F486500

General Info

Members Datasets Scaffolds Average Seq Length
948 592 1896 146

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10035196|JGI25153J46596_100351962
Length 172
Sequence MGAKLGARMGSPLKRGDPGDLDVTHEINVTPFIDVMLVLLIIFMVAAPLATVDIGVELPATAAEPAPRPDKPVFVTVKPDLTIAVGEDTMARDGLAAALAAATRGRKDERIYLRADKAVSYGDLMEVMNTLRNAGYLRSRSDRALGRVCGGDRGAASVCRGAGDELDQVAAG

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
102 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
103 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
104 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
186 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
197 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
274 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
322 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
323 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
324 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
325 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
326 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
331 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
332 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
333 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
334 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
335 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
336 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
337 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
338 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
339 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
340 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
341 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
342 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
343 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
344 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
347 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
348 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
349 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
350 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
353 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
354 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
355 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
356 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
357 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
358 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
359 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
360 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
361 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
362 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
363 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
364 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
369 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
370 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
371 2512875024
372 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
373 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
374 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
375 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
376 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
377 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
378 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
379 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
380 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
381 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
382 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
383 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
384 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
385 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
386 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
387 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
388 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
389 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
390 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
391 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
392 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
393 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
394 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
395 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
396 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
397 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
398 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
399 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
400 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
401 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
402 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
403 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
404 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
405 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
406 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
407 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
408 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
409 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
410 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
411 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
412 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
413 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
414 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
415 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
416 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
417 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
418 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
419 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
420 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
421 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
422 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
423 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
424 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
425 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
426 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
427 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
428 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
429 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
430 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
431 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
432 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
433 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
434 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
435 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
436 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
437 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
438 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
439 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
440 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
441 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
442 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
443 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
444 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
445 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
446 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
447 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
448 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
449 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
450 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
451 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
452 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
453 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
454 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
455 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
456 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
457 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
458 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
459 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
460 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
461 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
462 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
463 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
464 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
465 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
466 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
467 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
468 2906610324
469 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
470 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
471 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
472 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
473 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
474 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
475 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
476 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
477 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
478 2922368715
479 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
480 2922425934
481 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
482 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
483 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
484 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
485 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
486 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
487 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
488 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
489 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
490 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
491 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
492 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
493 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
494 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
495 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
496 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
497 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
498 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
499 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
500 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
501 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
502 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
503 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
504 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
505 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
506 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
507 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
508 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
509 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
510 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
511 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
512 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
513 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
514 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
515 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
516 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
517 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
518 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
519 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
520 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
521 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
522 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
523 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
524 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
525 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
526 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
527 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
528 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
529 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
530 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
531 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
532 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
533 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
534 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
535 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
536 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
537 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
538 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
539 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
540 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
541 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
542 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
543 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
544 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
545 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
546 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
547 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
548 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
549 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
550 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
551 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
552 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
553 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
554 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
555 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
556 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
557 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
558 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
559 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
560 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
561 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
562 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
563 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
564 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
565 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
566 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
567 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
568 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
569 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
570 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
571 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
572 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
573 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
574 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
575 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
576 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
577 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
578 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
579 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
580 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
581 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
582 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
583 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
584 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
585 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
586 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
587 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
588 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
589 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
590 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
591 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
592 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.4
Metatranscriptomes 0.11
Isolates 23.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.56
Nodule 20.25
Rhizoplane 4.54
Rhizosphere 46.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10035196 3300003215 Bacteria 1626
2 JGI25165J46597_1013007 3300003214 Bacteria 1153
3 JGI25153J46596_10000556 3300003215 Bacteria 23263
4 JGI25153J46596_10001313 3300003215 Bacteria 14885
5 JGI25153J46596_10003755 3300003215 Bacteria 8380
6 JGI25160J50197_1001571 3300003354 Bacteria 11274
7 JGI25160J50197_1005015 3300003354 Bacteria 5601
8 JGI25160J50197_1006864 3300003354 Bacteria 4547
9 JGI25161J50226_1025510 3300003374 Bacteria 577
10 JGI25404J52841_10043089 3300003659 Bacteria 954
11 Ga0055526_1045891 3300003771 Bacteria 1041
12 Ga0055531_10019226 3300003794 Bacteria 2777
13 Ga0055543_1002055 3300004625 Bacteria 7049
14 Ga0055543_1032588 3300004625 Bacteria 905
15 Ga0065165_1001533 3300005262 Bacteria 24165
16 Ga0065165_1002335 3300005262 Bacteria 16541
17 Ga0065165_1014380 3300005262 Bacteria 3076
18 Ga0065165_1044956 3300005262 Bacteria 1288
19 Ga0070690_100037594 3300005330 Bacteria 3052
20 Ga0068869_100705801 3300005334 Bacteria 860
21 Ga0070666_10273750 3300005335 Bacteria 1199
22 Ga0070682_100133727 3300005337 Bacteria 1682
23 Ga0070682_100755145 3300005337 Bacteria 786
24 Ga0068868_100038833 3300005338 Bacteria 3695
25 Ga0068868_100955732 3300005338 Bacteria 782
26 Ga0070660_100106810 3300005339 Bacteria 2224
27 Ga0070660_100868837 3300005339 Bacteria 760
28 Ga0070660_100907866 3300005339 Bacteria 743
29 Ga0070689_100746122 3300005340 Bacteria 858
30 Ga0070668_100064708 3300005347 Bacteria 2835
31 Ga0070668_100106524 3300005347 Bacteria 2227
32 Ga0070668_100125027 3300005347 Bacteria 2059
33 Ga0070669_100133688 3300005353 Bacteria 1906
34 Ga0070669_100167166 3300005353 Bacteria 1713
35 Ga0070669_100440189 3300005353 Bacteria 1073
36 Ga0070675_100239602 3300005354 Bacteria 1585
37 Ga0070675_100706061 3300005354 Bacteria 919
38 Ga0070671_100076243 3300005355 Bacteria 2801
39 Ga0070671_100191193 3300005355 Bacteria 1735
40 Ga0070671_100528029 3300005355 Bacteria 1017
41 Ga0070674_100032867 3300005356 Bacteria 3448
42 Ga0070674_100378841 3300005356 Bacteria 1150
43 Ga0070673_100485629 3300005364 Bacteria 1116
44 Ga0070659_100134945 3300005366 Bacteria 2007
45 Ga0070667_100958189 3300005367 Bacteria 797
46 Ga0070708_100309981 3300005445 Bacteria 1487
47 Ga0070663_100096170 3300005455 Bacteria 2202
48 Ga0070663_100217855 3300005455 Bacteria 1497
49 Ga0070663_100919684 3300005455 Bacteria 757
50 Ga0070663_101071471 3300005455 Bacteria 704
51 Ga0070678_100014756 3300005456 Bacteria 4941
52 Ga0070678_100085446 3300005456 Bacteria 2404
53 Ga0070678_100095811 3300005456 Bacteria 2288
54 Ga0070685_10447999 3300005466 Bacteria 904
55 Ga0070679_100677925 3300005530 Bacteria 973
56 Ga0068853_100444434 3300005539 Bacteria 1219
57 Ga0068853_100988737 3300005539 Bacteria 810
58 Ga0068853_101037994 3300005539 Bacteria 790
59 Ga0070696_100256386 3300005546 Bacteria 1325
60 Ga0070665_100100447 3300005548 Bacteria 2897
61 Ga0070665_100395621 3300005548 Bacteria 1389
62 Ga0070665_100576656 3300005548 Bacteria 1138
63 Ga0070665_100805099 3300005548 Bacteria 953
64 Ga0070665_100810167 3300005548 Bacteria 949
65 Ga0070665_101315359 3300005548 Bacteria 732
66 Ga0068855_100130261 3300005563 Bacteria 2873
67 Ga0068855_100561664 3300005563 Bacteria 1234
68 Ga0068855_100581467 3300005563 Bacteria 1210
69 Ga0068857_100688599 3300005577 Bacteria 971
70 Ga0068857_101533826 3300005577 Bacteria 650
71 Ga0068854_100114530 3300005578 Bacteria 2038
72 Ga0068854_101178590 3300005578 Bacteria 685
73 Ga0068854_101207072 3300005578 Bacteria 678
74 Ga0068856_101389606 3300005614 Bacteria 717
75 Ga0068852_100929038 3300005616 Bacteria 888
76 Ga0068859_100274360 3300005617 Bacteria 1779
77 Ga0068864_100522190 3300005618 Bacteria 1145
78 Ga0068861_100446862 3300005719 Bacteria 1157
79 Ga0068861_100677409 3300005719 Bacteria 956
80 Ga0068851_10490113 3300005834 Bacteria 736
81 Ga0068870_10696113 3300005840 Bacteria 701
82 Ga0068858_100019766 3300005842 Bacteria 6296
83 Ga0068858_100651234 3300005842 Bacteria 1023
84 Ga0068860_100117529 3300005843 Bacteria 2544
85 Ga0068860_100833429 3300005843 Bacteria 936
86 Ga0068862_100082320 3300005844 Bacteria 2793
87 Ga0068862_100466003 3300005844 Bacteria 1193
88 Ga0081455_10111394 3300005937 Bacteria 2174
89 Ga0081540_1009414 3300005983 Bacteria 6731
90 Ga0081540_1122153 3300005983 Bacteria 1079
91 Ga0081539_10116863 3300005985 Bacteria 1331
92 Ga0075365_10004909 3300006038 Bacteria 7151
93 Ga0075365_10212124 3300006038 Bacteria 1357
94 Ga0075365_10312281 3300006038 Bacteria 1107
95 Ga0075365_10376327 3300006038 Bacteria 1002
96 Ga0075365_10475705 3300006038 Bacteria 883
97 Ga0075365_10490596 3300006038 Bacteria 868
98 Ga0075368_10009852 3300006042 Bacteria 3445
99 Ga0075363_100066012 3300006048 Bacteria 1957
100 Ga0075363_100391799 3300006048 Bacteria 815
101 Ga0070716_100498477 3300006173 Bacteria 898
102 Ga0070716_101072700 3300006173 Bacteria 641
103 Ga0075362_10174607 3300006177 Bacteria 1039
104 Ga0075367_10200715 3300006178 Bacteria 1246
105 Ga0075367_10285157 3300006178 Bacteria 1038
106 Ga0075367_10431730 3300006178 Bacteria 834
107 Ga0075367_10800150 3300006178 Bacteria 600
108 Ga0075369_10046818 3300006186 Bacteria 1863
109 Ga0075369_10089667 3300006186 Bacteria 1371
110 Ga0075369_10234572 3300006186 Bacteria 850
111 Ga0075369_10248506 3300006186 Bacteria 826
112 Ga0075366_10054483 3300006195 Bacteria 2375
113 Ga0075366_10129226 3300006195 Bacteria 1524
114 Ga0097621_100185234 3300006237 Bacteria 1800
115 Ga0075370_10025245 3300006353 Bacteria 3285
116 Ga0075370_10087775 3300006353 Bacteria 1792
117 Ga0075370_10293177 3300006353 Bacteria 967
118 Ga0068871_100484538 3300006358 Bacteria 1113
119 Ga0075428_100726104 3300006844 Bacteria 1058
120 Ga0075433_10558643 3300006852 Bacteria 1006
121 Ga0068865_100129069 3300006881 Bacteria 1891
122 Ga0068865_100244991 3300006881 Bacteria 1412
123 Ga0097620_100274385 3300006931 Bacteria 1779
124 Ga0099825_1031176 3300006941 Bacteria 2289
125 Ga0099824_1008180 3300006942 Bacteria 13469
126 Ga0099822_1007748 3300006943 Bacteria 13828
127 Ga0099794_10140562 3300007265 Bacteria 1223
128 Ga0099794_10143834 3300007265 Bacteria 1209
129 Ga0099795_10002081 3300007788 Bacteria 4597
130 Ga0105251_10167637 3300009011 Bacteria 990
131 Ga0105250_10249197 3300009092 Bacteria 759
132 Ga0105240_10253199 3300009093 Bacteria 2035
133 Ga0105240_10417495 3300009093 Bacteria 1508
134 Ga0111539_10540028 3300009094 Bacteria 1358
135 Ga0105245_10334722 3300009098 Bacteria 1495
136 Ga0105245_12066973 3300009098 Bacteria 623
137 Ga0105247_10103210 3300009101 Bacteria 1826
138 Ga0105247_11005351 3300009101 Bacteria 651
139 Ga0114129_10280582 3300009147 Bacteria 2226
140 Ga0105243_10194627 3300009148 Bacteria 1774
141 Ga0105243_10519182 3300009148 Bacteria 1132
142 Ga0105241_10764808 3300009174 Bacteria 887
143 Ga0105242_10790070 3300009176 Bacteria 938
144 Ga0105242_12680119 3300009176 Bacteria 548
145 Ga0105248_10338625 3300009177 Bacteria 1694
146 Ga0105237_10111695 3300009545 Bacteria 2725
147 Ga0105237_10202856 3300009545 Bacteria 1983
148 Ga0105237_10797436 3300009545 Bacteria 951
149 Ga0105237_11222084 3300009545 Bacteria 758
150 Ga0105238_10284054 3300009551 Bacteria 1636
151 Ga0105238_11692295 3300009551 Bacteria 664
152 Ga0105249_10078552 3300009553 Bacteria 3062
153 Ga0105249_10106029 3300009553 Bacteria 2650
154 Ga0105239_10090333 3300010375 Bacteria 3379
155 Ga0105239_10147459 3300010375 Bacteria 2625
156 Ga0105239_10160940 3300010375 Bacteria 2508
157 Ga0105239_10410092 3300010375 Bacteria 1534
158 Ga0105239_11298057 3300010375 Bacteria 840
159 Ga0105246_10158158 3300011119 Bacteria 1723
160 Ga0105246_10759406 3300011119 Bacteria 856
161 Ga0157371_10000184 3300013102 Bacteria 92100
162 Ga0157369_10351591 3300013105 Bacteria 1530
163 Ga0157369_11898523 3300013105 Bacteria 605
164 Ga0157369_12463211 3300013105 Bacteria 527
165 Ga0157374_10128814 3300013296 Bacteria 2448
166 Ga0157374_11270585 3300013296 Bacteria 758
167 Ga0157374_12941354 3300013296 Bacteria 503
168 Ga0157378_10724241 3300013297 Bacteria 1016
169 Ga0163162_10320864 3300013306 Bacteria 1681
170 Ga0163162_11370149 3300013306 Bacteria 804
171 Ga0157372_10050925 3300013307 Bacteria 4607
172 Ga0157375_10097308 3300013308 Bacteria 3017
173 Ga0157375_10218635 3300013308 Bacteria 2063
174 Ga0163163_10035663 3300014325 Bacteria 4826
175 Ga0163163_10152711 3300014325 Bacteria 2352
176 Ga0163163_10526608 3300014325 Bacteria 1244
177 Ga0163163_10934995 3300014325 Bacteria 930
178 Ga0157380_10070658 3300014326 Bacteria 2821
179 Ga0157380_10880409 3300014326 Bacteria 920
180 Ga0157377_10040864 3300014745 Bacteria 2570
181 Ga0157379_10118097 3300014968 Bacteria 2385
182 Ga0157379_10149332 3300014968 Bacteria 2108
183 Ga0157379_10599791 3300014968 Bacteria 1028
184 Ga0157376_10232216 3300014969 Bacteria 1714
185 Ga0157376_11075119 3300014969 Bacteria 829
186 Ga0157376_12065200 3300014969 Bacteria 608
187 Ga0157376_12563918 3300014969 Bacteria 550
188 Ga0182007_10000118 3300015262 Bacteria 54536
189 Ga0182007_10062383 3300015262 Bacteria 1222
190 Ga0182005_1001582 3300015265 Bacteria 8964
191 Ga0163161_10246983 3300017792 Bacteria 1390
192 Ga0206354_11366296 3300020081 Bacteria 932
193 Ga0214544_1000005 3300021320 Bacteria 387675
194 Ga0214544_1022677 3300021320 Bacteria 3716
195 Ga0214542_1000004 3300021321 Bacteria 415597
196 Ga0214542_1023102 3300021321 Bacteria 3813
197 Ga0214545_1000005 3300021324 Bacteria 415590
198 Ga0214545_1009267 3300021324 Bacteria 15098
199 Ga0214543_1000564 3300021327 Bacteria 63531
200 Ga0213876_10114300 3300021384 Bacteria 1433
201 Ga0209563_102533 3300025230 Bacteria 4103
202 Ga0207425_1042389 3300025245 Bacteria 861
203 Ga0209677_102004 3300025253 Bacteria 8098
204 Ga0209233_1003650 3300025261 Bacteria 5388
205 Ga0209233_1007099 3300025261 Bacteria 3572
206 Ga0209564_1002546 3300025295 Bacteria 14040
207 Ga0209564_1075637 3300025295 Bacteria 679
208 Ga0209758_1000102 3300025297 Bacteria 224851
209 Ga0209758_1000732 3300025297 Bacteria 48005
210 Ga0209758_1007121 3300025297 Bacteria 7735
211 Ga0209758_1032231 3300025297 Bacteria 2131
212 Ga0209758_1035036 3300025297 Bacteria 1984
213 Ga0209256_1002569 3300025299 Bacteria 14499
214 Ga0207426_1000354 3300025302 Bacteria 83734
215 Ga0207426_1000521 3300025302 Bacteria 55976
216 Ga0207426_1006804 3300025302 Bacteria 4891
217 Ga0207426_1052495 3300025302 Bacteria 1206
218 Ga0207426_1064696 3300025302 Bacteria 1039
219 Ga0207426_1124615 3300025302 Bacteria 632
220 Ga0209257_1001340 3300025304 Bacteria 29845
221 Ga0209257_1061183 3300025304 Bacteria 1022
222 Ga0209257_1071267 3300025304 Bacteria 915
223 Ga0207642_10008965 3300025899 Bacteria 3459
224 Ga0207710_10568499 3300025900 Bacteria 591
225 Ga0207680_10192318 3300025903 Bacteria 1386
226 Ga0207647_10042612 3300025904 Bacteria 2847
227 Ga0207647_10134448 3300025904 Bacteria 1452
228 Ga0207647_10236192 3300025904 Bacteria 1051
229 Ga0207643_10230041 3300025908 Bacteria 1137
230 Ga0207705_11036669 3300025909 Bacteria 633
231 Ga0207695_10146979 3300025913 Bacteria 2300
232 Ga0207671_10188419 3300025914 Bacteria 1608
233 Ga0207671_10641437 3300025914 Bacteria 846
234 Ga0207693_10408774 3300025915 Bacteria 1061
235 Ga0207660_11361187 3300025917 Bacteria 576
236 Ga0207662_10134953 3300025918 Bacteria 1559
237 Ga0207657_10026225 3300025919 Bacteria 5359
238 Ga0207649_10265643 3300025920 Bacteria 1242
239 Ga0207652_10296076 3300025921 Bacteria 1460
240 Ga0207681_10056779 3300025923 Bacteria 2672
241 Ga0207659_11008901 3300025926 Bacteria 716
242 Ga0207687_10071553 3300025927 Bacteria 2478
243 Ga0207687_10246205 3300025927 Bacteria 1419
244 Ga0207644_10695889 3300025931 Bacteria 847
245 Ga0207690_10139348 3300025932 Bacteria 1785
246 Ga0207690_10623790 3300025932 Bacteria 882
247 Ga0207690_11305297 3300025932 Bacteria 606
248 Ga0207686_10251020 3300025934 Bacteria 1292
249 Ga0207709_11015803 3300025935 Bacteria 678
250 Ga0207670_10220850 3300025936 Bacteria 1450
251 Ga0207670_10825705 3300025936 Bacteria 773
252 Ga0207669_10021601 3300025937 Bacteria 3401
253 Ga0207669_10577113 3300025937 Bacteria 911
254 Ga0207704_10043474 3300025938 Bacteria 2654
255 Ga0207691_10010566 3300025940 Bacteria 8854
256 Ga0207691_10255192 3300025940 Bacteria 1512
257 Ga0207711_10165318 3300025941 Bacteria 2005
258 Ga0207711_10308320 3300025941 Bacteria 1461
259 Ga0207689_10039867 3300025942 Bacteria 3888
260 Ga0207689_10040824 3300025942 Bacteria 3839
261 Ga0207679_10105836 3300025945 Bacteria 2210
262 Ga0207667_10618348 3300025949 Bacteria 1091
263 Ga0207667_10734922 3300025949 Bacteria 987
264 Ga0207667_11201237 3300025949 Bacteria 738
265 Ga0207712_10030264 3300025961 Bacteria 3638
266 Ga0207712_11170178 3300025961 Bacteria 686
267 Ga0207668_10050476 3300025972 Bacteria 2867
268 Ga0207668_10133081 3300025972 Bacteria 1901
269 Ga0207668_10307580 3300025972 Bacteria 1310
270 Ga0207668_10514808 3300025972 Bacteria 1031
271 Ga0207640_10047096 3300025981 Bacteria 2779
272 Ga0207640_11080047 3300025981 Bacteria 709
273 Ga0207658_10152028 3300025986 Bacteria 1887
274 Ga0207658_10302702 3300025986 Bacteria 1378
275 Ga0207677_10372206 3300026023 Bacteria 1203
276 Ga0207677_10449758 3300026023 Bacteria 1103
277 Ga0207677_10794330 3300026023 Bacteria 847
278 Ga0207677_11274160 3300026023 Bacteria 674
279 Ga0207639_10125429 3300026041 Bacteria 2117
280 Ga0207639_11265674 3300026041 Bacteria 692
281 Ga0207678_10012243 3300026067 Bacteria 7532
282 Ga0207678_10023843 3300026067 Bacteria 5351
283 Ga0207678_10043610 3300026067 Bacteria 3881
284 Ga0207678_10102652 3300026067 Bacteria 2441
285 Ga0207678_10192978 3300026067 Bacteria 1741
286 Ga0207708_10108395 3300026075 Bacteria 2154
287 Ga0207702_10638366 3300026078 Bacteria 1047
288 Ga0207648_10198231 3300026089 Bacteria 1780
289 Ga0207674_10306534 3300026116 Bacteria 1537
290 Ga0207674_10494583 3300026116 Bacteria 1182
291 Ga0207675_100012334 3300026118 Bacteria 7985
292 Ga0207675_100151132 3300026118 Bacteria 2210
293 Ga0207675_100829118 3300026118 Bacteria 939
294 Ga0207683_10132242 3300026121 Bacteria 2244
295 Ga0207698_10271894 3300026142 Bacteria 1562
296 Ga0209589_1000005 3300027357 Bacteria 530958
297 Ga0209489_100005 3300027361 Bacteria 530958
298 Ga0209700_100006 3300027363 Bacteria 530958
299 Ga0209179_1023854 3300027512 Bacteria 1210
300 Ga0209588_1024496 3300027671 Bacteria 1906
301 Ga0209588_1044547 3300027671 Bacteria 1435
302 Ga0209813_10316700 3300027866 Bacteria 610
303 Ga0268266_10026503 3300028379 Bacteria 4932
304 Ga0268266_10040203 3300028379 Bacteria 3985
305 Ga0268266_10261067 3300028379 Bacteria 1605
306 Ga0268266_10445284 3300028379 Bacteria 1230
307 Ga0268266_10553456 3300028379 Bacteria 1102
308 Ga0268266_11197286 3300028379 Bacteria 735
309 Ga0268266_11409610 3300028379 Bacteria 672
310 Ga0268265_10045461 3300028380 Bacteria 3276
311 Ga0268265_10102665 3300028380 Bacteria 2313
312 Ga0268265_10240892 3300028380 Bacteria 1596
313 Ga0268264_10211588 3300028381 Bacteria 1780
314 Ga0268264_10238457 3300028381 Bacteria 1683
315 Ga0265332_10001304 3300031238 Bacteria 14222
316 Ga0265329_10037913 3300031242 Bacteria 1551
317 Ga0265340_10002000 3300031247 Bacteria 11666
318 Ga0265339_10006161 3300031249 Bacteria 7902
319 Ga0265316_10248708 3300031344 Bacteria 1306
320 Ga0307513_10872177 3300031456 Bacteria 607
321 Ga0307509_10090561 3300031507 Bacteria 3134
322 Ga0265342_10000073 3300031712 Bacteria 106620
323 Ga0307516_10025773 3300031730 Bacteria 5982
324 Ga0307405_10993564 3300031731 Bacteria 715
325 Ga0307410_10827495 3300031852 Bacteria 789
326 Ga0307407_10242705 3300031903 Bacteria 1230
327 Ga0307412_10652277 3300031911 Bacteria 898
328 Ga0307409_100350078 3300031995 Bacteria 1393
329 Ga0307416_101453976 3300032002 Bacteria 791
330 Ga0307411_11102674 3300032005 Bacteria 715
331 Ga0307415_100383708 3300032126 Bacteria 1194
332 Ga0307415_100654486 3300032126 Bacteria 942
333 Ga0307510_10023919 3300033180 Bacteria 7070
334 Ga0307510_10067959 3300033180 Bacteria 3582
335 Ga0307510_10139074 3300033180 Bacteria 2077
336 Ga0307510_10157739 3300033180 Bacteria 1872
337 Ga0315911_1000040 3300033442 Bacteria 50766
338 Ga0373930_0155516 3300034816 Bacteria 576
339 Ga0373929_0132019 3300035085 Bacteria 656
340 Ga0373952_0202294 3300035092 Bacteria 582
341 Ga0373936_0194830 3300035113 Bacteria 893
342 Ga0373962_0078350 3300035242 Bacteria 999
343 Ga0373925_0384532 3300037068 Bacteria 1143
344 Ga0395905_0660155 3300037471 Bacteria 948
345 Ga0395905_1190321 3300037471 Bacteria 666
346 Ga0436364_0286794 3300037853 Bacteria 610
347 Ga0436364_1437107 3300037853 Bacteria 2922
348 Ga0436365_0123231 3300039437 Bacteria 945
349 Ga0436365_0771653 3300039437 Bacteria 907
350 Ga0436365_1802818 3300039437 Bacteria 904
351 Ga0436363_0215083 3300039450 Bacteria 531
352 Ga0436363_0606788 3300039450 Bacteria 672
353 Ga0439465_0189215 3300041413 Bacteria 747
354 Ga0439431_0223984 3300041997 Bacteria 553
355 Ga0439445_0026177 3300042004 Bacteria 1492
356 Ga0439432_167826 3300042006 Bacteria 641
357 Ga0466960_0040022 3300044901 Bacteria 2214
358 Ga0495592_0243303 3300046454 Bacteria 1193
359 Ga0495603_0028125 3300046455 Bacteria 3391
360 Ga0495603_0087926 3300046455 Bacteria 1818
361 Ga0495629_0067947 3300046459 Bacteria 2487
362 Ga0495629_0429022 3300046459 Bacteria 896
363 Ga0495638_0417272 3300046460 Bacteria 693
364 Ga0495641_0099296 3300046461 Bacteria 1299
365 Ga0495653_0361702 3300046463 Bacteria 931
366 Ga0495650_0069961 3300046471 Bacteria 1379
367 Ga0495580_0088328 3300046472 Bacteria 2159
368 Ga0495582_0121112 3300046473 Bacteria 1474
369 Ga0495605_0272841 3300046474 Bacteria 720
370 Ga0495584_0082921 3300046491 Bacteria 1614
371 Ga0495584_0131427 3300046491 Bacteria 1270
372 Ga0495585_0111977 3300046492 Bacteria 1450
373 Ga0495585_0131867 3300046492 Bacteria 1314
374 Ga0495606_0000939 3300046507 Bacteria 42966
375 Ga0495606_0008450 3300046507 Bacteria 8938
376 Ga0495606_0350788 3300046507 Bacteria 783
377 Ga0495616_0131047 3300046513 Bacteria 1149
378 Ga0495616_0316529 3300046513 Bacteria 656
379 Ga0495616_0366064 3300046513 Bacteria 598
380 Ga0495618_0067230 3300046514 Bacteria 2279
381 Ga0495630_0456700 3300046517 Bacteria 979
382 Ga0495632_0135139 3300046519 Bacteria 1146
383 Ga0495637_0082427 3300046520 Bacteria 1281
384 Ga0495643_0029221 3300046522 Bacteria 3085
385 Ga0495643_0158217 3300046522 Bacteria 1116
386 Ga0495643_0229773 3300046522 Bacteria 875
387 Ga0495644_0093900 3300046523 Bacteria 1133
388 Ga0495648_0000271 3300046524 Bacteria 58164
389 Ga0495648_0005941 3300046524 Bacteria 10045
390 Ga0495648_0151924 3300046524 Bacteria 1207
391 Ga0495648_0338271 3300046524 Bacteria 692
392 Ga0495654_0076848 3300046530 Bacteria 1573
393 Ga0495587_0098470 3300046536 Bacteria 1686
394 Ga0495598_0080813 3300046537 Bacteria 1042
395 Ga0495609_0160462 3300046538 Bacteria 953
396 Ga0495609_0183564 3300046538 Bacteria 880
397 Ga0495622_0039382 3300046557 Bacteria 2201
398 Ga0495622_0049284 3300046557 Bacteria 1955
399 Ga0495622_0059118 3300046557 Bacteria 1775
400 Ga0495633_0101022 3300046558 Bacteria 1339
401 Ga0495656_0020082 3300046615 Bacteria 2587
402 Ga0495656_0070454 3300046615 Bacteria 1551
403 Ga0495656_0374222 3300046615 Bacteria 741
404 Ga0495668_0258735 3300046616 Bacteria 953
405 Ga0495668_0269002 3300046616 Bacteria 933
406 Ga0495668_0471707 3300046616 Bacteria 691
407 Ga0495635_0020566 3300046663 Bacteria 4596
408 Ga0495588_0059750 3300046674 Bacteria 1972
409 Ga0495588_0098644 3300046674 Bacteria 1534
410 Ga0495588_0183043 3300046674 Bacteria 1107
411 Ga0495658_0362389 3300046683 Bacteria 922
412 Ga0495669_0037799 3300046684 Bacteria 2137
413 Ga0495669_0046687 3300046684 Bacteria 1933
414 Ga0495669_0070108 3300046684 Bacteria 1596
415 Ga0495624_0308467 3300046690 Bacteria 954
416 Ga0495670_0073796 3300046691 Bacteria 1729
417 Ga0495671_0113371 3300046692 Bacteria 1324
418 Ga0495671_0153483 3300046692 Bacteria 1121
419 Ga0495671_0161386 3300046692 Bacteria 1090
420 Ga0495649_0094884 3300046694 Bacteria 1588
421 Ga0495649_0186351 3300046694 Bacteria 1081
422 Ga0495589_0037945 3300046794 Bacteria 2413
423 Ga0495589_0062089 3300046794 Bacteria 1833
424 Ga0495589_0337772 3300046794 Bacteria 695
425 Ga0495660_0130063 3300046810 Bacteria 1264
426 Ga0495660_0210772 3300046810 Bacteria 922
427 Ga0495581_0251339 3300047315 Bacteria 1034
428 Ga0495581_0351320 3300047315 Bacteria 861
429 Ga0495604_0160590 3300047317 Bacteria 1588
430 Ga0495636_0023477 3300047318 Bacteria 2497
431 Ga0495672_0017130 3300047320 Bacteria 4853
432 Ga0495676_0113199 3300047321 Bacteria 1987
433 Ga0495676_0278936 3300047321 Bacteria 1132
434 Ga0495683_0115493 3300047323 Bacteria 1278
435 Ga0495687_035818 3300047443 Bacteria 2227
436 Ga0495687_252866 3300047443 Bacteria 525
437 Ga0495686_0153572 3300047472 Bacteria 1350
438 Ga0495593_0087468 3300047673 Bacteria 1607
439 Ga0495602_0132758 3300048088 Bacteria 1983
440 Ga0495626_0211615 3300048091 Bacteria 791
441 Ga0495626_0362297 3300048091 Bacteria 564
442 Ga0496100_0038770 3300048903 Bacteria 3022
443 Ga0496100_0320948 3300048903 Bacteria 1163
444 Ga0496100_0892219 3300048903 Bacteria 698
445 Ga0496101_0133980 3300048904 Bacteria 1884
446 Ga0496101_1086493 3300048904 Bacteria 628
447 Ga0496102_0172696 3300048905 Bacteria 2035
448 Ga0496102_0204824 3300048905 Bacteria 1860
449 Ga0496102_0246584 3300048905 Bacteria 1684
450 Ga0496102_0251176 3300048905 Bacteria 1668
451 Ga0496102_0442268 3300048905 Bacteria 1220
452 Ga0496102_0757732 3300048905 Bacteria 893
453 Ga0496103_0057382 3300048906 Bacteria 2417
454 Ga0496104_0299755 3300048907 Bacteria 1519
455 Ga0496104_0360340 3300048907 Bacteria 1366
456 Ga0496104_0572100 3300048907 Bacteria 1040
457 Ga0496104_0810167 3300048907 Bacteria 842
458 Ga0496104_1280587 3300048907 Bacteria 636
459 Ga0496105_0005469 3300048908 Bacteria 9639
460 Ga0496105_0023572 3300048908 Bacteria 4993
461 Ga0496105_0025196 3300048908 Bacteria 4839
462 Ga0496105_0246611 3300048908 Bacteria 1448
463 Ga0496105_0547800 3300048908 Bacteria 903
464 Ga0496106_0102031 3300048909 Bacteria 2225
465 Ga0496106_0299052 3300048909 Bacteria 1290
466 Ga0496106_0317189 3300048909 Bacteria 1251
467 Ga0496107_0036476 3300048910 Bacteria 3527
468 Ga0496108_0446113 3300048911 Bacteria 1130
469 Ga0496109_0176961 3300048912 Bacteria 2003
470 Ga0496110_0791609 3300048913 Bacteria 852
471 Ga0496111_0046108 3300048914 Bacteria 3138
472 Ga0496111_0153420 3300048914 Bacteria 1709
473 Ga0496112_0000014 3300048915 Bacteria 210932
474 Ga0496112_0245225 3300048915 Bacteria 1743
475 Ga0496112_1307928 3300048915 Bacteria 640
476 Ga0496113_0126186 3300048916 Bacteria 2004
477 Ga0496113_1349693 3300048916 Bacteria 553
478 Ga0496114_0028579 3300048917 Bacteria 4577
479 Ga0496114_0093243 3300048917 Bacteria 2560
480 Ga0496115_0091091 3300048918 Bacteria 2492
481 Ga0496115_0306054 3300048918 Bacteria 1302
482 Ga0496115_0600584 3300048918 Bacteria 875
483 Ga0496115_0834200 3300048918 Bacteria 715
484 Ga0496116_0008246 3300048919 Bacteria 9074
485 Ga0496116_0014519 3300048919 Bacteria 6283
486 Ga0496116_0439100 3300048919 Bacteria 563
487 Ga0496117_0111923 3300048920 Bacteria 1699
488 Ga0496117_0113925 3300048920 Bacteria 1678
489 Ga0496117_0126550 3300048920 Bacteria 1558
490 Ga0496118_0046487 3300048921 Bacteria 3376
491 Ga0496118_0063623 3300048921 Bacteria 2713
492 Ga0496118_0070590 3300048921 Bacteria 2521
493 Ga0496118_0106787 3300048921 Bacteria 1872
494 Ga0496118_0145235 3300048921 Bacteria 1495
495 Ga0496118_0229940 3300048921 Bacteria 1071
496 Ga0496119_0000069 3300048922 Bacteria 155265
497 Ga0496119_0086055 3300048922 Bacteria 1797
498 Ga0496119_0089539 3300048922 Bacteria 1752
499 Ga0496119_0165608 3300048922 Bacteria 1171
500 Ga0496119_0181956 3300048922 Bacteria 1101
501 Ga0496120_0002382 3300048923 Bacteria 19183
502 Ga0496120_0073803 3300048923 Bacteria 1865
503 Ga0496120_0173065 3300048923 Bacteria 1066
504 Ga0496120_0202622 3300048923 Bacteria 960
505 Ga0496120_0474878 3300048923 Bacteria 541
506 Ga0496121_0000379 3300048924 Bacteria 91131
507 Ga0496121_0019688 3300048924 Bacteria 6733
508 Ga0496121_0035041 3300048924 Bacteria 4504
509 Ga0496121_0047920 3300048924 Bacteria 3641
510 Ga0496121_0059912 3300048924 Bacteria 3136
511 Ga0496121_0061366 3300048924 Bacteria 3085
512 Ga0496121_0093436 3300048924 Bacteria 2342
513 Ga0496121_0122240 3300048924 Bacteria 1963
514 Ga0496121_0155588 3300048924 Bacteria 1678
515 Ga0496121_0288820 3300048924 Bacteria 1118
516 Ga0496121_0495398 3300048924 Bacteria 777
517 Ga0496121_0540047 3300048924 Bacteria 731
518 Ga0496121_0614081 3300048924 Bacteria 668
519 Ga0496122_0005549 3300048925 Bacteria 14949
520 Ga0496122_0109431 3300048925 Bacteria 1819
521 Ga0496122_0416111 3300048925 Bacteria 677
522 Ga0496123_0021257 3300048926 Bacteria 5048
523 Ga0496123_0154263 3300048926 Bacteria 1234
524 Ga0496124_0009372 3300048927 Bacteria 10088
525 Ga0496124_0012706 3300048927 Bacteria 8280
526 Ga0496124_0481296 3300048927 Bacteria 838
527 Ga0496124_0590010 3300048927 Bacteria 725
528 Ga0496125_0008597 3300048928 Bacteria 10657
529 Ga0496125_0009153 3300048928 Bacteria 10235
530 Ga0496125_0012472 3300048928 Bacteria 8433
531 Ga0496125_0036175 3300048928 Bacteria 4316
532 Ga0496125_0102728 3300048928 Bacteria 2099
533 Ga0496126_0000913 3300048929 Bacteria 51086
534 Ga0496126_0017311 3300048929 Bacteria 7183
535 Ga0496126_0049396 3300048929 Bacteria 3841
536 Ga0496126_0064157 3300048929 Bacteria 3291
537 Ga0496126_0321567 3300048929 Bacteria 1271
538 Ga0496126_0470591 3300048929 Bacteria 1008
539 Ga0496126_0565510 3300048929 Bacteria 900
540 Ga0496126_0568571 3300048929 Bacteria 897
541 Ga0496126_0639830 3300048929 Bacteria 833
542 Ga0501031_0001811 3300049568 Bacteria 13440
543 Ga0501031_0074268 3300049568 Bacteria 2214
544 Ga0501031_0097128 3300049568 Bacteria 1922
545 Ga0501032_0000048 3300049569 Bacteria 106326
546 Ga0501032_0128676 3300049569 Bacteria 1671
547 Ga0501033_0000184 3300049570 Bacteria 59970
548 Ga0501033_0087608 3300049570 Bacteria 2278
549 Ga0501033_0143671 3300049570 Bacteria 1724
550 Ga0501033_0396335 3300049570 Bacteria 963
551 Ga0501034_0000082 3300049571 Bacteria 170039
552 Ga0501034_0430770 3300049571 Bacteria 1239
553 Ga0501034_0521067 3300049571 Bacteria 1100
554 Ga0501036_0014120 3300049572 Bacteria 6641
555 Ga0501036_0407817 3300049572 Bacteria 1133
556 Ga0501036_0766379 3300049572 Bacteria 795
557 Ga0501037_0000346 3300049573 Bacteria 39162
558 Ga0501037_0130060 3300049573 Bacteria 1805
559 Ga0501038_0003296 3300049574 Bacteria 15047
560 Ga0501038_0037116 3300049574 Bacteria 4275
561 Ga0501038_0415620 3300049574 Bacteria 1038
562 Ga0501039_0000082 3300049575 Bacteria 72201
563 Ga0501039_0066837 3300049575 Bacteria 2791
564 Ga0501042_0040061 3300049578 Bacteria 3331
565 Ga0501043_0000148 3300049579 Bacteria 65190
566 Ga0501043_0033766 3300049579 Bacteria 4025
567 Ga0501043_0838675 3300049579 Bacteria 663
568 Ga0501046_0000101 3300049580 Bacteria 91179
569 Ga0501046_0025876 3300049580 Bacteria 4796
570 Ga0501047_0000671 3300049581 Bacteria 35653
571 Ga0501047_0091118 3300049581 Bacteria 2926
572 Ga0501047_0128664 3300049581 Bacteria 2412
573 Ga0501047_0398805 3300049581 Bacteria 1209
574 Ga0501047_0557030 3300049581 Bacteria 970
575 Ga0501047_1030180 3300049581 Bacteria 636
576 Ga0501048_0000681 3300049582 Bacteria 24686
577 Ga0501048_0180880 3300049582 Bacteria 1494
578 Ga0501067_0000408 3300049583 Bacteria 23436
579 Ga0501067_0227228 3300049583 Bacteria 1039
580 Ga0501067_0590956 3300049583 Bacteria 622
581 Ga0501068_0056020 3300049584 Bacteria 2389
582 Ga0501068_0260783 3300049584 Bacteria 1105
583 Ga0501068_0263984 3300049584 Bacteria 1098
584 Ga0501068_0305993 3300049584 Bacteria 1018
585 Ga0501069_0004676 3300049585 Bacteria 7073
586 Ga0501069_0362564 3300049585 Bacteria 855
587 Ga0501070_0044093 3300049586 Bacteria 3711
588 Ga0501070_0209404 3300049586 Bacteria 1600
589 Ga0501071_0002034 3300049587 Bacteria 12106
590 Ga0501071_0230366 3300049587 Bacteria 1395
591 Ga0501072_0001931 3300049588 Bacteria 15436
592 Ga0501072_0135959 3300049588 Bacteria 1960
593 Ga0501072_0366826 3300049588 Bacteria 1143
594 Ga0501072_1344376 3300049588 Bacteria 553
595 Ga0501073_0000101 3300049589 Bacteria 54365
596 Ga0501074_0000331 3300049590 Bacteria 27484
597 Ga0501074_0052268 3300049590 Bacteria 2950
598 Ga0501074_0598887 3300049590 Bacteria 779
599 Ga0501075_0957223 3300049591 Bacteria 651
600 Ga0501076_0991115 3300049592 Bacteria 692
601 Ga0501079_0192832 3300049741 Bacteria 1590
602 Ga0501079_0568684 3300049741 Bacteria 892
603 Ga0501080_0019088 3300049742 Bacteria 6347
604 Ga0501080_0110215 3300049742 Bacteria 2551
605 Ga0501081_0514398 3300049743 Bacteria 893
606 Ga0501083_0001659 3300049744 Bacteria 15182
607 Ga0501083_0130954 3300049744 Bacteria 1644
608 Ga0501262_047281 3300049759 Bacteria 658
609 Ga0501035_0001078 3300049822 Bacteria 28573
610 Ga0501035_0096947 3300049822 Bacteria 2590
611 Ga0501035_0211597 3300049822 Bacteria 1658
612 Ga0501035_0518400 3300049822 Bacteria 979
613 Ga0501044_0000408 3300049823 Bacteria 52994
614 Ga0501044_0069795 3300049823 Bacteria 3577
615 Ga0501044_0123283 3300049823 Bacteria 2590
616 Ga0501044_0169227 3300049823 Bacteria 2157
617 Ga0501044_1035810 3300049823 Bacteria 691
618 Ga0501045_0651943 3300049824 Bacteria 778
619 nmdc:mga03683_66528_c1 3300050489 Bacteria 1532
620 nmdc:mga03n38_101851_c1 3300050490 Bacteria 1386
621 nmdc:mga03n38_400222_c1 3300050490 Bacteria 756
622 nmdc:mga03n38_851729_c1 3300050490 Bacteria 533
623 nmdc:mga00v17_44597_c1 3300050491 Bacteria 2674
624 nmdc:mga0yw44_148912_c1 3300050492 Bacteria 1526
625 nmdc:mga0yw44_21848_c1 3300050492 Bacteria 3577
626 nmdc:mga0yw44_276630_c1 3300050492 Bacteria 1121
627 nmdc:mga0yw44_47274_c1 3300050492 Bacteria 2589
628 nmdc:mga0yw44_70660_c1 3300050492 Bacteria 2165
629 nmdc:mga0yw44_74941_c1 3300050492 Bacteria 2109
630 nmdc:mga0k408_133875_c1 3300050493 Bacteria 1472
631 nmdc:mga0k408_361529_c1 3300050493 Bacteria 865
632 nmdc:mga06z11_170384_c1 3300050494 Bacteria 1250
633 nmdc:mga06z11_200547_c1 3300050494 Bacteria 1159
634 nmdc:mga06z11_7829_c1 3300050494 Bacteria 4420
635 nmdc:mga06z11_9566_c1 3300050494 Bacteria 3737
636 nmdc:mga04h51_210678_c1 3300050495 Bacteria 767
637 nmdc:mga04h51_351147_c1 3300050495 Bacteria 610
638 nmdc:mga04h51_65565_c1 3300050495 Bacteria 1256
639 nmdc:mga07m45_100728_c1 3300050496 Bacteria 1659
640 nmdc:mga07m45_171339_c1 3300050496 Bacteria 1262
641 nmdc:mga07m45_38886_c1 3300050496 Bacteria 2657
642 nmdc:mga07m45_566237_c1 3300050496 Bacteria 657
643 nmdc:mga05p37_181260_c1 3300050507 Bacteria 2562
644 nmdc:mga0qj67_1232577_c1 3300050509 Bacteria 581
645 nmdc:mga08y16_479776_c1 3300050511 Bacteria 1265
646 nmdc:mga0a205_612535_c1 3300050515 Bacteria 941
647 nmdc:mga0sz30_26334_c1 3300050516 Bacteria 1588
648 nmdc:mga0sz30_265943_c1 3300050516 Bacteria 764
649 nmdc:mga0sz30_57004_c1 3300050516 Bacteria 1664
650 nmdc:mga0sz30_61711_c1 3300050516 Bacteria 1602
651 nmdc:mga0sz30_82654_c1 3300050516 Bacteria 1391
652 Ga0500635_0003093 3300053080 Bacteria 4162
653 Ga0500635_0121533 3300053080 Bacteria 978
654 Ga0495655_0044928 3300053083 Bacteria 1145
655 Ga0500643_000016 3300053087 Bacteria 309502
656 Ga0500647_0046980 3300053091 Bacteria 2075
657 Ga0500583_0029660 3300053092 Bacteria 2387
658 Ga0500651_0240265 3300053093 Bacteria 1056
659 Ga0500651_0462487 3300053093 Bacteria 704
660 Ga0500566_0000378 3300053094 Bacteria 24521
661 Ga0500566_0058173 3300053094 Bacteria 2195
662 Ga0500566_0114133 3300053094 Bacteria 1465
663 Ga0500566_0238204 3300053094 Bacteria 893
664 Ga0500641_0060742 3300053096 Bacteria 1573
665 Ga0500641_0098879 3300053096 Bacteria 1250
666 Ga0500641_0109938 3300053096 Bacteria 1186
667 Ga0500650_0231405 3300053098 Bacteria 834
668 Ga0500650_0353755 3300053098 Bacteria 642
669 Ga0500554_007747 3300053102 Bacteria 2486
670 Ga0500555_136336 3300053103 Bacteria 607
671 Ga0500556_0123771 3300053104 Bacteria 1010
672 Ga0500557_000058 3300053105 Bacteria 45990
673 Ga0500562_031931 3300053108 Bacteria 1390
674 Ga0500572_005223 3300053111 Bacteria 2939
675 Ga0500593_041901 3300053117 Bacteria 2045
676 Ga0500595_001183 3300053119 Bacteria 14392
677 Ga0500595_004333 3300053119 Bacteria 6387
678 Ga0500595_012166 3300053119 Bacteria 3336
679 Ga0500595_014368 3300053119 Bacteria 3004
680 Ga0500595_021264 3300053119 Bacteria 2319
681 Ga0500595_119627 3300053119 Bacteria 745
682 Ga0500607_019531 3300053121 Bacteria 3834
683 Ga0500608_159555 3300053122 Bacteria 979
684 Ga0500617_101301 3300053124 Bacteria 1217
685 Ga0500618_055109 3300053125 Bacteria 897
686 Ga0500642_0000151 3300053130 Bacteria 29364
687 Ga0500642_0008388 3300053130 Bacteria 3535
688 Ga0500655_009905 3300053133 Bacteria 1720
689 Ga0500559_0100311 3300053136 Bacteria 1333
690 Ga0500559_0281112 3300053136 Bacteria 782
691 Ga0500568_0395808 3300053139 Bacteria 500
692 Ga0500588_0067457 3300053146 Bacteria 1164
693 Ga0500589_057182 3300053147 Bacteria 1796
694 Ga0500590_141806 3300053148 Bacteria 1097
695 Ga0500603_000226 3300053150 Bacteria 14827
696 Ga0500603_080523 3300053150 Bacteria 943
697 Ga0500603_181454 3300053150 Bacteria 662
698 Ga0500616_0000046 3300053153 Bacteria 333409
699 Ga0500616_0089214 3300053153 Bacteria 1531
700 Ga0500619_028128 3300053154 Bacteria 1690
701 Ga0500620_001318 3300053155 Bacteria 4502
702 Ga0500622_0007477 3300053156 Bacteria 6202
703 Ga0500638_024084 3300053162 Bacteria 2899
704 Ga0500636_0000146 3300053177 Bacteria 37168
705 Ga0500636_0171060 3300053177 Bacteria 1175
706 Ga0500637_0000138 3300053178 Bacteria 26740
707 Ga0500637_0005369 3300053178 Bacteria 6194
708 Ga0500570_165046 3300053724 Bacteria 753
709 Ga0500625_028036 3300053729 Bacteria 2671
710 Ga0500645_016504 3300053730 Bacteria 2325
711 Ga0500645_070573 3300053730 Bacteria 1003
712 Ga0500645_115072 3300053730 Bacteria 753
713 Ga0500609_018880 3300053731 Bacteria 940
714 Ga0500656_032165 3300053732 Bacteria 703
715 Ga0500599_007311 3300053736 Bacteria 1419
716 Ga0500601_001089 3300053737 Bacteria 3072
717 Ga0501084_0019286 3300054114 Bacteria 5681
718 Ga0501084_0184366 3300054114 Bacteria 1762
719 Ga0500661_000130 3300055283 Bacteria 12645
720 Ga0501082_0001007 3300060353 Bacteria 24901
721 Ga0501082_0002356 3300060353 Bacteria 16543
722 Ga0501082_0291175 3300060353 Bacteria 1422
723 Ga0501082_0407689 3300060353 Bacteria 1186
724 2509394086 2509276022 Bacteria 6200534
725 2510318225 2510065059 Bacteria 6847884
726 2511398275 2511231028 Bacteria 8046582
727 2512961579 2512875024 Bacteria 7195110
728 2513624125 2513237092 Bacteria 8341956
729 2513648508 2513237095 Bacteria 8976980
730 2513656116 2513237096 Bacteria 8722461
731 2513859012 2513237137 Bacteria 9558895
732 2513874982 2513237139 Bacteria 8737671
733 2513920875 2513237145 Bacteria 8979722
734 2514013950 2513237161 Bacteria 8871253
735 2514036863 2513237164 Bacteria 7563725
736 2517101138 2517093001 Bacteria 9002274
737 2517895937 2517572143 Bacteria 9484767
738 2524439920 2524023205 Bacteria 8918781
739 2528854016 2528768022 Bacteria 10457665
740 2617348454 2617270735 Bacteria 9163226
741 2617374998 2617270741 Bacteria 8201522
742 2671122728 2667528175 Bacteria 7532676
743 2728752368 2728368998 Bacteria 8720350
744 2745075798 2744054633 Bacteria 8678936
745 2793061642 2791355196 Bacteria 7323613
746 2793069637 2791355197 Bacteria 8420563
747 2805916427 2802429603 Bacteria 8777136
748 2818240091 2816332527 Bacteria 8933356
749 2824608125 2824600985 Bacteria 8488197
750 2824615717 2824609381 Bacteria 8672835
751 2824626326 2824617872 Bacteria 8814715
752 2824632110 2824626560 Bacteria 8813858
753 2824643499 2824635225 Bacteria 8785348
754 2824652974 2824644064 Bacteria 8743947
755 2824665443 2824661429 Bacteria 9877870
756 2824678408 2824671348 Bacteria 8369588
757 2824687260 2824679649 Bacteria 8248951
758 2824694852 2824687955 Bacteria 8360029
759 2824702805 2824696289 Bacteria 8335049
760 2824709846 2824704595 Bacteria 9667483
761 2824732820 2824723954 Bacteria 8758240
762 2824740162 2824732956 Bacteria 7810675
763 2824752966 2824746037 Bacteria 7911610
764 2824759987 2824753945 Bacteria 9787441
765 2824769391 2824763712 Bacteria 9792355
766 2824778987 2824773399 Bacteria 8360218
767 2838129901 2838122688 Bacteria 8803140
768 2841946941 2841941048 Bacteria 8688029
769 2841955128 2841949485 Bacteria 8680857
770 2841961552 2841957949 Bacteria 8652217
771 2841970085 2841966195 Bacteria 8673214
772 2841977271 2841974524 Bacteria 8931498
773 2841990315 2841983080 Bacteria 8395090
774 2842042313 2842038055 Bacteria 8002051
775 2842050356 2842045827 Bacteria 8006841
776 2844011254 2844009547 Bacteria 6728125
777 2847673870 2847670302 Bacteria 6165597
778 2847943876 2847939898 Bacteria 8606328
779 2849081899 2849076700 Bacteria 7039503
780 2856320479 2856314179 Bacteria 6477897
781 2856328427 2856328259 Bacteria 6528202
782 2856363521 2856356410 Bacteria 6297484
783 2857513613 2857509624 Bacteria 7472071
784 2869176958 2869169390 Bacteria 6659796
785 2869237839 2869234852 Bacteria 6654993
786 2869247466 2869242130 Bacteria 6609239
787 2869257159 2869256925 Bacteria 6981691
788 2869274489 2869271264 Bacteria 6908218
789 2871483675 2871481445 Bacteria 6700002
790 2871494836 2871488783 Bacteria 6929816
791 2874114513 2874109183 Bacteria 6517025
792 2874118648 2874116593 Bacteria 6674494
793 2874165475 2874162495 Bacteria 6174670
794 2874615343 2874612657 Bacteria 8252029
795 2874633690 2874628541 Bacteria 8630250
796 2876386392 2876386047 Bacteria 6698674
797 2876402223 2876399893 Bacteria 6927900
798 2876409964 2876406927 Bacteria 6191900
799 2876422156 2876420981 Bacteria 6687741
800 2876765509 2876761206 Bacteria 10111113
801 2878038894 2878035449 Bacteria 6555736
802 2878734737 2878730984 Bacteria 6380721
803 2878759961 2878753008 Bacteria 6922523
804 2878774320 2878774303 Bacteria 6108671
805 2878783423 2878781027 Bacteria 6834456
806 2879100845 2879099564 Bacteria 10442239
807 2881165408 2881161766 Bacteria 7127907
808 2881367298 2881364244 Bacteria 7710352
809 2881851949 2881845957 Bacteria 6611900
810 2885373741 2885366525 Bacteria 8326213
811 2888337108 2888337043 Bacteria 6629336
812 2888386957 2888378607 Bacteria 9652610
813 2888389651 2888388044 Bacteria 7304136
814 2888421445 2888419890 Bacteria 7857137
815 2894821133 2894817345 Bacteria 4892941
816 2903494195 2903492973 Bacteria 13473544
817 2903518503 2903513507 Bacteria 6344008
818 2904699087 2904690495 Bacteria 9412302
819 2904719542 2904711408 Bacteria 9771557
820 2906402708 2906401398 Bacteria 6693206
821 2906409994 2906408224 Bacteria 6162342
822 2906421258 2906414383 Bacteria 6580790
823 2906435284 2906427513 Bacteria 6375796
824 2906615598
825 2906626748 2906626472 Bacteria 8826946
826 2906636484 2906635258 Bacteria 8601019
827 2906665030 2906660503 Bacteria 8595048
828 2908745583 2908739725 Bacteria 8628932
829 2908763569 2908756301 Bacteria 8864324
830 2908777480 2908775508 Bacteria 8092255
831 2922153033 2922151315 Bacteria 6902399
832 2922172767 2922172374 Bacteria 6167644
833 2922181038 2922178524 Bacteria 6025201
834 2922377087
835 2922398234 2922393267 Bacteria 8285685
836 2922432409
837 2924715130 2924710171 Bacteria 6752351
838 2924734389 2924733363 Bacteria 7574837
839 2924744553 2924741084 Bacteria 6661321
840 2924753759 2924748358 Bacteria 6154725
841 2929619087 2929615660 Bacteria 9193770
842 2929628418 2929624759 Bacteria 9339455
843 2932791342 2932784394 Bacteria 9704911
844 2932814800 2932809354 Bacteria 9135765
845 2932823657 2932818245 Bacteria 9955613
846 2932833089 2932828146 Bacteria 9745859
847 2933581009 2933577622 Bacteria 9116884
848 2935612276 2935608549 Bacteria 8203142
849 2935623818 2935616580 Bacteria 9032984
850 2935639593 2935638405 Bacteria 10015038
851 2935670536 2935665750 Bacteria 9571747
852 2935679966 2935675223 Bacteria 9928132
853 2935687535 2935684952 Bacteria 9590419
854 2935696496 2935694250 Bacteria 9291695
855 2935705309 2935703347 Bacteria 10242284
856 2935718995 2935713505 Bacteria 9608509
857 2935728647 2935722832 Bacteria 9608746
858 2935736757 2935732158 Bacteria 9706831
859 2935746241 2935741537 Bacteria 9707219
860 2935753501 2935750917 Bacteria 9590372
861 2935767695 2935760218 Bacteria 9817913
862 2935807054 2935801545 Bacteria 9301974
863 2935814031 2935810662 Bacteria 9401221
864 2935823765 2935819856 Bacteria 8261050
865 2935829075 2935827899 Bacteria 10038562
866 2935845390 2935837841 Bacteria 9454360
867 2935854403 2935847175 Bacteria 8228321
868 2935861957 2935855204 Bacteria 9035059
869 2935872793 2935864058 Bacteria 9784707
870 2935880368 2935873716 Bacteria 9632195
871 2935913503 2935908558 Bacteria 8568796
872 2935923400 2935916978 Bacteria 9113783
873 2935931180 2935926038 Bacteria 8601059
874 2935935462 2935934488 Bacteria 8602579
875 2935947028 2935942939 Bacteria 8599779
876 2935953877 2935951376 Bacteria 8602333
877 2935961485 2935959822 Bacteria 7869783
878 2935968903 2935967501 Bacteria 8603075
879 2935994978 2935992306 Bacteria 9802711
880 2936006071 2936002035 Bacteria 9362176
881 2936039586 2936037263 Bacteria 9446081
882 2937852276 2937848649 Bacteria 6983481
883 2937862187 2937861824 Bacteria 6660327
884 2937982362 2937980651 Bacteria 6517427
885 2940559414 2940556831 Bacteria 9590747
886 2941545639 2941538514 Bacteria 9402094
887 2958068562 2958064165 Bacteria 7158582
888 2958109709 2958108152 Bacteria 6681128
889 2958144268 2958137437 Bacteria 6050276
890 2961138302 2961136820 Bacteria 6775228
891 2961177233 2961170736 Bacteria 7072258
892 2961186869 2961183825 Bacteria 6688536
893 2965030961 2965025482 Bacteria 6532201
894 2965053272 2965047637 Bacteria 6623551
895 2965108842 2965102966 Bacteria 6800987
896 2965111678 2965110997 Bacteria 6693150
897 2968002335 2967996073 Bacteria 6787468
898 2968009567 2968003550 Bacteria 6929263
899 2968139835 2968138860 Bacteria 6605449
900 2970494488 2970489779 Bacteria 6517260
901 2970509907 2970503327 Bacteria 7099517
902 2970517813 2970510686 Bacteria 7006402
903 2970534238 2970532167 Bacteria 6553173
904 2970552365 2970547951 Bacteria 6931819
905 2970625827 2970619444 Bacteria 6986144
906 2970633440 2970627176 Bacteria 6680862
907 2977828483 2977821940 Bacteria 6906439
908 2977835566 2977828996 Bacteria 7007971
909 2977857680 2977851361 Bacteria 6694324
910 2977900139 2977898635 Bacteria 6675551
911 2977914205 2977907340 Bacteria 6577984
912 2977941813 2977935797 Bacteria 6252826
913 2979764968 2979764755 Bacteria 6610066
914 2979776632 2979772303 Bacteria 6618277
915 2979814783 2979808191 Bacteria 7179355
916 2987651532 2987645492 Bacteria 6117018
917 2987677684 2987673487 Bacteria 6884027
918 2996389536 2996386984 Bacteria 6978667
919 3004239848 3004232784 Bacteria 6662140
920 3004248328 3004248173 Bacteria 6563236
921 3004269117 3004268573 Bacteria 7043476
922 3005476630 3005474847 Bacteria 9259049
923 3005487677 3005483717 Bacteria 7877331
924 3005511172 3005506211 Bacteria 6943378
925 3005592023 3005587118 Bacteria 7794411
926 8004304567 8004300914 Bacteria 6132239
927 8004321078 8004312739 Bacteria 7444653
928 8004381460 8004374579 Bacteria 6898112
929 8004728981 8004727605 Bacteria 6643904
930 8005661784 8005658619 Bacteria 4500593
931 8006934851 8006933436 Bacteria 10410654
932 8006974819 8006973647 Bacteria 10679141
933 8006991280 8006984368 Bacteria 9651211
934 8016516951 8016511872 Bacteria 9921665
935 8016588606 8016583857 Bacteria 10421953
936 8017059620 8017057580 Bacteria 10023680
937 8019563804 8019555841 Bacteria 9642137
938 8019573870 8019565922 Bacteria 9639779
939 8019579092 8019576017 Bacteria 10049540
940 8019597147 8019586578 Bacteria 10212056
941 8019604543 8019597564 Bacteria 10041141
942 8019613986 8019608314 Bacteria 10042931
943 8055433146 8055431914 Bacteria 4551896
944 8055618354 8055617313 Bacteria 7548464
945 8055749655 8055742211 Bacteria 9226248
946 8056675096 8056673599 Bacteria 7871253
947 8056684641 8056681323 Bacteria 8472857
948 8056696226 8056689827 Bacteria 6712655
949 JGI25153J46596_10035196
950 JGI25165J46597_1013007
951 JGI25153J46596_10000556
952 JGI25153J46596_10001313
953 JGI25153J46596_10003755
954 JGI25160J50197_1001571
955 JGI25160J50197_1005015
956 JGI25160J50197_1006864
957 JGI25161J50226_1025510
958 JGI25404J52841_10043089
959 Ga0055526_1045891
960 Ga0055531_10019226
961 Ga0055543_1002055
962 Ga0055543_1032588
963 Ga0065165_1001533
964 Ga0065165_1002335
965 Ga0065165_1014380
966 Ga0065165_1044956
967 Ga0070690_100037594
968 Ga0068869_100705801
969 Ga0070666_10273750
970 Ga0070682_100133727
971 Ga0070682_100755145
972 Ga0068868_100038833
973 Ga0068868_100955732
974 Ga0070660_100106810
975 Ga0070660_100868837
976 Ga0070660_100907866
977 Ga0070689_100746122
978 Ga0070668_100064708
979 Ga0070668_100106524
980 Ga0070668_100125027
981 Ga0070669_100133688
982 Ga0070669_100167166
983 Ga0070669_100440189
984 Ga0070675_100239602
985 Ga0070675_100706061
986 Ga0070671_100076243
987 Ga0070671_100191193
988 Ga0070671_100528029
989 Ga0070674_100032867
990 Ga0070674_100378841
991 Ga0070673_100485629
992 Ga0070659_100134945
993 Ga0070667_100958189
994 Ga0070708_100309981
995 Ga0070663_100096170
996 Ga0070663_100217855
997 Ga0070663_100919684
998 Ga0070663_101071471
999 Ga0070678_100014756
1000 Ga0070678_100085446
1001 Ga0070678_100095811
1002 Ga0070685_10447999
1003 Ga0070679_100677925
1004 Ga0068853_100444434
1005 Ga0068853_100988737
1006 Ga0068853_101037994
1007 Ga0070696_100256386
1008 Ga0070665_100100447
1009 Ga0070665_100395621
1010 Ga0070665_100576656
1011 Ga0070665_100805099
1012 Ga0070665_100810167
1013 Ga0070665_101315359
1014 Ga0068855_100130261
1015 Ga0068855_100561664
1016 Ga0068855_100581467
1017 Ga0068857_100688599
1018 Ga0068857_101533826
1019 Ga0068854_100114530
1020 Ga0068854_101178590
1021 Ga0068854_101207072
1022 Ga0068856_101389606
1023 Ga0068852_100929038
1024 Ga0068859_100274360
1025 Ga0068864_100522190
1026 Ga0068861_100446862
1027 Ga0068861_100677409
1028 Ga0068851_10490113
1029 Ga0068870_10696113
1030 Ga0068858_100019766
1031 Ga0068858_100651234
1032 Ga0068860_100117529
1033 Ga0068860_100833429
1034 Ga0068862_100082320
1035 Ga0068862_100466003
1036 Ga0081455_10111394
1037 Ga0081540_1009414
1038 Ga0081540_1122153
1039 Ga0081539_10116863
1040 Ga0075365_10004909
1041 Ga0075365_10212124
1042 Ga0075365_10312281
1043 Ga0075365_10376327
1044 Ga0075365_10475705
1045 Ga0075365_10490596
1046 Ga0075368_10009852
1047 Ga0075363_100066012
1048 Ga0075363_100391799
1049 Ga0070716_100498477
1050 Ga0070716_101072700
1051 Ga0075362_10174607
1052 Ga0075367_10200715
1053 Ga0075367_10285157
1054 Ga0075367_10431730
1055 Ga0075367_10800150
1056 Ga0075369_10046818
1057 Ga0075369_10089667
1058 Ga0075369_10234572
1059 Ga0075369_10248506
1060 Ga0075366_10054483
1061 Ga0075366_10129226
1062 Ga0097621_100185234
1063 Ga0075370_10025245
1064 Ga0075370_10087775
1065 Ga0075370_10293177
1066 Ga0068871_100484538
1067 Ga0075428_100726104
1068 Ga0075433_10558643
1069 Ga0068865_100129069
1070 Ga0068865_100244991
1071 Ga0097620_100274385
1072 Ga0099825_1031176
1073 Ga0099824_1008180
1074 Ga0099822_1007748
1075 Ga0099794_10140562
1076 Ga0099794_10143834
1077 Ga0099795_10002081
1078 Ga0105251_10167637
1079 Ga0105250_10249197
1080 Ga0105240_10253199
1081 Ga0105240_10417495
1082 Ga0111539_10540028
1083 Ga0105245_10334722
1084 Ga0105245_12066973
1085 Ga0105247_10103210
1086 Ga0105247_11005351
1087 Ga0114129_10280582
1088 Ga0105243_10194627
1089 Ga0105243_10519182
1090 Ga0105241_10764808
1091 Ga0105242_10790070
1092 Ga0105242_12680119
1093 Ga0105248_10338625
1094 Ga0105237_10111695
1095 Ga0105237_10202856
1096 Ga0105237_10797436
1097 Ga0105237_11222084
1098 Ga0105238_10284054
1099 Ga0105238_11692295
1100 Ga0105249_10078552
1101 Ga0105249_10106029
1102 Ga0105239_10090333
1103 Ga0105239_10147459
1104 Ga0105239_10160940
1105 Ga0105239_10410092
1106 Ga0105239_11298057
1107 Ga0105246_10158158
1108 Ga0105246_10759406
1109 Ga0157371_10000184
1110 Ga0157369_10351591
1111 Ga0157369_11898523
1112 Ga0157369_12463211
1113 Ga0157374_10128814
1114 Ga0157374_11270585
1115 Ga0157374_12941354
1116 Ga0157378_10724241
1117 Ga0163162_10320864
1118 Ga0163162_11370149
1119 Ga0157372_10050925
1120 Ga0157375_10097308
1121 Ga0157375_10218635
1122 Ga0163163_10035663
1123 Ga0163163_10152711
1124 Ga0163163_10526608
1125 Ga0163163_10934995
1126 Ga0157380_10070658
1127 Ga0157380_10880409
1128 Ga0157377_10040864
1129 Ga0157379_10118097
1130 Ga0157379_10149332
1131 Ga0157379_10599791
1132 Ga0157376_10232216
1133 Ga0157376_11075119
1134 Ga0157376_12065200
1135 Ga0157376_12563918
1136 Ga0182007_10000118
1137 Ga0182007_10062383
1138 Ga0182005_1001582
1139 Ga0163161_10246983
1140 Ga0206354_11366296
1141 Ga0214544_1000005
1142 Ga0214544_1022677
1143 Ga0214542_1000004
1144 Ga0214542_1023102
1145 Ga0214545_1000005
1146 Ga0214545_1009267
1147 Ga0214543_1000564
1148 Ga0213876_10114300
1149 Ga0209563_102533
1150 Ga0207425_1042389
1151 Ga0209677_102004
1152 Ga0209233_1003650
1153 Ga0209233_1007099
1154 Ga0209564_1002546
1155 Ga0209564_1075637
1156 Ga0209758_1000102
1157 Ga0209758_1000732
1158 Ga0209758_1007121
1159 Ga0209758_1032231
1160 Ga0209758_1035036
1161 Ga0209256_1002569
1162 Ga0207426_1000354
1163 Ga0207426_1000521
1164 Ga0207426_1006804
1165 Ga0207426_1052495
1166 Ga0207426_1064696
1167 Ga0207426_1124615
1168 Ga0209257_1001340
1169 Ga0209257_1061183
1170 Ga0209257_1071267
1171 Ga0207642_10008965
1172 Ga0207710_10568499
1173 Ga0207680_10192318
1174 Ga0207647_10042612
1175 Ga0207647_10134448
1176 Ga0207647_10236192
1177 Ga0207643_10230041
1178 Ga0207705_11036669
1179 Ga0207695_10146979
1180 Ga0207671_10188419
1181 Ga0207671_10641437
1182 Ga0207693_10408774
1183 Ga0207660_11361187
1184 Ga0207662_10134953
1185 Ga0207657_10026225
1186 Ga0207649_10265643
1187 Ga0207652_10296076
1188 Ga0207681_10056779
1189 Ga0207659_11008901
1190 Ga0207687_10071553
1191 Ga0207687_10246205
1192 Ga0207644_10695889
1193 Ga0207690_10139348
1194 Ga0207690_10623790
1195 Ga0207690_11305297
1196 Ga0207686_10251020
1197 Ga0207709_11015803
1198 Ga0207670_10220850
1199 Ga0207670_10825705
1200 Ga0207669_10021601
1201 Ga0207669_10577113
1202 Ga0207704_10043474
1203 Ga0207691_10010566
1204 Ga0207691_10255192
1205 Ga0207711_10165318
1206 Ga0207711_10308320
1207 Ga0207689_10039867
1208 Ga0207689_10040824
1209 Ga0207679_10105836
1210 Ga0207667_10618348
1211 Ga0207667_10734922
1212 Ga0207667_11201237
1213 Ga0207712_10030264
1214 Ga0207712_11170178
1215 Ga0207668_10050476
1216 Ga0207668_10133081
1217 Ga0207668_10307580
1218 Ga0207668_10514808
1219 Ga0207640_10047096
1220 Ga0207640_11080047
1221 Ga0207658_10152028
1222 Ga0207658_10302702
1223 Ga0207677_10372206
1224 Ga0207677_10449758
1225 Ga0207677_10794330
1226 Ga0207677_11274160
1227 Ga0207639_10125429
1228 Ga0207639_11265674
1229 Ga0207678_10012243
1230 Ga0207678_10023843
1231 Ga0207678_10043610
1232 Ga0207678_10102652
1233 Ga0207678_10192978
1234 Ga0207708_10108395
1235 Ga0207702_10638366
1236 Ga0207648_10198231
1237 Ga0207674_10306534
1238 Ga0207674_10494583
1239 Ga0207675_100012334
1240 Ga0207675_100151132
1241 Ga0207675_100829118
1242 Ga0207683_10132242
1243 Ga0207698_10271894
1244 Ga0209589_1000005
1245 Ga0209489_100005
1246 Ga0209700_100006
1247 Ga0209179_1023854
1248 Ga0209588_1024496
1249 Ga0209588_1044547
1250 Ga0209813_10316700
1251 Ga0268266_10026503
1252 Ga0268266_10040203
1253 Ga0268266_10261067
1254 Ga0268266_10445284
1255 Ga0268266_10553456
1256 Ga0268266_11197286
1257 Ga0268266_11409610
1258 Ga0268265_10045461
1259 Ga0268265_10102665
1260 Ga0268265_10240892
1261 Ga0268264_10211588
1262 Ga0268264_10238457
1263 Ga0265332_10001304
1264 Ga0265329_10037913
1265 Ga0265340_10002000
1266 Ga0265339_10006161
1267 Ga0265316_10248708
1268 Ga0307513_10872177
1269 Ga0307509_10090561
1270 Ga0265342_10000073
1271 Ga0307516_10025773
1272 Ga0307405_10993564
1273 Ga0307410_10827495
1274 Ga0307407_10242705
1275 Ga0307412_10652277
1276 Ga0307409_100350078
1277 Ga0307416_101453976
1278 Ga0307411_11102674
1279 Ga0307415_100383708
1280 Ga0307415_100654486
1281 Ga0307510_10023919
1282 Ga0307510_10067959
1283 Ga0307510_10139074
1284 Ga0307510_10157739
1285 Ga0315911_1000040
1286 Ga0373930_0155516
1287 Ga0373929_0132019
1288 Ga0373952_0202294
1289 Ga0373936_0194830
1290 Ga0373962_0078350
1291 Ga0373925_0384532
1292 Ga0395905_0660155
1293 Ga0395905_1190321
1294 Ga0436364_0286794
1295 Ga0436364_1437107
1296 Ga0436365_0123231
1297 Ga0436365_0771653
1298 Ga0436365_1802818
1299 Ga0436363_0215083
1300 Ga0436363_0606788
1301 Ga0439465_0189215
1302 Ga0439431_0223984
1303 Ga0439445_0026177
1304 Ga0439432_167826
1305 Ga0466960_0040022
1306 Ga0495592_0243303
1307 Ga0495603_0028125
1308 Ga0495603_0087926
1309 Ga0495629_0067947
1310 Ga0495629_0429022
1311 Ga0495638_0417272
1312 Ga0495641_0099296
1313 Ga0495653_0361702
1314 Ga0495650_0069961
1315 Ga0495580_0088328
1316 Ga0495582_0121112
1317 Ga0495605_0272841
1318 Ga0495584_0082921
1319 Ga0495584_0131427
1320 Ga0495585_0111977
1321 Ga0495585_0131867
1322 Ga0495606_0000939
1323 Ga0495606_0008450
1324 Ga0495606_0350788
1325 Ga0495616_0131047
1326 Ga0495616_0316529
1327 Ga0495616_0366064
1328 Ga0495618_0067230
1329 Ga0495630_0456700
1330 Ga0495632_0135139
1331 Ga0495637_0082427
1332 Ga0495643_0029221
1333 Ga0495643_0158217
1334 Ga0495643_0229773
1335 Ga0495644_0093900
1336 Ga0495648_0000271
1337 Ga0495648_0005941
1338 Ga0495648_0151924
1339 Ga0495648_0338271
1340 Ga0495654_0076848
1341 Ga0495587_0098470
1342 Ga0495598_0080813
1343 Ga0495609_0160462
1344 Ga0495609_0183564
1345 Ga0495622_0039382
1346 Ga0495622_0049284
1347 Ga0495622_0059118
1348 Ga0495633_0101022
1349 Ga0495656_0020082
1350 Ga0495656_0070454
1351 Ga0495656_0374222
1352 Ga0495668_0258735
1353 Ga0495668_0269002
1354 Ga0495668_0471707
1355 Ga0495635_0020566
1356 Ga0495588_0059750
1357 Ga0495588_0098644
1358 Ga0495588_0183043
1359 Ga0495658_0362389
1360 Ga0495669_0037799
1361 Ga0495669_0046687
1362 Ga0495669_0070108
1363 Ga0495624_0308467
1364 Ga0495670_0073796
1365 Ga0495671_0113371
1366 Ga0495671_0153483
1367 Ga0495671_0161386
1368 Ga0495649_0094884
1369 Ga0495649_0186351
1370 Ga0495589_0037945
1371 Ga0495589_0062089
1372 Ga0495589_0337772
1373 Ga0495660_0130063
1374 Ga0495660_0210772
1375 Ga0495581_0251339
1376 Ga0495581_0351320
1377 Ga0495604_0160590
1378 Ga0495636_0023477
1379 Ga0495672_0017130
1380 Ga0495676_0113199
1381 Ga0495676_0278936
1382 Ga0495683_0115493
1383 Ga0495687_035818
1384 Ga0495687_252866
1385 Ga0495686_0153572
1386 Ga0495593_0087468
1387 Ga0495602_0132758
1388 Ga0495626_0211615
1389 Ga0495626_0362297
1390 Ga0496100_0038770
1391 Ga0496100_0320948
1392 Ga0496100_0892219
1393 Ga0496101_0133980
1394 Ga0496101_1086493
1395 Ga0496102_0172696
1396 Ga0496102_0204824
1397 Ga0496102_0246584
1398 Ga0496102_0251176
1399 Ga0496102_0442268
1400 Ga0496102_0757732
1401 Ga0496103_0057382
1402 Ga0496104_0299755
1403 Ga0496104_0360340
1404 Ga0496104_0572100
1405 Ga0496104_0810167
1406 Ga0496104_1280587
1407 Ga0496105_0005469
1408 Ga0496105_0023572
1409 Ga0496105_0025196
1410 Ga0496105_0246611
1411 Ga0496105_0547800
1412 Ga0496106_0102031
1413 Ga0496106_0299052
1414 Ga0496106_0317189
1415 Ga0496107_0036476
1416 Ga0496108_0446113
1417 Ga0496109_0176961
1418 Ga0496110_0791609
1419 Ga0496111_0046108
1420 Ga0496111_0153420
1421 Ga0496112_0000014
1422 Ga0496112_0245225
1423 Ga0496112_1307928
1424 Ga0496113_0126186
1425 Ga0496113_1349693
1426 Ga0496114_0028579
1427 Ga0496114_0093243
1428 Ga0496115_0091091
1429 Ga0496115_0306054
1430 Ga0496115_0600584
1431 Ga0496115_0834200
1432 Ga0496116_0008246
1433 Ga0496116_0014519
1434 Ga0496116_0439100
1435 Ga0496117_0111923
1436 Ga0496117_0113925
1437 Ga0496117_0126550
1438 Ga0496118_0046487
1439 Ga0496118_0063623
1440 Ga0496118_0070590
1441 Ga0496118_0106787
1442 Ga0496118_0145235
1443 Ga0496118_0229940
1444 Ga0496119_0000069
1445 Ga0496119_0086055
1446 Ga0496119_0089539
1447 Ga0496119_0165608
1448 Ga0496119_0181956
1449 Ga0496120_0002382
1450 Ga0496120_0073803
1451 Ga0496120_0173065
1452 Ga0496120_0202622
1453 Ga0496120_0474878
1454 Ga0496121_0000379
1455 Ga0496121_0019688
1456 Ga0496121_0035041
1457 Ga0496121_0047920
1458 Ga0496121_0059912
1459 Ga0496121_0061366
1460 Ga0496121_0093436
1461 Ga0496121_0122240
1462 Ga0496121_0155588
1463 Ga0496121_0288820
1464 Ga0496121_0495398
1465 Ga0496121_0540047
1466 Ga0496121_0614081
1467 Ga0496122_0005549
1468 Ga0496122_0109431
1469 Ga0496122_0416111
1470 Ga0496123_0021257
1471 Ga0496123_0154263
1472 Ga0496124_0009372
1473 Ga0496124_0012706
1474 Ga0496124_0481296
1475 Ga0496124_0590010
1476 Ga0496125_0008597
1477 Ga0496125_0009153
1478 Ga0496125_0012472
1479 Ga0496125_0036175
1480 Ga0496125_0102728
1481 Ga0496126_0000913
1482 Ga0496126_0017311
1483 Ga0496126_0049396
1484 Ga0496126_0064157
1485 Ga0496126_0321567
1486 Ga0496126_0470591
1487 Ga0496126_0565510
1488 Ga0496126_0568571
1489 Ga0496126_0639830
1490 Ga0501031_0001811
1491 Ga0501031_0074268
1492 Ga0501031_0097128
1493 Ga0501032_0000048
1494 Ga0501032_0128676
1495 Ga0501033_0000184
1496 Ga0501033_0087608
1497 Ga0501033_0143671
1498 Ga0501033_0396335
1499 Ga0501034_0000082
1500 Ga0501034_0430770
1501 Ga0501034_0521067
1502 Ga0501036_0014120
1503 Ga0501036_0407817
1504 Ga0501036_0766379
1505 Ga0501037_0000346
1506 Ga0501037_0130060
1507 Ga0501038_0003296
1508 Ga0501038_0037116
1509 Ga0501038_0415620
1510 Ga0501039_0000082
1511 Ga0501039_0066837
1512 Ga0501042_0040061
1513 Ga0501043_0000148
1514 Ga0501043_0033766
1515 Ga0501043_0838675
1516 Ga0501046_0000101
1517 Ga0501046_0025876
1518 Ga0501047_0000671
1519 Ga0501047_0091118
1520 Ga0501047_0128664
1521 Ga0501047_0398805
1522 Ga0501047_0557030
1523 Ga0501047_1030180
1524 Ga0501048_0000681
1525 Ga0501048_0180880
1526 Ga0501067_0000408
1527 Ga0501067_0227228
1528 Ga0501067_0590956
1529 Ga0501068_0056020
1530 Ga0501068_0260783
1531 Ga0501068_0263984
1532 Ga0501068_0305993
1533 Ga0501069_0004676
1534 Ga0501069_0362564
1535 Ga0501070_0044093
1536 Ga0501070_0209404
1537 Ga0501071_0002034
1538 Ga0501071_0230366
1539 Ga0501072_0001931
1540 Ga0501072_0135959
1541 Ga0501072_0366826
1542 Ga0501072_1344376
1543 Ga0501073_0000101
1544 Ga0501074_0000331
1545 Ga0501074_0052268
1546 Ga0501074_0598887
1547 Ga0501075_0957223
1548 Ga0501076_0991115
1549 Ga0501079_0192832
1550 Ga0501079_0568684
1551 Ga0501080_0019088
1552 Ga0501080_0110215
1553 Ga0501081_0514398
1554 Ga0501083_0001659
1555 Ga0501083_0130954
1556 Ga0501262_047281
1557 Ga0501035_0001078
1558 Ga0501035_0096947
1559 Ga0501035_0211597
1560 Ga0501035_0518400
1561 Ga0501044_0000408
1562 Ga0501044_0069795
1563 Ga0501044_0123283
1564 Ga0501044_0169227
1565 Ga0501044_1035810
1566 Ga0501045_0651943
1567 nmdc:mga03683_66528_c1
1568 nmdc:mga03n38_101851_c1
1569 nmdc:mga03n38_400222_c1
1570 nmdc:mga03n38_851729_c1
1571 nmdc:mga00v17_44597_c1
1572 nmdc:mga0yw44_148912_c1
1573 nmdc:mga0yw44_21848_c1
1574 nmdc:mga0yw44_276630_c1
1575 nmdc:mga0yw44_47274_c1
1576 nmdc:mga0yw44_70660_c1
1577 nmdc:mga0yw44_74941_c1
1578 nmdc:mga0k408_133875_c1
1579 nmdc:mga0k408_361529_c1
1580 nmdc:mga06z11_170384_c1
1581 nmdc:mga06z11_200547_c1
1582 nmdc:mga06z11_7829_c1
1583 nmdc:mga06z11_9566_c1
1584 nmdc:mga04h51_210678_c1
1585 nmdc:mga04h51_351147_c1
1586 nmdc:mga04h51_65565_c1
1587 nmdc:mga07m45_100728_c1
1588 nmdc:mga07m45_171339_c1
1589 nmdc:mga07m45_38886_c1
1590 nmdc:mga07m45_566237_c1
1591 nmdc:mga05p37_181260_c1
1592 nmdc:mga0qj67_1232577_c1
1593 nmdc:mga08y16_479776_c1
1594 nmdc:mga0a205_612535_c1
1595 nmdc:mga0sz30_26334_c1
1596 nmdc:mga0sz30_265943_c1
1597 nmdc:mga0sz30_57004_c1
1598 nmdc:mga0sz30_61711_c1
1599 nmdc:mga0sz30_82654_c1
1600 Ga0500635_0003093
1601 Ga0500635_0121533
1602 Ga0495655_0044928
1603 Ga0500643_000016
1604 Ga0500647_0046980
1605 Ga0500583_0029660
1606 Ga0500651_0240265
1607 Ga0500651_0462487
1608 Ga0500566_0000378
1609 Ga0500566_0058173
1610 Ga0500566_0114133
1611 Ga0500566_0238204
1612 Ga0500641_0060742
1613 Ga0500641_0098879
1614 Ga0500641_0109938
1615 Ga0500650_0231405
1616 Ga0500650_0353755
1617 Ga0500554_007747
1618 Ga0500555_136336
1619 Ga0500556_0123771
1620 Ga0500557_000058
1621 Ga0500562_031931
1622 Ga0500572_005223
1623 Ga0500593_041901
1624 Ga0500595_001183
1625 Ga0500595_004333
1626 Ga0500595_012166
1627 Ga0500595_014368
1628 Ga0500595_021264
1629 Ga0500595_119627
1630 Ga0500607_019531
1631 Ga0500608_159555
1632 Ga0500617_101301
1633 Ga0500618_055109
1634 Ga0500642_0000151
1635 Ga0500642_0008388
1636 Ga0500655_009905
1637 Ga0500559_0100311
1638 Ga0500559_0281112
1639 Ga0500568_0395808
1640 Ga0500588_0067457
1641 Ga0500589_057182
1642 Ga0500590_141806
1643 Ga0500603_000226
1644 Ga0500603_080523
1645 Ga0500603_181454
1646 Ga0500616_0000046
1647 Ga0500616_0089214
1648 Ga0500619_028128
1649 Ga0500620_001318
1650 Ga0500622_0007477
1651 Ga0500638_024084
1652 Ga0500636_0000146
1653 Ga0500636_0171060
1654 Ga0500637_0000138
1655 Ga0500637_0005369
1656 Ga0500570_165046
1657 Ga0500625_028036
1658 Ga0500645_016504
1659 Ga0500645_070573
1660 Ga0500645_115072
1661 Ga0500609_018880
1662 Ga0500656_032165
1663 Ga0500599_007311
1664 Ga0500601_001089
1665 Ga0501084_0019286
1666 Ga0501084_0184366
1667 Ga0500661_000130
1668 Ga0501082_0001007
1669 Ga0501082_0002356
1670 Ga0501082_0291175
1671 Ga0501082_0407689
1672 2509394086
1673 2510318225
1674 2511398275
1675 2512961579
1676 2513624125
1677 2513648508
1678 2513656116
1679 2513859012
1680 2513874982
1681 2513920875
1682 2514013950
1683 2514036863
1684 2517101138
1685 2517895937
1686 2524439920
1687 2528854016
1688 2617348454
1689 2617374998
1690 2671122728
1691 2728752368
1692 2745075798
1693 2793061642
1694 2793069637
1695 2805916427
1696 2818240091
1697 2824608125
1698 2824615717
1699 2824626326
1700 2824632110
1701 2824643499
1702 2824652974
1703 2824665443
1704 2824678408
1705 2824687260
1706 2824694852
1707 2824702805
1708 2824709846
1709 2824732820
1710 2824740162
1711 2824752966
1712 2824759987
1713 2824769391
1714 2824778987
1715 2838129901
1716 2841946941
1717 2841955128
1718 2841961552
1719 2841970085
1720 2841977271
1721 2841990315
1722 2842042313
1723 2842050356
1724 2844011254
1725 2847673870
1726 2847943876
1727 2849081899
1728 2856320479
1729 2856328427
1730 2856363521
1731 2857513613
1732 2869176958
1733 2869237839
1734 2869247466
1735 2869257159
1736 2869274489
1737 2871483675
1738 2871494836
1739 2874114513
1740 2874118648
1741 2874165475
1742 2874615343
1743 2874633690
1744 2876386392
1745 2876402223
1746 2876409964
1747 2876422156
1748 2876765509
1749 2878038894
1750 2878734737
1751 2878759961
1752 2878774320
1753 2878783423
1754 2879100845
1755 2881165408
1756 2881367298
1757 2881851949
1758 2885373741
1759 2888337108
1760 2888386957
1761 2888389651
1762 2888421445
1763 2894821133
1764 2903494195
1765 2903518503
1766 2904699087
1767 2904719542
1768 2906402708
1769 2906409994
1770 2906421258
1771 2906435284
1772 2906615598
1773 2906626748
1774 2906636484
1775 2906665030
1776 2908745583
1777 2908763569
1778 2908777480
1779 2922153033
1780 2922172767
1781 2922181038
1782 2922377087
1783 2922398234
1784 2922432409
1785 2924715130
1786 2924734389
1787 2924744553
1788 2924753759
1789 2929619087
1790 2929628418
1791 2932791342
1792 2932814800
1793 2932823657
1794 2932833089
1795 2933581009
1796 2935612276
1797 2935623818
1798 2935639593
1799 2935670536
1800 2935679966
1801 2935687535
1802 2935696496
1803 2935705309
1804 2935718995
1805 2935728647
1806 2935736757
1807 2935746241
1808 2935753501
1809 2935767695
1810 2935807054
1811 2935814031
1812 2935823765
1813 2935829075
1814 2935845390
1815 2935854403
1816 2935861957
1817 2935872793
1818 2935880368
1819 2935913503
1820 2935923400
1821 2935931180
1822 2935935462
1823 2935947028
1824 2935953877
1825 2935961485
1826 2935968903
1827 2935994978
1828 2936006071
1829 2936039586
1830 2937852276
1831 2937862187
1832 2937982362
1833 2940559414
1834 2941545639
1835 2958068562
1836 2958109709
1837 2958144268
1838 2961138302
1839 2961177233
1840 2961186869
1841 2965030961
1842 2965053272
1843 2965108842
1844 2965111678
1845 2968002335
1846 2968009567
1847 2968139835
1848 2970494488
1849 2970509907
1850 2970517813
1851 2970534238
1852 2970552365
1853 2970625827
1854 2970633440
1855 2977828483
1856 2977835566
1857 2977857680
1858 2977900139
1859 2977914205
1860 2977941813
1861 2979764968
1862 2979776632
1863 2979814783
1864 2987651532
1865 2987677684
1866 2996389536
1867 3004239848
1868 3004248328
1869 3004269117
1870 3005476630
1871 3005487677
1872 3005511172
1873 3005592023
1874 8004304567
1875 8004321078
1876 8004381460
1877 8004728981
1878 8005661784
1879 8006934851
1880 8006974819
1881 8006991280
1882 8016516951
1883 8016588606
1884 8017059620
1885 8019563804
1886 8019573870
1887 8019579092
1888 8019597147
1889 8019604543
1890 8019613986
1891 8055433146
1892 8055618354
1893 8055749655
1894 8056675096
1895 8056684641
1896 8056696226

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

22

140

0.97

Map