | Ga0496111_0085558_297_1220 | 292 |
| 945 | 3300048915 | Ga0496112_0127004 | Ga0496112_0127004_57_980 | 292 |
| 946 | 3300048916 | Ga0496113_0014458 | Ga0496113_0014458_1765_2688 | 292 |
| 947 | 3300050507 | nmdc:mga05p37_150855_c1 | nmdc:mga05p37_150855_c1_850_1773 | 292 |
| 948 | 3300050510 | nmdc:mga06r32_95386_c1 | nmdc:mga06r32_95386_c1_1196_2119 | 292 |
| 949 | 3300050511 | nmdc:mga08y16_61313_c1 | nmdc:mga08y16_61313_c1_794_1717 | 292 |
| 950 | 3300050512 | nmdc:mga0n895_16561_c1 | nmdc:mga0n895_16561_c1_1490_2413 | 292 |
| 951 | 3300050513 | nmdc:mga0rr50_30669_c1 | nmdc:mga0rr50_30669_c1_1176_2099 | 292 |
| 952 | 3300050515 | nmdc:mga0a205_4097_c1 | nmdc:mga0a205_4097_c1_5008_5931 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
119
319
0.84
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.3527 | 76 | 285 |
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.3454 | 26 | 284 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.3396 | 27 | 277 |
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.3379 | 26 | 284 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.3194 | 25 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3923 | 26 | 282 | 1.10.3720.10 |
| af_P0AFR7_53_289_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3881 | 75 | 280 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3835 | 74 | 281 | 1.10.3720.10 |
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3808 | 26 | 282 | 1.10.3720.10 |
| af_P0AE34_6_232_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3794 | 75 | 290 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A1D584-F1-model_v4 | ABC-type maltose/maltodextrin transport system, permease component | 0.5447 | 123 | 292 |
GO:0005886
GO:0015423 GO:0042956 |
| AF-A0A382B3P7-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.5412 | 121 | 284 |
GO:0005886
GO:0055085 |
| AF-A0A7K0TD85-F1-model_v4 | ABC transporter permease subunit | 0.5407 | 126 | 281 |
GO:0005886
GO:0055085 |
| AF-X1QYW3-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.5256 | 150 | 292 |
GO:0016020
GO:0055085 |
| AF-A0A645AIT5-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.5109 | 124 | 291 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar