F486385

General Info

Members Datasets Scaffolds Average Seq Length
943 336 1886 214

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10319221|Ga0163163_103192211
Length 237
Sequence MCREELGHGCIDTPLVVRAHEAMAGVLEGLIDRPARKPERHSEDPGPRAAVIFAHPHPLRGGTMHTKAVYQGAKGLTRIGCAVLRFNFRGVGASTGTFDGDGGELDDFRAAVAFMTSEYPGVALWGAGFSFGSWVALEGGAADPRVSLLVGIAPPVARKEYRFEHILQSTKAKFFVQGSLDESCRLKDLRAFYAALPEPKELVVIDGADHLFSGRAAEVGEALEDLLADFTPDRRPE

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
205 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
210 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
211 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
302 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
303 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 0
Rhizoplane 4.14
Rhizosphere 92.58
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10319221 3300014325 Bacteria 1607
2 SwRhRL2b_contig_224687 2162886007 Bacteria 1826
3 Ga0065712_10005799 3300005290 Bacteria 3353
4 Ga0065712_10068319 3300005290 Bacteria 11734
5 Ga0065712_10118391 3300005290 Bacteria 1662
6 Ga0065712_10187218 3300005290 Bacteria 1164
7 Ga0065712_10196253 3300005290 Bacteria 1127
8 Ga0065715_10048060 3300005293 Bacteria 1020
9 Ga0065715_10091005 3300005293 Bacteria 6223
10 Ga0065715_10112461 3300005293 Bacteria 2528
11 Ga0065715_10169870 3300005293 Bacteria 1555
12 Ga0065707_10027061 3300005295 Bacteria 1323
13 Ga0065707_10116631 3300005295 Bacteria 2232
14 Ga0065707_10135568 3300005295 Bacteria 1847
15 Ga0070658_10929916 3300005327 Bacteria 756
16 Ga0070676_10042666 3300005328 Bacteria 2635
17 Ga0070683_100039007 3300005329 Bacteria 4357
18 Ga0070683_100190149 3300005329 Bacteria 1949
19 Ga0070683_100266043 3300005329 Bacteria 1631
20 Ga0070690_100341334 3300005330 Bacteria 1085
21 Ga0070690_100392007 3300005330 Bacteria 1018
22 Ga0070670_100003559 3300005331 Bacteria 12957
23 Ga0070670_100039899 3300005331 Bacteria 4037
24 Ga0070670_100127671 3300005331 Bacteria 2195
25 Ga0070670_100294649 3300005331 Bacteria 1418
26 Ga0068869_100289110 3300005334 Unclassified 1320
27 Ga0068869_100513927 3300005334 Bacteria 1002
28 Ga0070666_10146510 3300005335 Unclassified 1646
29 Ga0070666_10197926 3300005335 Bacteria 1413
30 Ga0068868_100360888 3300005338 Bacteria 1246
31 Ga0068868_100592970 3300005338 Bacteria 981
32 Ga0070660_100328920 3300005339 Unclassified 1256
33 Ga0070660_100634773 3300005339 Bacteria 894
34 Ga0070689_100023741 3300005340 Bacteria 4595
35 Ga0070689_100036732 3300005340 Bacteria 3746
36 Ga0070689_100189876 3300005340 Bacteria 1673
37 Ga0070689_100253086 3300005340 Unclassified 1454
38 Ga0070689_100292466 3300005340 Unclassified 1354
39 Ga0070687_100023806 3300005343 Bacteria 2914
40 Ga0070687_100065347 3300005343 Unclassified 1935
41 Ga0070687_100085327 3300005343 Bacteria 1733
42 Ga0070661_100124975 3300005344 Bacteria 1929
43 Ga0070661_100153146 3300005344 Unclassified 1744
44 Ga0070661_100480425 3300005344 Bacteria 992
45 Ga0070692_10050502 3300005345 Bacteria 2160
46 Ga0070692_10408475 3300005345 Unclassified 859
47 Ga0070668_100566735 3300005347 Bacteria 990
48 Ga0070669_100001192 3300005353 Bacteria 18941
49 Ga0070669_100196298 3300005353 Bacteria 1586
50 Ga0070669_100206724 3300005353 Bacteria 1547
51 Ga0070675_100004767 3300005354 Bacteria 10347
52 Ga0070675_100018751 3300005354 Bacteria 5508
53 Ga0070675_100025211 3300005354 Bacteria 4767
54 Ga0070675_100039446 3300005354 Bacteria 3854
55 Ga0070675_100052892 3300005354 Bacteria 3339
56 Ga0070675_100099182 3300005354 Unclassified 2451
57 Ga0070675_100130269 3300005354 Bacteria 2143
58 Ga0070671_100008027 3300005355 Bacteria 8448
59 Ga0070671_100135310 3300005355 Bacteria 2078
60 Ga0070671_100282759 3300005355 Unclassified 1411
61 Ga0070671_100283934 3300005355 Bacteria 1408
62 Ga0070674_100076974 3300005356 Bacteria 2374
63 Ga0070674_100246609 3300005356 Bacteria 1401
64 Ga0070674_100265243 3300005356 Bacteria 1355
65 Ga0070673_100354464 3300005364 Bacteria 1303
66 Ga0070673_100568735 3300005364 Bacteria 1031
67 Ga0070688_100003358 3300005365 Bacteria 8213
68 Ga0070688_100021295 3300005365 Bacteria 3786
69 Ga0070688_100068815 3300005365 Bacteria 2258
70 Ga0070688_100108829 3300005365 Bacteria 1839
71 Ga0070688_100188615 3300005365 Bacteria 1435
72 Ga0070688_100222047 3300005365 Bacteria 1332
73 Ga0070688_100337295 3300005365 Bacteria 1100
74 Ga0070688_100646342 3300005365 Bacteria 814
75 Ga0070659_100133780 3300005366 Bacteria 2015
76 Ga0070659_100826626 3300005366 Bacteria 807
77 Ga0070667_100288589 3300005367 Bacteria 1475
78 Ga0070667_100356171 3300005367 Bacteria 1326
79 Ga0070703_10072328 3300005406 Bacteria 1155
80 Ga0070714_100060282 3300005435 Bacteria 3256
81 Ga0070713_100016638 3300005436 Bacteria 5533
82 Ga0070713_100035741 3300005436 Bacteria 4003
83 Ga0070713_100049239 3300005436 Bacteria 3475
84 Ga0070710_10215009 3300005437 Bacteria 1220
85 Ga0070701_10003212 3300005438 Bacteria 6436
86 Ga0070701_10009769 3300005438 Bacteria 4215
87 Ga0070701_10135199 3300005438 Bacteria 1404
88 Ga0070711_100272823 3300005439 Bacteria 1335
89 Ga0070705_100001554 3300005440 Bacteria 12031
90 Ga0070705_100056157 3300005440 Bacteria 2317
91 Ga0070705_100137619 3300005440 Bacteria 1603
92 Ga0070705_100287578 3300005440 Bacteria 1172
93 Ga0070705_100311013 3300005440 Bacteria 1133
94 Ga0070705_100431267 3300005440 Bacteria 984
95 Ga0070700_100279054 3300005441 Bacteria 1211
96 Ga0070694_100001263 3300005444 Bacteria 14687
97 Ga0070694_100007236 3300005444 Bacteria 6759
98 Ga0070694_100027390 3300005444 Bacteria 3701
99 Ga0070694_100206827 3300005444 Bacteria 1466
100 Ga0070694_100308907 3300005444 Bacteria 1214
101 Ga0070708_100303276 3300005445 Bacteria 1504
102 Ga0070708_100499868 3300005445 Bacteria 1147
103 Ga0070678_100009889 3300005456 Bacteria 5797
104 Ga0070678_100199692 3300005456 Bacteria 1650
105 Ga0070662_100053625 3300005457 Bacteria 2919
106 Ga0070662_100094078 3300005457 Bacteria 2256
107 Ga0070662_100186977 3300005457 Bacteria 1636
108 Ga0070681_10061568 3300005458 Bacteria 3726
109 Ga0070681_10061685 3300005458 Bacteria 3723
110 Ga0070681_10425882 3300005458 Bacteria 1239
111 Ga0068867_100008016 3300005459 Bacteria 7464
112 Ga0068867_100025755 3300005459 Bacteria 4221
113 Ga0068867_100380655 3300005459 Unclassified 1185
114 Ga0070685_10362560 3300005466 Bacteria 994
115 Ga0070685_10460187 3300005466 Unclassified 893
116 Ga0070706_100216068 3300005467 Bacteria 1790
117 Ga0070706_100448936 3300005467 Bacteria 1200
118 Ga0070707_100019482 3300005468 Bacteria 6392
119 Ga0070707_100134012 3300005468 Bacteria 2410
120 Ga0070707_100773280 3300005468 Bacteria 924
121 Ga0070698_100006494 3300005471 Bacteria 12684
122 Ga0070698_100065906 3300005471 Bacteria 3646
123 Ga0070698_100715412 3300005471 Bacteria 944
124 Ga0070698_101084913 3300005471 Bacteria 749
125 Ga0070699_100004881 3300005518 Bacteria 11831
126 Ga0070699_100017419 3300005518 Bacteria 6166
127 Ga0070699_100124525 3300005518 Bacteria 2268
128 Ga0070679_100309434 3300005530 Bacteria 1530
129 Ga0070684_100049817 3300005535 Bacteria 3637
130 Ga0070684_100362021 3300005535 Unclassified 1335
131 Ga0070697_100099942 3300005536 Bacteria 2409
132 Ga0068853_100471334 3300005539 Bacteria 1183
133 Ga0070672_100009511 3300005543 Bacteria 6706
134 Ga0070672_100054107 3300005543 Bacteria 3141
135 Ga0070672_100138442 3300005543 Bacteria 2006
136 Ga0070672_100167482 3300005543 Bacteria 1826
137 Ga0070672_100211586 3300005543 Bacteria 1624
138 Ga0070686_100015831 3300005544 Bacteria 4377
139 Ga0070686_100050173 3300005544 Bacteria 2651
140 Ga0070686_100063048 3300005544 Bacteria 2400
141 Ga0070686_100077071 3300005544 Unclassified 2197
142 Ga0070686_100087763 3300005544 Bacteria 2074
143 Ga0070686_100393654 3300005544 Bacteria 1052
144 Ga0070686_100723474 3300005544 Bacteria 796
145 Ga0070695_100000155 3300005545 Bacteria 32258
146 Ga0070695_100044069 3300005545 Bacteria 2839
147 Ga0070695_100107179 3300005545 Bacteria 1890
148 Ga0070696_100001294 3300005546 Bacteria 16298
149 Ga0070696_100005218 3300005546 Bacteria 8684
150 Ga0070696_100191885 3300005546 Bacteria 1521
151 Ga0070696_100293452 3300005546 Bacteria 1243
152 Ga0070693_100028292 3300005547 Bacteria 3046
153 Ga0070665_100042506 3300005548 Bacteria 4568
154 Ga0070704_100001112 3300005549 Bacteria 13983
155 Ga0070704_100008387 3300005549 Bacteria 6194
156 Ga0070704_100024108 3300005549 Bacteria 3987
157 Ga0070704_100031640 3300005549 Bacteria 3562
158 Ga0070704_100066963 3300005549 Bacteria 2592
159 Ga0068855_100035013 3300005563 Bacteria 5984
160 Ga0070664_100020599 3300005564 Bacteria 5431
161 Ga0070664_100103208 3300005564 Bacteria 2482
162 Ga0070664_100214249 3300005564 Bacteria 1721
163 Ga0070664_100301652 3300005564 Bacteria 1448
164 Ga0070664_100349960 3300005564 Bacteria 1344
165 Ga0070664_100952105 3300005564 Bacteria 806
166 Ga0068857_100017945 3300005577 Bacteria 6206
167 Ga0068857_100062740 3300005577 Bacteria 3304
168 Ga0068857_100512689 3300005577 Bacteria 1126
169 Ga0068854_100046162 3300005578 Unclassified 3101
170 Ga0068854_100664281 3300005578 Bacteria 896
171 Ga0070702_100015756 3300005615 Bacteria 3865
172 Ga0070702_100025236 3300005615 Bacteria 3182
173 Ga0070702_100088811 3300005615 Bacteria 1869
174 Ga0068852_100149818 3300005616 Bacteria 2168
175 Ga0068852_100168337 3300005616 Bacteria 2052
176 Ga0068852_100553603 3300005616 Bacteria 1151
177 Ga0068859_100012705 3300005617 Bacteria 8464
178 Ga0068859_100016091 3300005617 Bacteria 7514
179 Ga0068859_100034153 3300005617 Bacteria 5105
180 Ga0068859_100036299 3300005617 Bacteria 4948
181 Ga0068859_100125215 3300005617 Bacteria 2639
182 Ga0068859_100140560 3300005617 Bacteria 2488
183 Ga0068859_100371448 3300005617 Bacteria 1526
184 Ga0068859_100574617 3300005617 Unclassified 1221
185 Ga0068859_100685629 3300005617 Bacteria 1116
186 Ga0068864_100005121 3300005618 Bacteria 10738
187 Ga0068864_100231322 3300005618 Bacteria 1710
188 Ga0068864_100281368 3300005618 Bacteria 1553
189 Ga0068866_10099278 3300005718 Bacteria 1603
190 Ga0068866_10286870 3300005718 Bacteria 1022
191 Ga0068866_10395589 3300005718 Bacteria 890
192 Ga0068861_100005603 3300005719 Bacteria 8510
193 Ga0068861_100083929 3300005719 Bacteria 2500
194 Ga0068861_100122766 3300005719 Bacteria 2097
195 Ga0068861_100958146 3300005719 Bacteria 814
196 Ga0068870_10002305 3300005840 Bacteria 7927
197 Ga0068870_10473270 3300005840 Unclassified 830
198 Ga0068863_100066757 3300005841 Bacteria 3403
199 Ga0068863_100253325 3300005841 Bacteria 1701
200 Ga0068863_100623853 3300005841 Bacteria 1068
201 Ga0068858_100087895 3300005842 Bacteria 2891
202 Ga0068858_100272720 3300005842 Bacteria 1610
203 Ga0068860_100070898 3300005843 Bacteria 3313
204 Ga0068860_100081629 3300005843 Bacteria 3074
205 Ga0068860_100623677 3300005843 Bacteria 1085
206 Ga0068862_100001571 3300005844 Bacteria 20810
207 Ga0068862_100032736 3300005844 Bacteria 4392
208 Ga0068862_100201759 3300005844 Bacteria 1794
209 Ga0081539_10057781 3300005985 Bacteria 2144
210 Ga0070717_10030097 3300006028 Bacteria 4361
211 Ga0070717_10139117 3300006028 Bacteria 2093
212 Ga0075365_10024339 3300006038 Bacteria 3817
213 Ga0075365_10049158 3300006038 Bacteria 2778
214 Ga0075368_10019135 3300006042 Bacteria 2583
215 Ga0075363_100249459 3300006048 Bacteria 1022
216 Ga0075364_10003175 3300006051 Bacteria 9306
217 Ga0075364_10005410 3300006051 Bacteria 7414
218 Ga0075362_10001764 3300006177 Bacteria 7044
219 Ga0075367_10000956 3300006178 Bacteria 11781
220 Ga0075367_10019460 3300006178 Bacteria 3764
221 Ga0075367_10055547 3300006178 Bacteria 2350
222 Ga0075366_10004154 3300006195 Bacteria 7758
223 Ga0075366_10010229 3300006195 Bacteria 5262
224 Ga0075366_10073877 3300006195 Bacteria 2033
225 Ga0097621_100006115 3300006237 Bacteria 8523
226 Ga0097621_100011860 3300006237 Bacteria 6442
227 Ga0097621_100148338 3300006237 Bacteria 2010
228 Ga0097621_100388781 3300006237 Bacteria 1247
229 Ga0097621_100494976 3300006237 Bacteria 1107
230 Ga0097621_100886749 3300006237 Bacteria 830
231 Ga0075370_10115131 3300006353 Bacteria 1563
232 Ga0075370_10163256 3300006353 Bacteria 1308
233 Ga0068871_100014418 3300006358 Bacteria 5894
234 Ga0068871_100307225 3300006358 Bacteria 1393
235 Ga0068871_100682446 3300006358 Bacteria 940
236 Ga0075428_100000080 3300006844 Bacteria 80349
237 Ga0075428_100007739 3300006844 Bacteria 11908
238 Ga0075428_100011749 3300006844 Bacteria 9748
239 Ga0075428_100381162 3300006844 Bacteria 1512
240 Ga0075428_100554161 3300006844 Bacteria 1229
241 Ga0075430_100005792 3300006846 Bacteria 10424
242 Ga0075430_100073140 3300006846 Bacteria 2875
243 Ga0075430_100106541 3300006846 Bacteria 2338
244 Ga0075431_100008574 3300006847 Bacteria 10235
245 Ga0075431_100013190 3300006847 Bacteria 8348
246 Ga0075431_100038850 3300006847 Bacteria 4903
247 Ga0075431_100039560 3300006847 Bacteria 4858
248 Ga0075431_100118566 3300006847 Bacteria 2731
249 Ga0075431_100300211 3300006847 Bacteria 1623
250 Ga0075431_100350200 3300006847 Bacteria 1485
251 Ga0075431_100592658 3300006847 Bacteria 1093
252 Ga0075433_10024458 3300006852 Bacteria 5098
253 Ga0075433_10026221 3300006852 Bacteria 4932
254 Ga0075433_10031125 3300006852 Bacteria 4559
255 Ga0075433_10045521 3300006852 Bacteria 3815
256 Ga0075433_10094226 3300006852 Bacteria 2650
257 Ga0075433_10161982 3300006852 Bacteria 1991
258 Ga0075433_10187164 3300006852 Bacteria 1842
259 Ga0075433_10314697 3300006852 Bacteria 1385
260 Ga0075434_100000553 3300006871 Bacteria 28642
261 Ga0075434_100002096 3300006871 Bacteria 17342
262 Ga0075434_100013870 3300006871 Bacteria 7687
263 Ga0075434_100082612 3300006871 Bacteria 3210
264 Ga0075434_100136515 3300006871 Bacteria 2472
265 Ga0075434_100158591 3300006871 Bacteria 2282
266 Ga0075434_100217689 3300006871 Bacteria 1930
267 Ga0075434_100327937 3300006871 Bacteria 1551
268 Ga0075434_101575187 3300006871 Unclassified 666
269 Ga0075429_100000411 3300006880 Bacteria 31783
270 Ga0075429_100002380 3300006880 Bacteria 15838
271 Ga0075429_100168313 3300006880 Bacteria 1920
272 Ga0075429_100473069 3300006880 Bacteria 1098
273 Ga0075429_100516588 3300006880 Bacteria 1047
274 Ga0068865_100033239 3300006881 Bacteria 3452
275 Ga0068865_100037421 3300006881 Bacteria 3276
276 Ga0068865_100423713 3300006881 Bacteria 1095
277 Ga0068865_100506171 3300006881 Bacteria 1008
278 Ga0075436_100009367 3300006914 Bacteria 6695
279 Ga0097620_100012707 3300006931 Bacteria 8464
280 Ga0097620_100016090 3300006931 Bacteria 7514
281 Ga0097620_100034155 3300006931 Bacteria 5105
282 Ga0097620_100036299 3300006931 Bacteria 4948
283 Ga0097620_100125212 3300006931 Bacteria 2639
284 Ga0097620_100140566 3300006931 Bacteria 2488
285 Ga0097620_100371462 3300006931 Bacteria 1526
286 Ga0097620_100574633 3300006931 Unclassified 1221
287 Ga0097620_100685585 3300006931 Bacteria 1116
288 Ga0097620_101273303 3300006931 Unclassified 810
289 Ga0075435_100032757 3300007076 Bacteria 4105
290 Ga0075435_100048422 3300007076 Bacteria 3415
291 Ga0075435_100069579 3300007076 Bacteria 2870
292 Ga0075435_100573364 3300007076 Bacteria 978
293 Ga0105240_10061210 3300009093 Bacteria 4692
294 Ga0105240_10107198 3300009093 Bacteria 3388
295 Ga0105240_10481857 3300009093 Bacteria 1383
296 Ga0105240_10487651 3300009093 Bacteria 1373
297 Ga0111539_10000181 3300009094 Bacteria 73457
298 Ga0111539_10003328 3300009094 Bacteria 21227
299 Ga0111539_10010704 3300009094 Bacteria 11546
300 Ga0111539_10032870 3300009094 Bacteria 6300
301 Ga0111539_10060627 3300009094 Bacteria 4483
302 Ga0111539_10064925 3300009094 Bacteria 4316
303 Ga0111539_10068797 3300009094 Bacteria 4180
304 Ga0111539_10102283 3300009094 Bacteria 3363
305 Ga0111539_10105503 3300009094 Bacteria 3306
306 Ga0111539_10113240 3300009094 Bacteria 3182
307 Ga0111539_10286102 3300009094 Bacteria 1918
308 Ga0111539_10504554 3300009094 Bacteria 1409
309 Ga0111539_10522733 3300009094 Bacteria 1382
310 Ga0111539_10540685 3300009094 Bacteria 1357
311 Ga0105245_10047995 3300009098 Bacteria 3818
312 Ga0105245_10177792 3300009098 Bacteria 2031
313 Ga0105245_10452405 3300009098 Bacteria 1293
314 Ga0105245_10706767 3300009098 Bacteria 1041
315 Ga0114129_10000077 3300009147 Bacteria 90951
316 Ga0114129_10000588 3300009147 Bacteria 44911
317 Ga0114129_10003634 3300009147 Bacteria 21704
318 Ga0114129_10006879 3300009147 Bacteria 16174
319 Ga0114129_10012882 3300009147 Bacteria 11900
320 Ga0114129_10016230 3300009147 Bacteria 10597
321 Ga0114129_10026556 3300009147 Bacteria 8201
322 Ga0114129_10033253 3300009147 Bacteria 7288
323 Ga0114129_10036869 3300009147 Bacteria 6904
324 Ga0114129_10047465 3300009147 Bacteria 6033
325 Ga0114129_10061111 3300009147 Bacteria 5266
326 Ga0114129_10268119 3300009147 Bacteria 2285
327 Ga0114129_10497111 3300009147 Bacteria 1593
328 Ga0114129_10591516 3300009147 Bacteria 1439
329 Ga0105243_10030455 3300009148 Bacteria 4154
330 Ga0105243_10202052 3300009148 Bacteria 1743
331 Ga0105243_10745867 3300009148 Bacteria 959
332 Ga0105241_10496136 3300009174 Bacteria 1088
333 Ga0105242_10035658 3300009176 Bacteria 3989
334 Ga0105242_10060137 3300009176 Bacteria 3120
335 Ga0105242_10085479 3300009176 Bacteria 2646
336 Ga0105242_10570311 3300009176 Bacteria 1088
337 Ga0105248_10001783 3300009177 Bacteria 23918
338 Ga0105248_10028705 3300009177 Bacteria 6200
339 Ga0105248_10043880 3300009177 Bacteria 5015
340 Ga0105248_10571491 3300009177 Bacteria 1276
341 Ga0105248_11116924 3300009177 Bacteria 891
342 Ga0105238_10912607 3300009551 Bacteria 897
343 Ga0105249_10015855 3300009553 Bacteria 6678
344 Ga0105249_10030475 3300009553 Bacteria 4876
345 Ga0105249_10364799 3300009553 Bacteria 1467
346 Ga0105249_10418439 3300009553 Bacteria 1373
347 Ga0105249_10453569 3300009553 Bacteria 1321
348 Ga0105249_10477083 3300009553 Bacteria 1289
349 Ga0105239_10057239 3300010375 Bacteria 4276
350 Ga0105246_10744349 3300011119 Bacteria 864
351 Ga0157370_10132577 3300013104 Bacteria 2324
352 Ga0157370_10236131 3300013104 Bacteria 1692
353 Ga0157370_10650577 3300013104 Bacteria 963
354 Ga0157369_10571656 3300013105 Unclassified 1167
355 Ga0157374_10138269 3300013296 Bacteria 2363
356 Ga0157374_10320816 3300013296 Bacteria 1535
357 Ga0157378_10005712 3300013297 Bacteria 10889
358 Ga0157378_10304141 3300013297 Bacteria 1544
359 Ga0157378_10412655 3300013297 Bacteria 1333
360 Ga0157378_10536262 3300013297 Bacteria 1174
361 Ga0157378_10679256 3300013297 Bacteria 1048
362 Ga0163162_10014459 3300013306 Bacteria 7711
363 Ga0163162_10038225 3300013306 Bacteria 4790
364 Ga0163162_10052516 3300013306 Bacteria 4094
365 Ga0163162_10209555 3300013306 Bacteria 2078
366 Ga0157372_10118289 3300013307 Bacteria 3040
367 Ga0157375_10062943 3300013308 Bacteria 3688
368 Ga0157375_10072886 3300013308 Bacteria 3452
369 Ga0157375_10134551 3300013308 Bacteria 2594
370 Ga0157375_10244951 3300013308 Bacteria 1952
371 Ga0157375_10357766 3300013308 Unclassified 1626
372 Ga0163163_10187271 3300014325 Bacteria 2117
373 Ga0163163_10261806 3300014325 Bacteria 1780
374 Ga0157380_10012368 3300014326 Bacteria 6192
375 Ga0157380_10056519 3300014326 Bacteria 3121
376 Ga0157380_10146864 3300014326 Bacteria 2033
377 Ga0157380_10343415 3300014326 Bacteria 1393
378 Ga0157380_10499715 3300014326 Bacteria 1181
379 Ga0157377_10125511 3300014745 Bacteria 1561
380 Ga0157377_10227050 3300014745 Unclassified 1198
381 Ga0157379_10044810 3300014968 Bacteria 3948
382 Ga0157379_10083900 3300014968 Bacteria 2856
383 Ga0157379_10484048 3300014968 Bacteria 1145
384 Ga0157376_10006410 3300014969 Bacteria 8313
385 Ga0157376_10084075 3300014969 Bacteria 2739
386 Ga0157376_10100674 3300014969 Bacteria 2524
387 Ga0157376_10382588 3300014969 Bacteria 1356
388 Ga0157376_10526560 3300014969 Bacteria 1166
389 Ga0163161_10263471 3300017792 Bacteria 1347
390 Ga0163161_10398143 3300017792 Bacteria 1104
391 Ga0163161_10534819 3300017792 Bacteria 959
392 Ga0207653_10035053 3300025885 Bacteria 1631
393 Ga0207688_10086295 3300025901 Bacteria 1798
394 Ga0207680_10027965 3300025903 Bacteria 3148
395 Ga0207680_10091936 3300025903 Bacteria 1932
396 Ga0207680_10176286 3300025903 Bacteria 1443
397 Ga0207647_10109589 3300025904 Bacteria 1633
398 Ga0207699_10003552 3300025906 Bacteria 7437
399 Ga0207645_10016102 3300025907 Bacteria 4951
400 Ga0207645_10031135 3300025907 Bacteria 3434
401 Ga0207643_10002349 3300025908 Bacteria 10283
402 Ga0207643_10008592 3300025908 Bacteria 5477
403 Ga0207643_10054088 3300025908 Bacteria 2281
404 Ga0207654_10139446 3300025911 Bacteria 1544
405 Ga0207707_10139082 3300025912 Bacteria 2123
406 Ga0207695_10034780 3300025913 Bacteria 5474
407 Ga0207663_10195720 3300025916 Bacteria 1455
408 Ga0207663_10255856 3300025916 Bacteria 1291
409 Ga0207660_10427119 3300025917 Unclassified 1069
410 Ga0207662_10001582 3300025918 Bacteria 11148
411 Ga0207662_10046981 3300025918 Bacteria 2556
412 Ga0207662_10073938 3300025918 Bacteria 2068
413 Ga0207662_10324300 3300025918 Unclassified 1029
414 Ga0207662_10588627 3300025918 Bacteria 773
415 Ga0207657_10348607 3300025919 Unclassified 1168
416 Ga0207657_10398182 3300025919 Bacteria 1083
417 Ga0207649_10155336 3300025920 Bacteria 1580
418 Ga0207649_10577483 3300025920 Bacteria 863
419 Ga0207652_10407014 3300025921 Bacteria 1227
420 Ga0207646_10037575 3300025922 Bacteria 4365
421 Ga0207646_10115530 3300025922 Bacteria 2411
422 Ga0207681_10016410 3300025923 Bacteria 4633
423 Ga0207681_10021025 3300025923 Bacteria 4143
424 Ga0207681_10199037 3300025923 Bacteria 1537
425 Ga0207681_10241962 3300025923 Bacteria 1405
426 Ga0207681_10809668 3300025923 Bacteria 783
427 Ga0207694_10666967 3300025924 Bacteria 876
428 Ga0207650_10041327 3300025925 Bacteria 3378
429 Ga0207650_10096032 3300025925 Bacteria 2273
430 Ga0207650_10153075 3300025925 Bacteria 1821
431 Ga0207650_10412284 3300025925 Bacteria 1120
432 Ga0207650_10615201 3300025925 Bacteria 914
433 Ga0207659_10026354 3300025926 Bacteria 3921
434 Ga0207659_10027377 3300025926 Bacteria 3860
435 Ga0207659_10037184 3300025926 Bacteria 3378
436 Ga0207659_10084529 3300025926 Bacteria 2355
437 Ga0207659_10470886 3300025926 Bacteria 1060
438 Ga0207659_10636842 3300025926 Bacteria 911
439 Ga0207687_10086026 3300025927 Bacteria 2282
440 Ga0207687_10239220 3300025927 Bacteria 1438
441 Ga0207687_10447958 3300025927 Bacteria 1070
442 Ga0207687_10489605 3300025927 Bacteria 1025
443 Ga0207644_10004067 3300025931 Bacteria 9485
444 Ga0207690_10246255 3300025932 Bacteria 1379
445 Ga0207690_10704153 3300025932 Bacteria 830
446 Ga0207706_10087843 3300025933 Bacteria 2734
447 Ga0207706_10135755 3300025933 Bacteria 2164
448 Ga0207706_10221835 3300025933 Bacteria 1655
449 Ga0207706_10576416 3300025933 Bacteria 968
450 Ga0207706_10709069 3300025933 Bacteria 859
451 Ga0207706_10728009 3300025933 Bacteria 846
452 Ga0207706_10757547 3300025933 Bacteria 827
453 Ga0207686_10014564 3300025934 Bacteria 4381
454 Ga0207686_10111732 3300025934 Bacteria 1844
455 Ga0207686_10159570 3300025934 Bacteria 1579
456 Ga0207709_10018785 3300025935 Bacteria 3876
457 Ga0207709_10370551 3300025935 Bacteria 1087
458 Ga0207670_10041339 3300025936 Bacteria 3031
459 Ga0207670_10070850 3300025936 Bacteria 2409
460 Ga0207670_10071188 3300025936 Bacteria 2404
461 Ga0207670_10095177 3300025936 Bacteria 2115
462 Ga0207670_10125539 3300025936 Bacteria 1872
463 Ga0207670_10441083 3300025936 Bacteria 1048
464 Ga0207669_10107189 3300025937 Bacteria 1863
465 Ga0207669_10149772 3300025937 Bacteria 1633
466 Ga0207669_10334498 3300025937 Bacteria 1164
467 Ga0207669_10353706 3300025937 Bacteria 1136
468 Ga0207669_10388073 3300025937 Bacteria 1090
469 Ga0207669_10408986 3300025937 Bacteria 1065
470 Ga0207669_10608767 3300025937 Bacteria 889
471 Ga0207704_10020443 3300025938 Bacteria 3502
472 Ga0207704_10034742 3300025938 Bacteria 2880
473 Ga0207704_10040070 3300025938 Bacteria 2734
474 Ga0207704_10975261 3300025938 Bacteria 716
475 Ga0207691_10011389 3300025940 Bacteria 8536
476 Ga0207691_10059256 3300025940 Bacteria 3482
477 Ga0207691_10075799 3300025940 Bacteria 3032
478 Ga0207691_10101483 3300025940 Bacteria 2567
479 Ga0207691_10164058 3300025940 Bacteria 1948
480 Ga0207691_10204818 3300025940 Bacteria 1716
481 Ga0207691_10496694 3300025940 Bacteria 1036
482 Ga0207711_10026089 3300025941 Bacteria 4901
483 Ga0207711_10076984 3300025941 Bacteria 2907
484 Ga0207711_10140910 3300025941 Bacteria 2169
485 Ga0207711_10160307 3300025941 Bacteria 2035
486 Ga0207711_10353439 3300025941 Bacteria 1361
487 Ga0207711_10373391 3300025941 Bacteria 1323
488 Ga0207711_10403301 3300025941 Bacteria 1271
489 Ga0207711_10485578 3300025941 Bacteria 1151
490 Ga0207689_10117260 3300025942 Bacteria 2189
491 Ga0207689_10226728 3300025942 Bacteria 1544
492 Ga0207689_10250637 3300025942 Bacteria 1464
493 Ga0207689_10293884 3300025942 Unclassified 1346
494 Ga0207689_10499670 3300025942 Bacteria 1019
495 Ga0207661_10051968 3300025944 Bacteria 3272
496 Ga0207661_10490962 3300025944 Bacteria 1122
497 Ga0207661_10718776 3300025944 Bacteria 919
498 Ga0207661_10929459 3300025944 Bacteria 801
499 Ga0207679_10089983 3300025945 Bacteria 2371
500 Ga0207679_10586394 3300025945 Bacteria 1003
501 Ga0207651_10027850 3300025960 Bacteria 3556
502 Ga0207651_10490847 3300025960 Bacteria 1060
503 Ga0207651_10617471 3300025960 Bacteria 949
504 Ga0207712_10004752 3300025961 Bacteria 8584
505 Ga0207712_10022403 3300025961 Bacteria 4159
506 Ga0207712_10027653 3300025961 Bacteria 3788
507 Ga0207712_10287361 3300025961 Bacteria 1344
508 Ga0207712_10294581 3300025961 Bacteria 1329
509 Ga0207712_10787569 3300025961 Bacteria 835
510 Ga0207712_10857752 3300025961 Bacteria 801
511 Ga0207668_10622071 3300025972 Bacteria 942
512 Ga0207640_10240148 3300025981 Bacteria 1399
513 Ga0207677_10104272 3300026023 Bacteria 2096
514 Ga0207703_10041795 3300026035 Bacteria 3675
515 Ga0207703_10044794 3300026035 Bacteria 3557
516 Ga0207703_10235854 3300026035 Bacteria 1642
517 Ga0207639_10980133 3300026041 Bacteria 791
518 Ga0207678_10022903 3300026067 Bacteria 5467
519 Ga0207708_10003536 3300026075 Bacteria 11509
520 Ga0207708_10031394 3300026075 Bacteria 4032
521 Ga0207708_10037230 3300026075 Bacteria 3706
522 Ga0207708_10164071 3300026075 Bacteria 1756
523 Ga0207708_10180659 3300026075 Bacteria 1675
524 Ga0207708_10340647 3300026075 Bacteria 1228
525 Ga0207641_10042332 3300026088 Bacteria 3820
526 Ga0207641_10244273 3300026088 Bacteria 1674
527 Ga0207641_10609695 3300026088 Bacteria 1069
528 Ga0207648_10000280 3300026089 Bacteria 55313
529 Ga0207648_10007517 3300026089 Bacteria 10696
530 Ga0207648_10041218 3300026089 Bacteria 4055
531 Ga0207648_10071112 3300026089 Bacteria 3033
532 Ga0207676_10108370 3300026095 Bacteria 2319
533 Ga0207676_10136973 3300026095 Bacteria 2090
534 Ga0207676_10144253 3300026095 Bacteria 2043
535 Ga0207676_10458705 3300026095 Bacteria 1203
536 Ga0207676_11093996 3300026095 Bacteria 788
537 Ga0207674_10009475 3300026116 Bacteria 11123
538 Ga0207674_10022765 3300026116 Bacteria 6724
539 Ga0207674_10119857 3300026116 Bacteria 2600
540 Ga0207675_100005112 3300026118 Bacteria 12628
541 Ga0207675_100083061 3300026118 Bacteria 3004
542 Ga0207675_100172708 3300026118 Bacteria 2066
543 Ga0207675_100373631 3300026118 Bacteria 1401
544 Ga0207675_100973952 3300026118 Bacteria 866
545 Ga0207683_10020578 3300026121 Bacteria 5647
546 Ga0207683_10145954 3300026121 Bacteria 2133
547 Ga0207683_10248578 3300026121 Bacteria 1623
548 Ga0207698_10642897 3300026142 Bacteria 1050
549 Ga0209813_10023152 3300027866 Bacteria 1764
550 Ga0207428_10000481 3300027907 Bacteria 48194
551 Ga0207428_10001864 3300027907 Bacteria 21519
552 Ga0207428_10044629 3300027907 Bacteria 3575
553 Ga0207428_10437738 3300027907 Bacteria 954
554 Ga0268266_10024911 3300028379 Bacteria 5091
555 Ga0268266_10044867 3300028379 Bacteria 3780
556 Ga0268265_10003942 3300028380 Bacteria 10455
557 Ga0268265_10270121 3300028380 Bacteria 1516
558 Ga0268264_10060528 3300028381 Bacteria 3174
559 Ga0265318_10024289 3300028577 Bacteria 2406
560 Ga0265320_10088558 3300031240 Bacteria 1436
561 Ga0307408_100147607 3300031548 Bacteria 1853
562 Ga0307408_100313125 3300031548 Bacteria 1319
563 Ga0307408_100377843 3300031548 Bacteria 1210
564 Ga0265314_10043744 3300031711 Bacteria 3180
565 Ga0265314_10133049 3300031711 Bacteria 1548
566 Ga0316576_10457356 3300031727 Bacteria 942
567 Ga0307405_10014290 3300031731 Bacteria 4264
568 Ga0307405_10030263 3300031731 Bacteria 3173
569 Ga0307413_10007133 3300031824 Bacteria 5161
570 Ga0307413_10255044 3300031824 Bacteria 1304
571 Ga0307410_10038888 3300031852 Bacteria 3119
572 Ga0307406_10029126 3300031901 Bacteria 3342
573 Ga0307407_10001825 3300031903 Bacteria 7993
574 Ga0307407_10004309 3300031903 Bacteria 6012
575 Ga0307412_10023631 3300031911 Bacteria 3785
576 Ga0307412_10036619 3300031911 Bacteria 3146
577 Ga0307412_10074102 3300031911 Bacteria 2331
578 Ga0307412_10146602 3300031911 Bacteria 1736
579 Ga0307412_10292430 3300031911 Bacteria 1284
580 Ga0307409_100019385 3300031995 Bacteria 4604
581 Ga0307409_100256740 3300031995 Bacteria 1601
582 Ga0307409_100300983 3300031995 Bacteria 1492
583 Ga0307409_100335145 3300031995 Unclassified 1421
584 Ga0307409_100363790 3300031995 Bacteria 1369
585 Ga0307409_100419698 3300031995 Bacteria 1283
586 Ga0307409_100559338 3300031995 Bacteria 1124
587 Ga0307416_100003790 3300032002 Bacteria 8973
588 Ga0307416_100005453 3300032002 Bacteria 7815
589 Ga0307416_100982596 3300032002 Bacteria 947
590 Ga0307416_100994316 3300032002 Bacteria 942
591 Ga0307414_10630168 3300032004 Bacteria 965
592 Ga0307411_10005511 3300032005 Bacteria 6227
593 Ga0307411_10206692 3300032005 Bacteria 1512
594 Ga0307411_10280783 3300032005 Bacteria 1325
595 Ga0307415_100006479 3300032126 Bacteria 6321
596 Ga0307415_100113769 3300032126 Bacteria 2013
597 Ga0307415_100114952 3300032126 Bacteria 2005
598 Ga0373940_0099819 3300035088 Bacteria 880
599 Ga0373923_0076546 3300035111 Bacteria 1445
600 Ga0373936_0339762 3300035113 Bacteria 682
601 Ga0373954_0359474 3300035118 Bacteria 719
602 Ga0373943_0109142 3300035170 Bacteria 1457
603 Ga0373946_0105501 3300035171 Bacteria 1269
604 Ga0373961_0046368 3300035241 Bacteria 1274
605 Ga0373931_0015783 3300035691 Bacteria 3708
606 Ga0373935_0247994 3300035692 Unclassified 1245
607 Ga0373935_0333781 3300035692 Bacteria 1078
608 Ga0373935_0408362 3300035692 Unclassified 976
609 Ga0373947_0051242 3300035725 Bacteria 2483
610 Ga0373937_0000331 3300036401 Bacteria 44847
611 Ga0373937_0002679 3300036401 Bacteria 14848
612 Ga0373937_0464518 3300036401 Bacteria 1202
613 Ga0373925_0002901 3300037068 Bacteria 13546
614 Ga0373925_0053130 3300037068 Bacteria 3028
615 Ga0373925_0120091 3300037068 Bacteria 2040
616 Ga0373925_0495706 3300037068 Bacteria 1003
617 Ga0439439_0012889 3300041406 Bacteria 2023
618 Ga0439439_0062527 3300041406 Bacteria 990
619 Ga0439453_0003363 3300041408 Bacteria 2297
620 Ga0451851_1307948 3300041507 Unclassified 853
621 Ga0451853_1137327 3300041512 Bacteria 801
622 Ga0451853_3884947 3300041512 Bacteria 1067
623 Ga0439433_0018868 3300041999 Bacteria 1537
624 Ga0439449_0152433 3300042007 Bacteria 862
625 Ga0450919_007521 3300042121 Bacteria 1273
626 Ga0450923_000364 3300042125 Bacteria 4730
627 Ga0450923_023929 3300042125 Bacteria 1208
628 Ga0450905_022591 3300042142 Bacteria 935
629 Ga0439446_0079078 3300042156 Bacteria 1016
630 Ga0439434_0160785 3300042435 Bacteria 746
631 Ga0439435_0015022 3300042436 Bacteria 1921
632 Ga0439444_0019354 3300042437 Bacteria 1187
633 Ga0439464_0002548 3300042439 Bacteria 4502
634 Ga0439460_0076504 3300042461 Bacteria 1044
635 Ga0451577_0127264 3300042876 Bacteria 2283
636 Ga0439440_0006996 3300042993 Bacteria 2286
637 Ga0453684_0208890 3300044712 Bacteria 2271
638 Ga0451576_0007793 3300045051 Bacteria 12703
639 Ga0451576_0037518 3300045051 Bacteria 5132
640 Ga0451576_0068252 3300045051 Bacteria 3700
641 Ga0451576_0416757 3300045051 Bacteria 1409
642 Ga0451576_0427722 3300045051 Bacteria 1389
643 Ga0466967_0735901 3300045976 Bacteria 978
644 Ga0495592_0062440 3300046454 Bacteria 2735
645 Ga0495603_0085517 3300046455 Bacteria 1846
646 Ga0495629_0060677 3300046459 Bacteria 2643
647 Ga0495653_0238590 3300046463 Bacteria 1213
648 Ga0495653_0429298 3300046463 Unclassified 835
649 Ga0495585_0256045 3300046492 Bacteria 872
650 Ga0495608_0007910 3300046511 Bacteria 7470
651 Ga0495628_0022709 3300046516 Bacteria 5153
652 Ga0495628_0320231 3300046516 Bacteria 1144
653 Ga0495628_0623368 3300046516 Unclassified 768
654 Ga0495630_0045249 3300046517 Bacteria 3289
655 Ga0495630_0428841 3300046517 Bacteria 1013
656 Ga0495644_0210210 3300046523 Bacteria 751
657 Ga0495652_0108062 3300046529 Bacteria 2243
658 Ga0495640_0062378 3300046533 Bacteria 2528
659 Ga0495586_0101309 3300046535 Bacteria 1598
660 Ga0495586_0148312 3300046535 Bacteria 1319
661 Ga0495598_0066352 3300046537 Bacteria 1125
662 Ga0495621_0003001 3300046539 Bacteria 4601
663 Ga0495621_0015215 3300046539 Bacteria 2450
664 Ga0495645_0027871 3300046543 Bacteria 4104
665 Ga0495645_0231430 3300046543 Bacteria 1238
666 Ga0495667_0016149 3300046559 Bacteria 5045
667 Ga0495656_0057241 3300046615 Bacteria 1687
668 Ga0495668_0168269 3300046616 Bacteria 1201
669 Ga0495659_0003284 3300046664 Bacteria 5189
670 Ga0495659_0004990 3300046664 Bacteria 4175
671 Ga0495659_0006283 3300046664 Bacteria 3754
672 Ga0495659_0019033 3300046664 Bacteria 2294
673 Ga0495659_0023193 3300046664 Bacteria 2107
674 Ga0495659_0035520 3300046664 Bacteria 1757
675 Ga0495659_0050804 3300046664 Bacteria 1509
676 Ga0495659_0238851 3300046664 Bacteria 754
677 Ga0495657_0223034 3300046675 Bacteria 1142
678 Ga0495599_0018444 3300046678 Bacteria 4348
679 Ga0495599_0117264 3300046678 Bacteria 1656
680 Ga0495647_0091655 3300046681 Bacteria 1247
681 Ga0495658_0045179 3300046683 Bacteria 2471
682 Ga0495658_0145302 3300046683 Unclassified 1453
683 Ga0495658_0337581 3300046683 Unclassified 957
684 Ga0495658_0426657 3300046683 Bacteria 846
685 Ga0495669_0010879 3300046684 Bacteria 3851
686 Ga0495669_0017880 3300046684 Bacteria 3044
687 Ga0495669_0056676 3300046684 Bacteria 1767
688 Ga0495669_0322108 3300046684 Bacteria 746
689 Ga0495613_0433216 3300046689 Unclassified 893
690 Ga0495624_0211727 3300046690 Bacteria 1176
691 Ga0495670_0016466 3300046691 Bacteria 3634
692 Ga0495600_0152136 3300046809 Bacteria 1497
693 Ga0495581_0089234 3300047315 Bacteria 1788
694 Ga0495604_0008192 3300047317 Bacteria 8268
695 Ga0495636_0015023 3300047318 Bacteria 3084
696 Ga0495636_0018647 3300047318 Bacteria 2784
697 Ga0495636_0180423 3300047318 Bacteria 958
698 Ga0495636_0224005 3300047318 Bacteria 864
699 Ga0495674_0192210 3300047319 Bacteria 1696
700 Ga0495674_0844523 3300047319 Bacteria 710
701 Ga0495680_0102764 3300047322 Bacteria 2128
702 Ga0495675_0047881 3300047444 Bacteria 2720
703 Ga0495677_0212785 3300047445 Bacteria 752
704 Ga0495685_040282 3300047447 Bacteria 1598
705 Ga0495684_0002104 3300047471 Bacteria 15970
706 Ga0495684_0049826 3300047471 Bacteria 3200
707 Ga0495684_0082999 3300047471 Bacteria 2431
708 Ga0495614_0246829 3300048089 Unclassified 816
709 Ga0496100_0002571 3300048903 Bacteria 9243
710 Ga0496100_0094383 3300048903 Unclassified 2049
711 Ga0496101_0003307 3300048904 Bacteria 10026
712 Ga0496101_0873282 3300048904 Unclassified 708
713 Ga0496102_0210783 3300048905 Bacteria 1832
714 Ga0496102_0398701 3300048905 Bacteria 1294
715 Ga0496103_0115968 3300048906 Bacteria 1704
716 Ga0496104_0001613 3300048907 Bacteria 19451
717 Ga0496104_0009116 3300048907 Bacteria 8824
718 Ga0496104_0032813 3300048907 Bacteria 4833
719 Ga0496104_0607206 3300048907 Unclassified 1004
720 Ga0496105_0018568 3300048908 Bacteria 5596
721 Ga0496105_0072552 3300048908 Bacteria 2845
722 Ga0496105_0136391 3300048908 Bacteria 2022
723 Ga0496105_0229430 3300048908 Bacteria 1509
724 Ga0496106_0014232 3300048909 Bacteria 5876
725 Ga0496106_0086529 3300048909 Bacteria 2414
726 Ga0496106_0166491 3300048909 Unclassified 1745
727 Ga0496106_0453823 3300048909 Bacteria 1030
728 Ga0496107_0115119 3300048910 Bacteria 1979
729 Ga0496108_0005680 3300048911 Bacteria 10099
730 Ga0496108_0161987 3300048911 Bacteria 1934
731 Ga0496109_0090194 3300048912 Bacteria 2835
732 Ga0496109_0158080 3300048912 Bacteria 2123
733 Ga0496110_0004936 3300048913 Bacteria 10418
734 Ga0496111_0096230 3300048914 Bacteria 2173
735 Ga0496112_0033130 3300048915 Bacteria 5020
736 Ga0496112_0036483 3300048915 Bacteria 4796
737 Ga0496112_0065888 3300048915 Bacteria 3574
738 Ga0496112_0702110 3300048915 Bacteria 939
739 Ga0496113_0073429 3300048916 Bacteria 2606
740 Ga0496113_0403400 3300048916 Bacteria 1098
741 Ga0496114_0002181 3300048917 Bacteria 14900
742 Ga0496114_0085941 3300048917 Bacteria 2665
743 Ga0496114_0158178 3300048917 Bacteria 1968
744 Ga0496114_0243608 3300048917 Bacteria 1581
745 Ga0496114_0327215 3300048917 Bacteria 1355
746 Ga0496115_0048059 3300048918 Bacteria 3413
747 Ga0496115_0084681 3300048918 Bacteria 2585
748 Ga0501299_005369 3300049522 Bacteria 1967
749 Ga0501031_0515174 3300049568 Bacteria 771
750 Ga0501032_0500126 3300049569 Bacteria 777
751 Ga0501034_0018184 3300049571 Bacteria 7210
752 Ga0501034_0042500 3300049571 Bacteria 4601
753 Ga0501036_0015943 3300049572 Bacteria 6276
754 Ga0501036_0141912 3300049572 Bacteria 2027
755 Ga0501036_0443467 3300049572 Bacteria 1082
756 Ga0501036_1014222 3300049572 Bacteria 679
757 Ga0501038_0232976 3300049574 Bacteria 1465
758 Ga0501038_0370354 3300049574 Unclassified 1113
759 Ga0501039_0998112 3300049575 Bacteria 650
760 Ga0501040_0008320 3300049576 Bacteria 6747
761 Ga0501040_0017256 3300049576 Bacteria 4791
762 Ga0501040_0259945 3300049576 Bacteria 1239
763 Ga0501040_0362702 3300049576 Bacteria 1038
764 Ga0501040_0544823 3300049576 Bacteria 837
765 Ga0501040_0586379 3300049576 Bacteria 805
766 Ga0501041_0015275 3300049577 Bacteria 4559
767 Ga0501041_0149228 3300049577 Bacteria 1459
768 Ga0501041_0171564 3300049577 Bacteria 1357
769 Ga0501042_0001638 3300049578 Bacteria 13329
770 Ga0501042_0043380 3300049578 Bacteria 3203
771 Ga0501042_0236204 3300049578 Bacteria 1319
772 Ga0501046_0028234 3300049580 Bacteria 4572
773 Ga0501046_0247244 3300049580 Bacteria 1314
774 Ga0501047_0049969 3300049581 Bacteria 4038
775 Ga0501047_0321258 3300049581 Bacteria 1388
776 Ga0501048_0080187 3300049582 Bacteria 2303
777 Ga0501048_0143341 3300049582 Bacteria 1689
778 Ga0501048_0234502 3300049582 Bacteria 1302
779 Ga0501067_0097126 3300049583 Bacteria 1636
780 Ga0501068_0050075 3300049584 Bacteria 2525
781 Ga0501069_0197146 3300049585 Bacteria 1166
782 Ga0501070_0302914 3300049586 Bacteria 1302
783 Ga0501071_0038259 3300049587 Bacteria 3428
784 Ga0501071_0058442 3300049587 Bacteria 2789
785 Ga0501071_0058523 3300049587 Bacteria 2787
786 Ga0501071_0598993 3300049587 Bacteria 847
787 Ga0501071_0724409 3300049587 Bacteria 766
788 Ga0501072_0012685 3300049588 Bacteria 6445
789 Ga0501072_0014894 3300049588 Bacteria 5960
790 Ga0501073_0013885 3300049589 Bacteria 5856
791 Ga0501074_0496205 3300049590 Bacteria 865
792 Ga0501075_0015338 3300049591 Bacteria 5497
793 Ga0501075_0049553 3300049591 Bacteria 3157
794 Ga0501075_0178315 3300049591 Bacteria 1621
795 Ga0501075_0202961 3300049591 Bacteria 1512
796 Ga0501075_0252762 3300049591 Bacteria 1343
797 Ga0501075_0470578 3300049591 Bacteria 958
798 Ga0501075_0617090 3300049591 Bacteria 827
799 Ga0501076_0002778 3300049592 Bacteria 12122
800 Ga0501076_0010090 3300049592 Bacteria 6992
801 Ga0501076_0012910 3300049592 Bacteria 6253
802 Ga0501076_0016934 3300049592 Bacteria 5533
803 Ga0501076_0100696 3300049592 Bacteria 2328
804 Ga0501076_0147979 3300049592 Bacteria 1910
805 Ga0501076_0173361 3300049592 Bacteria 1758
806 Ga0501077_0066857 3300049593 Bacteria 2280
807 Ga0501077_0079082 3300049593 Bacteria 2083
808 Ga0501077_0138837 3300049593 Bacteria 1541
809 Ga0501202_022025 3300049652 Bacteria 1278
810 Ga0501217_069652 3300049661 Bacteria 955
811 Ga0501251_021843 3300049681 Bacteria 856
812 Ga0501079_0007074 3300049741 Bacteria 8469
813 Ga0501079_0069120 3300049741 Bacteria 2726
814 Ga0501079_0085833 3300049741 Bacteria 2436
815 Ga0501079_0127187 3300049741 Bacteria 1982
816 Ga0501079_0137823 3300049741 Bacteria 1900
817 Ga0501079_0328046 3300049741 Bacteria 1198
818 Ga0501080_0145212 3300049742 Bacteria 2193
819 Ga0501080_0190087 3300049742 Bacteria 1887
820 Ga0501080_0359029 3300049742 Bacteria 1315
821 Ga0501080_0398811 3300049742 Bacteria 1238
822 Ga0501081_0014225 3300049743 Bacteria 5247
823 Ga0501081_0032890 3300049743 Bacteria 3521
824 Ga0501081_0083098 3300049743 Unclassified 2244
825 Ga0501081_0100027 3300049743 Bacteria 2049
826 Ga0501081_0204735 3300049743 Bacteria 1432
827 Ga0501081_0419085 3300049743 Bacteria 992
828 Ga0501081_0760477 3300049743 Bacteria 728
829 Ga0501083_0080892 3300049744 Bacteria 2154
830 Ga0501035_0738773 3300049822 Bacteria 791
831 Ga0501035_0812648 3300049822 Unclassified 746
832 Ga0501045_0057442 3300049824 Bacteria 2847
833 Ga0501045_0061388 3300049824 Bacteria 2757
834 Ga0501045_0234482 3300049824 Bacteria 1366
835 Ga0501045_0370687 3300049824 Bacteria 1066
836 nmdc:mga03683_1673_c1 3300050489 Bacteria 6677
837 nmdc:mga00v17_15337_c1 3300050491 Bacteria 4301
838 nmdc:mga00v17_25504_c1 3300050491 Bacteria 3437
839 nmdc:mga0k408_23586_c1 3300050493 Bacteria 3473
840 nmdc:mga0k408_34131_c1 3300050493 Bacteria 2912
841 nmdc:mga0k408_7204_c1 3300050493 Bacteria 5943
842 nmdc:mga06z11_127650_c1 3300050494 Bacteria 1425
843 nmdc:mga06z11_46065_c1 3300050494 Bacteria 2208
844 nmdc:mga06z11_56461_c1 3300050494 Bacteria 2031
845 nmdc:mga04h51_26601_c1 3300050495 Bacteria 1790
846 nmdc:mga07m45_117684_c1 3300050496 Bacteria 1533
847 nmdc:mga05p37_1139_c1 3300050507 Bacteria 30539
848 nmdc:mga05p37_115855_c1 3300050507 Bacteria 3294
849 nmdc:mga05p37_150129_c1 3300050507 Bacteria 2851
850 nmdc:mga05p37_17501_c1 3300050507 Bacteria 8651
851 nmdc:mga05p37_22982_c1 3300050507 Bacteria 7563
852 nmdc:mga05p37_30845_c1 3300050507 Bacteria 6543
853 nmdc:mga05p37_3120_c1 3300050507 Bacteria 19261
854 nmdc:mga05p37_326875_c1 3300050507 Bacteria 1813
855 nmdc:mga05p37_49_c1 3300050507 Bacteria 103776
856 nmdc:mga05p37_5323_c1 3300050507 Bacteria 15109
857 nmdc:mga05p37_65392_c1 3300050507 Bacteria 4474
858 nmdc:mga05p37_69457_c1 3300050507 Bacteria 4333
859 nmdc:mga05p37_70509_c1 3300050507 Bacteria 4298
860 nmdc:mga05p37_94802_c1 3300050507 Bacteria 3677
861 nmdc:mga09592_2888_c1 3300050508 Bacteria 13923
862 nmdc:mga09592_544578_c1 3300050508 Bacteria 997
863 nmdc:mga09592_5817_c1 3300050508 Bacteria 10056
864 nmdc:mga09592_597434_c1 3300050508 Bacteria 946
865 nmdc:mga09592_723868_c1 3300050508 Unclassified 846
866 nmdc:mga0qj67_17549_c1 3300050509 Bacteria 5443
867 nmdc:mga0qj67_19329_c1 3300050509 Bacteria 5203
868 nmdc:mga0qj67_49772_c1 3300050509 Bacteria 3312
869 nmdc:mga0qj67_797377_c1 3300050509 Bacteria 748
870 nmdc:mga06r32_201249_c1 3300050510 Bacteria 1979
871 nmdc:mga06r32_283173_c1 3300050510 Bacteria 1645
872 nmdc:mga06r32_37338_c1 3300050510 Bacteria 4596
873 nmdc:mga06r32_660417_c1 3300050510 Bacteria 1013
874 nmdc:mga06r32_76978_c1 3300050510 Bacteria 3240
875 nmdc:mga08y16_130554_c1 3300050511 Bacteria 2613
876 nmdc:mga08y16_15088_c1 3300050511 Bacteria 8124
877 nmdc:mga08y16_26115_c1 3300050511 Bacteria 6161
878 nmdc:mga08y16_32274_c1 3300050511 Bacteria 5507
879 nmdc:mga08y16_367935_c1 3300050511 Bacteria 1475
880 nmdc:mga08y16_441695_c1 3300050511 Bacteria 1328
881 nmdc:mga08y16_5069_c1 3300050511 Bacteria 13770
882 nmdc:mga08y16_53981_c1 3300050511 Bacteria 4200
883 nmdc:mga08y16_60740_c1 3300050511 Bacteria 3947
884 nmdc:mga08y16_70972_c1 3300050511 Bacteria 3630
885 nmdc:mga08y16_9318_c1 3300050511 Bacteria 10297
886 nmdc:mga0n895_11825_c1 3300050512 Bacteria 7805
887 nmdc:mga0n895_14275_c1 3300050512 Bacteria 7207
888 nmdc:mga0n895_14685_c1 3300050512 Bacteria 7122
889 nmdc:mga0n895_39050_c1 3300050512 Bacteria 4603
890 nmdc:mga0n895_508129_c1 3300050512 Bacteria 1214
891 nmdc:mga0n895_81867_c1 3300050512 Bacteria 3217
892 nmdc:mga0rr50_11399_c1 3300050513 Bacteria 5690
893 nmdc:mga0rr50_12325_c1 3300050513 Bacteria 5521
894 nmdc:mga0rr50_179444_c1 3300050513 Bacteria 1730
895 nmdc:mga0rr50_219746_c1 3300050513 Bacteria 1568
896 nmdc:mga0rr50_29180_c1 3300050513 Bacteria 3887
897 nmdc:mga0rr50_392331_c1 3300050513 Bacteria 1172
898 nmdc:mga08x19_118754_c1 3300050514 Bacteria 1770
899 nmdc:mga08x19_436872_c1 3300050514 Bacteria 920
900 nmdc:mga08x19_447156_c1 3300050514 Bacteria 909
901 nmdc:mga0a205_11933_c1 3300050515 Bacteria 8024
902 nmdc:mga0a205_124073_c1 3300050515 Bacteria 2482
903 nmdc:mga0a205_129148_c1 3300050515 Bacteria 2428
904 nmdc:mga0a205_24177_c1 3300050515 Bacteria 5771
905 nmdc:mga0a205_269427_c1 3300050515 Bacteria 1580
906 nmdc:mga0a205_35218_c1 3300050515 Bacteria 4806
907 nmdc:mga0a205_557584_c1 3300050515 Bacteria 1001
908 nmdc:mga0a205_6239_c1 3300050515 Bacteria 10760
909 Ga0495601_0005212 3300053077 Bacteria 7561
910 Ga0495601_0007830 3300053077 Bacteria 6286
911 Ga0495601_0010561 3300053077 Bacteria 5499
912 Ga0495612_0076871 3300053078 Bacteria 1399
913 Ga0495595_0522342 3300053084 Unclassified 605
914 Ga0495619_0007945 3300053085 Bacteria 6712
915 Ga0495619_0031839 3300053085 Bacteria 3419
916 Ga0495619_0080580 3300053085 Bacteria 2191
917 Ga0495619_0081315 3300053085 Bacteria 2181
918 Ga0495619_0144281 3300053085 Bacteria 1641
919 Ga0495619_0169793 3300053085 Bacteria 1508
920 Ga0500628_026346 3300053129 Bacteria 1224
921 Ga0501084_0028505 3300054114 Bacteria 4668
922 Ga0501084_0057135 3300054114 Bacteria 3266
923 Ga0501084_0089962 3300054114 Bacteria 2577
924 Ga0501084_0098659 3300054114 Bacteria 2453
925 Ga0501084_0104019 3300054114 Bacteria 2385
926 Ga0501084_0114455 3300054114 Bacteria 2268
927 Ga0501084_0304183 3300054114 Bacteria 1347
928 Ga0501084_0339607 3300054114 Bacteria 1269
929 Ga0590071_000285 3300059421 Bacteria 14753
930 Ga0590071_074639 3300059421 Bacteria 838
931 Ga0590074_000015 3300059423 Bacteria 22750
932 Ga0590075_000581 3300059424 Bacteria 9871
933 Ga0590075_014906 3300059424 Bacteria 1903
934 Ga0590075_048484 3300059424 Bacteria 1089
935 Ga0590077_000033 3300059426 Bacteria 32115
936 Ga0590077_011847 3300059426 Bacteria 1803
937 Ga0501082_0046615 3300060353 Bacteria 3736
938 Ga0501082_0141442 3300060353 Bacteria 2088
939 Ga0501082_0445575 3300060353 Unclassified 1131
940 Ga0501082_0546513 3300060353 Bacteria 1013
941 Ga0501082_0731154 3300060353 Bacteria 866
942 Ga0530510_0058102 3300061734 Bacteria 2796
943 Ga0530510_0058659 3300061734 Bacteria 2783
944 Ga0163163_10319221
945 SwRhRL2b_contig_224687
946 Ga0065712_10005799
947 Ga0065712_10068319
948 Ga0065712_10118391
949 Ga0065712_10187218
950 Ga0065712_10196253
951 Ga0065715_10048060
952 Ga0065715_10091005
953 Ga0065715_10112461
954 Ga0065715_10169870
955 Ga0065707_10027061
956 Ga0065707_10116631
957 Ga0065707_10135568
958 Ga0070658_10929916
959 Ga0070676_10042666
960 Ga0070683_100039007
961 Ga0070683_100190149
962 Ga0070683_100266043
963 Ga0070690_100341334
964 Ga0070690_100392007
965 Ga0070670_100003559
966 Ga0070670_100039899
967 Ga0070670_100127671
968 Ga0070670_100294649
969 Ga0068869_100289110
970 Ga0068869_100513927
971 Ga0070666_10146510
972 Ga0070666_10197926
973 Ga0068868_100360888
974 Ga0068868_100592970
975 Ga0070660_100328920
976 Ga0070660_100634773
977 Ga0070689_100023741
978 Ga0070689_100036732
979 Ga0070689_100189876
980 Ga0070689_100253086
981 Ga0070689_100292466
982 Ga0070687_100023806
983 Ga0070687_100065347
984 Ga0070687_100085327
985 Ga0070661_100124975
986 Ga0070661_100153146
987 Ga0070661_100480425
988 Ga0070692_10050502
989 Ga0070692_10408475
990 Ga0070668_100566735
991 Ga0070669_100001192
992 Ga0070669_100196298
993 Ga0070669_100206724
994 Ga0070675_100004767
995 Ga0070675_100018751
996 Ga0070675_100025211
997 Ga0070675_100039446
998 Ga0070675_100052892
999 Ga0070675_100099182
1000 Ga0070675_100130269
1001 Ga0070671_100008027
1002 Ga0070671_100135310
1003 Ga0070671_100282759
1004 Ga0070671_100283934
1005 Ga0070674_100076974
1006 Ga0070674_100246609
1007 Ga0070674_100265243
1008 Ga0070673_100354464
1009 Ga0070673_100568735
1010 Ga0070688_100003358
1011 Ga0070688_100021295
1012 Ga0070688_100068815
1013 Ga0070688_100108829
1014 Ga0070688_100188615
1015 Ga0070688_100222047
1016 Ga0070688_100337295
1017 Ga0070688_100646342
1018 Ga0070659_100133780
1019 Ga0070659_100826626
1020 Ga0070667_100288589
1021 Ga0070667_100356171
1022 Ga0070703_10072328
1023 Ga0070714_100060282
1024 Ga0070713_100016638
1025 Ga0070713_100035741
1026 Ga0070713_100049239
1027 Ga0070710_10215009
1028 Ga0070701_10003212
1029 Ga0070701_10009769
1030 Ga0070701_10135199
1031 Ga0070711_100272823
1032 Ga0070705_100001554
1033 Ga0070705_100056157
1034 Ga0070705_100137619
1035 Ga0070705_100287578
1036 Ga0070705_100311013
1037 Ga0070705_100431267
1038 Ga0070700_100279054
1039 Ga0070694_100001263
1040 Ga0070694_100007236
1041 Ga0070694_100027390
1042 Ga0070694_100206827
1043 Ga0070694_100308907
1044 Ga0070708_100303276
1045 Ga0070708_100499868
1046 Ga0070678_100009889
1047 Ga0070678_100199692
1048 Ga0070662_100053625
1049 Ga0070662_100094078
1050 Ga0070662_100186977
1051 Ga0070681_10061568
1052 Ga0070681_10061685
1053 Ga0070681_10425882
1054 Ga0068867_100008016
1055 Ga0068867_100025755
1056 Ga0068867_100380655
1057 Ga0070685_10362560
1058 Ga0070685_10460187
1059 Ga0070706_100216068
1060 Ga0070706_100448936
1061 Ga0070707_100019482
1062 Ga0070707_100134012
1063 Ga0070707_100773280
1064 Ga0070698_100006494
1065 Ga0070698_100065906
1066 Ga0070698_100715412
1067 Ga0070698_101084913
1068 Ga0070699_100004881
1069 Ga0070699_100017419
1070 Ga0070699_100124525
1071 Ga0070679_100309434
1072 Ga0070684_100049817
1073 Ga0070684_100362021
1074 Ga0070697_100099942
1075 Ga0068853_100471334
1076 Ga0070672_100009511
1077 Ga0070672_100054107
1078 Ga0070672_100138442
1079 Ga0070672_100167482
1080 Ga0070672_100211586
1081 Ga0070686_100015831
1082 Ga0070686_100050173
1083 Ga0070686_100063048
1084 Ga0070686_100077071
1085 Ga0070686_100087763
1086 Ga0070686_100393654
1087 Ga0070686_100723474
1088 Ga0070695_100000155
1089 Ga0070695_100044069
1090 Ga0070695_100107179
1091 Ga0070696_100001294
1092 Ga0070696_100005218
1093 Ga0070696_100191885
1094 Ga0070696_100293452
1095 Ga0070693_100028292
1096 Ga0070665_100042506
1097 Ga0070704_100001112
1098 Ga0070704_100008387
1099 Ga0070704_100024108
1100 Ga0070704_100031640
1101 Ga0070704_100066963
1102 Ga0068855_100035013
1103 Ga0070664_100020599
1104 Ga0070664_100103208
1105 Ga0070664_100214249
1106 Ga0070664_100301652
1107 Ga0070664_100349960
1108 Ga0070664_100952105
1109 Ga0068857_100017945
1110 Ga0068857_100062740
1111 Ga0068857_100512689
1112 Ga0068854_100046162
1113 Ga0068854_100664281
1114 Ga0070702_100015756
1115 Ga0070702_100025236
1116 Ga0070702_100088811
1117 Ga0068852_100149818
1118 Ga0068852_100168337
1119 Ga0068852_100553603
1120 Ga0068859_100012705
1121 Ga0068859_100016091
1122 Ga0068859_100034153
1123 Ga0068859_100036299
1124 Ga0068859_100125215
1125 Ga0068859_100140560
1126 Ga0068859_100371448
1127 Ga0068859_100574617
1128 Ga0068859_100685629
1129 Ga0068864_100005121
1130 Ga0068864_100231322
1131 Ga0068864_100281368
1132 Ga0068866_10099278
1133 Ga0068866_10286870
1134 Ga0068866_10395589
1135 Ga0068861_100005603
1136 Ga0068861_100083929
1137 Ga0068861_100122766
1138 Ga0068861_100958146
1139 Ga0068870_10002305
1140 Ga0068870_10473270
1141 Ga0068863_100066757
1142 Ga0068863_100253325
1143 Ga0068863_100623853
1144 Ga0068858_100087895
1145 Ga0068858_100272720
1146 Ga0068860_100070898
1147 Ga0068860_100081629
1148 Ga0068860_100623677
1149 Ga0068862_100001571
1150 Ga0068862_100032736
1151 Ga0068862_100201759
1152 Ga0081539_10057781
1153 Ga0070717_10030097
1154 Ga0070717_10139117
1155 Ga0075365_10024339
1156 Ga0075365_10049158
1157 Ga0075368_10019135
1158 Ga0075363_100249459
1159 Ga0075364_10003175
1160 Ga0075364_10005410
1161 Ga0075362_10001764
1162 Ga0075367_10000956
1163 Ga0075367_10019460
1164 Ga0075367_10055547
1165 Ga0075366_10004154
1166 Ga0075366_10010229
1167 Ga0075366_10073877
1168 Ga0097621_100006115
1169 Ga0097621_100011860
1170 Ga0097621_100148338
1171 Ga0097621_100388781
1172 Ga0097621_100494976
1173 Ga0097621_100886749
1174 Ga0075370_10115131
1175 Ga0075370_10163256
1176 Ga0068871_100014418
1177 Ga0068871_100307225
1178 Ga0068871_100682446
1179 Ga0075428_100000080
1180 Ga0075428_100007739
1181 Ga0075428_100011749
1182 Ga0075428_100381162
1183 Ga0075428_100554161
1184 Ga0075430_100005792
1185 Ga0075430_100073140
1186 Ga0075430_100106541
1187 Ga0075431_100008574
1188 Ga0075431_100013190
1189 Ga0075431_100038850
1190 Ga0075431_100039560
1191 Ga0075431_100118566
1192 Ga0075431_100300211
1193 Ga0075431_100350200
1194 Ga0075431_100592658
1195 Ga0075433_10024458
1196 Ga0075433_10026221
1197 Ga0075433_10031125
1198 Ga0075433_10045521
1199 Ga0075433_10094226
1200 Ga0075433_10161982
1201 Ga0075433_10187164
1202 Ga0075433_10314697
1203 Ga0075434_100000553
1204 Ga0075434_100002096
1205 Ga0075434_100013870
1206 Ga0075434_100082612
1207 Ga0075434_100136515
1208 Ga0075434_100158591
1209 Ga0075434_100217689
1210 Ga0075434_100327937
1211 Ga0075434_101575187
1212 Ga0075429_100000411
1213 Ga0075429_100002380
1214 Ga0075429_100168313
1215 Ga0075429_100473069
1216 Ga0075429_100516588
1217 Ga0068865_100033239
1218 Ga0068865_100037421
1219 Ga0068865_100423713
1220 Ga0068865_100506171
1221 Ga0075436_100009367
1222 Ga0097620_100012707
1223 Ga0097620_100016090
1224 Ga0097620_100034155
1225 Ga0097620_100036299
1226 Ga0097620_100125212
1227 Ga0097620_100140566
1228 Ga0097620_100371462
1229 Ga0097620_100574633
1230 Ga0097620_100685585
1231 Ga0097620_101273303
1232 Ga0075435_100032757
1233 Ga0075435_100048422
1234 Ga0075435_100069579
1235 Ga0075435_100573364
1236 Ga0105240_10061210
1237 Ga0105240_10107198
1238 Ga0105240_10481857
1239 Ga0105240_10487651
1240 Ga0111539_10000181
1241 Ga0111539_10003328
1242 Ga0111539_10010704
1243 Ga0111539_10032870
1244 Ga0111539_10060627
1245 Ga0111539_10064925
1246 Ga0111539_10068797
1247 Ga0111539_10102283
1248 Ga0111539_10105503
1249 Ga0111539_10113240
1250 Ga0111539_10286102
1251 Ga0111539_10504554
1252 Ga0111539_10522733
1253 Ga0111539_10540685
1254 Ga0105245_10047995
1255 Ga0105245_10177792
1256 Ga0105245_10452405
1257 Ga0105245_10706767
1258 Ga0114129_10000077
1259 Ga0114129_10000588
1260 Ga0114129_10003634
1261 Ga0114129_10006879
1262 Ga0114129_10012882
1263 Ga0114129_10016230
1264 Ga0114129_10026556
1265 Ga0114129_10033253
1266 Ga0114129_10036869
1267 Ga0114129_10047465
1268 Ga0114129_10061111
1269 Ga0114129_10268119
1270 Ga0114129_10497111
1271 Ga0114129_10591516
1272 Ga0105243_10030455
1273 Ga0105243_10202052
1274 Ga0105243_10745867
1275 Ga0105241_10496136
1276 Ga0105242_10035658
1277 Ga0105242_10060137
1278 Ga0105242_10085479
1279 Ga0105242_10570311
1280 Ga0105248_10001783
1281 Ga0105248_10028705
1282 Ga0105248_10043880
1283 Ga0105248_10571491
1284 Ga0105248_11116924
1285 Ga0105238_10912607
1286 Ga0105249_10015855
1287 Ga0105249_10030475
1288 Ga0105249_10364799
1289 Ga0105249_10418439
1290 Ga0105249_10453569
1291 Ga0105249_10477083
1292 Ga0105239_10057239
1293 Ga0105246_10744349
1294 Ga0157370_10132577
1295 Ga0157370_10236131
1296 Ga0157370_10650577
1297 Ga0157369_10571656
1298 Ga0157374_10138269
1299 Ga0157374_10320816
1300 Ga0157378_10005712
1301 Ga0157378_10304141
1302 Ga0157378_10412655
1303 Ga0157378_10536262
1304 Ga0157378_10679256
1305 Ga0163162_10014459
1306 Ga0163162_10038225
1307 Ga0163162_10052516
1308 Ga0163162_10209555
1309 Ga0157372_10118289
1310 Ga0157375_10062943
1311 Ga0157375_10072886
1312 Ga0157375_10134551
1313 Ga0157375_10244951
1314 Ga0157375_10357766
1315 Ga0163163_10187271
1316 Ga0163163_10261806
1317 Ga0157380_10012368
1318 Ga0157380_10056519
1319 Ga0157380_10146864
1320 Ga0157380_10343415
1321 Ga0157380_10499715
1322 Ga0157377_10125511
1323 Ga0157377_10227050
1324 Ga0157379_10044810
1325 Ga0157379_10083900
1326 Ga0157379_10484048
1327 Ga0157376_10006410
1328 Ga0157376_10084075
1329 Ga0157376_10100674
1330 Ga0157376_10382588
1331 Ga0157376_10526560
1332 Ga0163161_10263471
1333 Ga0163161_10398143
1334 Ga0163161_10534819
1335 Ga0207653_10035053
1336 Ga0207688_10086295
1337 Ga0207680_10027965
1338 Ga0207680_10091936
1339 Ga0207680_10176286
1340 Ga0207647_10109589
1341 Ga0207699_10003552
1342 Ga0207645_10016102
1343 Ga0207645_10031135
1344 Ga0207643_10002349
1345 Ga0207643_10008592
1346 Ga0207643_10054088
1347 Ga0207654_10139446
1348 Ga0207707_10139082
1349 Ga0207695_10034780
1350 Ga0207663_10195720
1351 Ga0207663_10255856
1352 Ga0207660_10427119
1353 Ga0207662_10001582
1354 Ga0207662_10046981
1355 Ga0207662_10073938
1356 Ga0207662_10324300
1357 Ga0207662_10588627
1358 Ga0207657_10348607
1359 Ga0207657_10398182
1360 Ga0207649_10155336
1361 Ga0207649_10577483
1362 Ga0207652_10407014
1363 Ga0207646_10037575
1364 Ga0207646_10115530
1365 Ga0207681_10016410
1366 Ga0207681_10021025
1367 Ga0207681_10199037
1368 Ga0207681_10241962
1369 Ga0207681_10809668
1370 Ga0207694_10666967
1371 Ga0207650_10041327
1372 Ga0207650_10096032
1373 Ga0207650_10153075
1374 Ga0207650_10412284
1375 Ga0207650_10615201
1376 Ga0207659_10026354
1377 Ga0207659_10027377
1378 Ga0207659_10037184
1379 Ga0207659_10084529
1380 Ga0207659_10470886
1381 Ga0207659_10636842
1382 Ga0207687_10086026
1383 Ga0207687_10239220
1384 Ga0207687_10447958
1385 Ga0207687_10489605
1386 Ga0207644_10004067
1387 Ga0207690_10246255
1388 Ga0207690_10704153
1389 Ga0207706_10087843
1390 Ga0207706_10135755
1391 Ga0207706_10221835
1392 Ga0207706_10576416
1393 Ga0207706_10709069
1394 Ga0207706_10728009
1395 Ga0207706_10757547
1396 Ga0207686_10014564
1397 Ga0207686_10111732
1398 Ga0207686_10159570
1399 Ga0207709_10018785
1400 Ga0207709_10370551
1401 Ga0207670_10041339
1402 Ga0207670_10070850
1403 Ga0207670_10071188
1404 Ga0207670_10095177
1405 Ga0207670_10125539
1406 Ga0207670_10441083
1407 Ga0207669_10107189
1408 Ga0207669_10149772
1409 Ga0207669_10334498
1410 Ga0207669_10353706
1411 Ga0207669_10388073
1412 Ga0207669_10408986
1413 Ga0207669_10608767
1414 Ga0207704_10020443
1415 Ga0207704_10034742
1416 Ga0207704_10040070
1417 Ga0207704_10975261
1418 Ga0207691_10011389
1419 Ga0207691_10059256
1420 Ga0207691_10075799
1421 Ga0207691_10101483
1422 Ga0207691_10164058
1423 Ga0207691_10204818
1424 Ga0207691_10496694
1425 Ga0207711_10026089
1426 Ga0207711_10076984
1427 Ga0207711_10140910
1428 Ga0207711_10160307
1429 Ga0207711_10353439
1430 Ga0207711_10373391
1431 Ga0207711_10403301
1432 Ga0207711_10485578
1433 Ga0207689_10117260
1434 Ga0207689_10226728
1435 Ga0207689_10250637
1436 Ga0207689_10293884
1437 Ga0207689_10499670
1438 Ga0207661_10051968
1439 Ga0207661_10490962
1440 Ga0207661_10718776
1441 Ga0207661_10929459
1442 Ga0207679_10089983
1443 Ga0207679_10586394
1444 Ga0207651_10027850
1445 Ga0207651_10490847
1446 Ga0207651_10617471
1447 Ga0207712_10004752
1448 Ga0207712_10022403
1449 Ga0207712_10027653
1450 Ga0207712_10287361
1451 Ga0207712_10294581
1452 Ga0207712_10787569
1453 Ga0207712_10857752
1454 Ga0207668_10622071
1455 Ga0207640_10240148
1456 Ga0207677_10104272
1457 Ga0207703_10041795
1458 Ga0207703_10044794
1459 Ga0207703_10235854
1460 Ga0207639_10980133
1461 Ga0207678_10022903
1462 Ga0207708_10003536
1463 Ga0207708_10031394
1464 Ga0207708_10037230
1465 Ga0207708_10164071
1466 Ga0207708_10180659
1467 Ga0207708_10340647
1468 Ga0207641_10042332
1469 Ga0207641_10244273
1470 Ga0207641_10609695
1471 Ga0207648_10000280
1472 Ga0207648_10007517
1473 Ga0207648_10041218
1474 Ga0207648_10071112
1475 Ga0207676_10108370
1476 Ga0207676_10136973
1477 Ga0207676_10144253
1478 Ga0207676_10458705
1479 Ga0207676_11093996
1480 Ga0207674_10009475
1481 Ga0207674_10022765
1482 Ga0207674_10119857
1483 Ga0207675_100005112
1484 Ga0207675_100083061
1485 Ga0207675_100172708
1486 Ga0207675_100373631
1487 Ga0207675_100973952
1488 Ga0207683_10020578
1489 Ga0207683_10145954
1490 Ga0207683_10248578
1491 Ga0207698_10642897
1492 Ga0209813_10023152
1493 Ga0207428_10000481
1494 Ga0207428_10001864
1495 Ga0207428_10044629
1496 Ga0207428_10437738
1497 Ga0268266_10024911
1498 Ga0268266_10044867
1499 Ga0268265_10003942
1500 Ga0268265_10270121
1501 Ga0268264_10060528
1502 Ga0265318_10024289
1503 Ga0265320_10088558
1504 Ga0307408_100147607
1505 Ga0307408_100313125
1506 Ga0307408_100377843
1507 Ga0265314_10043744
1508 Ga0265314_10133049
1509 Ga0316576_10457356
1510 Ga0307405_10014290
1511 Ga0307405_10030263
1512 Ga0307413_10007133
1513 Ga0307413_10255044
1514 Ga0307410_10038888
1515 Ga0307406_10029126
1516 Ga0307407_10001825
1517 Ga0307407_10004309
1518 Ga0307412_10023631
1519 Ga0307412_10036619
1520 Ga0307412_10074102
1521 Ga0307412_10146602
1522 Ga0307412_10292430
1523 Ga0307409_100019385
1524 Ga0307409_100256740
1525 Ga0307409_100300983
1526 Ga0307409_100335145
1527 Ga0307409_100363790
1528 Ga0307409_100419698
1529 Ga0307409_100559338
1530 Ga0307416_100003790
1531 Ga0307416_100005453
1532 Ga0307416_100982596
1533 Ga0307416_100994316
1534 Ga0307414_10630168
1535 Ga0307411_10005511
1536 Ga0307411_10206692
1537 Ga0307411_10280783
1538 Ga0307415_100006479
1539 Ga0307415_100113769
1540 Ga0307415_100114952
1541 Ga0373940_0099819
1542 Ga0373923_0076546
1543 Ga0373936_0339762
1544 Ga0373954_0359474
1545 Ga0373943_0109142
1546 Ga0373946_0105501
1547 Ga0373961_0046368
1548 Ga0373931_0015783
1549 Ga0373935_0247994
1550 Ga0373935_0333781
1551 Ga0373935_0408362
1552 Ga0373947_0051242
1553 Ga0373937_0000331
1554 Ga0373937_0002679
1555 Ga0373937_0464518
1556 Ga0373925_0002901
1557 Ga0373925_0053130
1558 Ga0373925_0120091
1559 Ga0373925_0495706
1560 Ga0439439_0012889
1561 Ga0439439_0062527
1562 Ga0439453_0003363
1563 Ga0451851_1307948
1564 Ga0451853_1137327
1565 Ga0451853_3884947
1566 Ga0439433_0018868
1567 Ga0439449_0152433
1568 Ga0450919_007521
1569 Ga0450923_000364
1570 Ga0450923_023929
1571 Ga0450905_022591
1572 Ga0439446_0079078
1573 Ga0439434_0160785
1574 Ga0439435_0015022
1575 Ga0439444_0019354
1576 Ga0439464_0002548
1577 Ga0439460_0076504
1578 Ga0451577_0127264
1579 Ga0439440_0006996
1580 Ga0453684_0208890
1581 Ga0451576_0007793
1582 Ga0451576_0037518
1583 Ga0451576_0068252
1584 Ga0451576_0416757
1585 Ga0451576_0427722
1586 Ga0466967_0735901
1587 Ga0495592_0062440
1588 Ga0495603_0085517
1589 Ga0495629_0060677
1590 Ga0495653_0238590
1591 Ga0495653_0429298
1592 Ga0495585_0256045
1593 Ga0495608_0007910
1594 Ga0495628_0022709
1595 Ga0495628_0320231
1596 Ga0495628_0623368
1597 Ga0495630_0045249
1598 Ga0495630_0428841
1599 Ga0495644_0210210
1600 Ga0495652_0108062
1601 Ga0495640_0062378
1602 Ga0495586_0101309
1603 Ga0495586_0148312
1604 Ga0495598_0066352
1605 Ga0495621_0003001
1606 Ga0495621_0015215
1607 Ga0495645_0027871
1608 Ga0495645_0231430
1609 Ga0495667_0016149
1610 Ga0495656_0057241
1611 Ga0495668_0168269
1612 Ga0495659_0003284
1613 Ga0495659_0004990
1614 Ga0495659_0006283
1615 Ga0495659_0019033
1616 Ga0495659_0023193
1617 Ga0495659_0035520
1618 Ga0495659_0050804
1619 Ga0495659_0238851
1620 Ga0495657_0223034
1621 Ga0495599_0018444
1622 Ga0495599_0117264
1623 Ga0495647_0091655
1624 Ga0495658_0045179
1625 Ga0495658_0145302
1626 Ga0495658_0337581
1627 Ga0495658_0426657
1628 Ga0495669_0010879
1629 Ga0495669_0017880
1630 Ga0495669_0056676
1631 Ga0495669_0322108
1632 Ga0495613_0433216
1633 Ga0495624_0211727
1634 Ga0495670_0016466
1635 Ga0495600_0152136
1636 Ga0495581_0089234
1637 Ga0495604_0008192
1638 Ga0495636_0015023
1639 Ga0495636_0018647
1640 Ga0495636_0180423
1641 Ga0495636_0224005
1642 Ga0495674_0192210
1643 Ga0495674_0844523
1644 Ga0495680_0102764
1645 Ga0495675_0047881
1646 Ga0495677_0212785
1647 Ga0495685_040282
1648 Ga0495684_0002104
1649 Ga0495684_0049826
1650 Ga0495684_0082999
1651 Ga0495614_0246829
1652 Ga0496100_0002571
1653 Ga0496100_0094383
1654 Ga0496101_0003307
1655 Ga0496101_0873282
1656 Ga0496102_0210783
1657 Ga0496102_0398701
1658 Ga0496103_0115968
1659 Ga0496104_0001613
1660 Ga0496104_0009116
1661 Ga0496104_0032813
1662 Ga0496104_0607206
1663 Ga0496105_0018568
1664 Ga0496105_0072552
1665 Ga0496105_0136391
1666 Ga0496105_0229430
1667 Ga0496106_0014232
1668 Ga0496106_0086529
1669 Ga0496106_0166491
1670 Ga0496106_0453823
1671 Ga0496107_0115119
1672 Ga0496108_0005680
1673 Ga0496108_0161987
1674 Ga0496109_0090194
1675 Ga0496109_0158080
1676 Ga0496110_0004936
1677 Ga0496111_0096230
1678 Ga0496112_0033130
1679 Ga0496112_0036483
1680 Ga0496112_0065888
1681 Ga0496112_0702110
1682 Ga0496113_0073429
1683 Ga0496113_0403400
1684 Ga0496114_0002181
1685 Ga0496114_0085941
1686 Ga0496114_0158178
1687 Ga0496114_0243608
1688 Ga0496114_0327215
1689 Ga0496115_0048059
1690 Ga0496115_0084681
1691 Ga0501299_005369
1692 Ga0501031_0515174
1693 Ga0501032_0500126
1694 Ga0501034_0018184
1695 Ga0501034_0042500
1696 Ga0501036_0015943
1697 Ga0501036_0141912
1698 Ga0501036_0443467
1699 Ga0501036_1014222
1700 Ga0501038_0232976
1701 Ga0501038_0370354
1702 Ga0501039_0998112
1703 Ga0501040_0008320
1704 Ga0501040_0017256
1705 Ga0501040_0259945
1706 Ga0501040_0362702
1707 Ga0501040_0544823
1708 Ga0501040_0586379
1709 Ga0501041_0015275
1710 Ga0501041_0149228
1711 Ga0501041_0171564
1712 Ga0501042_0001638
1713 Ga0501042_0043380
1714 Ga0501042_0236204
1715 Ga0501046_0028234
1716 Ga0501046_0247244
1717 Ga0501047_0049969
1718 Ga0501047_0321258
1719 Ga0501048_0080187
1720 Ga0501048_0143341
1721 Ga0501048_0234502
1722 Ga0501067_0097126
1723 Ga0501068_0050075
1724 Ga0501069_0197146
1725 Ga0501070_0302914
1726 Ga0501071_0038259
1727 Ga0501071_0058442
1728 Ga0501071_0058523
1729 Ga0501071_0598993
1730 Ga0501071_0724409
1731 Ga0501072_0012685
1732 Ga0501072_0014894
1733 Ga0501073_0013885
1734 Ga0501074_0496205
1735 Ga0501075_0015338
1736 Ga0501075_0049553
1737 Ga0501075_0178315
1738 Ga0501075_0202961
1739 Ga0501075_0252762
1740 Ga0501075_0470578
1741 Ga0501075_0617090
1742 Ga0501076_0002778
1743 Ga0501076_0010090
1744 Ga0501076_0012910
1745 Ga0501076_0016934
1746 Ga0501076_0100696
1747 Ga0501076_0147979
1748 Ga0501076_0173361
1749 Ga0501077_0066857
1750 Ga0501077_0079082
1751 Ga0501077_0138837
1752 Ga0501202_022025
1753 Ga0501217_069652
1754 Ga0501251_021843
1755 Ga0501079_0007074
1756 Ga0501079_0069120
1757 Ga0501079_0085833
1758 Ga0501079_0127187
1759 Ga0501079_0137823
1760 Ga0501079_0328046
1761 Ga0501080_0145212
1762 Ga0501080_0190087
1763 Ga0501080_0359029
1764 Ga0501080_0398811
1765 Ga0501081_0014225
1766 Ga0501081_0032890
1767 Ga0501081_0083098
1768 Ga0501081_0100027
1769 Ga0501081_0204735
1770 Ga0501081_0419085
1771 Ga0501081_0760477
1772 Ga0501083_0080892
1773 Ga0501035_0738773
1774 Ga0501035_0812648
1775 Ga0501045_0057442
1776 Ga0501045_0061388
1777 Ga0501045_0234482
1778 Ga0501045_0370687
1779 nmdc:mga03683_1673_c1
1780 nmdc:mga00v17_15337_c1
1781 nmdc:mga00v17_25504_c1
1782 nmdc:mga0k408_23586_c1
1783 nmdc:mga0k408_34131_c1
1784 nmdc:mga0k408_7204_c1
1785 nmdc:mga06z11_127650_c1
1786 nmdc:mga06z11_46065_c1
1787 nmdc:mga06z11_56461_c1
1788 nmdc:mga04h51_26601_c1
1789 nmdc:mga07m45_117684_c1
1790 nmdc:mga05p37_1139_c1
1791 nmdc:mga05p37_115855_c1
1792 nmdc:mga05p37_150129_c1
1793 nmdc:mga05p37_17501_c1
1794 nmdc:mga05p37_22982_c1
1795 nmdc:mga05p37_30845_c1
1796 nmdc:mga05p37_3120_c1
1797 nmdc:mga05p37_326875_c1
1798 nmdc:mga05p37_49_c1
1799 nmdc:mga05p37_5323_c1
1800 nmdc:mga05p37_65392_c1
1801 nmdc:mga05p37_69457_c1
1802 nmdc:mga05p37_70509_c1
1803 nmdc:mga05p37_94802_c1
1804 nmdc:mga09592_2888_c1
1805 nmdc:mga09592_544578_c1
1806 nmdc:mga09592_5817_c1
1807 nmdc:mga09592_597434_c1
1808 nmdc:mga09592_723868_c1
1809 nmdc:mga0qj67_17549_c1
1810 nmdc:mga0qj67_19329_c1
1811 nmdc:mga0qj67_49772_c1
1812 nmdc:mga0qj67_797377_c1
1813 nmdc:mga06r32_201249_c1
1814 nmdc:mga06r32_283173_c1
1815 nmdc:mga06r32_37338_c1
1816 nmdc:mga06r32_660417_c1
1817 nmdc:mga06r32_76978_c1
1818 nmdc:mga08y16_130554_c1
1819 nmdc:mga08y16_15088_c1
1820 nmdc:mga08y16_26115_c1
1821 nmdc:mga08y16_32274_c1
1822 nmdc:mga08y16_367935_c1
1823 nmdc:mga08y16_441695_c1
1824 nmdc:mga08y16_5069_c1
1825 nmdc:mga08y16_53981_c1
1826 nmdc:mga08y16_60740_c1
1827 nmdc:mga08y16_70972_c1
1828 nmdc:mga08y16_9318_c1
1829 nmdc:mga0n895_11825_c1
1830 nmdc:mga0n895_14275_c1
1831 nmdc:mga0n895_14685_c1
1832 nmdc:mga0n895_39050_c1
1833 nmdc:mga0n895_508129_c1
1834 nmdc:mga0n895_81867_c1
1835 nmdc:mga0rr50_11399_c1
1836 nmdc:mga0rr50_12325_c1
1837 nmdc:mga0rr50_179444_c1
1838 nmdc:mga0rr50_219746_c1
1839 nmdc:mga0rr50_29180_c1
1840 nmdc:mga0rr50_392331_c1
1841 nmdc:mga08x19_118754_c1
1842 nmdc:mga08x19_436872_c1
1843 nmdc:mga08x19_447156_c1
1844 nmdc:mga0a205_11933_c1
1845 nmdc:mga0a205_124073_c1
1846 nmdc:mga0a205_129148_c1
1847 nmdc:mga0a205_24177_c1
1848 nmdc:mga0a205_269427_c1
1849 nmdc:mga0a205_35218_c1
1850 nmdc:mga0a205_557584_c1
1851 nmdc:mga0a205_6239_c1
1852 Ga0495601_0005212
1853 Ga0495601_0007830
1854 Ga0495601_0010561
1855 Ga0495612_0076871
1856 Ga0495595_0522342
1857 Ga0495619_0007945
1858 Ga0495619_0031839
1859 Ga0495619_0080580
1860 Ga0495619_0081315
1861 Ga0495619_0144281
1862 Ga0495619_0169793
1863 Ga0500628_026346
1864 Ga0501084_0028505
1865 Ga0501084_0057135
1866 Ga0501084_0089962
1867 Ga0501084_0098659
1868 Ga0501084_0104019
1869 Ga0501084_0114455
1870 Ga0501084_0304183
1871 Ga0501084_0339607
1872 Ga0590071_000285
1873 Ga0590071_074639
1874 Ga0590074_000015
1875 Ga0590075_000581
1876 Ga0590075_014906
1877 Ga0590075_048484
1878 Ga0590077_000033
1879 Ga0590077_011847
1880 Ga0501082_0046615
1881 Ga0501082_0141442
1882 Ga0501082_0445575
1883 Ga0501082_0546513
1884 Ga0501082_0731154
1885 Ga0530510_0058102
1886 Ga0530510_0058659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

45

176

0.9

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

47

232

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.9558 2 188
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.9289 3 186
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.9262 2 188
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.9086 2 188
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.8815 2 188
ID Description Score Start End Superfamily
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9558 2 188 3.40.50.1820
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9289 3 186 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9086 2 188 3.40.50.1820
af_Q54TH2_43_268_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9024 2 189 3.40.50.1820
2wtnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8797 2 188 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1F2T4R4-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9992 1 196
AF-A0A3D1IJW1-F1-model_v4 Alpha/beta hydrolase 0.9984 2 140 GO:0016787
AF-A0A2D8R3M7-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9977 2 191
AF-A0A2D6R1L1-F1-model_v4 Alpha/beta hydrolase 0.9975 17 192 GO:0016787
AF-A0A2V8GXT7-F1-model_v4 Alpha/beta hydrolase 0.9969 2 125 GO:0016787

Map