F486517

General Info

Members Datasets Scaffolds Average Seq Length
948 332 1896 296

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0063586|Ga0466963_0063586_1089_2033
Length 314
Sequence MTLLEELETTVQEVAERVGPAVVGLGRGWGVGSGVVIAPGRVLTNAHNLRHDESTVTFADGRTAGGRVAASDGDADIAVIDVDTADVEPIEWAATGSSSHPSGETAGEAGETTDGDGPRIGRAVLALANPGGRGLRVTPGFISSTSRSFRGPRGRRFAGAIEHTAPLPRGSSGGPLVDTAGKLIGINSVRIDGGLILAIPADEALHNRVEALGRGEAPKRVRLGVAIAPPRVARKLRRAVGLPERDGALVRAVEDGSAAARAGIERGDLIVAAAGRDIERIDVLYEALDAARPEGSIELTIVRGTEERTVKVEF

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
94 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
169 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
172 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
198 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
230 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
332 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.17
Rhizosphere 89.98
Stem 0
Stem Tuber 0
Unclassified 7.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0063586 3300044694 Bacteria 2470
2 JGI25406J46586_10060876 3300003203 Unclassified 1219
3 JGI25407J50210_10001198 3300003373 Bacteria 5775
4 JGI25407J50210_10002396 3300003373 Bacteria 4410
5 JGI25407J50210_10006772 3300003373 Bacteria 2862
6 Ga0070676_10054564 3300005328 Bacteria 2356
7 Ga0070683_100186797 3300005329 Bacteria 1967
8 Ga0070670_100523516 3300005331 Bacteria 1056
9 Ga0068869_100304115 3300005334 Bacteria 1289
10 Ga0070680_100014681 3300005336 Bacteria 6125
11 Ga0070680_100130848 3300005336 Bacteria 2099
12 Ga0070682_100010594 3300005337 Bacteria 5236
13 Ga0070682_100032953 3300005337 Bacteria 3144
14 Ga0068868_100041218 3300005338 Bacteria 3596
15 Ga0068868_100051517 3300005338 Bacteria 3238
16 Ga0068868_100056210 3300005338 Bacteria 3107
17 Ga0070689_100218173 3300005340 Unclassified 1564
18 Ga0070691_10017644 3300005341 Bacteria 3284
19 Ga0070668_100033133 3300005347 Bacteria 3933
20 Ga0070668_100074679 3300005347 Bacteria 2645
21 Ga0070668_100261887 3300005347 Bacteria 1438
22 Ga0070669_100080559 3300005353 Bacteria 2424
23 Ga0070669_100182845 3300005353 Bacteria 1641
24 Ga0070675_100212214 3300005354 Bacteria 1683
25 Ga0070671_100226433 3300005355 Bacteria 1586
26 Ga0070674_100085110 3300005356 Bacteria 2269
27 Ga0070673_100127866 3300005364 Bacteria 2128
28 Ga0070659_100279287 3300005366 Bacteria 1389
29 Ga0070659_100317759 3300005366 Bacteria 1301
30 Ga0070709_10000491 3300005434 Bacteria 23345
31 Ga0070709_10009406 3300005434 Bacteria 5390
32 Ga0070709_10014252 3300005434 Bacteria 4494
33 Ga0070709_10086557 3300005434 Unclassified 2057
34 Ga0070714_100001919 3300005435 Bacteria 15175
35 Ga0070714_100005630 3300005435 Bacteria 9580
36 Ga0070714_100039978 3300005435 Bacteria 3952
37 Ga0070714_100046466 3300005435 Bacteria 3684
38 Ga0070714_100047843 3300005435 Bacteria 3635
39 Ga0070714_100150179 3300005435 Bacteria 2099
40 Ga0070714_100171595 3300005435 Bacteria 1968
41 Ga0070714_100179731 3300005435 Unclassified 1924
42 Ga0070714_100195629 3300005435 Bacteria 1847
43 Ga0070714_100204828 3300005435 Bacteria 1806
44 Ga0070714_100230942 3300005435 Bacteria 1704
45 Ga0070714_100356753 3300005435 Archaea 1374
46 Ga0070714_100548646 3300005435 Bacteria 1106
47 Ga0070713_100024503 3300005436 Bacteria 4701
48 Ga0070713_100028369 3300005436 Bacteria 4420
49 Ga0070713_100052157 3300005436 Bacteria 3385
50 Ga0070713_100068922 3300005436 Bacteria 2981
51 Ga0070713_100167224 3300005436 Bacteria 1967
52 Ga0070713_100244315 3300005436 Bacteria 1635
53 Ga0070713_100267511 3300005436 Bacteria 1564
54 Ga0070713_100383791 3300005436 Bacteria 1309
55 Ga0070713_100466004 3300005436 Bacteria 1188
56 Ga0070713_100533065 3300005436 Bacteria 1110
57 Ga0070710_10002695 3300005437 Bacteria 8440
58 Ga0070710_10010223 3300005437 Bacteria 4605
59 Ga0070710_10035533 3300005437 Bacteria 2717
60 Ga0070710_10036591 3300005437 Bacteria 2684
61 Ga0070710_10152023 3300005437 Bacteria 1428
62 Ga0070711_100004689 3300005439 Bacteria 8095
63 Ga0070711_100046811 3300005439 Bacteria 2949
64 Ga0070711_100133258 3300005439 Bacteria 1853
65 Ga0070711_100197438 3300005439 Bacteria 1550
66 Ga0070705_100110294 3300005440 Bacteria 1757
67 Ga0070700_100014270 3300005441 Bacteria 4482
68 Ga0070700_100044115 3300005441 Bacteria 2745
69 Ga0070700_100063675 3300005441 Bacteria 2333
70 Ga0070694_100093855 3300005444 Bacteria 2110
71 Ga0070694_100281536 3300005444 Bacteria 1268
72 Ga0070694_100327618 3300005444 Bacteria 1180
73 Ga0070708_100004424 3300005445 Bacteria 11039
74 Ga0070708_100017649 3300005445 Bacteria 5957
75 Ga0070708_100181642 3300005445 Bacteria 1967
76 Ga0070708_100259488 3300005445 Bacteria 1633
77 Ga0070708_100264756 3300005445 Bacteria 1616
78 Ga0070663_100063092 3300005455 Unclassified 2674
79 Ga0070663_100089887 3300005455 Bacteria 2273
80 Ga0070678_100007503 3300005456 Bacteria 6475
81 Ga0070678_100039327 3300005456 Bacteria 3336
82 Ga0070678_100086668 3300005456 Bacteria 2390
83 Ga0070678_100555792 3300005456 Bacteria 1019
84 Ga0070662_100004637 3300005457 Bacteria 8712
85 Ga0070662_100063804 3300005457 Bacteria 2695
86 Ga0070662_100109120 3300005457 Bacteria 2106
87 Ga0070681_10082704 3300005458 Bacteria 3165
88 Ga0070681_10149890 3300005458 Bacteria 2259
89 Ga0070685_10076513 3300005466 Bacteria 1996
90 Ga0070706_100000375 3300005467 Bacteria 53735
91 Ga0070706_100031441 3300005467 Bacteria 4895
92 Ga0070706_100043571 3300005467 Bacteria 4147
93 Ga0070706_100065617 3300005467 Bacteria 3357
94 Ga0070706_100100499 3300005467 Unclassified 2688
95 Ga0070707_100000066 3300005468 Bacteria 94334
96 Ga0070707_100017702 3300005468 Bacteria 6701
97 Ga0070707_100021138 3300005468 Bacteria 6149
98 Ga0070707_100023318 3300005468 Bacteria 5855
99 Ga0070707_100038344 3300005468 Bacteria 4576
100 Ga0070707_100043093 3300005468 Bacteria 4320
101 Ga0070707_100139439 3300005468 Bacteria 2359
102 Ga0070707_100144814 3300005468 Bacteria 2313
103 Ga0070707_100156010 3300005468 Bacteria 2223
104 Ga0070707_100545947 3300005468 Unclassified 1121
105 Ga0070698_100000154 3300005471 Bacteria 62325
106 Ga0070698_100001286 3300005471 Bacteria 27984
107 Ga0070698_100001968 3300005471 Bacteria 22831
108 Ga0070698_100011919 3300005471 Bacteria 9224
109 Ga0070698_100019313 3300005471 Bacteria 7158
110 Ga0070698_100040084 3300005471 Bacteria 4816
111 Ga0070698_100047136 3300005471 Bacteria 4405
112 Ga0070698_100060698 3300005471 Bacteria 3815
113 Ga0070698_100141832 3300005471 Bacteria 2353
114 Ga0070699_100064177 3300005518 Bacteria 3185
115 Ga0070679_100018007 3300005530 Bacteria 6847
116 Ga0070684_100012361 3300005535 Bacteria 6839
117 Ga0070697_100054991 3300005536 Bacteria 3236
118 Ga0070672_100130656 3300005543 Bacteria 2063
119 Ga0070672_100588217 3300005543 Bacteria 969
120 Ga0070686_100032404 3300005544 Bacteria 3204
121 Ga0070695_100138049 3300005545 Unclassified 1687
122 Ga0070696_100016321 3300005546 Bacteria 4998
123 Ga0070696_100076288 3300005546 Bacteria 2366
124 Ga0070693_100024525 3300005547 Bacteria 3235
125 Ga0070665_100212756 3300005548 Bacteria 1934
126 Ga0070665_100307890 3300005548 Bacteria 1587
127 Ga0070704_100132805 3300005549 Bacteria 1932
128 Ga0070704_100165203 3300005549 Bacteria 1754
129 Ga0068855_100504180 3300005563 Bacteria 1315
130 Ga0070664_100107819 3300005564 Bacteria 2428
131 Ga0068857_100157844 3300005577 Bacteria 2057
132 Ga0068857_100222354 3300005577 Bacteria 1725
133 Ga0068854_100073339 3300005578 Bacteria 2508
134 Ga0068854_100121366 3300005578 Bacteria 1984
135 Ga0068856_100011107 3300005614 Bacteria 8743
136 Ga0068856_100275341 3300005614 Bacteria 1699
137 Ga0070702_100005419 3300005615 Bacteria 5936
138 Ga0070702_100102751 3300005615 Unclassified 1756
139 Ga0068852_100059682 3300005616 Bacteria 3309
140 Ga0068859_100145346 3300005617 Bacteria 2446
141 Ga0068859_100221308 3300005617 Bacteria 1981
142 Ga0068864_100020263 3300005618 Bacteria 5563
143 Ga0068864_100046068 3300005618 Bacteria 3741
144 Ga0068866_10018039 3300005718 Bacteria 3186
145 Ga0068861_100028049 3300005719 Bacteria 4106
146 Ga0068870_10057575 3300005840 Bacteria 2078
147 Ga0068858_100084553 3300005842 Unclassified 2951
148 Ga0068858_100174921 3300005842 Bacteria 2025
149 Ga0068858_100267144 3300005842 Bacteria 1627
150 Ga0068860_100330427 3300005843 Bacteria 1497
151 Ga0068862_100262817 3300005844 Unclassified 1576
152 Ga0068862_100398380 3300005844 Bacteria 1287
153 Ga0081455_10001580 3300005937 Bacteria 27889
154 Ga0081455_10005547 3300005937 Bacteria 13811
155 Ga0081455_10006129 3300005937 Bacteria 12989
156 Ga0081455_10007490 3300005937 Bacteria 11486
157 Ga0081455_10024619 3300005937 Bacteria 5569
158 Ga0081455_10103873 3300005937 Unclassified 2274
159 Ga0081538_10000119 3300005981 Bacteria 79144
160 Ga0081538_10000341 3300005981 Bacteria 53130
161 Ga0081538_10000363 3300005981 Bacteria 51672
162 Ga0081538_10000794 3300005981 Bacteria 34312
163 Ga0081538_10001231 3300005981 Bacteria 26860
164 Ga0081538_10001459 3300005981 Bacteria 24258
165 Ga0081538_10003155 3300005981 Bacteria 15674
166 Ga0081538_10004603 3300005981 Bacteria 12669
167 Ga0081538_10007265 3300005981 Bacteria 9607
168 Ga0081538_10010210 3300005981 Bacteria 7714
169 Ga0081538_10010704 3300005981 Bacteria 7505
170 Ga0081538_10014365 3300005981 Bacteria 6204
171 Ga0081538_10018571 3300005981 Bacteria 5214
172 Ga0081538_10059045 3300005981 Bacteria 2219
173 Ga0081540_1001060 3300005983 Bacteria 24500
174 Ga0081540_1001071 3300005983 Bacteria 24309
175 Ga0081539_10001190 3300005985 Bacteria 46973
176 Ga0081539_10003624 3300005985 Bacteria 18628
177 Ga0070717_10003127 3300006028 Bacteria 11823
178 Ga0070717_10014119 3300006028 Bacteria 6139
179 Ga0070717_10015943 3300006028 Bacteria 5816
180 Ga0070717_10019528 3300006028 Bacteria 5316
181 Ga0070717_10024168 3300006028 Bacteria 4822
182 Ga0070717_10038499 3300006028 Bacteria 3887
183 Ga0070717_10178772 3300006028 Bacteria 1848
184 Ga0070717_10256857 3300006028 Bacteria 1545
185 Ga0070717_10444612 3300006028 Unclassified 1168
186 Ga0075432_10000309 3300006058 Bacteria 13716
187 Ga0075432_10001600 3300006058 Bacteria 7443
188 Ga0075432_10019558 3300006058 Bacteria 2315
189 Ga0070715_10073488 3300006163 Bacteria 1533
190 Ga0070715_10163237 3300006163 Bacteria 1103
191 Ga0070716_100006952 3300006173 Bacteria 5547
192 Ga0070716_100025593 3300006173 Unclassified 3150
193 Ga0070716_100053225 3300006173 Bacteria 2307
194 Ga0070712_100003643 3300006175 Bacteria 9497
195 Ga0070712_100015513 3300006175 Bacteria 4912
196 Ga0070712_100028476 3300006175 Bacteria 3737
197 Ga0070712_100031147 3300006175 Bacteria 3591
198 Ga0070712_100037668 3300006175 Bacteria 3298
199 Ga0070712_100041840 3300006175 Bacteria 3148
200 Ga0070712_100131729 3300006175 Bacteria 1896
201 Ga0070712_100146781 3300006175 Bacteria 1806
202 Ga0070712_100292758 3300006175 Bacteria 1315
203 Ga0070712_100330066 3300006175 Unclassified 1243
204 Ga0075428_100009273 3300006844 Bacteria 10912
205 Ga0075428_100049587 3300006844 Bacteria 4606
206 Ga0075428_100058206 3300006844 Bacteria 4231
207 Ga0075428_100067155 3300006844 Bacteria 3926
208 Ga0075428_100070392 3300006844 Bacteria 3824
209 Ga0075428_100075538 3300006844 Plasmid 3679
210 Ga0075428_100129503 3300006844 Bacteria 2746
211 Ga0075428_100165122 3300006844 Bacteria 2402
212 Ga0075428_100348823 3300006844 Bacteria 1589
213 Ga0075428_100491503 3300006844 Bacteria 1313
214 Ga0075430_100005349 3300006846 Bacteria 10842
215 Ga0075430_100024405 3300006846 Bacteria 5145
216 Ga0075430_100302874 3300006846 Bacteria 1322
217 Ga0075430_100325432 3300006846 Bacteria 1271
218 Ga0075431_100002349 3300006847 Bacteria 18169
219 Ga0075431_100061014 3300006847 Bacteria 3892
220 Ga0075431_100118852 3300006847 Bacteria 2727
221 Ga0075431_100236693 3300006847 Bacteria 1859
222 Ga0075431_100322320 3300006847 Bacteria 1558
223 Ga0075433_10000234 3300006852 Bacteria 31714
224 Ga0075433_10000811 3300006852 Bacteria 21706
225 Ga0075433_10019309 3300006852 Bacteria 5678
226 Ga0075433_10024200 3300006852 Bacteria 5122
227 Ga0075433_10028634 3300006852 Bacteria 4738
228 Ga0075434_100001052 3300006871 Bacteria 22507
229 Ga0075434_100004422 3300006871 Bacteria 12671
230 Ga0075434_100009064 3300006871 Bacteria 9268
231 Ga0075434_100034418 3300006871 Bacteria 5002
232 Ga0075434_100074608 3300006871 Bacteria 3385
233 Ga0075434_100380457 3300006871 Bacteria 1432
234 Ga0075429_100018673 3300006880 Bacteria 6004
235 Ga0075429_100032915 3300006880 Bacteria 4505
236 Ga0075429_100051050 3300006880 Bacteria 3599
237 Ga0075429_100182053 3300006880 Bacteria 1841
238 Ga0068865_100011176 3300006881 Bacteria 5611
239 Ga0068865_100190358 3300006881 Bacteria 1586
240 Ga0075436_100019951 3300006914 Bacteria 4599
241 Ga0075436_100073007 3300006914 Bacteria 2374
242 Ga0097620_100145352 3300006931 Bacteria 2446
243 Ga0097620_100221307 3300006931 Bacteria 1981
244 Ga0075435_100004443 3300007076 Bacteria 9634
245 Ga0075435_100100413 3300007076 Bacteria 2397
246 Ga0075435_100221815 3300007076 Bacteria 1605
247 Ga0075435_100280694 3300007076 Unclassified 1422
248 Ga0105251_10038250 3300009011 Bacteria 2351
249 Ga0111539_10021582 3300009094 Bacteria 7921
250 Ga0111539_10049652 3300009094 Bacteria 5002
251 Ga0111539_10060157 3300009094 Bacteria 4502
252 Ga0111539_10080417 3300009094 Bacteria 3833
253 Ga0111539_10173886 3300009094 Bacteria 2516
254 Ga0111539_10316443 3300009094 Unclassified 1816
255 Ga0105245_10010448 3300009098 Bacteria 8082
256 Ga0105245_10013848 3300009098 Bacteria 7026
257 Ga0105245_10047883 3300009098 Bacteria 3823
258 Ga0105245_10268098 3300009098 Bacteria 1664
259 Ga0114129_10000828 3300009147 Bacteria 39974
260 Ga0114129_10006324 3300009147 Bacteria 16796
261 Ga0114129_10017561 3300009147 Bacteria 10184
262 Ga0114129_10031864 3300009147 Bacteria 7452
263 Ga0114129_10034855 3300009147 Bacteria 7110
264 Ga0114129_10102441 3300009147 Bacteria 3959
265 Ga0114129_10130309 3300009147 Bacteria 3454
266 Ga0114129_10145984 3300009147 Bacteria 3241
267 Ga0114129_10203819 3300009147 Bacteria 2677
268 Ga0114129_10238927 3300009147 Bacteria 2443
269 Ga0105243_10007622 3300009148 Bacteria 8319
270 Ga0105243_10126263 3300009148 Bacteria 2164
271 Ga0105243_10126547 3300009148 Unclassified 2162
272 Ga0105243_10242820 3300009148 Unclassified 1604
273 Ga0105242_10092778 3300009176 Bacteria 2544
274 Ga0105242_10141215 3300009176 Bacteria 2090
275 Ga0105248_10275454 3300009177 Bacteria 1894
276 Ga0105237_10338970 3300009545 Bacteria 1508
277 Ga0105237_10468619 3300009545 Bacteria 1266
278 Ga0105238_10051230 3300009551 Bacteria 4152
279 Ga0105238_10075013 3300009551 Bacteria 3374
280 Ga0105238_10180422 3300009551 Bacteria 2088
281 Ga0105249_10007496 3300009553 Bacteria 9520
282 Ga0105249_10024741 3300009553 Bacteria 5398
283 Ga0105249_10331718 3300009553 Bacteria 1535
284 Ga0105239_10224996 3300010375 Bacteria 2104
285 Ga0105239_10383876 3300010375 Unclassified 1588
286 Ga0157313_1000544 3300012503 Bacteria 1763
287 Ga0157342_1004730 3300012507 Unclassified 1222
288 Ga0157373_10109159 3300013100 Bacteria 1945
289 Ga0157373_10279865 3300013100 Bacteria 1182
290 Ga0157369_10173293 3300013105 Bacteria 2272
291 Ga0157369_10344393 3300013105 Bacteria 1548
292 Ga0157374_10029783 3300013296 Bacteria 4949
293 Ga0157374_10262275 3300013296 Bacteria 1702
294 Ga0163162_10136391 3300013306 Bacteria 2565
295 Ga0163162_10236582 3300013306 Bacteria 1957
296 Ga0157372_10007232 3300013307 Bacteria 11821
297 Ga0157372_10209682 3300013307 Bacteria 2258
298 Ga0157372_10411381 3300013307 Bacteria 1576
299 Ga0157375_10090320 3300013308 Bacteria 3121
300 Ga0157375_10243495 3300013308 Bacteria 1958
301 Ga0157375_10636741 3300013308 Bacteria 1223
302 Ga0163163_10024088 3300014325 Bacteria 5791
303 Ga0163163_10381327 3300014325 Bacteria 1467
304 Ga0157380_10329998 3300014326 Bacteria 1418
305 Ga0157377_10034424 3300014745 Bacteria 2772
306 Ga0157377_10284900 3300014745 Bacteria 1084
307 Ga0157379_10085306 3300014968 Unclassified 2830
308 Ga0157376_10303683 3300014969 Bacteria 1512
309 Ga0163161_10044759 3300017792 Bacteria 3189
310 Ga0163161_10065162 3300017792 Bacteria 2659
311 Ga0206353_10589720 3300020082 Unclassified 1440
312 Ga0213873_10002755 3300021358 Unclassified 3084
313 Ga0213874_10009744 3300021377 Bacteria 2386
314 Ga0213876_10017042 3300021384 Bacteria 3837
315 Ga0213876_10026893 3300021384 Bacteria 3036
316 Ga0213876_10031475 3300021384 Bacteria 2800
317 Ga0213876_10039018 3300021384 Bacteria 2508
318 Ga0213876_10048819 3300021384 Bacteria 2235
319 Ga0213876_10056108 3300021384 Bacteria 2079
320 Ga0213876_10079983 3300021384 Bacteria 1727
321 Ga0213876_10093359 3300021384 Bacteria 1594
322 Ga0213876_10230540 3300021384 Bacteria 984
323 Ga0213875_10001813 3300021388 Bacteria 13309
324 Ga0213875_10002888 3300021388 Bacteria 10043
325 Ga0213875_10005972 3300021388 Bacteria 6457
326 Ga0213875_10011152 3300021388 Bacteria 4480
327 Ga0213875_10019205 3300021388 Bacteria 3289
328 Ga0213875_10077572 3300021388 Bacteria 1550
329 Ga0224572_1007312 3300024225 Bacteria 2021
330 Ga0207656_10055985 3300025321 Bacteria 1718
331 Ga0207653_10012856 3300025885 Bacteria 2617
332 Ga0207692_10005054 3300025898 Bacteria 5254
333 Ga0207692_10011928 3300025898 Bacteria 3718
334 Ga0207692_10019007 3300025898 Bacteria 3096
335 Ga0207692_10060827 3300025898 Bacteria 1955
336 Ga0207692_10207004 3300025898 Unclassified 1156
337 Ga0207642_10051213 3300025899 Bacteria 1867
338 Ga0207642_10056524 3300025899 Bacteria 1800
339 Ga0207688_10001125 3300025901 Bacteria 13756
340 Ga0207688_10023495 3300025901 Bacteria 3377
341 Ga0207688_10029205 3300025901 Bacteria 3034
342 Ga0207688_10053343 3300025901 Bacteria 2267
343 Ga0207647_10099580 3300025904 Bacteria 1726
344 Ga0207685_10003459 3300025905 Bacteria 3845
345 Ga0207699_10000659 3300025906 Bacteria 16627
346 Ga0207699_10004980 3300025906 Bacteria 6351
347 Ga0207699_10016450 3300025906 Bacteria 3870
348 Ga0207699_10029097 3300025906 Bacteria 3077
349 Ga0207699_10030870 3300025906 Unclassified 3003
350 Ga0207699_10108636 3300025906 Bacteria 1774
351 Ga0207645_10155238 3300025907 Bacteria 1495
352 Ga0207645_10171599 3300025907 Bacteria 1422
353 Ga0207643_10074076 3300025908 Bacteria 1963
354 Ga0207705_10033687 3300025909 Bacteria 3660
355 Ga0207684_10000482 3300025910 Bacteria 51648
356 Ga0207684_10003822 3300025910 Bacteria 14506
357 Ga0207684_10018630 3300025910 Bacteria 5944
358 Ga0207684_10023353 3300025910 Bacteria 5280
359 Ga0207684_10041000 3300025910 Bacteria 3926
360 Ga0207684_10128889 3300025910 Bacteria 2171
361 Ga0207684_10186950 3300025910 Bacteria 1786
362 Ga0207684_10304173 3300025910 Bacteria 1375
363 Ga0207707_10029210 3300025912 Bacteria 4819
364 Ga0207707_10265224 3300025912 Bacteria 1489
365 Ga0207693_10004052 3300025915 Bacteria 12453
366 Ga0207693_10004896 3300025915 Bacteria 11254
367 Ga0207693_10016006 3300025915 Bacteria 6002
368 Ga0207693_10018247 3300025915 Bacteria 5589
369 Ga0207693_10020319 3300025915 Bacteria 5284
370 Ga0207693_10040245 3300025915 Bacteria 3681
371 Ga0207693_10195522 3300025915 Bacteria 1591
372 Ga0207663_10028778 3300025916 Unclassified 3257
373 Ga0207663_10038675 3300025916 Bacteria 2886
374 Ga0207660_10355689 3300025917 Bacteria 1174
375 Ga0207662_10007952 3300025918 Bacteria 5777
376 Ga0207662_10009716 3300025918 Bacteria 5304
377 Ga0207657_10017985 3300025919 Bacteria 6763
378 Ga0207657_10210454 3300025919 Bacteria 1561
379 Ga0207652_10040804 3300025921 Bacteria 3942
380 Ga0207652_10411823 3300025921 Bacteria 1219
381 Ga0207646_10000065 3300025922 Bacteria 149387
382 Ga0207646_10008867 3300025922 Bacteria 10016
383 Ga0207646_10043136 3300025922 Bacteria 4052
384 Ga0207646_10045029 3300025922 Bacteria 3960
385 Ga0207646_10059077 3300025922 Bacteria 3425
386 Ga0207646_10073536 3300025922 Bacteria 3053
387 Ga0207646_10092570 3300025922 Bacteria 2706
388 Ga0207646_10170988 3300025922 Bacteria 1962
389 Ga0207646_10193149 3300025922 Bacteria 1838
390 Ga0207681_10114236 3300025923 Bacteria 1970
391 Ga0207694_10122831 3300025924 Bacteria 2074
392 Ga0207659_10187210 3300025926 Bacteria 1645
393 Ga0207687_10022594 3300025927 Bacteria 4188
394 Ga0207687_10218564 3300025927 Bacteria 1499
395 Ga0207687_10282905 3300025927 Unclassified 1330
396 Ga0207687_10310540 3300025927 Unclassified 1273
397 Ga0207700_10005110 3300025928 Bacteria 7803
398 Ga0207700_10013335 3300025928 Bacteria 5343
399 Ga0207700_10017692 3300025928 Bacteria 4767
400 Ga0207700_10020878 3300025928 Bacteria 4459
401 Ga0207700_10022201 3300025928 Bacteria 4349
402 Ga0207700_10042573 3300025928 Bacteria 3330
403 Ga0207700_10045239 3300025928 Bacteria 3246
404 Ga0207700_10079389 3300025928 Bacteria 2555
405 Ga0207700_10115337 3300025928 Bacteria 2169
406 Ga0207700_10129655 3300025928 Bacteria 2057
407 Ga0207700_10135497 3300025928 Unclassified 2017
408 Ga0207700_10184256 3300025928 Bacteria 1750
409 Ga0207700_10221151 3300025928 Bacteria 1605
410 Ga0207700_10568489 3300025928 Bacteria 1007
411 Ga0207664_10011686 3300025929 Bacteria 6256
412 Ga0207664_10013891 3300025929 Bacteria 5801
413 Ga0207664_10014275 3300025929 Bacteria 5729
414 Ga0207664_10024582 3300025929 Bacteria 4528
415 Ga0207664_10030076 3300025929 Bacteria 4144
416 Ga0207664_10036147 3300025929 Bacteria 3816
417 Ga0207664_10043788 3300025929 Bacteria 3503
418 Ga0207664_10045244 3300025929 Bacteria 3451
419 Ga0207664_10164854 3300025929 Bacteria 1892
420 Ga0207664_10174931 3300025929 Bacteria 1839
421 Ga0207664_10180511 3300025929 Bacteria 1812
422 Ga0207664_10274528 3300025929 Bacteria 1478
423 Ga0207706_10010261 3300025933 Bacteria 8564
424 Ga0207706_10012626 3300025933 Bacteria 7689
425 Ga0207706_10055577 3300025933 Bacteria 3490
426 Ga0207706_10075832 3300025933 Bacteria 2958
427 Ga0207706_10177864 3300025933 Bacteria 1869
428 Ga0207670_10189902 3300025936 Unclassified 1554
429 Ga0207670_10195683 3300025936 Bacteria 1532
430 Ga0207704_10002466 3300025938 Bacteria 8328
431 Ga0207704_10147218 3300025938 Unclassified 1656
432 Ga0207665_10003760 3300025939 Bacteria 10137
433 Ga0207665_10051133 3300025939 Unclassified 2780
434 Ga0207665_10092192 3300025939 Bacteria 2101
435 Ga0207691_10088069 3300025940 Bacteria 2784
436 Ga0207689_10017942 3300025942 Bacteria 5977
437 Ga0207689_10448283 3300025942 Bacteria 1078
438 Ga0207661_10128283 3300025944 Bacteria 2169
439 Ga0207661_10150040 3300025944 Bacteria 2014
440 Ga0207661_10192348 3300025944 Bacteria 1789
441 Ga0207661_10222498 3300025944 Bacteria 1669
442 Ga0207679_10254791 3300025945 Bacteria 1494
443 Ga0207679_10292254 3300025945 Bacteria 1401
444 Ga0207667_10363815 3300025949 Bacteria 1475
445 Ga0207651_10061888 3300025960 Bacteria 2606
446 Ga0207712_10057584 3300025961 Bacteria 2743
447 Ga0207712_10159974 3300025961 Bacteria 1749
448 Ga0207668_10273036 3300025972 Bacteria 1383
449 Ga0207640_10241589 3300025981 Bacteria 1396
450 Ga0207658_10058070 3300025986 Bacteria 2878
451 Ga0207677_10102627 3300026023 Bacteria 2109
452 Ga0207703_10058815 3300026035 Unclassified 3138
453 Ga0207678_10026853 3300026067 Bacteria 5022
454 Ga0207678_10069036 3300026067 Unclassified 3031
455 Ga0207678_10399367 3300026067 Bacteria 1190
456 Ga0207708_10000313 3300026075 Bacteria 38253
457 Ga0207708_10005382 3300026075 Bacteria 9432
458 Ga0207708_10126990 3300026075 Bacteria 1991
459 Ga0207708_10167222 3300026075 Bacteria 1739
460 Ga0207702_10059165 3300026078 Unclassified 3263
461 Ga0207702_10094052 3300026078 Bacteria 2630
462 Ga0207702_10220015 3300026078 Bacteria 1769
463 Ga0207648_10302955 3300026089 Bacteria 1433
464 Ga0207676_10545399 3300026095 Unclassified 1107
465 Ga0207674_10011077 3300026116 Bacteria 10138
466 Ga0207674_10149194 3300026116 Bacteria 2296
467 Ga0207674_10365020 3300026116 Bacteria 1396
468 Ga0207675_100004300 3300026118 Bacteria 13763
469 Ga0207675_100024503 3300026118 Bacteria 5610
470 Ga0207675_100043134 3300026118 Bacteria 4212
471 Ga0207675_100076652 3300026118 Bacteria 3131
472 Ga0207683_10009073 3300026121 Bacteria 8473
473 Ga0207683_10090481 3300026121 Bacteria 2725
474 Ga0207683_10464958 3300026121 Bacteria 1167
475 Ga0207698_10298981 3300026142 Bacteria 1497
476 Ga0207698_10429260 3300026142 Bacteria 1270
477 Ga0207428_10000786 3300027907 Bacteria 35962
478 Ga0207428_10010177 3300027907 Bacteria 8407
479 Ga0207428_10020818 3300027907 Bacteria 5563
480 Ga0207428_10091719 3300027907 Bacteria 2358
481 Ga0207428_10120580 3300027907 Bacteria 2011
482 Ga0207428_10293637 3300027907 Bacteria 1204
483 Ga0268266_10005801 3300028379 Bacteria 11432
484 Ga0268266_10211503 3300028379 Bacteria 1779
485 Ga0268265_10506299 3300028380 Bacteria 1139
486 Ga0268264_10202744 3300028381 Bacteria 1816
487 Ga0265337_1000319 3300028556 Bacteria 25692
488 Ga0265326_10016822 3300028558 Bacteria 2111
489 Ga0265319_1000691 3300028563 Bacteria 21986
490 Ga0265334_10000319 3300028573 Bacteria 26458
491 Ga0265318_10013900 3300028577 Bacteria 3389
492 Ga0265336_10007712 3300028666 Bacteria 3817
493 Ga0265338_10003620 3300028800 Bacteria 21541
494 Ga0265324_10001646 3300029957 Bacteria 12355
495 Ga0265332_10041382 3300031238 Bacteria 1993
496 Ga0265320_10028404 3300031240 Bacteria 2904
497 Ga0265325_10147622 3300031241 Bacteria 1114
498 Ga0265340_10023361 3300031247 Bacteria 3153
499 Ga0265339_10129029 3300031249 Bacteria 1294
500 Ga0265316_10090231 3300031344 Bacteria 2338
501 Ga0307408_100009358 3300031548 Bacteria 6458
502 Ga0307408_100042968 3300031548 Bacteria 3214
503 Ga0307408_100079791 3300031548 Bacteria 2443
504 Ga0307408_100163592 3300031548 Bacteria 1770
505 Ga0307408_100425782 3300031548 Bacteria 1146
506 Ga0265313_10015288 3300031595 Bacteria 4481
507 Ga0265314_10025109 3300031711 Bacteria 4502
508 Ga0307405_10010826 3300031731 Bacteria 4748
509 Ga0307405_10019735 3300031731 Bacteria 3752
510 Ga0307413_10014988 3300031824 Bacteria 3959
511 Ga0307413_10036238 3300031824 Bacteria 2838
512 Ga0307413_10085742 3300031824 Bacteria 2034
513 Ga0307413_10296948 3300031824 Bacteria 1223
514 Ga0307413_10416972 3300031824 Bacteria 1056
515 Ga0307410_10039483 3300031852 Bacteria 3099
516 Ga0307410_10057755 3300031852 Unclassified 2643
517 Ga0307410_10070140 3300031852 Bacteria 2426
518 Ga0307410_10120840 3300031852 Bacteria 1910
519 Ga0307406_10000092 3300031901 Bacteria 50968
520 Ga0307406_10009606 3300031901 Bacteria 5436
521 Ga0307406_10027282 3300031901 Bacteria 3440
522 Ga0307406_10137275 3300031901 Bacteria 1726
523 Ga0307406_10152834 3300031901 Bacteria 1649
524 Ga0307406_10274405 3300031901 Bacteria 1282
525 Ga0307407_10031208 3300031903 Bacteria 2883
526 Ga0307407_10051904 3300031903 Bacteria 2352
527 Ga0307407_10193705 3300031903 Bacteria 1357
528 Ga0307407_10280511 3300031903 Bacteria 1154
529 Ga0307412_10280855 3300031911 Bacteria 1307
530 Ga0307409_100000271 3300031995 Bacteria 21043
531 Ga0307409_100013409 3300031995 Bacteria 5274
532 Ga0307409_100094877 3300031995 Bacteria 2456
533 Ga0307409_100165593 3300031995 Bacteria 1939
534 Ga0307409_100235602 3300031995 Bacteria 1662
535 Ga0307409_100287648 3300031995 Bacteria 1522
536 Ga0307409_100517786 3300031995 Bacteria 1165
537 Ga0307416_100000069 3300032002 Bacteria 84159
538 Ga0307416_100023223 3300032002 Bacteria 4495
539 Ga0307416_100024727 3300032002 Bacteria 4390
540 Ga0307416_100083569 3300032002 Bacteria 2709
541 Ga0307416_100110591 3300032002 Bacteria 2420
542 Ga0307416_100114226 3300032002 Bacteria 2388
543 Ga0307416_100475139 3300032002 Unclassified 1309
544 Ga0307416_100689336 3300032002 Bacteria 1110
545 Ga0307416_100690012 3300032002 Bacteria 1109
546 Ga0307414_10018263 3300032004 Bacteria 4312
547 Ga0307414_10047459 3300032004 Bacteria 2955
548 Ga0307414_10113199 3300032004 Bacteria 2071
549 Ga0307414_10163212 3300032004 Unclassified 1772
550 Ga0307411_10032643 3300032005 Bacteria 3219
551 Ga0307411_10044690 3300032005 Bacteria 2844
552 Ga0307415_100026321 3300032126 Bacteria 3667
553 Ga0307415_100040837 3300032126 Bacteria 3076
554 Ga0307415_100093916 3300032126 Unclassified 2179
555 Ga0307415_100169836 3300032126 Bacteria 1699
556 Ga0307415_100239591 3300032126 Bacteria 1466
557 Ga0307415_100364523 3300032126 Bacteria 1221
558 Ga0307415_100366697 3300032126 Bacteria 1218
559 Ga0307415_100385503 3300032126 Bacteria 1191
560 Ga0307415_100522842 3300032126 Bacteria 1042
561 Ga0373948_0009622 3300034817 Bacteria 1671
562 Ga0373950_0032982 3300034818 Bacteria 965
563 Ga0373959_0005244 3300034820 Bacteria 2122
564 Ga0373926_0021790 3300035083 Bacteria 2220
565 Ga0373929_0006252 3300035085 Bacteria 2151
566 Ga0373934_0033901 3300035086 Bacteria 2005
567 Ga0373944_0035599 3300035089 Bacteria 1518
568 Ga0373951_0021181 3300035091 Bacteria 1492
569 Ga0373923_0009008 3300035111 Bacteria 3584
570 Ga0373939_0005122 3300035114 Bacteria 3116
571 Ga0373953_0001251 3300035117 Bacteria 7255
572 Ga0373953_0049077 3300035117 Bacteria 1702
573 Ga0373956_0086396 3300035119 Bacteria 1443
574 Ga0373943_0052571 3300035170 Bacteria 2009
575 Ga0373943_0251507 3300035170 Bacteria 993
576 Ga0373946_0061753 3300035171 Bacteria 1596
577 Ga0373955_0012095 3300035172 Bacteria 4139
578 Ga0373955_0013035 3300035172 Unclassified 4009
579 Ga0373961_0010613 3300035241 Bacteria 2272
580 Ga0373931_0005214 3300035691 Bacteria 5995
581 Ga0373931_0036552 3300035691 Bacteria 2560
582 Ga0373931_0381435 3300035691 Bacteria 889
583 Ga0373935_0102302 3300035692 Bacteria 1890
584 Ga0373935_0202401 3300035692 Bacteria 1372
585 Ga0373927_0137006 3300035695 Bacteria 1600
586 Ga0373933_0001453 3300035724 Bacteria 13872
587 Ga0373933_0043094 3300035724 Bacteria 2669
588 Ga0373933_0050916 3300035724 Bacteria 2473
589 Ga0373947_0074053 3300035725 Bacteria 2094
590 Ga0373947_0077724 3300035725 Bacteria 2047
591 Ga0373947_0097396 3300035725 Unclassified 1843
592 Ga0373937_0010406 3300036401 Bacteria 8123
593 Ga0373937_0242338 3300036401 Bacteria 1699
594 Ga0373937_0274505 3300036401 Bacteria 1591
595 Ga0373937_0297133 3300036401 Bacteria 1526
596 Ga0373937_0316032 3300036401 Bacteria 1477
597 Ga0373937_0498154 3300036401 Unclassified 1157
598 Ga0373925_0000439 3300037068 Bacteria 42045
599 Ga0373925_0098791 3300037068 Bacteria 2241
600 Ga0373925_0115028 3300037068 Bacteria 2082
601 Ga0373925_0168033 3300037068 Bacteria 1730
602 Ga0395899_0009710 3300037312 Bacteria 7386
603 Ga0395899_0149513 3300037312 Unclassified 1656
604 Ga0395900_0005816 3300037418 Bacteria 12883
605 Ga0395900_0006317 3300037418 Bacteria 12357
606 Ga0395898_0008896 3300037466 Bacteria 10580
607 Ga0395905_0004992 3300037471 Bacteria 13672
608 Ga0395905_0009808 3300037471 Bacteria 9333
609 Ga0436364_0081382 3300037853 Bacteria 2968
610 Ga0436364_0150699 3300037853 Unclassified 1089
611 Ga0436364_0285692 3300037853 Bacteria 6091
612 Ga0436364_0373092 3300037853 Bacteria 1194
613 Ga0436364_0488398 3300037853 Bacteria 13678
614 Ga0436364_0537044 3300037853 Bacteria 7294
615 Ga0436364_0576770 3300037853 Bacteria 27877
616 Ga0436364_0645587 3300037853 Bacteria 4057
617 Ga0436364_0754041 3300037853 Bacteria 41620
618 Ga0436364_1135053 3300037853 Bacteria 5279
619 Ga0436364_1142348 3300037853 Bacteria 6070
620 Ga0436364_1426668 3300037853 Bacteria 1073
621 Ga0395901_0004700 3300038443 Bacteria 13780
622 Ga0395901_0008877 3300038443 Bacteria 10177
623 Ga0395901_0045891 3300038443 Unclassified 4537
624 Ga0395901_0202433 3300038443 Bacteria 2081
625 Ga0395901_0447877 3300038443 Bacteria 1321
626 Ga0436365_0025044 3300039437 Bacteria 3728
627 Ga0436365_0056917 3300039437 Bacteria 5413
628 Ga0436365_0350884 3300039437 Bacteria 2931
629 Ga0436365_0426170 3300039437 Bacteria 2157
630 Ga0436365_0504462 3300039437 Bacteria 1824
631 Ga0436365_0602287 3300039437 Bacteria 4165
632 Ga0436365_0734234 3300039437 Bacteria 4543
633 Ga0436365_0966623 3300039437 Bacteria 16320
634 Ga0436365_0969664 3300039437 Bacteria 2063
635 Ga0436365_1024425 3300039437 Bacteria 28313
636 Ga0436365_1112899 3300039437 Bacteria 27402
637 Ga0436365_1845008 3300039437 Bacteria 9892
638 Ga0436361_0466244 3300039447 Bacteria 1359
639 Ga0436363_0284115 3300039450 Bacteria 2011
640 Ga0436363_0627696 3300039450 Bacteria 32730
641 Ga0436363_1058512 3300039450 Bacteria 2567
642 Ga0436363_1283675 3300039450 Bacteria 3394
643 Ga0436363_1354190 3300039450 Unclassified 1280
644 Ga0436363_1435316 3300039450 Bacteria 1339
645 Ga0436362_0525430 3300039453 Bacteria 1068
646 Ga0436362_1024318 3300039453 Bacteria 4541
647 Ga0436362_1061294 3300039453 Bacteria 1823
648 Ga0436362_1135735 3300039453 Unclassified 4207
649 Ga0439463_005424 3300042016 Bacteria 3167
650 Ga0439435_0010732 3300042436 Bacteria 2182
651 Ga0439464_0028229 3300042439 Bacteria 1563
652 Ga0439440_0003192 3300042993 Bacteria 3143
653 Ga0439440_0005352 3300042993 Bacteria 2548
654 Ga0439440_0007076 3300042993 Bacteria 2273
655 Ga0466969_0120296 3300044656 Bacteria 1223
656 Ga0466965_0018058 3300044683 Bacteria 3376
657 Ga0466966_0020434 3300044684 Bacteria 4353
658 Ga0466961_0003639 3300044693 Bacteria 9604
659 Ga0466961_0139843 3300044693 Bacteria 1516
660 Ga0466963_0205449 3300044694 Bacteria 1378
661 Ga0466963_0305179 3300044694 Unclassified 1120
662 Ga0466971_0010628 3300044719 Bacteria 4025
663 Ga0466971_0023902 3300044719 Bacteria 2725
664 Ga0466968_0013898 3300044735 Bacteria 3173
665 Ga0466968_0030277 3300044735 Bacteria 2242
666 Ga0466968_0034519 3300044735 Bacteria 2111
667 Ga0466970_0005271 3300044765 Bacteria 6402
668 Ga0466957_0005944 3300044842 Bacteria 6879
669 Ga0466957_0080075 3300044842 Bacteria 2033
670 Ga0466959_0001493 3300045049 Bacteria 14360
671 Ga0466959_0131659 3300045049 Bacteria 1772
672 Ga0466959_0179949 3300045049 Bacteria 1479
673 Ga0466958_0000080 3300045836 Bacteria 29245
674 Ga0466958_0003438 3300045836 Bacteria 8217
675 Ga0466958_0085335 3300045836 Bacteria 1948
676 Ga0466958_0100681 3300045836 Bacteria 1796
677 Ga0466958_0175484 3300045836 Bacteria 1358
678 Ga0466967_0005794 3300045976 Bacteria 8641
679 Ga0466967_0006775 3300045976 Bacteria 8160
680 Ga0466967_0009928 3300045976 Bacteria 7106
681 Ga0466967_0122895 3300045976 Bacteria 2401
682 Ga0466967_0343534 3300045976 Bacteria 1444
683 Ga0466967_0402025 3300045976 Unclassified 1333
684 Ga0466967_0548475 3300045976 Bacteria 1138
685 Ga0495592_0000540 3300046454 Bacteria 26898
686 Ga0495592_0004832 3300046454 Bacteria 9910
687 Ga0495592_0012128 3300046454 Bacteria 6539
688 Ga0495592_0166720 3300046454 Bacteria 1511
689 Ga0495603_0040545 3300046455 Bacteria 2787
690 Ga0495603_0203493 3300046455 Bacteria 1144
691 Ga0495629_0008809 3300046459 Bacteria 7420
692 Ga0495629_0061355 3300046459 Bacteria 2628
693 Ga0495641_0011176 3300046461 Bacteria 5138
694 Ga0495651_0000497 3300046462 Bacteria 30480
695 Ga0495651_0000634 3300046462 Bacteria 27128
696 Ga0495651_0014903 3300046462 Bacteria 6010
697 Ga0495653_0017000 3300046463 Bacteria 5916
698 Ga0495653_0036045 3300046463 Bacteria 3899
699 Ga0495653_0056094 3300046463 Bacteria 3004
700 Ga0495653_0071233 3300046463 Bacteria 2600
701 Ga0495580_0052129 3300046472 Bacteria 2890
702 Ga0495582_0003013 3300046473 Bacteria 9439
703 Ga0495582_0056537 3300046473 Bacteria 2162
704 Ga0495662_0096957 3300046476 Bacteria 1441
705 Ga0495664_0007877 3300046477 Bacteria 5931
706 Ga0495664_0164849 3300046477 Bacteria 1344
707 Ga0495608_0000564 3300046511 Bacteria 25451
708 Ga0495608_0002267 3300046511 Bacteria 13889
709 Ga0495618_0005317 3300046514 Bacteria 7858
710 Ga0495618_0042335 3300046514 Bacteria 2870
711 Ga0495618_0103078 3300046514 Bacteria 1826
712 Ga0495618_0187569 3300046514 Unclassified 1312
713 Ga0495628_0010021 3300046516 Bacteria 8063
714 Ga0495628_0019819 3300046516 Bacteria 5556
715 Ga0495630_0066974 3300046517 Bacteria 2699
716 Ga0495642_0060660 3300046528 Bacteria 1569
717 Ga0495652_0002504 3300046529 Bacteria 18842
718 Ga0495652_0013239 3300046529 Bacteria 7425
719 Ga0495652_0038734 3300046529 Bacteria 4128
720 Ga0495652_0084519 3300046529 Bacteria 2610
721 Ga0495652_0246416 3300046529 Bacteria 1326
722 Ga0495665_0014557 3300046531 Bacteria 4242
723 Ga0495640_0006890 3300046533 Bacteria 8953
724 Ga0495640_0014211 3300046533 Bacteria 6035
725 Ga0495640_0016273 3300046533 Bacteria 5566
726 Ga0495640_0082756 3300046533 Bacteria 2130
727 Ga0495640_0103477 3300046533 Bacteria 1867
728 Ga0495640_0167074 3300046533 Bacteria 1407
729 Ga0495587_0001383 3300046536 Bacteria 16134
730 Ga0495587_0031468 3300046536 Bacteria 3212
731 Ga0495645_0002683 3300046543 Bacteria 12082
732 Ga0495645_0009895 3300046543 Bacteria 6672
733 Ga0495645_0013134 3300046543 Bacteria 5854
734 Ga0495645_0037406 3300046543 Bacteria 3538
735 Ga0495645_0052027 3300046543 Bacteria 2980
736 Ga0495645_0286014 3300046543 Bacteria 1082
737 Ga0495667_0000478 3300046559 Bacteria 25490
738 Ga0495667_0006223 3300046559 Bacteria 8088
739 Ga0495667_0008109 3300046559 Bacteria 7129
740 Ga0495667_0016115 3300046559 Bacteria 5050
741 Ga0495634_0036422 3300046642 Bacteria 3365
742 Ga0495634_0057503 3300046642 Bacteria 2596
743 Ga0495635_0005076 3300046663 Bacteria 9151
744 Ga0495635_0052973 3300046663 Bacteria 2795
745 Ga0495635_0054614 3300046663 Bacteria 2751
746 Ga0495635_0146470 3300046663 Bacteria 1607
747 Ga0495659_0090378 3300046664 Unclassified 1175
748 Ga0495657_0003398 3300046675 Bacteria 13000
749 Ga0495657_0107388 3300046675 Bacteria 1771
750 Ga0495599_0000393 3300046678 Bacteria 25011
751 Ga0495599_0065855 3300046678 Bacteria 2263
752 Ga0495599_0098271 3300046678 Bacteria 1825
753 Ga0495623_0071466 3300046679 Bacteria 2159
754 Ga0495646_0023042 3300046680 Bacteria 3921
755 Ga0495646_0040621 3300046680 Bacteria 2863
756 Ga0495646_0050830 3300046680 Bacteria 2510
757 Ga0495646_0058662 3300046680 Bacteria 2301
758 Ga0495646_0134102 3300046680 Bacteria 1391
759 Ga0495646_0155431 3300046680 Bacteria 1269
760 Ga0495613_0009433 3300046689 Bacteria 7239
761 Ga0495613_0075537 3300046689 Bacteria 2453
762 Ga0495624_0081901 3300046690 Bacteria 1998
763 Ga0495589_0081799 3300046794 Bacteria 1571
764 Ga0495600_0010295 3300046809 Bacteria 5801
765 Ga0495600_0017616 3300046809 Bacteria 4546
766 Ga0495600_0026737 3300046809 Bacteria 3726
767 Ga0495600_0026763 3300046809 Bacteria 3724
768 Ga0495581_0007704 3300047315 Bacteria 6231
769 Ga0495604_0003667 3300047317 Bacteria 12241
770 Ga0495604_0041136 3300047317 Bacteria 3625
771 Ga0495604_0055930 3300047317 Unclassified 3039
772 Ga0495674_0009633 3300047319 Bacteria 9177
773 Ga0495674_0013966 3300047319 Bacteria 7533
774 Ga0495674_0046815 3300047319 Unclassified 3838
775 Ga0495674_0060046 3300047319 Bacteria 3319
776 Ga0495680_0000911 3300047322 Bacteria 32800
777 Ga0495680_0005033 3300047322 Bacteria 12496
778 Ga0495680_0048497 3300047322 Bacteria 3334
779 Ga0495675_0081580 3300047444 Bacteria 2036
780 Ga0495675_0214373 3300047444 Bacteria 1167
781 Ga0495684_0000969 3300047471 Bacteria 23399
782 Ga0495684_0076544 3300047471 Bacteria 2541
783 Ga0495684_0079003 3300047471 Bacteria 2497
784 Ga0495684_0174993 3300047471 Bacteria 1593
785 Ga0495593_0018085 3300047673 Bacteria 3963
786 Ga0495593_0052667 3300047673 Bacteria 2150
787 Ga0495593_0176972 3300047673 Unclassified 1074
788 Ga0495602_0005533 3300048088 Bacteria 13255
789 Ga0495602_0033929 3300048088 Bacteria 4781
790 Ga0495602_0035853 3300048088 Bacteria 4622
791 Ga0496100_0137400 3300048903 Bacteria 1728
792 Ga0496100_0240688 3300048903 Unclassified 1335
793 Ga0496100_0299946 3300048903 Bacteria 1202
794 Ga0496101_0013801 3300048904 Bacteria 5422
795 Ga0496102_0086879 3300048905 Bacteria 2889
796 Ga0496102_0124542 3300048905 Bacteria 2408
797 Ga0496102_0492176 3300048905 Bacteria 1148
798 Ga0496104_0009034 3300048907 Bacteria 8861
799 Ga0496104_0032953 3300048907 Bacteria 4823
800 Ga0496104_0036030 3300048907 Bacteria 4622
801 Ga0496104_0358286 3300048907 Bacteria 1371
802 Ga0496105_0017962 3300048908 Bacteria 5677
803 Ga0496105_0046881 3300048908 Bacteria 3567
804 Ga0496105_0165333 3300048908 Bacteria 1815
805 Ga0496106_0136005 3300048909 Bacteria 1930
806 Ga0496106_0155448 3300048909 Bacteria 1806
807 Ga0496106_0320345 3300048909 Unclassified 1244
808 Ga0496106_0364632 3300048909 Bacteria 1161
809 Ga0496107_0080235 3300048910 Bacteria 2379
810 Ga0496108_0015207 3300048911 Bacteria 6279
811 Ga0496108_0017845 3300048911 Bacteria 5804
812 Ga0496108_0109176 3300048911 Bacteria 2364
813 Ga0496108_0120733 3300048911 Bacteria 2247
814 Ga0496108_0159694 3300048911 Bacteria 1947
815 Ga0496108_0216457 3300048911 Bacteria 1663
816 Ga0496108_0583180 3300048911 Unclassified 975
817 Ga0496109_0029572 3300048912 Bacteria 4908
818 Ga0496109_0048970 3300048912 Bacteria 3846
819 Ga0496109_0081925 3300048912 Bacteria 2973
820 Ga0496110_0006309 3300048913 Bacteria 9363
821 Ga0496110_0006957 3300048913 Bacteria 8998
822 Ga0496110_0080508 3300048913 Bacteria 2902
823 Ga0496110_0122603 3300048913 Bacteria 2343
824 Ga0496111_0004357 3300048914 Bacteria 8934
825 Ga0496111_0064541 3300048914 Unclassified 2656
826 Ga0496111_0418739 3300048914 Bacteria 989
827 Ga0496112_0010532 3300048915 Bacteria 8394
828 Ga0496112_0022659 3300048915 Bacteria 5989
829 Ga0496112_0144603 3300048915 Bacteria 2346
830 Ga0496112_0212445 3300048915 Bacteria 1892
831 Ga0496113_0022110 3300048916 Bacteria 4493
832 Ga0496113_0115760 3300048916 Bacteria 2091
833 Ga0496114_0015254 3300048917 Bacteria 6177
834 Ga0496114_0032089 3300048917 Bacteria 4321
835 Ga0496114_0075880 3300048917 Bacteria 2832
836 Ga0496114_0303994 3300048917 Unclassified 1408
837 Ga0496115_0072009 3300048918 Bacteria 2804
838 Ga0496115_0096835 3300048918 Bacteria 2416
839 Ga0496115_0130817 3300048918 Bacteria 2068
840 Ga0501031_0040637 3300049568 Bacteria 3037
841 Ga0501031_0137077 3300049568 Bacteria 1599
842 Ga0501031_0225647 3300049568 Bacteria 1219
843 Ga0501033_0160209 3300049570 Bacteria 1620
844 Ga0501036_0077529 3300049572 Bacteria 2812
845 Ga0501038_0283002 3300049574 Unclassified 1305
846 Ga0501039_0094998 3300049575 Bacteria 2324
847 Ga0501039_0181095 3300049575 Bacteria 1657
848 Ga0501040_0033965 3300049576 Bacteria 3457
849 Ga0501040_0499344 3300049576 Bacteria 877
850 Ga0501041_0052381 3300049577 Bacteria 2488
851 Ga0501042_0167051 3300049578 Bacteria 1587
852 Ga0501048_0096507 3300049582 Bacteria 2085
853 Ga0501048_0162196 3300049582 Bacteria 1582
854 Ga0501048_0187983 3300049582 Bacteria 1464
855 Ga0501048_0237962 3300049582 Bacteria 1292
856 Ga0501071_0033407 3300049587 Bacteria 3655
857 Ga0501072_0030051 3300049588 Bacteria 4247
858 Ga0501072_0041819 3300049588 Bacteria 3600
859 Ga0501072_0267739 3300049588 Bacteria 1360
860 Ga0501072_0499328 3300049588 Unclassified 962
861 Ga0501076_0101762 3300049592 Bacteria 2316
862 Ga0501077_0042461 3300049593 Bacteria 2891
863 Ga0501079_0018897 3300049741 Bacteria 5267
864 Ga0501079_0029391 3300049741 Bacteria 4219
865 Ga0501079_0122207 3300049741 Bacteria 2025
866 Ga0501079_0404730 3300049741 Unclassified 1070
867 Ga0501079_0463409 3300049741 Unclassified 995
868 Ga0501081_0064935 3300049743 Bacteria 2536
869 Ga0501081_0087553 3300049743 Bacteria 2188
870 Ga0501081_0172513 3300049743 Bacteria 1562
871 Ga0501035_0258034 3300049822 Bacteria 1478
872 Ga0501045_0022820 3300049824 Bacteria 4483
873 Ga0501045_0065090 3300049824 Bacteria 2677
874 Ga0501045_0131290 3300049824 Bacteria 1862
875 nmdc:mga05p37_1171603_c1 3300050507 Unclassified 797
876 nmdc:mga05p37_12310_c1 3300050507 Bacteria 10217
877 nmdc:mga05p37_14942_c1 3300050507 Bacteria 9320
878 nmdc:mga05p37_27246_c1 3300050507 Bacteria 6957
879 nmdc:mga05p37_41256_c1 3300050507 Bacteria 5666
880 nmdc:mga05p37_4477_c1 3300050507 Bacteria 16325
881 nmdc:mga05p37_59267_c1 3300050507 Bacteria 4714
882 nmdc:mga05p37_70682_c1 3300050507 Bacteria 4293
883 nmdc:mga05p37_966245_c1 3300050507 Bacteria 910
884 nmdc:mga09592_30352_c1 3300050508 Bacteria 4498
885 nmdc:mga09592_498878_c1 3300050508 Bacteria 1048
886 nmdc:mga09592_5100_c1 3300050508 Bacteria 10663
887 nmdc:mga0qj67_117712_c1 3300050509 Bacteria 2148
888 nmdc:mga0qj67_123833_c1 3300050509 Bacteria 2092
889 nmdc:mga0qj67_148383_c1 3300050509 Unclassified 1902
890 nmdc:mga0qj67_230062_c1 3300050509 Bacteria 1504
891 nmdc:mga0qj67_335_c1 3300050509 Bacteria 32445
892 nmdc:mga0qj67_451432_c1 3300050509 Bacteria 1035
893 nmdc:mga06r32_12707_c1 3300050510 Bacteria 7609
894 nmdc:mga06r32_161132_c1 3300050510 Bacteria 2226
895 nmdc:mga06r32_260532_c1 3300050510 Bacteria 1722
896 nmdc:mga06r32_4890_c1 3300050510 Bacteria 12069
897 nmdc:mga08y16_125397_c1 3300050511 Bacteria 2671
898 nmdc:mga08y16_139099_c1 3300050511 Bacteria 2524
899 nmdc:mga08y16_191228_c1 3300050511 Bacteria 2123
900 nmdc:mga08y16_251352_c1 3300050511 Unclassified 1827
901 nmdc:mga08y16_370773_c1 3300050511 Unclassified 1469
902 nmdc:mga08y16_520264_c1 3300050511 Bacteria 1207
903 nmdc:mga08y16_527896_c1 3300050511 Unclassified 1196
904 nmdc:mga08y16_545309_c1 3300050511 Bacteria 1174
905 nmdc:mga0n895_102984_c1 3300050512 Bacteria 2866
906 nmdc:mga0n895_110843_c1 3300050512 Bacteria 2760
907 nmdc:mga0n895_11341_c1 3300050512 Bacteria 7943
908 nmdc:mga0n895_146893_c1 3300050512 Bacteria 2388
909 nmdc:mga0n895_163181_c1 3300050512 Bacteria 2260
910 nmdc:mga0n895_20265_c1 3300050512 Bacteria 6198
911 nmdc:mga0n895_20304_c1 3300050512 Bacteria 6193
912 nmdc:mga0n895_315724_c1 3300050512 Bacteria 1584
913 nmdc:mga0n895_35044_c1 3300050512 Bacteria 4836
914 nmdc:mga0n895_35475_c1 3300050512 Bacteria 4809
915 nmdc:mga0n895_46801_c1 3300050512 Bacteria 4228
916 nmdc:mga0n895_672673_c1 3300050512 Unclassified 1033
917 nmdc:mga0rr50_11505_c1 3300050513 Bacteria 5670
918 nmdc:mga0rr50_117912_c1 3300050513 Bacteria 2109
919 nmdc:mga0rr50_424811_c1 3300050513 Unclassified 1125
920 nmdc:mga0rr50_596518_c1 3300050513 Bacteria 941
921 nmdc:mga08x19_197392_c1 3300050514 Unclassified 1378
922 nmdc:mga08x19_22071_c1 3300050514 Bacteria 3938
923 nmdc:mga0a205_14017_c1 3300050515 Bacteria 7476
924 nmdc:mga0a205_145188_c1 3300050515 Bacteria 2273
925 nmdc:mga0a205_186420_c1 3300050515 Bacteria 1968
926 nmdc:mga0a205_2017_c1 3300050515 Bacteria 17726
927 nmdc:mga0a205_250912_c1 3300050515 Bacteria 1649
928 nmdc:mga0a205_3174_c1 3300050515 Bacteria 14601
929 nmdc:mga0a205_59016_c1 3300050515 Bacteria 3707
930 nmdc:mga0a205_7749_c1 3300050515 Bacteria 9749
931 Ga0495601_0015088 3300053077 Bacteria 4666
932 Ga0495601_0100127 3300053077 Unclassified 1871
933 Ga0495612_0071735 3300053078 Bacteria 1445
934 Ga0495612_0112676 3300053078 Bacteria 1165
935 Ga0495595_0001765 3300053084 Bacteria 8447
936 Ga0495619_0007685 3300053085 Bacteria 6825
937 Ga0495619_0211710 3300053085 Bacteria 1342
938 Ga0501084_0014979 3300054114 Bacteria 6429
939 Ga0501084_0026705 3300054114 Bacteria 4821
940 Ga0501084_0063546 3300054114 Bacteria 3091
941 Ga0501084_0173668 3300054114 Bacteria 1819
942 Ga0501082_0025570 3300060353 Bacteria 5088
943 Ga0501082_0307691 3300060353 Bacteria 1380
944 Ga0501082_0522079 3300060353 Bacteria 1038
945 Ga0466962_0123761 3300061719 Bacteria 1249
946 Ga0530510_0004432 3300061734 Bacteria 9722
947 Ga0530510_0084838 3300061734 Bacteria 2307
948 Ga0530510_0096860 3300061734 Bacteria 2156
949 Ga0466963_0063586
950 JGI25406J46586_10060876
951 JGI25407J50210_10001198
952 JGI25407J50210_10002396
953 JGI25407J50210_10006772
954 Ga0070676_10054564
955 Ga0070683_100186797
956 Ga0070670_100523516
957 Ga0068869_100304115
958 Ga0070680_100014681
959 Ga0070680_100130848
960 Ga0070682_100010594
961 Ga0070682_100032953
962 Ga0068868_100041218
963 Ga0068868_100051517
964 Ga0068868_100056210
965 Ga0070689_100218173
966 Ga0070691_10017644
967 Ga0070668_100033133
968 Ga0070668_100074679
969 Ga0070668_100261887
970 Ga0070669_100080559
971 Ga0070669_100182845
972 Ga0070675_100212214
973 Ga0070671_100226433
974 Ga0070674_100085110
975 Ga0070673_100127866
976 Ga0070659_100279287
977 Ga0070659_100317759
978 Ga0070709_10000491
979 Ga0070709_10009406
980 Ga0070709_10014252
981 Ga0070709_10086557
982 Ga0070714_100001919
983 Ga0070714_100005630
984 Ga0070714_100039978
985 Ga0070714_100046466
986 Ga0070714_100047843
987 Ga0070714_100150179
988 Ga0070714_100171595
989 Ga0070714_100179731
990 Ga0070714_100195629
991 Ga0070714_100204828
992 Ga0070714_100230942
993 Ga0070714_100356753
994 Ga0070714_100548646
995 Ga0070713_100024503
996 Ga0070713_100028369
997 Ga0070713_100052157
998 Ga0070713_100068922
999 Ga0070713_100167224
1000 Ga0070713_100244315
1001 Ga0070713_100267511
1002 Ga0070713_100383791
1003 Ga0070713_100466004
1004 Ga0070713_100533065
1005 Ga0070710_10002695
1006 Ga0070710_10010223
1007 Ga0070710_10035533
1008 Ga0070710_10036591
1009 Ga0070710_10152023
1010 Ga0070711_100004689
1011 Ga0070711_100046811
1012 Ga0070711_100133258
1013 Ga0070711_100197438
1014 Ga0070705_100110294
1015 Ga0070700_100014270
1016 Ga0070700_100044115
1017 Ga0070700_100063675
1018 Ga0070694_100093855
1019 Ga0070694_100281536
1020 Ga0070694_100327618
1021 Ga0070708_100004424
1022 Ga0070708_100017649
1023 Ga0070708_100181642
1024 Ga0070708_100259488
1025 Ga0070708_100264756
1026 Ga0070663_100063092
1027 Ga0070663_100089887
1028 Ga0070678_100007503
1029 Ga0070678_100039327
1030 Ga0070678_100086668
1031 Ga0070678_100555792
1032 Ga0070662_100004637
1033 Ga0070662_100063804
1034 Ga0070662_100109120
1035 Ga0070681_10082704
1036 Ga0070681_10149890
1037 Ga0070685_10076513
1038 Ga0070706_100000375
1039 Ga0070706_100031441
1040 Ga0070706_100043571
1041 Ga0070706_100065617
1042 Ga0070706_100100499
1043 Ga0070707_100000066
1044 Ga0070707_100017702
1045 Ga0070707_100021138
1046 Ga0070707_100023318
1047 Ga0070707_100038344
1048 Ga0070707_100043093
1049 Ga0070707_100139439
1050 Ga0070707_100144814
1051 Ga0070707_100156010
1052 Ga0070707_100545947
1053 Ga0070698_100000154
1054 Ga0070698_100001286
1055 Ga0070698_100001968
1056 Ga0070698_100011919
1057 Ga0070698_100019313
1058 Ga0070698_100040084
1059 Ga0070698_100047136
1060 Ga0070698_100060698
1061 Ga0070698_100141832
1062 Ga0070699_100064177
1063 Ga0070679_100018007
1064 Ga0070684_100012361
1065 Ga0070697_100054991
1066 Ga0070672_100130656
1067 Ga0070672_100588217
1068 Ga0070686_100032404
1069 Ga0070695_100138049
1070 Ga0070696_100016321
1071 Ga0070696_100076288
1072 Ga0070693_100024525
1073 Ga0070665_100212756
1074 Ga0070665_100307890
1075 Ga0070704_100132805
1076 Ga0070704_100165203
1077 Ga0068855_100504180
1078 Ga0070664_100107819
1079 Ga0068857_100157844
1080 Ga0068857_100222354
1081 Ga0068854_100073339
1082 Ga0068854_100121366
1083 Ga0068856_100011107
1084 Ga0068856_100275341
1085 Ga0070702_100005419
1086 Ga0070702_100102751
1087 Ga0068852_100059682
1088 Ga0068859_100145346
1089 Ga0068859_100221308
1090 Ga0068864_100020263
1091 Ga0068864_100046068
1092 Ga0068866_10018039
1093 Ga0068861_100028049
1094 Ga0068870_10057575
1095 Ga0068858_100084553
1096 Ga0068858_100174921
1097 Ga0068858_100267144
1098 Ga0068860_100330427
1099 Ga0068862_100262817
1100 Ga0068862_100398380
1101 Ga0081455_10001580
1102 Ga0081455_10005547
1103 Ga0081455_10006129
1104 Ga0081455_10007490
1105 Ga0081455_10024619
1106 Ga0081455_10103873
1107 Ga0081538_10000119
1108 Ga0081538_10000341
1109 Ga0081538_10000363
1110 Ga0081538_10000794
1111 Ga0081538_10001231
1112 Ga0081538_10001459
1113 Ga0081538_10003155
1114 Ga0081538_10004603
1115 Ga0081538_10007265
1116 Ga0081538_10010210
1117 Ga0081538_10010704
1118 Ga0081538_10014365
1119 Ga0081538_10018571
1120 Ga0081538_10059045
1121 Ga0081540_1001060
1122 Ga0081540_1001071
1123 Ga0081539_10001190
1124 Ga0081539_10003624
1125 Ga0070717_10003127
1126 Ga0070717_10014119
1127 Ga0070717_10015943
1128 Ga0070717_10019528
1129 Ga0070717_10024168
1130 Ga0070717_10038499
1131 Ga0070717_10178772
1132 Ga0070717_10256857
1133 Ga0070717_10444612
1134 Ga0075432_10000309
1135 Ga0075432_10001600
1136 Ga0075432_10019558
1137 Ga0070715_10073488
1138 Ga0070715_10163237
1139 Ga0070716_100006952
1140 Ga0070716_100025593
1141 Ga0070716_100053225
1142 Ga0070712_100003643
1143 Ga0070712_100015513
1144 Ga0070712_100028476
1145 Ga0070712_100031147
1146 Ga0070712_100037668
1147 Ga0070712_100041840
1148 Ga0070712_100131729
1149 Ga0070712_100146781
1150 Ga0070712_100292758
1151 Ga0070712_100330066
1152 Ga0075428_100009273
1153 Ga0075428_100049587
1154 Ga0075428_100058206
1155 Ga0075428_100067155
1156 Ga0075428_100070392
1157 Ga0075428_100075538
1158 Ga0075428_100129503
1159 Ga0075428_100165122
1160 Ga0075428_100348823
1161 Ga0075428_100491503
1162 Ga0075430_100005349
1163 Ga0075430_100024405
1164 Ga0075430_100302874
1165 Ga0075430_100325432
1166 Ga0075431_100002349
1167 Ga0075431_100061014
1168 Ga0075431_100118852
1169 Ga0075431_100236693
1170 Ga0075431_100322320
1171 Ga0075433_10000234
1172 Ga0075433_10000811
1173 Ga0075433_10019309
1174 Ga0075433_10024200
1175 Ga0075433_10028634
1176 Ga0075434_100001052
1177 Ga0075434_100004422
1178 Ga0075434_100009064
1179 Ga0075434_100034418
1180 Ga0075434_100074608
1181 Ga0075434_100380457
1182 Ga0075429_100018673
1183 Ga0075429_100032915
1184 Ga0075429_100051050
1185 Ga0075429_100182053
1186 Ga0068865_100011176
1187 Ga0068865_100190358
1188 Ga0075436_100019951
1189 Ga0075436_100073007
1190 Ga0097620_100145352
1191 Ga0097620_100221307
1192 Ga0075435_100004443
1193 Ga0075435_100100413
1194 Ga0075435_100221815
1195 Ga0075435_100280694
1196 Ga0105251_10038250
1197 Ga0111539_10021582
1198 Ga0111539_10049652
1199 Ga0111539_10060157
1200 Ga0111539_10080417
1201 Ga0111539_10173886
1202 Ga0111539_10316443
1203 Ga0105245_10010448
1204 Ga0105245_10013848
1205 Ga0105245_10047883
1206 Ga0105245_10268098
1207 Ga0114129_10000828
1208 Ga0114129_10006324
1209 Ga0114129_10017561
1210 Ga0114129_10031864
1211 Ga0114129_10034855
1212 Ga0114129_10102441
1213 Ga0114129_10130309
1214 Ga0114129_10145984
1215 Ga0114129_10203819
1216 Ga0114129_10238927
1217 Ga0105243_10007622
1218 Ga0105243_10126263
1219 Ga0105243_10126547
1220 Ga0105243_10242820
1221 Ga0105242_10092778
1222 Ga0105242_10141215
1223 Ga0105248_10275454
1224 Ga0105237_10338970
1225 Ga0105237_10468619
1226 Ga0105238_10051230
1227 Ga0105238_10075013
1228 Ga0105238_10180422
1229 Ga0105249_10007496
1230 Ga0105249_10024741
1231 Ga0105249_10331718
1232 Ga0105239_10224996
1233 Ga0105239_10383876
1234 Ga0157313_1000544
1235 Ga0157342_1004730
1236 Ga0157373_10109159
1237 Ga0157373_10279865
1238 Ga0157369_10173293
1239 Ga0157369_10344393
1240 Ga0157374_10029783
1241 Ga0157374_10262275
1242 Ga0163162_10136391
1243 Ga0163162_10236582
1244 Ga0157372_10007232
1245 Ga0157372_10209682
1246 Ga0157372_10411381
1247 Ga0157375_10090320
1248 Ga0157375_10243495
1249 Ga0157375_10636741
1250 Ga0163163_10024088
1251 Ga0163163_10381327
1252 Ga0157380_10329998
1253 Ga0157377_10034424
1254 Ga0157377_10284900
1255 Ga0157379_10085306
1256 Ga0157376_10303683
1257 Ga0163161_10044759
1258 Ga0163161_10065162
1259 Ga0206353_10589720
1260 Ga0213873_10002755
1261 Ga0213874_10009744
1262 Ga0213876_10017042
1263 Ga0213876_10026893
1264 Ga0213876_10031475
1265 Ga0213876_10039018
1266 Ga0213876_10048819
1267 Ga0213876_10056108
1268 Ga0213876_10079983
1269 Ga0213876_10093359
1270 Ga0213876_10230540
1271 Ga0213875_10001813
1272 Ga0213875_10002888
1273 Ga0213875_10005972
1274 Ga0213875_10011152
1275 Ga0213875_10019205
1276 Ga0213875_10077572
1277 Ga0224572_1007312
1278 Ga0207656_10055985
1279 Ga0207653_10012856
1280 Ga0207692_10005054
1281 Ga0207692_10011928
1282 Ga0207692_10019007
1283 Ga0207692_10060827
1284 Ga0207692_10207004
1285 Ga0207642_10051213
1286 Ga0207642_10056524
1287 Ga0207688_10001125
1288 Ga0207688_10023495
1289 Ga0207688_10029205
1290 Ga0207688_10053343
1291 Ga0207647_10099580
1292 Ga0207685_10003459
1293 Ga0207699_10000659
1294 Ga0207699_10004980
1295 Ga0207699_10016450
1296 Ga0207699_10029097
1297 Ga0207699_10030870
1298 Ga0207699_10108636
1299 Ga0207645_10155238
1300 Ga0207645_10171599
1301 Ga0207643_10074076
1302 Ga0207705_10033687
1303 Ga0207684_10000482
1304 Ga0207684_10003822
1305 Ga0207684_10018630
1306 Ga0207684_10023353
1307 Ga0207684_10041000
1308 Ga0207684_10128889
1309 Ga0207684_10186950
1310 Ga0207684_10304173
1311 Ga0207707_10029210
1312 Ga0207707_10265224
1313 Ga0207693_10004052
1314 Ga0207693_10004896
1315 Ga0207693_10016006
1316 Ga0207693_10018247
1317 Ga0207693_10020319
1318 Ga0207693_10040245
1319 Ga0207693_10195522
1320 Ga0207663_10028778
1321 Ga0207663_10038675
1322 Ga0207660_10355689
1323 Ga0207662_10007952
1324 Ga0207662_10009716
1325 Ga0207657_10017985
1326 Ga0207657_10210454
1327 Ga0207652_10040804
1328 Ga0207652_10411823
1329 Ga0207646_10000065
1330 Ga0207646_10008867
1331 Ga0207646_10043136
1332 Ga0207646_10045029
1333 Ga0207646_10059077
1334 Ga0207646_10073536
1335 Ga0207646_10092570
1336 Ga0207646_10170988
1337 Ga0207646_10193149
1338 Ga0207681_10114236
1339 Ga0207694_10122831
1340 Ga0207659_10187210
1341 Ga0207687_10022594
1342 Ga0207687_10218564
1343 Ga0207687_10282905
1344 Ga0207687_10310540
1345 Ga0207700_10005110
1346 Ga0207700_10013335
1347 Ga0207700_10017692
1348 Ga0207700_10020878
1349 Ga0207700_10022201
1350 Ga0207700_10042573
1351 Ga0207700_10045239
1352 Ga0207700_10079389
1353 Ga0207700_10115337
1354 Ga0207700_10129655
1355 Ga0207700_10135497
1356 Ga0207700_10184256
1357 Ga0207700_10221151
1358 Ga0207700_10568489
1359 Ga0207664_10011686
1360 Ga0207664_10013891
1361 Ga0207664_10014275
1362 Ga0207664_10024582
1363 Ga0207664_10030076
1364 Ga0207664_10036147
1365 Ga0207664_10043788
1366 Ga0207664_10045244
1367 Ga0207664_10164854
1368 Ga0207664_10174931
1369 Ga0207664_10180511
1370 Ga0207664_10274528
1371 Ga0207706_10010261
1372 Ga0207706_10012626
1373 Ga0207706_10055577
1374 Ga0207706_10075832
1375 Ga0207706_10177864
1376 Ga0207670_10189902
1377 Ga0207670_10195683
1378 Ga0207704_10002466
1379 Ga0207704_10147218
1380 Ga0207665_10003760
1381 Ga0207665_10051133
1382 Ga0207665_10092192
1383 Ga0207691_10088069
1384 Ga0207689_10017942
1385 Ga0207689_10448283
1386 Ga0207661_10128283
1387 Ga0207661_10150040
1388 Ga0207661_10192348
1389 Ga0207661_10222498
1390 Ga0207679_10254791
1391 Ga0207679_10292254
1392 Ga0207667_10363815
1393 Ga0207651_10061888
1394 Ga0207712_10057584
1395 Ga0207712_10159974
1396 Ga0207668_10273036
1397 Ga0207640_10241589
1398 Ga0207658_10058070
1399 Ga0207677_10102627
1400 Ga0207703_10058815
1401 Ga0207678_10026853
1402 Ga0207678_10069036
1403 Ga0207678_10399367
1404 Ga0207708_10000313
1405 Ga0207708_10005382
1406 Ga0207708_10126990
1407 Ga0207708_10167222
1408 Ga0207702_10059165
1409 Ga0207702_10094052
1410 Ga0207702_10220015
1411 Ga0207648_10302955
1412 Ga0207676_10545399
1413 Ga0207674_10011077
1414 Ga0207674_10149194
1415 Ga0207674_10365020
1416 Ga0207675_100004300
1417 Ga0207675_100024503
1418 Ga0207675_100043134
1419 Ga0207675_100076652
1420 Ga0207683_10009073
1421 Ga0207683_10090481
1422 Ga0207683_10464958
1423 Ga0207698_10298981
1424 Ga0207698_10429260
1425 Ga0207428_10000786
1426 Ga0207428_10010177
1427 Ga0207428_10020818
1428 Ga0207428_10091719
1429 Ga0207428_10120580
1430 Ga0207428_10293637
1431 Ga0268266_10005801
1432 Ga0268266_10211503
1433 Ga0268265_10506299
1434 Ga0268264_10202744
1435 Ga0265337_1000319
1436 Ga0265326_10016822
1437 Ga0265319_1000691
1438 Ga0265334_10000319
1439 Ga0265318_10013900
1440 Ga0265336_10007712
1441 Ga0265338_10003620
1442 Ga0265324_10001646
1443 Ga0265332_10041382
1444 Ga0265320_10028404
1445 Ga0265325_10147622
1446 Ga0265340_10023361
1447 Ga0265339_10129029
1448 Ga0265316_10090231
1449 Ga0307408_100009358
1450 Ga0307408_100042968
1451 Ga0307408_100079791
1452 Ga0307408_100163592
1453 Ga0307408_100425782
1454 Ga0265313_10015288
1455 Ga0265314_10025109
1456 Ga0307405_10010826
1457 Ga0307405_10019735
1458 Ga0307413_10014988
1459 Ga0307413_10036238
1460 Ga0307413_10085742
1461 Ga0307413_10296948
1462 Ga0307413_10416972
1463 Ga0307410_10039483
1464 Ga0307410_10057755
1465 Ga0307410_10070140
1466 Ga0307410_10120840
1467 Ga0307406_10000092
1468 Ga0307406_10009606
1469 Ga0307406_10027282
1470 Ga0307406_10137275
1471 Ga0307406_10152834
1472 Ga0307406_10274405
1473 Ga0307407_10031208
1474 Ga0307407_10051904
1475 Ga0307407_10193705
1476 Ga0307407_10280511
1477 Ga0307412_10280855
1478 Ga0307409_100000271
1479 Ga0307409_100013409
1480 Ga0307409_100094877
1481 Ga0307409_100165593
1482 Ga0307409_100235602
1483 Ga0307409_100287648
1484 Ga0307409_100517786
1485 Ga0307416_100000069
1486 Ga0307416_100023223
1487 Ga0307416_100024727
1488 Ga0307416_100083569
1489 Ga0307416_100110591
1490 Ga0307416_100114226
1491 Ga0307416_100475139
1492 Ga0307416_100689336
1493 Ga0307416_100690012
1494 Ga0307414_10018263
1495 Ga0307414_10047459
1496 Ga0307414_10113199
1497 Ga0307414_10163212
1498 Ga0307411_10032643
1499 Ga0307411_10044690
1500 Ga0307415_100026321
1501 Ga0307415_100040837
1502 Ga0307415_100093916
1503 Ga0307415_100169836
1504 Ga0307415_100239591
1505 Ga0307415_100364523
1506 Ga0307415_100366697
1507 Ga0307415_100385503
1508 Ga0307415_100522842
1509 Ga0373948_0009622
1510 Ga0373950_0032982
1511 Ga0373959_0005244
1512 Ga0373926_0021790
1513 Ga0373929_0006252
1514 Ga0373934_0033901
1515 Ga0373944_0035599
1516 Ga0373951_0021181
1517 Ga0373923_0009008
1518 Ga0373939_0005122
1519 Ga0373953_0001251
1520 Ga0373953_0049077
1521 Ga0373956_0086396
1522 Ga0373943_0052571
1523 Ga0373943_0251507
1524 Ga0373946_0061753
1525 Ga0373955_0012095
1526 Ga0373955_0013035
1527 Ga0373961_0010613
1528 Ga0373931_0005214
1529 Ga0373931_0036552
1530 Ga0373931_0381435
1531 Ga0373935_0102302
1532 Ga0373935_0202401
1533 Ga0373927_0137006
1534 Ga0373933_0001453
1535 Ga0373933_0043094
1536 Ga0373933_0050916
1537 Ga0373947_0074053
1538 Ga0373947_0077724
1539 Ga0373947_0097396
1540 Ga0373937_0010406
1541 Ga0373937_0242338
1542 Ga0373937_0274505
1543 Ga0373937_0297133
1544 Ga0373937_0316032
1545 Ga0373937_0498154
1546 Ga0373925_0000439
1547 Ga0373925_0098791
1548 Ga0373925_0115028
1549 Ga0373925_0168033
1550 Ga0395899_0009710
1551 Ga0395899_0149513
1552 Ga0395900_0005816
1553 Ga0395900_0006317
1554 Ga0395898_0008896
1555 Ga0395905_0004992
1556 Ga0395905_0009808
1557 Ga0436364_0081382
1558 Ga0436364_0150699
1559 Ga0436364_0285692
1560 Ga0436364_0373092
1561 Ga0436364_0488398
1562 Ga0436364_0537044
1563 Ga0436364_0576770
1564 Ga0436364_0645587
1565 Ga0436364_0754041
1566 Ga0436364_1135053
1567 Ga0436364_1142348
1568 Ga0436364_1426668
1569 Ga0395901_0004700
1570 Ga0395901_0008877
1571 Ga0395901_0045891
1572 Ga0395901_0202433
1573 Ga0395901_0447877
1574 Ga0436365_0025044
1575 Ga0436365_0056917
1576 Ga0436365_0350884
1577 Ga0436365_0426170
1578 Ga0436365_0504462
1579 Ga0436365_0602287
1580 Ga0436365_0734234
1581 Ga0436365_0966623
1582 Ga0436365_0969664
1583 Ga0436365_1024425
1584 Ga0436365_1112899
1585 Ga0436365_1845008
1586 Ga0436361_0466244
1587 Ga0436363_0284115
1588 Ga0436363_0627696
1589 Ga0436363_1058512
1590 Ga0436363_1283675
1591 Ga0436363_1354190
1592 Ga0436363_1435316
1593 Ga0436362_0525430
1594 Ga0436362_1024318
1595 Ga0436362_1061294
1596 Ga0436362_1135735
1597 Ga0439463_005424
1598 Ga0439435_0010732
1599 Ga0439464_0028229
1600 Ga0439440_0003192
1601 Ga0439440_0005352
1602 Ga0439440_0007076
1603 Ga0466969_0120296
1604 Ga0466965_0018058
1605 Ga0466966_0020434
1606 Ga0466961_0003639
1607 Ga0466961_0139843
1608 Ga0466963_0205449
1609 Ga0466963_0305179
1610 Ga0466971_0010628
1611 Ga0466971_0023902
1612 Ga0466968_0013898
1613 Ga0466968_0030277
1614 Ga0466968_0034519
1615 Ga0466970_0005271
1616 Ga0466957_0005944
1617 Ga0466957_0080075
1618 Ga0466959_0001493
1619 Ga0466959_0131659
1620 Ga0466959_0179949
1621 Ga0466958_0000080
1622 Ga0466958_0003438
1623 Ga0466958_0085335
1624 Ga0466958_0100681
1625 Ga0466958_0175484
1626 Ga0466967_0005794
1627 Ga0466967_0006775
1628 Ga0466967_0009928
1629 Ga0466967_0122895
1630 Ga0466967_0343534
1631 Ga0466967_0402025
1632 Ga0466967_0548475
1633 Ga0495592_0000540
1634 Ga0495592_0004832
1635 Ga0495592_0012128
1636 Ga0495592_0166720
1637 Ga0495603_0040545
1638 Ga0495603_0203493
1639 Ga0495629_0008809
1640 Ga0495629_0061355
1641 Ga0495641_0011176
1642 Ga0495651_0000497
1643 Ga0495651_0000634
1644 Ga0495651_0014903
1645 Ga0495653_0017000
1646 Ga0495653_0036045
1647 Ga0495653_0056094
1648 Ga0495653_0071233
1649 Ga0495580_0052129
1650 Ga0495582_0003013
1651 Ga0495582_0056537
1652 Ga0495662_0096957
1653 Ga0495664_0007877
1654 Ga0495664_0164849
1655 Ga0495608_0000564
1656 Ga0495608_0002267
1657 Ga0495618_0005317
1658 Ga0495618_0042335
1659 Ga0495618_0103078
1660 Ga0495618_0187569
1661 Ga0495628_0010021
1662 Ga0495628_0019819
1663 Ga0495630_0066974
1664 Ga0495642_0060660
1665 Ga0495652_0002504
1666 Ga0495652_0013239
1667 Ga0495652_0038734
1668 Ga0495652_0084519
1669 Ga0495652_0246416
1670 Ga0495665_0014557
1671 Ga0495640_0006890
1672 Ga0495640_0014211
1673 Ga0495640_0016273
1674 Ga0495640_0082756
1675 Ga0495640_0103477
1676 Ga0495640_0167074
1677 Ga0495587_0001383
1678 Ga0495587_0031468
1679 Ga0495645_0002683
1680 Ga0495645_0009895
1681 Ga0495645_0013134
1682 Ga0495645_0037406
1683 Ga0495645_0052027
1684 Ga0495645_0286014
1685 Ga0495667_0000478
1686 Ga0495667_0006223
1687 Ga0495667_0008109
1688 Ga0495667_0016115
1689 Ga0495634_0036422
1690 Ga0495634_0057503
1691 Ga0495635_0005076
1692 Ga0495635_0052973
1693 Ga0495635_0054614
1694 Ga0495635_0146470
1695 Ga0495659_0090378
1696 Ga0495657_0003398
1697 Ga0495657_0107388
1698 Ga0495599_0000393
1699 Ga0495599_0065855
1700 Ga0495599_0098271
1701 Ga0495623_0071466
1702 Ga0495646_0023042
1703 Ga0495646_0040621
1704 Ga0495646_0050830
1705 Ga0495646_0058662
1706 Ga0495646_0134102
1707 Ga0495646_0155431
1708 Ga0495613_0009433
1709 Ga0495613_0075537
1710 Ga0495624_0081901
1711 Ga0495589_0081799
1712 Ga0495600_0010295
1713 Ga0495600_0017616
1714 Ga0495600_0026737
1715 Ga0495600_0026763
1716 Ga0495581_0007704
1717 Ga0495604_0003667
1718 Ga0495604_0041136
1719 Ga0495604_0055930
1720 Ga0495674_0009633
1721 Ga0495674_0013966
1722 Ga0495674_0046815
1723 Ga0495674_0060046
1724 Ga0495680_0000911
1725 Ga0495680_0005033
1726 Ga0495680_0048497
1727 Ga0495675_0081580
1728 Ga0495675_0214373
1729 Ga0495684_0000969
1730 Ga0495684_0076544
1731 Ga0495684_0079003
1732 Ga0495684_0174993
1733 Ga0495593_0018085
1734 Ga0495593_0052667
1735 Ga0495593_0176972
1736 Ga0495602_0005533
1737 Ga0495602_0033929
1738 Ga0495602_0035853
1739 Ga0496100_0137400
1740 Ga0496100_0240688
1741 Ga0496100_0299946
1742 Ga0496101_0013801
1743 Ga0496102_0086879
1744 Ga0496102_0124542
1745 Ga0496102_0492176
1746 Ga0496104_0009034
1747 Ga0496104_0032953
1748 Ga0496104_0036030
1749 Ga0496104_0358286
1750 Ga0496105_0017962
1751 Ga0496105_0046881
1752 Ga0496105_0165333
1753 Ga0496106_0136005
1754 Ga0496106_0155448
1755 Ga0496106_0320345
1756 Ga0496106_0364632
1757 Ga0496107_0080235
1758 Ga0496108_0015207
1759 Ga0496108_0017845
1760 Ga0496108_0109176
1761 Ga0496108_0120733
1762 Ga0496108_0159694
1763 Ga0496108_0216457
1764 Ga0496108_0583180
1765 Ga0496109_0029572
1766 Ga0496109_0048970
1767 Ga0496109_0081925
1768 Ga0496110_0006309
1769 Ga0496110_0006957
1770 Ga0496110_0080508
1771 Ga0496110_0122603
1772 Ga0496111_0004357
1773 Ga0496111_0064541
1774 Ga0496111_0418739
1775 Ga0496112_0010532
1776 Ga0496112_0022659
1777 Ga0496112_0144603
1778 Ga0496112_0212445
1779 Ga0496113_0022110
1780 Ga0496113_0115760
1781 Ga0496114_0015254
1782 Ga0496114_0032089
1783 Ga0496114_0075880
1784 Ga0496114_0303994
1785 Ga0496115_0072009
1786 Ga0496115_0096835
1787 Ga0496115_0130817
1788 Ga0501031_0040637
1789 Ga0501031_0137077
1790 Ga0501031_0225647
1791 Ga0501033_0160209
1792 Ga0501036_0077529
1793 Ga0501038_0283002
1794 Ga0501039_0094998
1795 Ga0501039_0181095
1796 Ga0501040_0033965
1797 Ga0501040_0499344
1798 Ga0501041_0052381
1799 Ga0501042_0167051
1800 Ga0501048_0096507
1801 Ga0501048_0162196
1802 Ga0501048_0187983
1803 Ga0501048_0237962
1804 Ga0501071_0033407
1805 Ga0501072_0030051
1806 Ga0501072_0041819
1807 Ga0501072_0267739
1808 Ga0501072_0499328
1809 Ga0501076_0101762
1810 Ga0501077_0042461
1811 Ga0501079_0018897
1812 Ga0501079_0029391
1813 Ga0501079_0122207
1814 Ga0501079_0404730
1815 Ga0501079_0463409
1816 Ga0501081_0064935
1817 Ga0501081_0087553
1818 Ga0501081_0172513
1819 Ga0501035_0258034
1820 Ga0501045_0022820
1821 Ga0501045_0065090
1822 Ga0501045_0131290
1823 nmdc:mga05p37_1171603_c1
1824 nmdc:mga05p37_12310_c1
1825 nmdc:mga05p37_14942_c1
1826 nmdc:mga05p37_27246_c1
1827 nmdc:mga05p37_41256_c1
1828 nmdc:mga05p37_4477_c1
1829 nmdc:mga05p37_59267_c1
1830 nmdc:mga05p37_70682_c1
1831 nmdc:mga05p37_966245_c1
1832 nmdc:mga09592_30352_c1
1833 nmdc:mga09592_498878_c1
1834 nmdc:mga09592_5100_c1
1835 nmdc:mga0qj67_117712_c1
1836 nmdc:mga0qj67_123833_c1
1837 nmdc:mga0qj67_148383_c1
1838 nmdc:mga0qj67_230062_c1
1839 nmdc:mga0qj67_335_c1
1840 nmdc:mga0qj67_451432_c1
1841 nmdc:mga06r32_12707_c1
1842 nmdc:mga06r32_161132_c1
1843 nmdc:mga06r32_260532_c1
1844 nmdc:mga06r32_4890_c1
1845 nmdc:mga08y16_125397_c1
1846 nmdc:mga08y16_139099_c1
1847 nmdc:mga08y16_191228_c1
1848 nmdc:mga08y16_251352_c1
1849 nmdc:mga08y16_370773_c1
1850 nmdc:mga08y16_520264_c1
1851 nmdc:mga08y16_527896_c1
1852 nmdc:mga08y16_545309_c1
1853 nmdc:mga0n895_102984_c1
1854 nmdc:mga0n895_110843_c1
1855 nmdc:mga0n895_11341_c1
1856 nmdc:mga0n895_146893_c1
1857 nmdc:mga0n895_163181_c1
1858 nmdc:mga0n895_20265_c1
1859 nmdc:mga0n895_20304_c1
1860 nmdc:mga0n895_315724_c1
1861 nmdc:mga0n895_35044_c1
1862 nmdc:mga0n895_35475_c1
1863 nmdc:mga0n895_46801_c1
1864 nmdc:mga0n895_672673_c1
1865 nmdc:mga0rr50_11505_c1
1866 nmdc:mga0rr50_117912_c1
1867 nmdc:mga0rr50_424811_c1
1868 nmdc:mga0rr50_596518_c1
1869 nmdc:mga08x19_197392_c1
1870 nmdc:mga08x19_22071_c1
1871 nmdc:mga0a205_14017_c1
1872 nmdc:mga0a205_145188_c1
1873 nmdc:mga0a205_186420_c1
1874 nmdc:mga0a205_2017_c1
1875 nmdc:mga0a205_250912_c1
1876 nmdc:mga0a205_3174_c1
1877 nmdc:mga0a205_59016_c1
1878 nmdc:mga0a205_7749_c1
1879 Ga0495601_0015088
1880 Ga0495601_0100127
1881 Ga0495612_0071735
1882 Ga0495612_0112676
1883 Ga0495595_0001765
1884 Ga0495619_0007685
1885 Ga0495619_0211710
1886 Ga0501084_0014979
1887 Ga0501084_0026705
1888 Ga0501084_0063546
1889 Ga0501084_0173668
1890 Ga0501082_0025570
1891 Ga0501082_0307691
1892 Ga0501082_0522079
1893 Ga0466962_0123761
1894 Ga0530510_0004432
1895 Ga0530510_0084838
1896 Ga0530510_0096860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17820

PDZ_6

PDZ domain

249

303

0.97

PF13180

PDZ_2

PDZ domain

228

314

0.96

PF13365

Trypsin_2

Trypsin-like peptidase domain

32

186

0.85

PF00595

PDZ

PDZ domain

216

302

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w70-assembly1.cif.gz_B crystal structure of the pdz-c domain fragment of kangiella koreensis rsep orthologue 0.8933 215 277
8f0a-assembly1.cif.gz_D client-bound structure of a degp trimer within a 12mer cage 0.8847 209 275
2p3w-assembly2.cif.gz_B-3 crystal structure of the htra3 pdz domain bound to a phage-derived ligand (fgrwv) 0.876 187 279
2p3w-assembly1.cif.gz_A-2 crystal structure of the htra3 pdz domain bound to a phage-derived ligand (fgrwv) 0.8755 187 279
7xfs-assembly1.cif.gz_B mucp pdz1 domain 0.8723 215 281
ID Description Score Start End Superfamily
af_Q2G1Z5_167_256_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9267 215 277 2.30.42.10
af_A0A143ZXD4_85_198_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9108 33 84 2.40.10.10
3stiA01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8928 12 90 2.40.10.10
af_Q9VFJ3_320_421_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8915 186 278 2.30.42.10
3mh4B01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.886 21 93 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A7C8APE7-F1-model_v4 PDZ domain-containing protein 0.9362 186 279 GO:0004252
GO:0006508
AF-A0A7V9RAM8-F1-model_v4 Trypsin-like peptidase domain-containing protein 0.9321 4 179 GO:0004252
GO:0006508
GO:0016020
AF-A0A832A266-F1-model_v4 PDZ domain-containing protein 0.9269 188 277
AF-A0A7X8CCV0-F1-model_v4 deleted 0.9252 186 279
AF-A0A7X7Y9T0-F1-model_v4 PDZ domain-containing protein 0.9224 189 277

Map