F486378

General Info

Members Datasets Scaffolds Average Seq Length
943 251 941 110

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100468315|Ga0070659_1004683152
Length 114
Sequence MYTFLLIVQTIVATSLVLGVGGSSSGFMTARGAADLLTRSTSVLAAIFIVLAILLAAIAGVSRKPTTIDTSLVNQMAPTVPASGSAVPGQQPAQQQPQNGAPANQTAPAVPLQQ

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
158 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
159 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
238 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
239 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
240 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
241 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
244 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
245 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
246 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.74
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 3.92
Rhizosphere 95.55
Stem 0
Stem Tuber 0.11
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1006508 3300001915 Bacteria 2341
2 JGI24747J21853_1004086 3300001978 Bacteria 1291
3 JGI24740J21852_10005667 3300001979 Bacteria 5257
4 JGI24739J22299_10005106 3300001989 Bacteria 4998
5 JGI24739J22299_10005954 3300001989 Bacteria 4615
6 JGI24739J22299_10011414 3300001989 Bacteria 3280
7 JGI24737J22298_10000422 3300001990 Bacteria 14521
8 JGI24743J22301_10006458 3300001991 Bacteria 2000
9 JGI24735J21928_10002159 3300002067 Bacteria 6907
10 JGI24735J21928_10007891 3300002067 Bacteria 3458
11 JGI24735J21928_10055911 3300002067 Bacteria 1136
12 JGI24738J21930_10001939 3300002075 Bacteria 5575
13 JGI24738J21930_10004649 3300002075 Bacteria 3347
14 Ga0070658_10012936 3300005327 Bacteria 6699
15 Ga0070658_10015921 3300005327 Bacteria 6014
16 Ga0070658_10023474 3300005327 Bacteria 4949
17 Ga0070658_10048731 3300005327 Bacteria 3430
18 Ga0070658_10106727 3300005327 Bacteria 2317
19 Ga0070658_10107796 3300005327 Bacteria 2305
20 Ga0070658_10130728 3300005327 Bacteria 2092
21 Ga0070658_10194692 3300005327 Bacteria 1709
22 Ga0070658_10218497 3300005327 Bacteria 1611
23 Ga0070658_10493840 3300005327 Bacteria 1057
24 Ga0070658_11081880 3300005327 Bacteria 697
25 Ga0070658_11132446 3300005327 Bacteria 680
26 Ga0070658_11177128 3300005327 Bacteria 666
27 Ga0070658_11251927 3300005327 Bacteria 645
28 Ga0070658_11878739 3300005327 Unclassified 517
29 Ga0070676_10070423 3300005328 Bacteria 2098
30 Ga0070676_10101812 3300005328 Bacteria 1775
31 Ga0070676_10167729 3300005328 Bacteria 1418
32 Ga0070676_10295220 3300005328 Bacteria 1097
33 Ga0070676_11151739 3300005328 Bacteria 588
34 Ga0070683_100000644 3300005329 Bacteria 25133
35 Ga0070683_100012323 3300005329 Bacteria 7427
36 Ga0070683_100040893 3300005329 Bacteria 4263
37 Ga0070683_100083467 3300005329 Bacteria 2992
38 Ga0070683_100432648 3300005329 Bacteria 1255
39 Ga0070683_101531359 3300005329 Bacteria 641
40 Ga0070690_100012038 3300005330 Bacteria 5079
41 Ga0070690_100137374 3300005330 Bacteria 1656
42 Ga0070690_100168729 3300005330 Bacteria 1505
43 Ga0070670_100011264 3300005331 Bacteria 7646
44 Ga0070670_100027542 3300005331 Bacteria 4888
45 Ga0070670_100044913 3300005331 Bacteria 3798
46 Ga0070670_100829920 3300005331 Bacteria 836
47 Ga0070677_10348195 3300005333 Bacteria 767
48 Ga0070666_10000346 3300005335 Bacteria 29073
49 Ga0070666_10016985 3300005335 Bacteria 4661
50 Ga0070666_10018053 3300005335 Bacteria 4530
51 Ga0070666_10022405 3300005335 Bacteria 4101
52 Ga0070666_10185932 3300005335 Bacteria 1459
53 Ga0070680_100004746 3300005336 Bacteria 10232
54 Ga0070680_100195661 3300005336 Bacteria 1704
55 Ga0070680_100288469 3300005336 Bacteria 1391
56 Ga0070682_100017248 3300005337 Bacteria 4207
57 Ga0070682_100095445 3300005337 Bacteria 1953
58 Ga0070682_100107007 3300005337 Bacteria 1857
59 Ga0068868_100033307 3300005338 Bacteria 3971
60 Ga0070660_100000350 3300005339 Bacteria 30817
61 Ga0070660_100007777 3300005339 Bacteria 7475
62 Ga0070660_100008243 3300005339 Bacteria 7283
63 Ga0070660_100020719 3300005339 Bacteria 4838
64 Ga0070660_100027712 3300005339 Bacteria 4230
65 Ga0070660_100050213 3300005339 Bacteria 3209
66 Ga0070660_100062648 3300005339 Bacteria 2890
67 Ga0070660_100120369 3300005339 Bacteria 2095
68 Ga0070687_100370419 3300005343 Bacteria 930
69 Ga0070661_100000536 3300005344 Bacteria 29149
70 Ga0070661_100003274 3300005344 Bacteria 11184
71 Ga0070661_100004872 3300005344 Bacteria 9242
72 Ga0070661_100006434 3300005344 Bacteria 8098
73 Ga0070661_100007774 3300005344 Bacteria 7398
74 Ga0070661_100020420 3300005344 Bacteria 4723
75 Ga0070661_100043316 3300005344 Bacteria 3288
76 Ga0070661_100048009 3300005344 Bacteria 3125
77 Ga0070661_100089346 3300005344 Bacteria 2281
78 Ga0070661_100296981 3300005344 Bacteria 1256
79 Ga0070661_100405509 3300005344 Bacteria 1078
80 Ga0070661_100534838 3300005344 Bacteria 941
81 Ga0070692_10076721 3300005345 Bacteria 1792
82 Ga0070692_10274597 3300005345 Bacteria 1019
83 Ga0070692_10545273 3300005345 Bacteria 759
84 Ga0070692_10787483 3300005345 Bacteria 648
85 Ga0070668_100364073 3300005347 Bacteria 1227
86 Ga0070668_100429802 3300005347 Bacteria 1132
87 Ga0070668_100520799 3300005347 Bacteria 1032
88 Ga0070669_100155690 3300005353 Bacteria 1772
89 Ga0070675_100116649 3300005354 Bacteria 2265
90 Ga0070675_100219839 3300005354 Bacteria 1654
91 Ga0070671_100004623 3300005355 Bacteria 10913
92 Ga0070671_100012009 3300005355 Bacteria 6967
93 Ga0070671_100020835 3300005355 Bacteria 5348
94 Ga0070671_100026271 3300005355 Bacteria 4784
95 Ga0070671_100062212 3300005355 Bacteria 3109
96 Ga0070671_100070915 3300005355 Bacteria 2907
97 Ga0070671_100071087 3300005355 Bacteria 2904
98 Ga0070671_100072787 3300005355 Bacteria 2870
99 Ga0070674_100014903 3300005356 Bacteria 4841
100 Ga0070674_100036773 3300005356 Bacteria 3289
101 Ga0070674_100059398 3300005356 Bacteria 2662
102 Ga0070673_100017318 3300005364 Bacteria 5119
103 Ga0070673_100058691 3300005364 Bacteria 3043
104 Ga0070673_100081879 3300005364 Bacteria 2618
105 Ga0070673_100285111 3300005364 Bacteria 1450
106 Ga0070673_100600052 3300005364 Unclassified 1004
107 Ga0070673_100685767 3300005364 Bacteria 940
108 Ga0070659_100000139 3300005366 Bacteria 55743
109 Ga0070659_100002650 3300005366 Bacteria 12741
110 Ga0070659_100017396 3300005366 Bacteria 5409
111 Ga0070659_100035232 3300005366 Bacteria 3897
112 Ga0070659_100061107 3300005366 Bacteria 2977
113 Ga0070659_100072894 3300005366 Bacteria 2733
114 Ga0070659_100086055 3300005366 Bacteria 2515
115 Ga0070659_100274356 3300005366 Bacteria 1402
116 Ga0070659_100468315 3300005366 Bacteria 1071
117 Ga0070659_100580947 3300005366 Bacteria 961
118 Ga0070659_100617677 3300005366 Bacteria 933
119 Ga0070659_101149083 3300005366 Unclassified 685
120 Ga0070659_101495815 3300005366 Bacteria 601
121 Ga0070667_100009737 3300005367 Bacteria 7967
122 Ga0070667_100011453 3300005367 Bacteria 7333
123 Ga0070667_100011779 3300005367 Bacteria 7226
124 Ga0070667_100024847 3300005367 Bacteria 4978
125 Ga0070667_100029058 3300005367 Bacteria 4605
126 Ga0070667_101157351 3300005367 Bacteria 724
127 Ga0070667_101247933 3300005367 Bacteria 696
128 Ga0070714_100035769 3300005435 Bacteria 4163
129 Ga0070714_100128294 3300005435 Bacteria 2264
130 Ga0070714_100186984 3300005435 Bacteria 1888
131 Ga0070713_100091068 3300005436 Bacteria 2623
132 Ga0070713_100186690 3300005436 Bacteria 1866
133 Ga0070711_100705544 3300005439 Bacteria 850
134 Ga0070663_100004900 3300005455 Bacteria 7902
135 Ga0070663_100016745 3300005455 Bacteria 4770
136 Ga0070663_100039757 3300005455 Bacteria 3289
137 Ga0070663_100045477 3300005455 Bacteria 3102
138 Ga0070663_100061660 3300005455 Bacteria 2701
139 Ga0070663_100096737 3300005455 Bacteria 2196
140 Ga0070663_100244932 3300005455 Bacteria 1416
141 Ga0070663_100635171 3300005455 Bacteria 901
142 Ga0070678_100128031 3300005456 Bacteria 2013
143 Ga0070678_100387912 3300005456 Bacteria 1210
144 Ga0070662_100000024 3300005457 Bacteria 91042
145 Ga0070662_100001022 3300005457 Bacteria 17123
146 Ga0070662_100008953 3300005457 Bacteria 6525
147 Ga0070662_100016566 3300005457 Bacteria 4950
148 Ga0070662_100031305 3300005457 Bacteria 3733
149 Ga0070662_100085640 3300005457 Bacteria 2355
150 Ga0070662_100189414 3300005457 Bacteria 1626
151 Ga0070662_100227490 3300005457 Bacteria 1491
152 Ga0070662_100486441 3300005457 Bacteria 1028
153 Ga0070662_100910392 3300005457 Bacteria 751
154 Ga0070662_100929896 3300005457 Bacteria 743
155 Ga0070662_101603118 3300005457 Bacteria 562
156 Ga0070681_10007319 3300005458 Bacteria 10778
157 Ga0070681_10039471 3300005458 Bacteria 4732
158 Ga0070681_10181234 3300005458 Bacteria 2028
159 Ga0070681_11076860 3300005458 Bacteria 724
160 Ga0068867_100028916 3300005459 Bacteria 3991
161 Ga0070679_100016119 3300005530 Bacteria 7200
162 Ga0070679_100171166 3300005530 Bacteria 2144
163 Ga0070679_100234572 3300005530 Bacteria 1794
164 Ga0070679_100276772 3300005530 Bacteria 1631
165 Ga0070679_100570217 3300005530 Bacteria 1075
166 Ga0070679_100917471 3300005530 Bacteria 819
167 Ga0070684_100033437 3300005535 Bacteria 4390
168 Ga0070684_100043691 3300005535 Bacteria 3871
169 Ga0070684_100132721 3300005535 Bacteria 2247
170 Ga0070684_100474304 3300005535 Bacteria 1158
171 Ga0070684_101507210 3300005535 Bacteria 634
172 Ga0070684_101529843 3300005535 Bacteria 629
173 Ga0068853_100000342 3300005539 Bacteria 32471
174 Ga0068853_100009064 3300005539 Bacteria 8011
175 Ga0068853_100087423 3300005539 Bacteria 2735
176 Ga0068853_100102888 3300005539 Bacteria 2528
177 Ga0068853_100158027 3300005539 Bacteria 2044
178 Ga0068853_100209354 3300005539 Bacteria 1777
179 Ga0068853_100947246 3300005539 Bacteria 828
180 Ga0068853_101286542 3300005539 Bacteria 707
181 Ga0070672_100006707 3300005543 Bacteria 7760
182 Ga0070672_100021543 3300005543 Bacteria 4719
183 Ga0070672_100042656 3300005543 Bacteria 3493
184 Ga0070672_100974369 3300005543 Bacteria 751
185 Ga0070672_101554667 3300005543 Bacteria 593
186 Ga0070686_100066840 3300005544 Bacteria 2340
187 Ga0070686_100870845 3300005544 Bacteria 731
188 Ga0070686_101499532 3300005544 Bacteria 568
189 Ga0070696_100250881 3300005546 Bacteria 1338
190 Ga0070693_100000870 3300005547 Bacteria 13452
191 Ga0070693_100339225 3300005547 Unclassified 1025
192 Ga0070665_100014111 3300005548 Bacteria 8029
193 Ga0070665_100023145 3300005548 Bacteria 6257
194 Ga0070665_100863825 3300005548 Bacteria 918
195 Ga0070665_102363366 3300005548 Bacteria 534
196 Ga0068855_100015488 3300005563 Bacteria 9181
197 Ga0068855_100017881 3300005563 Bacteria 8519
198 Ga0068855_100021596 3300005563 Bacteria 7721
199 Ga0068855_100027432 3300005563 Bacteria 6812
200 Ga0068855_100042302 3300005563 Bacteria 5398
201 Ga0068855_100092966 3300005563 Bacteria 3478
202 Ga0068855_100257759 3300005563 Bacteria 1944
203 Ga0068855_101853963 3300005563 Bacteria 612
204 Ga0070664_100000082 3300005564 Bacteria 60083
205 Ga0070664_100000446 3300005564 Bacteria 31189
206 Ga0070664_100001856 3300005564 Bacteria 16919
207 Ga0070664_100002946 3300005564 Bacteria 13768
208 Ga0070664_100029443 3300005564 Bacteria 4578
209 Ga0070664_100031851 3300005564 Bacteria 4408
210 Ga0070664_100072114 3300005564 Bacteria 2961
211 Ga0070664_100086865 3300005564 Bacteria 2702
212 Ga0070664_100122336 3300005564 Bacteria 2279
213 Ga0070664_101233790 3300005564 Bacteria 706
214 Ga0068857_100004407 3300005577 Bacteria 11899
215 Ga0068857_100004836 3300005577 Bacteria 11412
216 Ga0068857_100005624 3300005577 Bacteria 10716
217 Ga0068857_100097208 3300005577 Bacteria 2639
218 Ga0068857_100239752 3300005577 Bacteria 1660
219 Ga0068857_100640955 3300005577 Bacteria 1006
220 Ga0068857_101215477 3300005577 Bacteria 730
221 Ga0068857_101579937 3300005577 Bacteria 640
222 Ga0068854_100017161 3300005578 Bacteria 4840
223 Ga0068854_100021380 3300005578 Bacteria 4390
224 Ga0068854_100039529 3300005578 Bacteria 3324
225 Ga0068854_100165928 3300005578 Bacteria 1714
226 Ga0068854_100272826 3300005578 Bacteria 1359
227 Ga0068854_100279902 3300005578 Bacteria 1343
228 Ga0068854_100374544 3300005578 Bacteria 1172
229 Ga0068854_100421151 3300005578 Bacteria 1109
230 Ga0068854_100454289 3300005578 Bacteria 1071
231 Ga0068854_100880824 3300005578 Bacteria 786
232 Ga0068856_100002271 3300005614 Bacteria 19834
233 Ga0068856_100033360 3300005614 Bacteria 5040
234 Ga0068856_100041454 3300005614 Bacteria 4524
235 Ga0068856_100048587 3300005614 Bacteria 4182
236 Ga0068856_100176690 3300005614 Bacteria 2148
237 Ga0068856_100426828 3300005614 Bacteria 1346
238 Ga0068856_100536307 3300005614 Bacteria 1191
239 Ga0068856_100569955 3300005614 Bacteria 1153
240 Ga0068856_101842204 3300005614 Bacteria 616
241 Ga0068852_100000442 3300005616 Bacteria 27467
242 Ga0068852_100004452 3300005616 Bacteria 9902
243 Ga0068852_100011074 3300005616 Bacteria 6770
244 Ga0068852_100013406 3300005616 Bacteria 6274
245 Ga0068852_100025443 3300005616 Bacteria 4796
246 Ga0068852_100054137 3300005616 Bacteria 3458
247 Ga0068852_100158396 3300005616 Bacteria 2111
248 Ga0068852_100406327 3300005616 Bacteria 1340
249 Ga0068852_100443746 3300005616 Bacteria 1283
250 Ga0068852_100680628 3300005616 Bacteria 1038
251 Ga0068852_100790748 3300005616 Bacteria 962
252 Ga0068852_101903420 3300005616 Bacteria 617
253 Ga0068859_100032384 3300005617 Bacteria 5252
254 Ga0068859_100628853 3300005617 Bacteria 1166
255 Ga0068864_100023721 3300005618 Bacteria 5154
256 Ga0068864_100328318 3300005618 Bacteria 1438
257 Ga0068866_11323862 3300005718 Bacteria 524
258 Ga0068861_100078926 3300005719 Bacteria 2572
259 Ga0068861_101723312 3300005719 Bacteria 620
260 Ga0068851_10002364 3300005834 Bacteria 8299
261 Ga0068851_10024058 3300005834 Bacteria 2981
262 Ga0068851_10030480 3300005834 Bacteria 2675
263 Ga0068851_10037997 3300005834 Bacteria 2414
264 Ga0068851_10038992 3300005834 Bacteria 2386
265 Ga0068851_10054222 3300005834 Bacteria 2042
266 Ga0068863_100010487 3300005841 Bacteria 9007
267 Ga0068863_100020844 3300005841 Bacteria 6259
268 Ga0068863_100275138 3300005841 Bacteria 1630
269 Ga0068858_100001843 3300005842 Bacteria 21605
270 Ga0068858_100011050 3300005842 Bacteria 8534
271 Ga0068858_100218889 3300005842 Bacteria 1803
272 Ga0068858_100439125 3300005842 Bacteria 1257
273 Ga0068860_100014099 3300005843 Bacteria 7841
274 Ga0068860_100039315 3300005843 Bacteria 4524
275 Ga0068860_100667711 3300005843 Bacteria 1048
276 Ga0068862_100073889 3300005844 Bacteria 2946
277 Ga0068862_100505483 3300005844 Bacteria 1148
278 Ga0068862_100587191 3300005844 Bacteria 1068
279 Ga0081539_10052112 3300005985 Bacteria 2301
280 Ga0070716_100044871 3300006173 Bacteria 2478
281 Ga0070716_100252767 3300006173 Bacteria 1202
282 Ga0075366_10709121 3300006195 Bacteria 625
283 Ga0097621_100009747 3300006237 Bacteria 6991
284 Ga0097621_100011685 3300006237 Bacteria 6479
285 Ga0097621_100074060 3300006237 Bacteria 2820
286 Ga0097621_100230514 3300006237 Bacteria 1617
287 Ga0068871_100011780 3300006358 Bacteria 6426
288 Ga0068871_100013252 3300006358 Bacteria 6113
289 Ga0068871_100036381 3300006358 Bacteria 3920
290 Ga0097620_100032383 3300006931 Bacteria 5252
291 Ga0097620_100330704 3300006931 Bacteria 1618
292 Ga0097620_100628902 3300006931 Bacteria 1166
293 Ga0075435_101756348 3300007076 Bacteria 544
294 Ga0105240_10031411 3300009093 Bacteria 6888
295 Ga0105240_10062809 3300009093 Bacteria 4623
296 Ga0105240_10455216 3300009093 Bacteria 1431
297 Ga0105240_10529078 3300009093 Bacteria 1307
298 Ga0111539_11105191 3300009094 Bacteria 921
299 Ga0105245_10021400 3300009098 Bacteria 5672
300 Ga0105245_10093834 3300009098 Bacteria 2766
301 Ga0105247_11029079 3300009101 Bacteria 645
302 Ga0105243_10029641 3300009148 Bacteria 4209
303 Ga0105243_10104737 3300009148 Bacteria 2355
304 Ga0105241_10014435 3300009174 Bacteria 5784
305 Ga0105241_10271244 3300009174 Bacteria 1446
306 Ga0105241_10925430 3300009174 Bacteria 811
307 Ga0105241_11532887 3300009174 Bacteria 642
308 Ga0105241_11970045 3300009174 Bacteria 574
309 Ga0105241_12324651 3300009174 Unclassified 534
310 Ga0105248_10000059 3300009177 Bacteria 137176
311 Ga0105248_10004017 3300009177 Bacteria 16262
312 Ga0105248_10010113 3300009177 Bacteria 10392
313 Ga0105248_10029474 3300009177 Bacteria 6122
314 Ga0105248_10071025 3300009177 Bacteria 3910
315 Ga0105248_10178351 3300009177 Bacteria 2394
316 Ga0105248_10559644 3300009177 Bacteria 1290
317 Ga0105248_10925557 3300009177 Bacteria 984
318 Ga0105248_10928840 3300009177 Bacteria 983
319 Ga0105248_13214743 3300009177 Bacteria 520
320 Ga0105237_10025986 3300009545 Bacteria 5986
321 Ga0105237_10158420 3300009545 Bacteria 2261
322 Ga0105238_10009851 3300009551 Bacteria 9574
323 Ga0105238_10009986 3300009551 Bacteria 9518
324 Ga0105249_12427064 3300009553 Bacteria 597
325 Ga0105032_114107 3300009979 Bacteria 637
326 Ga0105239_10267295 3300010375 Bacteria 1923
327 Ga0105239_10354061 3300010375 Bacteria 1658
328 Ga0105239_10539368 3300010375 Bacteria 1328
329 Ga0105246_11262195 3300011119 Bacteria 683
330 Ga0157373_10021409 3300013100 Bacteria 4697
331 Ga0157373_10027757 3300013100 Bacteria 4084
332 Ga0157373_10028490 3300013100 Bacteria 4029
333 Ga0157373_10031145 3300013100 Bacteria 3839
334 Ga0157373_10031266 3300013100 Bacteria 3832
335 Ga0157373_10031869 3300013100 Bacteria 3796
336 Ga0157373_10061564 3300013100 Unclassified 2658
337 Ga0157373_10131278 3300013100 Bacteria 1762
338 Ga0157373_10152744 3300013100 Bacteria 1624
339 Ga0157373_10570416 3300013100 Bacteria 822
340 Ga0157373_10718841 3300013100 Bacteria 733
341 Ga0157373_10721087 3300013100 Bacteria 732
342 Ga0157373_10997743 3300013100 Bacteria 625
343 Ga0157373_11176616 3300013100 Bacteria 577
344 Ga0157373_11572309 3300013100 Unclassified 503
345 Ga0157371_10001377 3300013102 Bacteria 25491
346 Ga0157371_10025702 3300013102 Bacteria 4288
347 Ga0157371_10031308 3300013102 Bacteria 3832
348 Ga0157371_10041133 3300013102 Bacteria 3300
349 Ga0157371_10076620 3300013102 Bacteria 2368
350 Ga0157371_10106222 3300013102 Bacteria 1992
351 Ga0157371_10108056 3300013102 Bacteria 1974
352 Ga0157371_10179820 3300013102 Bacteria 1513
353 Ga0157371_10265627 3300013102 Bacteria 1238
354 Ga0157371_10499551 3300013102 Bacteria 898
355 Ga0157371_10541687 3300013102 Bacteria 862
356 Ga0157371_10550291 3300013102 Bacteria 855
357 Ga0157371_10782361 3300013102 Bacteria 718
358 Ga0157370_10004183 3300013104 Bacteria 16700
359 Ga0157370_10015902 3300013104 Bacteria 7635
360 Ga0157370_10018260 3300013104 Bacteria 7054
361 Ga0157370_10042309 3300013104 Bacteria 4391
362 Ga0157370_11230264 3300013104 Bacteria 675
363 Ga0157369_10000457 3300013105 Bacteria 54100
364 Ga0157369_10041372 3300013105 Bacteria 5030
365 Ga0157369_10228825 3300013105 Bacteria 1944
366 Ga0157369_10378868 3300013105 Bacteria 1468
367 Ga0157369_10552822 3300013105 Bacteria 1190
368 Ga0157369_11147941 3300013105 Bacteria 794
369 Ga0157369_11384412 3300013105 Bacteria 716
370 Ga0157369_11467256 3300013105 Bacteria 694
371 Ga0157369_12594729 3300013105 Bacteria 512
372 Ga0157374_10009657 3300013296 Bacteria 8284
373 Ga0157374_10181851 3300013296 Bacteria 2054
374 Ga0157374_10490086 3300013296 Bacteria 1233
375 Ga0157374_10600473 3300013296 Bacteria 1111
376 Ga0157378_10430906 3300013297 Bacteria 1305
377 Ga0163162_10007460 3300013306 Bacteria 10637
378 Ga0163162_10148629 3300013306 Bacteria 2460
379 Ga0157372_10023084 3300013307 Bacteria 6741
380 Ga0157372_10053618 3300013307 Bacteria 4495
381 Ga0157372_10093824 3300013307 Bacteria 3416
382 Ga0157372_10173303 3300013307 Bacteria 2496
383 Ga0157372_10604915 3300013307 Bacteria 1278
384 Ga0157372_10907361 3300013307 Bacteria 1022
385 Ga0157372_12361487 3300013307 Bacteria 611
386 Ga0157372_12637339 3300013307 Bacteria 577
387 Ga0157372_12896285 3300013307 Bacteria 549
388 Ga0157375_10004536 3300013308 Bacteria 12064
389 Ga0157375_10234026 3300013308 Bacteria 1996
390 Ga0157375_10479198 3300013308 Bacteria 1409
391 Ga0163163_10001588 3300014325 Bacteria 19116
392 Ga0163163_10011294 3300014325 Bacteria 8094
393 Ga0163163_10046192 3300014325 Bacteria 4277
394 Ga0163163_11625893 3300014325 Bacteria 707
395 Ga0157380_10001828 3300014326 Bacteria 14057
396 Ga0157380_10972460 3300014326 Bacteria 880
397 Ga0157380_11724043 3300014326 Bacteria 684
398 Ga0182008_10195689 3300014497 Bacteria 1027
399 Ga0182008_10252637 3300014497 Bacteria 910
400 Ga0157379_10045768 3300014968 Bacteria 3906
401 Ga0157379_10053629 3300014968 Bacteria 3602
402 Ga0157379_10500506 3300014968 Bacteria 1126
403 Ga0157376_10159828 3300014969 Bacteria 2041
404 Ga0197907_10114585 3300020069 Bacteria 993
405 Ga0197907_10985389 3300020069 Bacteria 1332
406 Ga0206356_11773638 3300020070 Bacteria 1731
407 Ga0206354_11653543 3300020081 Bacteria 1313
408 Ga0206353_10677093 3300020082 Bacteria 2628
409 Ga0213876_10058141 3300021384 Bacteria 2041
410 Ga0224712_10237661 3300022467 Bacteria 838
411 Ga0224712_10345548 3300022467 Bacteria 702
412 Ga0207656_10089896 3300025321 Bacteria 1392
413 Ga0207656_10372467 3300025321 Bacteria 715
414 Ga0207642_10821860 3300025899 Bacteria 592
415 Ga0207680_10000874 3300025903 Bacteria 14229
416 Ga0207680_10055789 3300025903 Bacteria 2383
417 Ga0207680_10059338 3300025903 Bacteria 2323
418 Ga0207647_10019612 3300025904 Bacteria 4545
419 Ga0207647_10032503 3300025904 Bacteria 3350
420 Ga0207645_10005127 3300025907 Bacteria 9585
421 Ga0207645_10094922 3300025907 Bacteria 1920
422 Ga0207645_10390059 3300025907 Bacteria 936
423 Ga0207705_10000062 3300025909 Bacteria 149432
424 Ga0207705_10000192 3300025909 Bacteria 62246
425 Ga0207705_10001710 3300025909 Bacteria 17412
426 Ga0207705_10022394 3300025909 Bacteria 4505
427 Ga0207705_10036827 3300025909 Bacteria 3501
428 Ga0207705_10113817 3300025909 Unclassified 2001
429 Ga0207705_10309627 3300025909 Bacteria 1212
430 Ga0207705_10328303 3300025909 Bacteria 1176
431 Ga0207705_10372648 3300025909 Bacteria 1102
432 Ga0207707_10404128 3300025912 Bacteria 1172
433 Ga0207707_11107345 3300025912 Bacteria 645
434 Ga0207707_11372860 3300025912 Bacteria 565
435 Ga0207707_11663277 3300025912 Bacteria 501
436 Ga0207695_10018769 3300025913 Bacteria 7982
437 Ga0207671_10041187 3300025914 Bacteria 3418
438 Ga0207671_10457803 3300025914 Bacteria 1016
439 Ga0207693_10008153 3300025915 Bacteria 8586
440 Ga0207660_10003522 3300025917 Bacteria 10202
441 Ga0207660_10030369 3300025917 Bacteria 3714
442 Ga0207660_10119029 3300025917 Bacteria 1998
443 Ga0207660_10607254 3300025917 Bacteria 891
444 Ga0207657_10000015 3300025919 Bacteria 175776
445 Ga0207657_10000924 3300025919 Bacteria 31097
446 Ga0207657_10001620 3300025919 Bacteria 24220
447 Ga0207657_10011425 3300025919 Bacteria 8815
448 Ga0207657_10014904 3300025919 Bacteria 7559
449 Ga0207657_10044733 3300025919 Bacteria 3891
450 Ga0207657_10049034 3300025919 Bacteria 3683
451 Ga0207657_10092466 3300025919 Bacteria 2521
452 Ga0207657_10150698 3300025919 Bacteria 1895
453 Ga0207657_10157627 3300025919 Bacteria 1845
454 Ga0207649_10000264 3300025920 Bacteria 41423
455 Ga0207649_10002895 3300025920 Bacteria 9443
456 Ga0207649_10032781 3300025920 Bacteria 3099
457 Ga0207649_10053105 3300025920 Bacteria 2517
458 Ga0207649_10070690 3300025920 Bacteria 2227
459 Ga0207649_10207302 3300025920 Bacteria 1389
460 Ga0207649_10213874 3300025920 Bacteria 1369
461 Ga0207649_10233182 3300025920 Bacteria 1317
462 Ga0207649_10261086 3300025920 Bacteria 1251
463 Ga0207649_10281478 3300025920 Bacteria 1209
464 Ga0207649_10315132 3300025920 Bacteria 1147
465 Ga0207649_10768683 3300025920 Bacteria 750
466 Ga0207652_10028353 3300025921 Bacteria 4671
467 Ga0207652_10275023 3300025921 Bacteria 1519
468 Ga0207652_10315937 3300025921 Bacteria 1410
469 Ga0207652_10621600 3300025921 Bacteria 968
470 Ga0207652_10759782 3300025921 Bacteria 862
471 Ga0207652_10856952 3300025921 Bacteria 804
472 Ga0207652_11807014 3300025921 Bacteria 516
473 Ga0207681_10060355 3300025923 Bacteria 2603
474 Ga0207681_10087119 3300025923 Bacteria 2221
475 Ga0207650_10006533 3300025925 Bacteria 7952
476 Ga0207650_10027132 3300025925 Bacteria 4096
477 Ga0207650_10047240 3300025925 Bacteria 3172
478 Ga0207650_10222605 3300025925 Bacteria 1519
479 Ga0207650_10768661 3300025925 Bacteria 816
480 Ga0207659_10211331 3300025926 Bacteria 1555
481 Ga0207687_10054425 3300025927 Bacteria 2799
482 Ga0207700_10323958 3300025928 Bacteria 1336
483 Ga0207700_10808072 3300025928 Bacteria 839
484 Ga0207664_10022983 3300025929 Bacteria 4666
485 Ga0207664_10270472 3300025929 Bacteria 1488
486 Ga0207664_10324223 3300025929 Bacteria 1359
487 Ga0207644_10003121 3300025931 Bacteria 10665
488 Ga0207644_10005596 3300025931 Bacteria 8180
489 Ga0207644_10036823 3300025931 Bacteria 3437
490 Ga0207644_10058621 3300025931 Bacteria 2783
491 Ga0207644_10118549 3300025931 Bacteria 2011
492 Ga0207690_10000032 3300025932 Bacteria 152479
493 Ga0207690_10011885 3300025932 Bacteria 5205
494 Ga0207690_10031694 3300025932 Bacteria 3385
495 Ga0207690_10061657 3300025932 Bacteria 2550
496 Ga0207690_10257671 3300025932 Bacteria 1350
497 Ga0207690_10259046 3300025932 Bacteria 1347
498 Ga0207690_10262082 3300025932 Bacteria 1340
499 Ga0207690_10304873 3300025932 Bacteria 1247
500 Ga0207690_10646763 3300025932 Bacteria 866
501 Ga0207690_11001532 3300025932 Bacteria 695
502 Ga0207690_11312423 3300025932 Bacteria 605
503 Ga0207690_11671078 3300025932 Bacteria 532
504 Ga0207706_10000032 3300025933 Bacteria 142723
505 Ga0207706_10036477 3300025933 Bacteria 4367
506 Ga0207706_10061386 3300025933 Bacteria 3310
507 Ga0207706_10147339 3300025933 Bacteria 2071
508 Ga0207706_10307425 3300025933 Bacteria 1381
509 Ga0207706_10625759 3300025933 Bacteria 923
510 Ga0207669_10659457 3300025937 Bacteria 856
511 Ga0207669_10862618 3300025937 Bacteria 754
512 Ga0207665_10032193 3300025939 Bacteria 3472
513 Ga0207665_10041392 3300025939 Bacteria 3076
514 Ga0207691_10037688 3300025940 Bacteria 4476
515 Ga0207691_10362750 3300025940 Bacteria 1238
516 Ga0207691_10415376 3300025940 Bacteria 1147
517 Ga0207711_10000476 3300025941 Bacteria 41373
518 Ga0207711_10003388 3300025941 Bacteria 13815
519 Ga0207711_10003405 3300025941 Bacteria 13768
520 Ga0207711_10331279 3300025941 Bacteria 1408
521 Ga0207711_10726092 3300025941 Unclassified 926
522 Ga0207711_11481784 3300025941 Bacteria 622
523 Ga0207711_11664807 3300025941 Bacteria 581
524 Ga0207661_10007272 3300025944 Bacteria 7877
525 Ga0207661_10074005 3300025944 Bacteria 2792
526 Ga0207661_10384409 3300025944 Bacteria 1271
527 Ga0207679_10002831 3300025945 Bacteria 10761
528 Ga0207679_10008801 3300025945 Bacteria 6436
529 Ga0207679_10019442 3300025945 Bacteria 4562
530 Ga0207679_10029126 3300025945 Bacteria 3841
531 Ga0207679_10031196 3300025945 Bacteria 3729
532 Ga0207679_10060099 3300025945 Bacteria 2822
533 Ga0207679_11002128 3300025945 Bacteria 766
534 Ga0207667_10006833 3300025949 Bacteria 13786
535 Ga0207667_10012957 3300025949 Bacteria 9575
536 Ga0207667_10086411 3300025949 Bacteria 3245
537 Ga0207667_10086548 3300025949 Bacteria 3243
538 Ga0207667_10101868 3300025949 Bacteria 2962
539 Ga0207667_10112445 3300025949 Bacteria 2808
540 Ga0207667_10117262 3300025949 Bacteria 2744
541 Ga0207667_10230328 3300025949 Bacteria 1897
542 Ga0207667_10389942 3300025949 Bacteria 1418
543 Ga0207667_10769372 3300025949 Bacteria 961
544 Ga0207651_10001385 3300025960 Bacteria 10984
545 Ga0207651_10006626 3300025960 Bacteria 6086
546 Ga0207651_10371764 3300025960 Bacteria 1209
547 Ga0207651_10407530 3300025960 Bacteria 1158
548 Ga0207651_11852377 3300025960 Bacteria 543
549 Ga0207668_10062639 3300025972 Bacteria 2620
550 Ga0207668_10116082 3300025972 Bacteria 2018
551 Ga0207668_10222351 3300025972 Bacteria 1517
552 Ga0207668_10312846 3300025972 Bacteria 1300
553 Ga0207640_10005181 3300025981 Bacteria 7091
554 Ga0207640_10025454 3300025981 Bacteria 3583
555 Ga0207640_10036832 3300025981 Bacteria 3074
556 Ga0207640_10188022 3300025981 Bacteria 1554
557 Ga0207640_10597914 3300025981 Bacteria 933
558 Ga0207640_11674363 3300025981 Bacteria 574
559 Ga0207658_10012412 3300025986 Bacteria 5820
560 Ga0207658_10012532 3300025986 Bacteria 5792
561 Ga0207658_10028041 3300025986 Bacteria 3962
562 Ga0207658_10039859 3300025986 Bacteria 3391
563 Ga0207658_11080238 3300025986 Bacteria 733
564 Ga0207658_11827643 3300025986 Bacteria 554
565 Ga0207677_10027828 3300026023 Bacteria 3567
566 Ga0207677_10180400 3300026023 Bacteria 1660
567 Ga0207703_10061367 3300026035 Bacteria 3077
568 Ga0207703_10087145 3300026035 Bacteria 2617
569 Ga0207703_10411617 3300026035 Bacteria 1257
570 Ga0207639_10012166 3300026041 Bacteria 5987
571 Ga0207639_10203897 3300026041 Bacteria 1698
572 Ga0207639_10240540 3300026041 Bacteria 1573
573 Ga0207639_10375496 3300026041 Bacteria 1276
574 Ga0207678_10000716 3300026067 Bacteria 30304
575 Ga0207678_10008290 3300026067 Bacteria 9157
576 Ga0207678_10008664 3300026067 Bacteria 8960
577 Ga0207678_10016250 3300026067 Bacteria 6532
578 Ga0207678_10027597 3300026067 Bacteria 4954
579 Ga0207678_10063448 3300026067 Bacteria 3174
580 Ga0207678_10066035 3300026067 Bacteria 3106
581 Ga0207678_10084766 3300026067 Bacteria 2710
582 Ga0207678_10116085 3300026067 Bacteria 2284
583 Ga0207678_10163220 3300026067 Bacteria 1902
584 Ga0207702_10000072 3300026078 Bacteria 113840
585 Ga0207702_10034947 3300026078 Bacteria 4203
586 Ga0207702_10045035 3300026078 Bacteria 3711
587 Ga0207702_10090641 3300026078 Bacteria 2675
588 Ga0207702_10326691 3300026078 Bacteria 1462
589 Ga0207702_10556833 3300026078 Bacteria 1122
590 Ga0207641_10012508 3300026088 Bacteria 6956
591 Ga0207641_10121830 3300026088 Bacteria 2328
592 Ga0207641_10161978 3300026088 Bacteria 2034
593 Ga0207641_10590610 3300026088 Bacteria 1086
594 Ga0207648_10104585 3300026089 Bacteria 2483
595 Ga0207648_10108667 3300026089 Bacteria 2435
596 Ga0207676_10010149 3300026095 Bacteria 6704
597 Ga0207676_10021705 3300026095 Bacteria 4712
598 Ga0207676_10030671 3300026095 Bacteria 4038
599 Ga0207674_10001057 3300026116 Bacteria 35856
600 Ga0207674_10008780 3300026116 Bacteria 11638
601 Ga0207674_10027289 3300026116 Bacteria 6044
602 Ga0207674_10042347 3300026116 Bacteria 4703
603 Ga0207674_10098050 3300026116 Bacteria 2915
604 Ga0207674_10160114 3300026116 Bacteria 2206
605 Ga0207674_10392382 3300026116 Bacteria 1342
606 Ga0207674_10869939 3300026116 Bacteria 869
607 Ga0207675_100035826 3300026118 Bacteria 4629
608 Ga0207675_100517290 3300026118 Bacteria 1189
609 Ga0207683_10155374 3300026121 Bacteria 2066
610 Ga0207698_10000401 3300026142 Bacteria 25075
611 Ga0207698_10002246 3300026142 Bacteria 11425
612 Ga0207698_10005358 3300026142 Bacteria 7914
613 Ga0207698_10029937 3300026142 Bacteria 3907
614 Ga0207698_10173327 3300026142 Bacteria 1902
615 Ga0207698_10203429 3300026142 Bacteria 1775
616 Ga0207698_10373548 3300026142 Bacteria 1354
617 Ga0207698_10415676 3300026142 Bacteria 1289
618 Ga0207698_11143710 3300026142 Bacteria 792
619 Ga0207698_11273998 3300026142 Bacteria 750
620 Ga0207698_11296417 3300026142 Bacteria 743
621 Ga0207698_11680659 3300026142 Bacteria 650
622 Ga0207698_12498212 3300026142 Bacteria 527
623 Ga0209967_1027559 3300027364 Bacteria 845
624 Ga0210002_1017256 3300027617 Bacteria 1147
625 Ga0209971_1050533 3300027682 Bacteria 1004
626 Ga0209974_10058112 3300027876 Bacteria 1307
627 Ga0268266_10011662 3300028379 Bacteria 7629
628 Ga0268266_10022624 3300028379 Bacteria 5352
629 Ga0268266_10030267 3300028379 Bacteria 4600
630 Ga0268266_12005992 3300028379 Bacteria 552
631 Ga0268265_10020109 3300028380 Bacteria 4655
632 Ga0268265_10417872 3300028380 Bacteria 1244
633 Ga0268265_12000959 3300028380 Bacteria 586
634 Ga0268264_10016442 3300028381 Bacteria 6057
635 Ga0268264_10526155 3300028381 Bacteria 1157
636 Ga0314311_1052117 3300030733 Bacteria 1142
637 Ga0316178_1013034 3300030735 Bacteria 1117
638 Ga0316183_1159422 3300030742 Bacteria 1242
639 Ga0316182_1233204 3300030745 Bacteria 1947
640 Ga0307408_100049375 3300031548 Bacteria 3022
641 Ga0307408_100091306 3300031548 Bacteria 2299
642 Ga0307408_100109614 3300031548 Bacteria 2118
643 Ga0307408_100118065 3300031548 Bacteria 2050
644 Ga0307408_100235975 3300031548 Bacteria 1500
645 Ga0307408_100343269 3300031548 Bacteria 1264
646 Ga0307408_100434449 3300031548 Bacteria 1135
647 Ga0307408_100841569 3300031548 Bacteria 836
648 Ga0307408_101407127 3300031548 Bacteria 657
649 Ga0307405_10039077 3300031731 Bacteria 2865
650 Ga0307405_10050678 3300031731 Bacteria 2572
651 Ga0307405_10080307 3300031731 Bacteria 2129
652 Ga0307405_10082817 3300031731 Bacteria 2101
653 Ga0307405_10118719 3300031731 Bacteria 1806
654 Ga0307405_10650852 3300031731 Bacteria 867
655 Ga0307413_10047533 3300031824 Bacteria 2559
656 Ga0307413_10111561 3300031824 Bacteria 1832
657 Ga0307413_10246025 3300031824 Bacteria 1323
658 Ga0307413_10487100 3300031824 Bacteria 987
659 Ga0307413_10528779 3300031824 Bacteria 952
660 Ga0307413_11285145 3300031824 Bacteria 639
661 Ga0307410_10062242 3300031852 Bacteria 2556
662 Ga0307410_10086647 3300031852 Bacteria 2212
663 Ga0307410_10111353 3300031852 Bacteria 1981
664 Ga0307410_10119223 3300031852 Bacteria 1921
665 Ga0307410_10184133 3300031852 Bacteria 1583
666 Ga0307410_10287056 3300031852 Bacteria 1293
667 Ga0307410_10407712 3300031852 Bacteria 1100
668 Ga0307406_10022227 3300031901 Bacteria 3760
669 Ga0307406_10022776 3300031901 Bacteria 3719
670 Ga0307406_10152900 3300031901 Bacteria 1648
671 Ga0307406_10249767 3300031901 Bacteria 1335
672 Ga0307406_10421956 3300031901 Bacteria 1063
673 Ga0307406_10481494 3300031901 Bacteria 1002
674 Ga0307406_11610412 3300031901 Bacteria 574
675 Ga0307407_10056015 3300031903 Bacteria 2280
676 Ga0307407_10237943 3300031903 Bacteria 1240
677 Ga0307407_10332743 3300031903 Bacteria 1069
678 Ga0307407_10530843 3300031903 Bacteria 867
679 Ga0307407_10661251 3300031903 Bacteria 783
680 Ga0307412_10006486 3300031911 Bacteria 6617
681 Ga0307412_10006588 3300031911 Bacteria 6575
682 Ga0307412_10063942 3300031911 Bacteria 2484
683 Ga0307412_10070448 3300031911 Bacteria 2383
684 Ga0307412_10178547 3300031911 Bacteria 1594
685 Ga0307412_10496664 3300031911 Bacteria 1015
686 Ga0307412_11123318 3300031911 Bacteria 700
687 Ga0307412_12200223 3300031911 Bacteria 513
688 Ga0307409_100019902 3300031995 Bacteria 4558
689 Ga0307409_100057294 3300031995 Bacteria 3018
690 Ga0307409_100263662 3300031995 Bacteria 1583
691 Ga0307409_101140802 3300031995 Bacteria 801
692 Ga0307409_101735873 3300031995 Bacteria 653
693 Ga0307416_100006186 3300032002 Bacteria 7467
694 Ga0307416_100048216 3300032002 Bacteria 3377
695 Ga0307416_100064621 3300032002 Bacteria 3003
696 Ga0307416_100243883 3300032002 Bacteria 1743
697 Ga0307416_100263414 3300032002 Bacteria 1686
698 Ga0307416_100431112 3300032002 Bacteria 1365
699 Ga0307416_100500248 3300032002 Bacteria 1280
700 Ga0307416_101518818 3300032002 Bacteria 775
701 Ga0307416_103276237 3300032002 Bacteria 542
702 Ga0307414_10005634 3300032004 Bacteria 6909
703 Ga0307414_10006399 3300032004 Bacteria 6565
704 Ga0307414_10101017 3300032004 Bacteria 2170
705 Ga0307414_10269319 3300032004 Bacteria 1425
706 Ga0307414_10537695 3300032004 Bacteria 1039
707 Ga0307411_10006500 3300032005 Bacteria 5856
708 Ga0307411_10133436 3300032005 Bacteria 1818
709 Ga0307411_10140610 3300032005 Bacteria 1779
710 Ga0307411_10171765 3300032005 Bacteria 1635
711 Ga0307411_10180986 3300032005 Bacteria 1600
712 Ga0307411_10181714 3300032005 Bacteria 1597
713 Ga0307411_10487207 3300032005 Bacteria 1039
714 Ga0307411_10644141 3300032005 Bacteria 916
715 Ga0307411_11003098 3300032005 Bacteria 747
716 Ga0307411_11260355 3300032005 Bacteria 672
717 Ga0307415_100009297 3300032126 Bacteria 5498
718 Ga0307415_100012333 3300032126 Bacteria 4938
719 Ga0307415_100048836 3300032126 Bacteria 2857
720 Ga0307415_100079878 3300032126 Bacteria 2331
721 Ga0307415_100239797 3300032126 Bacteria 1466
722 Ga0307415_100298067 3300032126 Bacteria 1334
723 Ga0307415_100465738 3300032126 Bacteria 1096
724 Ga0307415_100490420 3300032126 Bacteria 1072
725 Ga0307415_100623974 3300032126 Bacteria 963
726 Ga0307415_101889983 3300032126 Bacteria 579
727 Ga0373949_0222039 3300035090 Bacteria 575
728 Ga0373941_0212516 3300035115 Unclassified 740
729 Ga0373960_0048676 3300035121 Bacteria 1251
730 Ga0373960_0294607 3300035121 Bacteria 602
731 Ga0373943_0002991 3300035170 Bacteria 7677
732 Ga0373943_0701021 3300035170 Bacteria 600
733 Ga0373942_0063085 3300035207 Bacteria 1066
734 Ga0373961_0106608 3300035241 Bacteria 913
735 Ga0373962_0056396 3300035242 Bacteria 1144
736 Ga0373931_0163811 3300035691 Bacteria 1305
737 Ga0373947_0225381 3300035725 Bacteria 1233
738 Ga0373925_0017811 3300037068 Bacteria 5154
739 Ga0395899_0000804 3300037312 Bacteria 30745
740 Ga0395899_0008182 3300037312 Bacteria 8057
741 Ga0395899_0018328 3300037312 Bacteria 5322
742 Ga0395899_0178023 3300037312 Bacteria 1494
743 Ga0395899_0253989 3300037312 Bacteria 1205
744 Ga0395899_0550667 3300037312 Bacteria 741
745 Ga0395899_0684988 3300037312 Bacteria 644
746 Ga0395899_0705834 3300037312 Bacteria 632
747 Ga0395900_0001255 3300037418 Bacteria 31098
748 Ga0395900_0024744 3300037418 Bacteria 6145
749 Ga0395900_0025967 3300037418 Bacteria 5998
750 Ga0395900_0028095 3300037418 Bacteria 5760
751 Ga0395900_0039865 3300037418 Bacteria 4841
752 Ga0395900_0046815 3300037418 Bacteria 4453
753 Ga0395900_0050547 3300037418 Bacteria 4281
754 Ga0395900_0059192 3300037418 Bacteria 3943
755 Ga0395900_0143347 3300037418 Bacteria 2445
756 Ga0395900_0168130 3300037418 Bacteria 2234
757 Ga0395900_0271030 3300037418 Bacteria 1692
758 Ga0395900_0352040 3300037418 Bacteria 1446
759 Ga0395900_0637246 3300037418 Bacteria 1003
760 Ga0395900_0934257 3300037418 Bacteria 789
761 Ga0395898_0004581 3300037466 Bacteria 15090
762 Ga0395898_0013178 3300037466 Bacteria 8517
763 Ga0395898_0019790 3300037466 Bacteria 6845
764 Ga0395898_0021025 3300037466 Bacteria 6620
765 Ga0395898_0063939 3300037466 Bacteria 3570
766 Ga0395898_0080689 3300037466 Bacteria 3137
767 Ga0395898_0099013 3300037466 Bacteria 2800
768 Ga0395898_0145415 3300037466 Bacteria 2269
769 Ga0395898_0231311 3300037466 Bacteria 1763
770 Ga0395898_0233448 3300037466 Bacteria 1754
771 Ga0395898_0286871 3300037466 Bacteria 1570
772 Ga0395898_0413431 3300037466 Bacteria 1286
773 Ga0395898_0793655 3300037466 Bacteria 887
774 Ga0395898_1126888 3300037466 Bacteria 717
775 Ga0395905_0001765 3300037471 Bacteria 25140
776 Ga0395905_0006827 3300037471 Bacteria 11423
777 Ga0395905_0018990 3300037471 Bacteria 6519
778 Ga0395905_0025496 3300037471 Bacteria 5576
779 Ga0395905_0033709 3300037471 Bacteria 4809
780 Ga0395905_0038084 3300037471 Bacteria 4512
781 Ga0395905_0040973 3300037471 Bacteria 4345
782 Ga0395905_0044686 3300037471 Bacteria 4156
783 Ga0395905_0045444 3300037471 Bacteria 4118
784 Ga0395905_0047313 3300037471 Bacteria 4031
785 Ga0395905_0072818 3300037471 Bacteria 3221
786 Ga0395905_0094601 3300037471 Bacteria 2803
787 Ga0395905_0119430 3300037471 Bacteria 2477
788 Ga0395905_0132180 3300037471 Bacteria 2347
789 Ga0395905_0161418 3300037471 Bacteria 2106
790 Ga0395905_0279521 3300037471 Bacteria 1555
791 Ga0395905_0461580 3300037471 Bacteria 1168
792 Ga0395905_0649891 3300037471 Bacteria 957
793 Ga0395905_0794708 3300037471 Bacteria 849
794 Ga0395905_1227166 3300037471 Bacteria 653
795 Ga0395905_1463891 3300037471 Bacteria 587
796 Ga0395901_0001481 3300038443 Bacteria 24431
797 Ga0395901_0005056 3300038443 Bacteria 13319
798 Ga0395901_0010390 3300038443 Bacteria 9430
799 Ga0395901_0020018 3300038443 Bacteria 6846
800 Ga0395901_0023789 3300038443 Bacteria 6282
801 Ga0395901_0037448 3300038443 Bacteria 5016
802 Ga0395901_0085261 3300038443 Bacteria 3302
803 Ga0395901_0181397 3300038443 Bacteria 2208
804 Ga0395901_0185866 3300038443 Bacteria 2179
805 Ga0395901_0308710 3300038443 Bacteria 1639
806 Ga0395901_0391934 3300038443 Bacteria 1428
807 Ga0395901_0446771 3300038443 Bacteria 1323
808 Ga0395901_0985980 3300038443 Bacteria 819
809 Ga0395901_1044486 3300038443 Bacteria 790
810 Ga0395901_1659293 3300038443 Bacteria 591
811 Ga0439465_0041653 3300041413 Bacteria 1487
812 Ga0451853_1009202 3300041512 Bacteria 504
813 Ga0439445_0095145 3300042004 Bacteria 842
814 Ga0439432_016963 3300042006 Bacteria 2447
815 Ga0439432_022289 3300042006 Bacteria 2092
816 Ga0439432_033260 3300042006 Bacteria 1660
817 Ga0439449_0048452 3300042007 Bacteria 1573
818 Ga0439449_0311047 3300042007 Bacteria 595
819 Ga0439455_0032544 3300042012 Bacteria 1304
820 Ga0439458_0002361 3300042157 Bacteria 4627
821 Ga0450916_030715 3300042530 Bacteria 782
822 Ga0466969_0024732 3300044656 Bacteria 3089
823 Ga0466969_0132382 3300044656 Bacteria 1156
824 Ga0466972_0045663 3300044658 Bacteria 2123
825 Ga0466965_0482004 3300044683 Bacteria 694
826 Ga0466966_0050183 3300044684 Bacteria 2655
827 Ga0466966_0128694 3300044684 Bacteria 1551
828 Ga0466961_0077704 3300044693 Bacteria 2102
829 Ga0466961_0087877 3300044693 Bacteria 1964
830 Ga0466961_0105504 3300044693 Bacteria 1774
831 Ga0466961_0122036 3300044693 Bacteria 1635
832 Ga0466961_0126569 3300044693 Bacteria 1602
833 Ga0466963_0115074 3300044694 Bacteria 1848
834 Ga0466963_0431367 3300044694 Bacteria 929
835 Ga0466963_0742340 3300044694 Bacteria 692
836 Ga0466963_1063413 3300044694 Bacteria 569
837 Ga0466964_0062337 3300044706 Bacteria 1554
838 Ga0466964_0331205 3300044706 Bacteria 777
839 Ga0466964_0718645 3300044706 Bacteria 558
840 Ga0466971_0001138 3300044719 Bacteria 11048
841 Ga0466968_0005658 3300044735 Bacteria 4682
842 Ga0466970_0068563 3300044765 Bacteria 1905
843 Ga0466970_0113975 3300044765 Bacteria 1477
844 Ga0466970_0322725 3300044765 Bacteria 873
845 Ga0466970_0595448 3300044765 Bacteria 641
846 Ga0466957_0027560 3300044842 Bacteria 3377
847 Ga0466957_0058778 3300044842 Bacteria 2355
848 Ga0466957_0094351 3300044842 Bacteria 1879
849 Ga0466957_0118526 3300044842 Bacteria 1686
850 Ga0466959_0010905 3300045049 Bacteria 6515
851 Ga0466959_0108714 3300045049 Bacteria 1980
852 Ga0466959_0134865 3300045049 Bacteria 1748
853 Ga0466959_0509724 3300045049 Bacteria 813
854 Ga0466959_0591742 3300045049 Bacteria 747
855 Ga0466958_0046514 3300045836 Bacteria 2618
856 Ga0466958_0089663 3300045836 Bacteria 1901
857 Ga0466958_0111283 3300045836 Bacteria 1709
858 Ga0466958_0952422 3300045836 Bacteria 560
859 Ga0466967_0052395 3300045976 Bacteria 3582
860 Ga0466967_0083661 3300045976 Bacteria 2886
861 Ga0466967_0103957 3300045976 Bacteria 2599
862 Ga0466967_0168554 3300045976 Bacteria 2059
863 Ga0466967_0328382 3300045976 Bacteria 1477
864 Ga0495629_1129312 3300046459 Bacteria 506
865 Ga0495663_0018884 3300046525 Bacteria 1966
866 Ga0495663_0041496 3300046525 Bacteria 1400
867 Ga0495663_0198017 3300046525 Bacteria 700
868 Ga0495621_0002275 3300046539 Bacteria 5141
869 Ga0495621_0005527 3300046539 Bacteria 3636
870 Ga0495621_0342927 3300046539 Bacteria 625
871 Ga0495633_0011741 3300046558 Bacteria 4703
872 Ga0495668_0668634 3300046616 Bacteria 574
873 Ga0495659_0012774 3300046664 Bacteria 2726
874 Ga0495659_0167098 3300046664 Bacteria 891
875 Ga0495669_0000398 3300046684 Bacteria 21390
876 Ga0495669_0002491 3300046684 Bacteria 7519
877 Ga0495670_0000265 3300046691 Bacteria 24414
878 Ga0495670_0015052 3300046691 Bacteria 3805
879 Ga0495670_0084084 3300046691 Bacteria 1624
880 Ga0495670_0344867 3300046691 Bacteria 801
881 Ga0495636_0241964 3300047318 Bacteria 833
882 Ga0495683_0128025 3300047323 Bacteria 1200
883 Ga0495677_0008959 3300047445 Bacteria 3702
884 Ga0495677_0070792 3300047445 Bacteria 1300
885 Ga0495677_0072553 3300047445 Bacteria 1284
886 Ga0496100_0085083 3300048903 Bacteria 2145
887 Ga0496100_1053907 3300048903 Bacteria 640
888 Ga0496101_1097705 3300048904 Bacteria 625
889 Ga0496102_0864297 3300048905 Bacteria 826
890 Ga0496102_1076188 3300048905 Bacteria 724
891 Ga0496103_0076255 3300048906 Bacteria 2103
892 Ga0496104_0233993 3300048907 Bacteria 1749
893 Ga0496104_0384869 3300048907 Bacteria 1315
894 Ga0496106_0873921 3300048909 Bacteria 711
895 Ga0496107_0576461 3300048910 Unclassified 832
896 Ga0496108_0019106 3300048911 Bacteria 5622
897 Ga0496108_0025663 3300048911 Bacteria 4858
898 Ga0496109_0010272 3300048912 Bacteria 7993
899 Ga0496109_0126702 3300048912 Bacteria 2381
900 Ga0496109_0284682 3300048912 Bacteria 1558
901 Ga0496109_0989337 3300048912 Bacteria 779
902 Ga0496109_1541514 3300048912 Unclassified 599
903 Ga0496109_1562982 3300048912 Bacteria 594
904 Ga0496110_0002670 3300048913 Bacteria 13468
905 Ga0496110_0020991 3300048913 Bacteria 5519
906 Ga0496110_0058937 3300048913 Bacteria 3382
907 Ga0496110_0083978 3300048913 Bacteria 2842
908 Ga0496111_0006573 3300048914 Bacteria 7560
909 Ga0496111_0008220 3300048914 Bacteria 6897
910 Ga0496111_0085326 3300048914 Bacteria 2309
911 Ga0496112_0007106 3300048915 Bacteria 9899
912 Ga0496112_0020797 3300048915 Bacteria 6228
913 Ga0496112_0062992 3300048915 Bacteria 3658
914 Ga0496112_0158361 3300048915 Bacteria 2231
915 Ga0496112_0293183 3300048915 Bacteria 1573
916 Ga0496112_0342629 3300048915 Bacteria 1438
917 Ga0496112_0370907 3300048915 Bacteria 1373
918 Ga0496113_0066232 3300048916 Bacteria 2735
919 Ga0496113_0182848 3300048916 Bacteria 1662
920 Ga0496113_0894159 3300048916 Bacteria 703
921 Ga0496114_0000130 3300048917 Bacteria 54437
922 Ga0496114_1110497 3300048917 Bacteria 676
923 Ga0501067_0076212 3300049583 Bacteria 1858
924 Ga0501068_0447843 3300049584 Bacteria 835
925 Ga0501209_116140 3300049656 Bacteria 792
926 Ga0501217_030409 3300049661 Bacteria 1326
927 Ga0501223_006051 3300049663 Bacteria 2517
928 Ga0501233_011309 3300049668 Bacteria 1773
929 Ga0501245_088074 3300049708 Bacteria 611
930 Ga0501080_0618971 3300049742 Bacteria 960
931 Ga0501241_117479 3300049758 Bacteria 588
932 Ga0501263_006368 3300049760 Bacteria 1361
933 Ga0501270_010438 3300049767 Bacteria 1223
934 Ga0501283_107490 3300049779 Bacteria 549
935 nmdc:mga0k408_845769_c1 3300050493 Bacteria 532
936 nmdc:mga0qj67_575084_c1 3300050509 Bacteria 902
937 nmdc:mga08y16_1317997_c1 3300050511 Bacteria 688
938 Ga0495655_0006404 3300053083 Bacteria 2138
939 Ga0466962_0015781 3300061719 Bacteria 3643
940 Ga0466962_0022080 3300061719 Bacteria 3057
941 Ga0466962_0600639 3300061719 Bacteria 561

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10856952 Ga0207652_108569522 87
2 3300005366 Ga0070659_100468315 Ga0070659_1004683152 96
3 3300013102 Ga0157371_10782361 Ga0157371_107823611 96
4 3300013307 Ga0157372_12361487 Ga0157372_123614872 96
5 3300025932 Ga0207690_10262082 Ga0207690_102620822 96
6 3300045976 Ga0466967_0083661 Ga0466967_0083661_1839_2210 96
7 3300005355 Ga0070671_100004623 Ga0070671_10000462312 97
8 3300005364 Ga0070673_100600052 Ga0070673_1006000522 97
9 3300005578 Ga0068854_100165928 Ga0068854_1001659281 97
10 3300009093 Ga0105240_10455216 Ga0105240_104552161 97
11 3300009174 Ga0105241_10925430 Ga0105241_109254302 97
12 3300009177 Ga0105248_10928840 Ga0105248_109288402 97
13 3300013296 Ga0157374_10600473 Ga0157374_106004732 97
14 3300044684 Ga0466966_0128694 Ga0466966_0128694_889_1266 97
15 3300044693 Ga0466961_0077704 Ga0466961_0077704_201_578 97
16 3300044719 Ga0466971_0001138 Ga0466971_0001138_9523_9900 97
17 3300044765 Ga0466970_0113975 Ga0466970_0113975_615_992 97
18 3300044842 Ga0466957_0027560 Ga0466957_0027560_2440_2817 97
19 3300045049 Ga0466959_0010905 Ga0466959_0010905_6095_6472 97
20 3300045836 Ga0466958_0111283 Ga0466958_0111283_1289_1666 97
21 3300050509 nmdc:mga0qj67_575084_c1 nmdc:mga0qj67_575084_c1_350_754 97
22 3300061719 Ga0466962_0022080 Ga0466962_0022080_368_745 97
23 3300001989 JGI24739J22299_10005954 JGI24739J22299_100059542 98
24 3300001991 JGI24743J22301_10006458 JGI24743J22301_100064583 98
25 3300002075 JGI24738J21930_10004649 JGI24738J21930_100046492 98
26 3300005327 Ga0070658_10015921 Ga0070658_100159217 98
27 3300005327 Ga0070658_10106727 Ga0070658_101067271 98
28 3300005327 Ga0070658_11081880 Ga0070658_110818801 98
29 3300005327 Ga0070658_11177128 Ga0070658_111771281 98
30 3300005328 Ga0070676_11151739 Ga0070676_111517391 98
31 3300005329 Ga0070683_100040893 Ga0070683_1000408932 98
32 3300005335 Ga0070666_10016985 Ga0070666_100169852 98
33 3300005339 Ga0070660_100027712 Ga0070660_1000277122 98
34 3300005344 Ga0070661_100405509 Ga0070661_1004055091 98
35 3300005344 Ga0070661_100534838 Ga0070661_1005348381 98
36 3300005345 Ga0070692_10274597 Ga0070692_102745972 98
37 3300005355 Ga0070671_100062212 Ga0070671_1000622124 98
38 3300005364 Ga0070673_100081879 Ga0070673_1000818792 98
39 3300005366 Ga0070659_100061107 Ga0070659_1000611072 98
40 3300005367 Ga0070667_100009737 Ga0070667_1000097374 98
41 3300005435 Ga0070714_100035769 Ga0070714_1000357694 98
42 3300005436 Ga0070713_100091068 Ga0070713_1000910681 98
43 3300005455 Ga0070663_100061660 Ga0070663_1000616603 98
44 3300005457 Ga0070662_100016566 Ga0070662_1000165667 98
45 3300005535 Ga0070684_100474304 Ga0070684_1004743042 98
46 3300005539 Ga0068853_100209354 Ga0068853_1002093542 98
47 3300005564 Ga0070664_100072114 Ga0070664_1000721142 98
48 3300005577 Ga0068857_100097208 Ga0068857_1000972083 98
49 3300005578 Ga0068854_100017161 Ga0068854_1000171611 98
50 3300005614 Ga0068856_100041454 Ga0068856_1000414544 98
51 3300005614 Ga0068856_100048587 Ga0068856_1000485874 98
52 3300005614 Ga0068856_100569955 Ga0068856_1005699551 98
53 3300005616 Ga0068852_100158396 Ga0068852_1001583962 98
54 3300005616 Ga0068852_100443746 Ga0068852_1004437461 98
55 3300005616 Ga0068852_100790748 Ga0068852_1007907482 98
56 3300005834 Ga0068851_10024058 Ga0068851_100240581 98
57 3300006173 Ga0070716_100044871 Ga0070716_1000448712 98
58 3300009093 Ga0105240_10529078 Ga0105240_105290781 98
59 3300013100 Ga0157373_10721087 Ga0157373_107210871 98
60 3300013102 Ga0157371_10041133 Ga0157371_100411332 98
61 3300013102 Ga0157371_10179820 Ga0157371_101798203 98
62 3300013104 Ga0157370_11230264 Ga0157370_112302642 98
63 3300013105 Ga0157369_10378868 Ga0157369_103788682 98
64 3300013105 Ga0157369_11147941 Ga0157369_111479412 98
65 3300013105 Ga0157369_11384412 Ga0157369_113844122 98
66 3300013307 Ga0157372_10053618 Ga0157372_100536184 98
67 3300013307 Ga0157372_10093824 Ga0157372_100938243 98
68 3300022467 Ga0224712_10237661 Ga0224712_102376611 98
69 3300025909 Ga0207705_10000192 Ga0207705_1000019261 98
70 3300025909 Ga0207705_10328303 Ga0207705_103283032 98
71 3300025920 Ga0207649_10002895 Ga0207649_100028952 98
72 3300025920 Ga0207649_10768683 Ga0207649_107686831 98
73 3300025929 Ga0207664_10270472 Ga0207664_102704723 98
74 3300025939 Ga0207665_10041392 Ga0207665_100413922 98
75 3300025941 Ga0207711_10726092 Ga0207711_107260921 98
76 3300025949 Ga0207667_10769372 Ga0207667_107693722 98
77 3300025972 Ga0207668_10116082 Ga0207668_101160823 98
78 3300025981 Ga0207640_10005181 Ga0207640_100051814 98
79 3300026067 Ga0207678_10063448 Ga0207678_100634482 98
80 3300026078 Ga0207702_10034947 Ga0207702_100349471 98
81 3300026078 Ga0207702_10090641 Ga0207702_100906414 98
82 3300026142 Ga0207698_10029937 Ga0207698_100299372 98
83 3300026142 Ga0207698_10415676 Ga0207698_104156762 98
84 3300037312 Ga0395899_0178023 Ga0395899_0178023_782_1156 98
85 3300037418 Ga0395900_0934257 Ga0395900_0934257_122_499 98
86 3300037466 Ga0395898_0793655 Ga0395898_0793655_93_470 98
87 3300037471 Ga0395905_0038084 Ga0395905_0038084_3276_3641 98
88 3300038443 Ga0395901_0308710 Ga0395901_0308710_802_1167 98
89 3300045836 Ga0466958_0952422 Ga0466958_0952422_161_535 98
90 iso_pu_bacteria 2885427238 2885428453 98
91 3300005333 Ga0070677_10348195 Ga0070677_103481952 99
92 3300005344 Ga0070661_100007774 Ga0070661_1000077745 99
93 3300005366 Ga0070659_100086055 Ga0070659_1000860552 99
94 3300005366 Ga0070659_100274356 Ga0070659_1002743562 99
95 3300005457 Ga0070662_100001022 Ga0070662_1000010222 99
96 3300005458 Ga0070681_11076860 Ga0070681_110768601 99
97 3300005530 Ga0070679_100016119 Ga0070679_1000161198 99
98 3300005539 Ga0068853_101286542 Ga0068853_1012865421 99
99 3300005563 Ga0068855_100257759 Ga0068855_1002577591 99
100 3300005564 Ga0070664_100029443 Ga0070664_1000294433 99
101 3300005577 Ga0068857_100239752 Ga0068857_1002397522 99
102 3300005577 Ga0068857_101579937 Ga0068857_1015799371 99
103 3300013100 Ga0157373_10031266 Ga0157373_100312663 99
104 3300013100 Ga0157373_10031869 Ga0157373_100318692 99
105 3300013100 Ga0157373_10997743 Ga0157373_109977432 99
106 3300013102 Ga0157371_10265627 Ga0157371_102656273 99
107 3300013105 Ga0157369_12594729 Ga0157369_125947291 99
108 3300013307 Ga0157372_10604915 Ga0157372_106049152 99
109 3300013307 Ga0157372_12637339 Ga0157372_126373391 99
110 3300014326 Ga0157380_10972460 Ga0157380_109724601 99
111 3300025912 Ga0207707_11372860 Ga0207707_113728602 99
112 3300025917 Ga0207660_10607254 Ga0207660_106072542 99
113 3300025919 Ga0207657_10011425 Ga0207657_100114255 99
114 3300025919 Ga0207657_10049034 Ga0207657_100490343 99
115 3300025920 Ga0207649_10207302 Ga0207649_102073022 99
116 3300025920 Ga0207649_10261086 Ga0207649_102610862 99
117 3300025921 Ga0207652_10315937 Ga0207652_103159373 99
118 3300025932 Ga0207690_10257671 Ga0207690_102576712 99
119 3300025932 Ga0207690_10646763 Ga0207690_106467632 99
120 3300025945 Ga0207679_10031196 Ga0207679_100311963 99
121 3300026041 Ga0207639_10240540 Ga0207639_102405401 99
122 3300026067 Ga0207678_10008664 Ga0207678_100086645 99
123 3300026116 Ga0207674_10042347 Ga0207674_100423472 99
124 3300026116 Ga0207674_10160114 Ga0207674_101601142 99
125 3300031731 Ga0307405_10050678 Ga0307405_100506782 99
126 3300031824 Ga0307413_10487100 Ga0307413_104871002 99
127 3300032002 Ga0307416_100006186 Ga0307416_1000061864 99
128 3300037312 Ga0395899_0253989 Ga0395899_0253989_389_757 99
129 3300037418 Ga0395900_0028095 Ga0395900_0028095_993_1361 99
130 3300037466 Ga0395898_0413431 Ga0395898_0413431_761_1129 99
131 3300037471 Ga0395905_0040973 Ga0395905_0040973_1169_1537 99
132 3300048916 Ga0496113_0182848 Ga0496113_0182848_373_744 99
133 3300005355 Ga0070671_100012009 Ga0070671_1000120094 100
134 3300005355 Ga0070671_100072787 Ga0070671_1000727871 100
135 3300005457 Ga0070662_100189414 Ga0070662_1001894143 100
136 3300005563 Ga0068855_100042302 Ga0068855_1000423025 100
137 3300005564 Ga0070664_100002946 Ga0070664_10000294611 100
138 3300005577 Ga0068857_100004407 Ga0068857_10000440714 100
139 3300005614 Ga0068856_100536307 Ga0068856_1005363072 100
140 3300005616 Ga0068852_100680628 Ga0068852_1006806282 100
141 3300005617 Ga0068859_100032384 Ga0068859_1000323843 100
142 3300005618 Ga0068864_100328318 Ga0068864_1003283182 100
143 3300005841 Ga0068863_100010487 Ga0068863_1000104876 100
144 3300005842 Ga0068858_100011050 Ga0068858_1000110504 100
145 3300005843 Ga0068860_100667711 Ga0068860_1006677112 100
146 3300006237 Ga0097621_100011685 Ga0097621_1000116855 100
147 3300006358 Ga0068871_100013252 Ga0068871_1000132525 100
148 3300006931 Ga0097620_100032383 Ga0097620_1000323835 100
149 3300007076 Ga0075435_101756348 Ga0075435_1017563482 100
150 3300009101 Ga0105247_11029079 Ga0105247_110290792 100
151 3300009177 Ga0105248_10071025 Ga0105248_100710252 100
152 3300009545 Ga0105237_10025986 Ga0105237_100259864 100
153 3300013100 Ga0157373_10131278 Ga0157373_101312783 100
154 3300013102 Ga0157371_10106222 Ga0157371_101062222 100
155 3300014325 Ga0163163_11625893 Ga0163163_116258931 100
156 3300014497 Ga0182008_10195689 Ga0182008_101956892 100
157 3300014968 Ga0157379_10045768 Ga0157379_100457682 100
158 3300025904 Ga0207647_10032503 Ga0207647_100325034 100
159 3300025909 Ga0207705_10372648 Ga0207705_103726482 100
160 3300025914 Ga0207671_10041187 Ga0207671_100411874 100
161 3300025920 Ga0207649_10315132 Ga0207649_103151322 100
162 3300025931 Ga0207644_10058621 Ga0207644_100586212 100
163 3300025932 Ga0207690_11671078 Ga0207690_116710781 100
164 3300025933 Ga0207706_10061386 Ga0207706_100613863 100
165 3300025945 Ga0207679_10029126 Ga0207679_100291265 100
166 3300025949 Ga0207667_10101868 Ga0207667_101018683 100
167 3300025960 Ga0207651_11852377 Ga0207651_118523771 100
168 3300026067 Ga0207678_10163220 Ga0207678_101632202 100
169 3300026088 Ga0207641_10121830 Ga0207641_101218302 100
170 3300026095 Ga0207676_10030671 Ga0207676_100306713 100
171 3300026116 Ga0207674_10008780 Ga0207674_100087806 100
172 3300026142 Ga0207698_11143710 Ga0207698_111437102 100
173 3300028381 Ga0268264_10526155 Ga0268264_105261552 100
174 3300031548 Ga0307408_100841569 Ga0307408_1008415692 100
175 3300031731 Ga0307405_10080307 Ga0307405_100803073 100
176 3300031852 Ga0307410_10111353 Ga0307410_101113532 100
177 3300031911 Ga0307412_11123318 Ga0307412_111233182 100
178 3300032005 Ga0307411_10181714 Ga0307411_101817142 100
179 3300035115 Ga0373941_0212516 Ga0373941_0212516_78_443 100
180 3300037471 Ga0395905_0025496 Ga0395905_0025496_328_690 100
181 3300037471 Ga0395905_0794708 Ga0395905_0794708_242_601 100
182 3300042006 Ga0439432_016963 Ga0439432_016963_1073_1444 100
183 3300048905 Ga0496102_0864297 Ga0496102_0864297_268_630 100
184 3300048906 Ga0496103_0076255 Ga0496103_0076255_1303_1665 100
185 3300048907 Ga0496104_0384869 Ga0496104_0384869_212_574 100
186 3300048910 Ga0496107_0576461 Ga0496107_0576461_434_796 100
187 3300048911 Ga0496108_0025663 Ga0496108_0025663_4054_4416 100
188 3300048913 Ga0496110_0020991 Ga0496110_0020991_3553_3915 100
189 3300048914 Ga0496111_0008220 Ga0496111_0008220_2458_2820 100
190 3300048915 Ga0496112_0020797 Ga0496112_0020797_5843_6208 100
191 3300048915 Ga0496112_0062992 Ga0496112_0062992_2659_3021 100
192 3300048915 Ga0496112_0293183 Ga0496112_0293183_1115_1486 100
193 3300048916 Ga0496113_0066232 Ga0496113_0066232_976_1341 100
194 3300005328 Ga0070676_10070423 Ga0070676_100704233 101
195 3300005328 Ga0070676_10167729 Ga0070676_101677292 101
196 3300005330 Ga0070690_100012038 Ga0070690_1000120382 101
197 3300005339 Ga0070660_100020719 Ga0070660_1000207193 101
198 3300005343 Ga0070687_100370419 Ga0070687_1003704191 101
199 3300005344 Ga0070661_100296981 Ga0070661_1002969812 101
200 3300005355 Ga0070671_100070915 Ga0070671_1000709153 101
201 3300005356 Ga0070674_100036773 Ga0070674_1000367732 101
202 3300005356 Ga0070674_100059398 Ga0070674_1000593982 101
203 3300005366 Ga0070659_100035232 Ga0070659_1000352322 101
204 3300005367 Ga0070667_100024847 Ga0070667_1000248472 101
205 3300005456 Ga0070678_100128031 Ga0070678_1001280312 101
206 3300005457 Ga0070662_100008953 Ga0070662_1000089534 101
207 3300005543 Ga0070672_100021543 Ga0070672_1000215432 101
208 3300005547 Ga0070693_100339225 Ga0070693_1003392251 101
209 3300005563 Ga0068855_101853963 Ga0068855_1018539631 101
210 3300005578 Ga0068854_100454289 Ga0068854_1004542892 101
211 3300005614 Ga0068856_100426828 Ga0068856_1004268282 101
212 3300005834 Ga0068851_10037997 Ga0068851_100379971 101
213 3300005843 Ga0068860_100014099 Ga0068860_1000140995 101
214 3300009098 Ga0105245_10021400 Ga0105245_100214002 101
215 3300009098 Ga0105245_10093834 Ga0105245_100938342 101
216 3300009148 Ga0105243_10029641 Ga0105243_100296412 101
217 3300009174 Ga0105241_12324651 Ga0105241_123246511 101
218 3300009551 Ga0105238_10009851 Ga0105238_100098517 101
219 3300010375 Ga0105239_10539368 Ga0105239_105393681 101
220 3300014325 Ga0163163_10046192 Ga0163163_100461922 101
221 3300014497 Ga0182008_10252637 Ga0182008_102526372 101
222 3300014968 Ga0157379_10500506 Ga0157379_105005062 101
223 3300027617 Ga0210002_1017256 Ga0210002_10172562 101
224 3300030733 Ga0314311_1052117 Ga0314311_10521171 101
225 3300030735 Ga0316178_1013034 Ga0316178_10130342 101
226 3300030742 Ga0316183_1159422 Ga0316183_11594221 101
227 3300030745 Ga0316182_1233204 Ga0316182_12332041 101
228 3300031548 Ga0307408_100091306 Ga0307408_1000913062 101
229 3300031824 Ga0307413_10246025 Ga0307413_102460252 101
230 3300031852 Ga0307410_10287056 Ga0307410_102870562 101
231 3300031901 Ga0307406_10022776 Ga0307406_100227763 101
232 3300031901 Ga0307406_10249767 Ga0307406_102497671 101
233 3300031901 Ga0307406_10421956 Ga0307406_104219562 101
234 3300031903 Ga0307407_10237943 Ga0307407_102379432 101
235 3300031903 Ga0307407_10332743 Ga0307407_103327432 101
236 3300031911 Ga0307412_10006588 Ga0307412_100065882 101
237 3300031911 Ga0307412_10178547 Ga0307412_101785472 101
238 3300031995 Ga0307409_100057294 Ga0307409_1000572943 101
239 3300032002 Ga0307416_100431112 Ga0307416_1004311122 101
240 3300032002 Ga0307416_103276237 Ga0307416_1032762371 101
241 3300032004 Ga0307414_10005634 Ga0307414_100056345 101
242 3300032004 Ga0307414_10101017 Ga0307414_101010172 101
243 3300032005 Ga0307411_10140610 Ga0307411_101406102 101
244 3300032005 Ga0307411_10644141 Ga0307411_106441412 101
245 3300032005 Ga0307411_11003098 Ga0307411_110030981 101
246 3300032126 Ga0307415_100009297 Ga0307415_1000092976 101
247 3300038443 Ga0395901_0446771 Ga0395901_0446771_213_575 101
248 3300041413 Ga0439465_0041653 Ga0439465_0041653_49_411 101
249 3300042004 Ga0439445_0095145 Ga0439445_0095145_303_665 101
250 3300042006 Ga0439432_022289 Ga0439432_022289_187_549 101
251 3300042006 Ga0439432_033260 Ga0439432_033260_212_586 101
252 3300042007 Ga0439449_0048452 Ga0439449_0048452_1172_1534 101
253 3300042007 Ga0439449_0311047 Ga0439449_0311047_158_532 101
254 3300049656 Ga0501209_116140 Ga0501209_116140_35_397 101
255 3300049661 Ga0501217_030409 Ga0501217_030409_825_1187 101
256 3300049663 Ga0501223_006051 Ga0501223_006051_1703_2065 101
257 3300049668 Ga0501233_011309 Ga0501233_011309_651_1013 101
258 3300049760 Ga0501263_006368 Ga0501263_006368_243_605 101
259 3300049767 Ga0501270_010438 Ga0501270_010438_243_605 101
260 3300049779 Ga0501283_107490 Ga0501283_107490_29_391 101
261 iso_pu_bacteria 2896429255 2896430503 101
262 3300002067 JGI24735J21928_10002159 JGI24735J21928_100021594 102
263 3300005327 Ga0070658_10012936 Ga0070658_100129364 102
264 3300005328 Ga0070676_10295220 Ga0070676_102952202 102
265 3300005336 Ga0070680_100288469 Ga0070680_1002884692 102
266 3300005339 Ga0070660_100008243 Ga0070660_1000082434 102
267 3300005344 Ga0070661_100003274 Ga0070661_1000032742 102
268 3300005344 Ga0070661_100020420 Ga0070661_1000204203 102
269 3300005345 Ga0070692_10787483 Ga0070692_107874831 102
270 3300005347 Ga0070668_100364073 Ga0070668_1003640732 102
271 3300005347 Ga0070668_100429802 Ga0070668_1004298021 102
272 3300005353 Ga0070669_100155690 Ga0070669_1001556903 102
273 3300005356 Ga0070674_100014903 Ga0070674_1000149032 102
274 3300005366 Ga0070659_100002650 Ga0070659_1000026503 102
275 3300005458 Ga0070681_10007319 Ga0070681_100073195 102
276 3300005530 Ga0070679_100234572 Ga0070679_1002345722 102
277 3300005530 Ga0070679_100276772 Ga0070679_1002767721 102
278 3300005535 Ga0070684_101529843 Ga0070684_1015298431 102
279 3300005539 Ga0068853_100009064 Ga0068853_1000090647 102
280 3300005563 Ga0068855_100015488 Ga0068855_1000154886 102
281 3300005564 Ga0070664_101233790 Ga0070664_1012337902 102
282 3300005577 Ga0068857_100004836 Ga0068857_1000048366 102
283 3300005578 Ga0068854_100272826 Ga0068854_1002728262 102
284 3300005616 Ga0068852_100013406 Ga0068852_1000134064 102
285 3300005718 Ga0068866_11323862 Ga0068866_113238621 102
286 3300005719 Ga0068861_100078926 Ga0068861_1000789262 102
287 3300005834 Ga0068851_10038992 Ga0068851_100389922 102
288 3300005834 Ga0068851_10054222 Ga0068851_100542222 102
289 3300005844 Ga0068862_100073889 Ga0068862_1000738893 102
290 3300009093 Ga0105240_10031411 Ga0105240_100314119 102
291 3300009148 Ga0105243_10104737 Ga0105243_101047372 102
292 3300009174 Ga0105241_10014435 Ga0105241_100144352 102
293 3300009177 Ga0105248_10178351 Ga0105248_101783512 102
294 3300009545 Ga0105237_10158420 Ga0105237_101584203 102
295 3300009551 Ga0105238_10009986 Ga0105238_100099862 102
296 3300010375 Ga0105239_10267295 Ga0105239_102672952 102
297 3300013100 Ga0157373_10031145 Ga0157373_100311452 102
298 3300013100 Ga0157373_10152744 Ga0157373_101527443 102
299 3300013102 Ga0157371_10108056 Ga0157371_101080562 102
300 3300013104 Ga0157370_10015902 Ga0157370_100159022 102
301 3300013105 Ga0157369_10228825 Ga0157369_102288253 102
302 3300013307 Ga0157372_10023084 Ga0157372_100230847 102
303 3300025899 Ga0207642_10821860 Ga0207642_108218601 102
304 3300025907 Ga0207645_10094922 Ga0207645_100949222 102
305 3300025907 Ga0207645_10390059 Ga0207645_103900592 102
306 3300025923 Ga0207681_10060355 Ga0207681_100603553 102
307 3300025927 Ga0207687_10054425 Ga0207687_100544253 102
308 3300025931 Ga0207644_10118549 Ga0207644_101185493 102
309 3300025933 Ga0207706_10625759 Ga0207706_106257592 102
310 3300025940 Ga0207691_10362750 Ga0207691_103627502 102
311 3300025941 Ga0207711_11481784 Ga0207711_114817841 102
312 3300025972 Ga0207668_10062639 Ga0207668_100626392 102
313 3300026118 Ga0207675_100035826 Ga0207675_1000358264 102
314 3300028380 Ga0268265_12000959 Ga0268265_120009591 102
315 3300031548 Ga0307408_100109614 Ga0307408_1001096143 102
316 3300031548 Ga0307408_100235975 Ga0307408_1002359752 102
317 3300031548 Ga0307408_101407127 Ga0307408_1014071271 102
318 3300031852 Ga0307410_10119223 Ga0307410_101192232 102
319 3300031901 Ga0307406_10152900 Ga0307406_101529001 102
320 3300031903 Ga0307407_10056015 Ga0307407_100560152 102
321 3300031911 Ga0307412_10070448 Ga0307412_100704482 102
322 3300031995 Ga0307409_100019902 Ga0307409_1000199026 102
323 3300031995 Ga0307409_100263662 Ga0307409_1002636622 102
324 3300032002 Ga0307416_100263414 Ga0307416_1002634142 102
325 3300032004 Ga0307414_10006399 Ga0307414_100063999 102
326 3300032004 Ga0307414_10269319 Ga0307414_102693192 102
327 3300032005 Ga0307411_10006500 Ga0307411_100065001 102
328 3300032005 Ga0307411_10133436 Ga0307411_101334362 102
329 3300032126 Ga0307415_100048836 Ga0307415_1000488362 102
330 3300035170 Ga0373943_0002991 Ga0373943_0002991_6117_6494 102
331 3300035725 Ga0373947_0225381 Ga0373947_0225381_327_704 102
332 3300037068 Ga0373925_0017811 Ga0373925_0017811_3285_3662 102
333 3300037418 Ga0395900_0039865 Ga0395900_0039865_3650_4045 102
334 3300037466 Ga0395898_0286871 Ga0395898_0286871_238_606 102
335 3300037471 Ga0395905_0279521 Ga0395905_0279521_399_767 102
336 3300038443 Ga0395901_0023789 Ga0395901_0023789_5299_5667 102
337 3300038443 Ga0395901_0185866 Ga0395901_0185866_1219_1587 102
338 3300044706 Ga0466964_0718645 Ga0466964_0718645_32_397 102
339 3300045976 Ga0466967_0328382 Ga0466967_0328382_70_444 102
340 3300048904 Ga0496101_1097705 Ga0496101_1097705_196_582 102
341 3300048912 Ga0496109_0126702 Ga0496109_0126702_1059_1445 102
342 3300048915 Ga0496112_0370907 Ga0496112_0370907_285_668 102
343 3300048916 Ga0496113_0894159 Ga0496113_0894159_288_674 102
344 3300049742 Ga0501080_0618971 Ga0501080_0618971_21_380 102
345 3300061719 Ga0466962_0600639 Ga0466962_0600639_12_386 102
346 3300005327 Ga0070658_10048731 Ga0070658_100487311 103
347 3300005339 Ga0070660_100007777 Ga0070660_1000077773 103
348 3300005616 Ga0068852_101903420 Ga0068852_1019034201 103
349 3300009177 Ga0105248_13214743 Ga0105248_132147431 103
350 3300013100 Ga0157373_11176616 Ga0157373_111766162 103
351 3300013104 Ga0157370_10042309 Ga0157370_100423093 103
352 3300013308 Ga0157375_10479198 Ga0157375_104791982 103
353 3300021384 Ga0213876_10058141 Ga0213876_100581412 103
354 3300025909 Ga0207705_10036827 Ga0207705_100368274 103
355 3300025912 Ga0207707_11663277 Ga0207707_116632771 103
356 3300025915 Ga0207693_10008153 Ga0207693_100081531 103
357 3300025919 Ga0207657_10001620 Ga0207657_1000162028 103
358 3300025920 Ga0207649_10053105 Ga0207649_100531052 103
359 3300025921 Ga0207652_10275023 Ga0207652_102750233 103
360 3300025921 Ga0207652_10759782 Ga0207652_107597822 103
361 3300025932 Ga0207690_10259046 Ga0207690_102590462 103
362 3300025949 Ga0207667_10389942 Ga0207667_103899422 103
363 3300025972 Ga0207668_10222351 Ga0207668_102223512 103
364 3300025981 Ga0207640_11674363 Ga0207640_116743631 103
365 3300026142 Ga0207698_11273998 Ga0207698_112739982 103
366 3300027364 Ga0209967_1027559 Ga0209967_10275592 103
367 3300027682 Ga0209971_1050533 Ga0209971_10505332 103
368 3300031548 Ga0307408_100049375 Ga0307408_1000493753 103
369 3300031731 Ga0307405_10650852 Ga0307405_106508522 103
370 3300031824 Ga0307413_10047533 Ga0307413_100475333 103
371 3300031824 Ga0307413_10528779 Ga0307413_105287792 103
372 3300031852 Ga0307410_10184133 Ga0307410_101841332 103
373 3300032002 Ga0307416_100500248 Ga0307416_1005002481 103
374 3300032005 Ga0307411_10171765 Ga0307411_101717652 103
375 3300032126 Ga0307415_100465738 Ga0307415_1004657381 103
376 3300032126 Ga0307415_100490420 Ga0307415_1004904202 103
377 3300044658 Ga0466972_0045663 Ga0466972_0045663_1111_1500 103
378 3300044683 Ga0466965_0482004 Ga0466965_0482004_88_477 103
379 3300044693 Ga0466961_0122036 Ga0466961_0122036_38_427 103
380 3300044694 Ga0466963_0431367 Ga0466963_0431367_325_693 103
381 3300044694 Ga0466963_1063413 Ga0466963_1063413_111_506 103
382 3300044706 Ga0466964_0062337 Ga0466964_0062337_416_805 103
383 3300044706 Ga0466964_0331205 Ga0466964_0331205_371_766 103
384 3300044735 Ga0466968_0005658 Ga0466968_0005658_1120_1509 103
385 3300044765 Ga0466970_0068563 Ga0466970_0068563_751_1140 103
386 3300045836 Ga0466958_0046514 Ga0466958_0046514_1375_1764 103
387 3300045976 Ga0466967_0103957 Ga0466967_0103957_1214_1603 103
388 3300046459 Ga0495629_1129312 Ga0495629_1129312_44_412 103
389 3300048912 Ga0496109_0989337 Ga0496109_0989337_210_605 103
390 3300048912 Ga0496109_1541514 Ga0496109_1541514_204_575 103
391 3300001978 JGI24747J21853_1004086 JGI24747J21853_10040862 104
392 3300005327 Ga0070658_10194692 Ga0070658_101946922 104
393 3300005329 Ga0070683_100012323 Ga0070683_1000123235 104
394 3300005330 Ga0070690_100137374 Ga0070690_1001373743 104
395 3300005337 Ga0070682_100095445 Ga0070682_1000954453 104
396 3300005339 Ga0070660_100120369 Ga0070660_1001203693 104
397 3300005344 Ga0070661_100004872 Ga0070661_1000048726 104
398 3300005344 Ga0070661_100043316 Ga0070661_1000433164 104
399 3300005345 Ga0070692_10545273 Ga0070692_105452732 104
400 3300005347 Ga0070668_100520799 Ga0070668_1005207992 104
401 3300005366 Ga0070659_100017396 Ga0070659_1000173964 104
402 3300005366 Ga0070659_100072894 Ga0070659_1000728942 104
403 3300005367 Ga0070667_101157351 Ga0070667_1011573512 104
404 3300005367 Ga0070667_101247933 Ga0070667_1012479331 104
405 3300005455 Ga0070663_100039757 Ga0070663_1000397573 104
406 3300005455 Ga0070663_100096737 Ga0070663_1000967372 104
407 3300005455 Ga0070663_100244932 Ga0070663_1002449322 104
408 3300005457 Ga0070662_100085640 Ga0070662_1000856402 104
409 3300005458 Ga0070681_10181234 Ga0070681_101812342 104
410 3300005530 Ga0070679_100570217 Ga0070679_1005702172 104
411 3300005535 Ga0070684_100132721 Ga0070684_1001327211 104
412 3300005539 Ga0068853_100102888 Ga0068853_1001028884 104
413 3300005539 Ga0068853_100158027 Ga0068853_1001580272 104
414 3300005543 Ga0070672_100974369 Ga0070672_1009743692 104
415 3300005548 Ga0070665_100863825 Ga0070665_1008638252 104
416 3300005563 Ga0068855_100027432 Ga0068855_1000274323 104
417 3300005564 Ga0070664_100031851 Ga0070664_1000318512 104
418 3300005564 Ga0070664_100122336 Ga0070664_1001223362 104
419 3300005577 Ga0068857_100005624 Ga0068857_1000056246 104
420 3300005578 Ga0068854_100021380 Ga0068854_1000213804 104
421 3300005578 Ga0068854_100880824 Ga0068854_1008808242 104
422 3300005614 Ga0068856_100176690 Ga0068856_1001766903 104
423 3300005616 Ga0068852_100406327 Ga0068852_1004063272 104
424 3300005834 Ga0068851_10002364 Ga0068851_100023645 104
425 3300005844 Ga0068862_100587191 Ga0068862_1005871912 104
426 3300006195 Ga0075366_10709121 Ga0075366_107091212 104
427 3300009174 Ga0105241_11970045 Ga0105241_119700451 104
428 3300009177 Ga0105248_10029474 Ga0105248_100294742 104
429 3300009177 Ga0105248_10559644 Ga0105248_105596442 104
430 3300013102 Ga0157371_10550291 Ga0157371_105502912 104
431 3300013104 Ga0157370_10004183 Ga0157370_1000418314 104
432 3300013105 Ga0157369_10552822 Ga0157369_105528222 104
433 3300013105 Ga0157369_11467256 Ga0157369_114672561 104
434 3300013296 Ga0157374_10181851 Ga0157374_101818512 104
435 3300013307 Ga0157372_10907361 Ga0157372_109073612 104
436 3300014326 Ga0157380_10001828 Ga0157380_1000182810 104
437 3300014326 Ga0157380_11724043 Ga0157380_117240432 104
438 3300020069 Ga0197907_10114585 Ga0197907_101145851 104
439 3300025321 Ga0207656_10089896 Ga0207656_100898962 104
440 3300025909 Ga0207705_10001710 Ga0207705_100017106 104
441 3300025909 Ga0207705_10022394 Ga0207705_100223942 104
442 3300025917 Ga0207660_10119029 Ga0207660_101190292 104
443 3300025919 Ga0207657_10000924 Ga0207657_1000092419 104
444 3300025919 Ga0207657_10150698 Ga0207657_101506982 104
445 3300025919 Ga0207657_10157627 Ga0207657_101576272 104
446 3300025920 Ga0207649_10032781 Ga0207649_100327812 104
447 3300025920 Ga0207649_10233182 Ga0207649_102331821 104
448 3300025921 Ga0207652_11807014 Ga0207652_118070141 104
449 3300025932 Ga0207690_10061657 Ga0207690_100616572 104
450 3300025932 Ga0207690_11312423 Ga0207690_113124231 104
451 3300025945 Ga0207679_10060099 Ga0207679_100600992 104
452 3300025949 Ga0207667_10112445 Ga0207667_101124454 104
453 3300025972 Ga0207668_10312846 Ga0207668_103128462 104
454 3300025981 Ga0207640_10036832 Ga0207640_100368323 104
455 3300025981 Ga0207640_10188022 Ga0207640_101880222 104
456 3300026041 Ga0207639_10203897 Ga0207639_102038972 104
457 3300026041 Ga0207639_10375496 Ga0207639_103754962 104
458 3300026067 Ga0207678_10000716 Ga0207678_100007166 104
459 3300026067 Ga0207678_10008290 Ga0207678_100082905 104
460 3300026067 Ga0207678_10116085 Ga0207678_101160852 104
461 3300026078 Ga0207702_10326691 Ga0207702_103266913 104
462 3300026142 Ga0207698_10173327 Ga0207698_101733272 104
463 3300026142 Ga0207698_11680659 Ga0207698_116806592 104
464 3300028380 Ga0268265_10417872 Ga0268265_104178722 104
465 3300031824 Ga0307413_10111561 Ga0307413_101115613 104
466 3300031911 Ga0307412_10496664 Ga0307412_104966642 104
467 3300031911 Ga0307412_12200223 Ga0307412_122002231 104
468 3300032002 Ga0307416_100064621 Ga0307416_1000646213 104
469 3300032005 Ga0307411_10180986 Ga0307411_101809862 104
470 3300032005 Ga0307411_11260355 Ga0307411_112603552 104
471 3300032126 Ga0307415_100298067 Ga0307415_1002980672 104
472 3300032126 Ga0307415_100623974 Ga0307415_1006239742 104
473 3300037312 Ga0395899_0000804 Ga0395899_0000804_25084_25449 104
474 3300037312 Ga0395899_0008182 Ga0395899_0008182_3374_3787 104
475 3300037312 Ga0395899_0018328 Ga0395899_0018328_4241_4603 104
476 3300037418 Ga0395900_0001255 Ga0395900_0001255_6277_6642 104
477 3300037418 Ga0395900_0024744 Ga0395900_0024744_5636_5998 104
478 3300037418 Ga0395900_0050547 Ga0395900_0050547_3073_3486 104
479 3300037418 Ga0395900_0637246 Ga0395900_0637246_510_881 104
480 3300037466 Ga0395898_0013178 Ga0395898_0013178_6872_7237 104
481 3300037466 Ga0395898_0019790 Ga0395898_0019790_3498_3911 104
482 3300037466 Ga0395898_0021025 Ga0395898_0021025_1316_1678 104
483 3300037466 Ga0395898_0063939 Ga0395898_0063939_2636_3007 104
484 3300037466 Ga0395898_0231311 Ga0395898_0231311_1177_1545 104
485 3300037471 Ga0395905_0001765 Ga0395905_0001765_1029_1394 104
486 3300037471 Ga0395905_0006827 Ga0395905_0006827_6491_6859 104
487 3300037471 Ga0395905_0033709 Ga0395905_0033709_1021_1383 104
488 3300037471 Ga0395905_0045444 Ga0395905_0045444_633_1046 104
489 3300038443 Ga0395901_0001481 Ga0395901_0001481_13948_14313 104
490 3300038443 Ga0395901_0005056 Ga0395901_0005056_5542_5904 104
491 3300038443 Ga0395901_0037448 Ga0395901_0037448_3861_4274 104
492 3300038443 Ga0395901_1659293 Ga0395901_1659293_11_382 104
493 3300042530 Ga0450916_030715 Ga0450916_030715_210_563 104
494 3300044656 Ga0466969_0024732 Ga0466969_0024732_56_433 104
495 3300044693 Ga0466961_0105504 Ga0466961_0105504_1184_1561 104
496 3300044693 Ga0466961_0126569 Ga0466961_0126569_497_892 104
497 3300044694 Ga0466963_0742340 Ga0466963_0742340_121_516 104
498 3300044765 Ga0466970_0322725 Ga0466970_0322725_120_515 104
499 3300044842 Ga0466957_0058778 Ga0466957_0058778_316_711 104
500 3300045049 Ga0466959_0108714 Ga0466959_0108714_1511_1906 104
501 3300045049 Ga0466959_0134865 Ga0466959_0134865_1104_1481 104
502 3300045836 Ga0466958_0089663 Ga0466958_0089663_422_817 104
503 3300046664 Ga0495659_0167098 Ga0495659_0167098_61_405 104
504 3300046684 Ga0495669_0002491 Ga0495669_0002491_3458_3814 104
505 3300046691 Ga0495670_0084084 Ga0495670_0084084_334_690 104
506 3300046691 Ga0495670_0344867 Ga0495670_0344867_52_396 104
507 3300047445 Ga0495677_0070792 Ga0495677_0070792_175_531 104
508 3300049584 Ga0501068_0447843 Ga0501068_0447843_442_813 104
509 3300061719 Ga0466962_0015781 Ga0466962_0015781_3101_3496 104
510 3300005327 Ga0070658_11132446 Ga0070658_111324461 105
511 3300005327 Ga0070658_11251927 Ga0070658_112519271 105
512 3300005331 Ga0070670_100027542 Ga0070670_1000275424 105
513 3300005366 Ga0070659_101149083 Ga0070659_1011490832 105
514 3300005439 Ga0070711_100705544 Ga0070711_1007055442 105
515 3300005457 Ga0070662_100227490 Ga0070662_1002274902 105
516 3300005457 Ga0070662_101603118 Ga0070662_1016031181 105
517 3300005535 Ga0070684_101507210 Ga0070684_1015072101 105
518 3300005564 Ga0070664_100001856 Ga0070664_1000018566 105
519 3300005577 Ga0068857_101215477 Ga0068857_1012154771 105
520 3300005578 Ga0068854_100374544 Ga0068854_1003745443 105
521 3300005719 Ga0068861_101723312 Ga0068861_1017233121 105
522 3300005844 Ga0068862_100505483 Ga0068862_1005054832 105
523 3300005985 Ga0081539_10052112 Ga0081539_100521122 105
524 3300006173 Ga0070716_100252767 Ga0070716_1002527672 105
525 3300009094 Ga0111539_11105191 Ga0111539_111051912 105
526 3300009979 Ga0105032_114107 Ga0105032_1141071 105
527 3300013100 Ga0157373_10570416 Ga0157373_105704162 105
528 3300013100 Ga0157373_10718841 Ga0157373_107188412 105
529 3300025923 Ga0207681_10087119 Ga0207681_100871192 105
530 3300025928 Ga0207700_10323958 Ga0207700_103239582 105
531 3300025939 Ga0207665_10032193 Ga0207665_100321934 105
532 3300025941 Ga0207711_10331279 Ga0207711_103312792 105
533 3300025945 Ga0207679_10002831 Ga0207679_1000283112 105
534 3300026116 Ga0207674_10869939 Ga0207674_108699392 105
535 3300027876 Ga0209974_10058112 Ga0209974_100581122 105
536 3300028379 Ga0268266_12005992 Ga0268266_120059922 105
537 3300031852 Ga0307410_10407712 Ga0307410_104077122 105
538 3300041512 Ga0451853_1009202 Ga0451853_1009202_126_488 105
539 3300042012 Ga0439455_0032544 Ga0439455_0032544_541_900 105
540 3300042157 Ga0439458_0002361 Ga0439458_0002361_1925_2284 105
541 3300045976 Ga0466967_0052395 Ga0466967_0052395_2465_2875 105
542 3300046525 Ga0495663_0018884 Ga0495663_0018884_468_818 105
543 3300046525 Ga0495663_0198017 Ga0495663_0198017_111_476 105
544 3300046539 Ga0495621_0002275 Ga0495621_0002275_3946_4296 105
545 3300046539 Ga0495621_0005527 Ga0495621_0005527_1477_1842 105
546 3300046539 Ga0495621_0342927 Ga0495621_0342927_140_490 105
547 3300046558 Ga0495633_0011741 Ga0495633_0011741_2211_2561 105
548 3300046664 Ga0495659_0012774 Ga0495659_0012774_1710_2060 105
549 3300046691 Ga0495670_0000265 Ga0495670_0000265_20762_21127 105
550 3300046691 Ga0495670_0015052 Ga0495670_0015052_525_875 105
551 3300047318 Ga0495636_0241964 Ga0495636_0241964_152_502 105
552 3300047445 Ga0495677_0008959 Ga0495677_0008959_2161_2511 105
553 3300048903 Ga0496100_0085083 Ga0496100_0085083_1522_1899 105
554 3300048913 Ga0496110_0002670 Ga0496110_0002670_9581_9964 105
555 3300049708 Ga0501245_088074 Ga0501245_088074_144_530 105
556 3300049758 Ga0501241_117479 Ga0501241_117479_92_454 105
557 3300050493 nmdc:mga0k408_845769_c1 nmdc:mga0k408_845769_c1_46_414 105
558 3300050511 nmdc:mga08y16_1317997_c1 nmdc:mga08y16_1317997_c1_47_397 105
559 3300005327 Ga0070658_10107796 Ga0070658_101077961 106
560 3300005327 Ga0070658_10493840 Ga0070658_104938402 106
561 3300005328 Ga0070676_10101812 Ga0070676_101018122 106
562 3300005329 Ga0070683_100432648 Ga0070683_1004326482 106
563 3300005335 Ga0070666_10185932 Ga0070666_101859322 106
564 3300005339 Ga0070660_100050213 Ga0070660_1000502133 106
565 3300005344 Ga0070661_100048009 Ga0070661_1000480092 106
566 3300005364 Ga0070673_100285111 Ga0070673_1002851112 106
567 3300005367 Ga0070667_100029058 Ga0070667_1000290583 106
568 3300005455 Ga0070663_100004900 Ga0070663_1000049003 106
569 3300005455 Ga0070663_100635171 Ga0070663_1006351711 106
570 3300005457 Ga0070662_100486441 Ga0070662_1004864412 106
571 3300005457 Ga0070662_100929896 Ga0070662_1009298962 106
572 3300005459 Ga0068867_100028916 Ga0068867_1000289162 106
573 3300005530 Ga0070679_100171166 Ga0070679_1001711664 106
574 3300005544 Ga0070686_101499532 Ga0070686_1014995321 106
575 3300005548 Ga0070665_100023145 Ga0070665_1000231456 106
576 3300005548 Ga0070665_102363366 Ga0070665_1023633661 106
577 3300005563 Ga0068855_100017881 Ga0068855_1000178816 106
578 3300005564 Ga0070664_100086865 Ga0070664_1000868653 106
579 3300005614 Ga0068856_100033360 Ga0068856_1000333603 106
580 3300005616 Ga0068852_100004452 Ga0068852_1000044525 106
581 3300005616 Ga0068852_100025443 Ga0068852_1000254434 106
582 3300005842 Ga0068858_100439125 Ga0068858_1004391252 106
583 3300005843 Ga0068860_100039315 Ga0068860_1000393154 106
584 3300009093 Ga0105240_10062809 Ga0105240_100628093 106
585 3300009177 Ga0105248_10004017 Ga0105248_1000401712 106
586 3300009553 Ga0105249_12427064 Ga0105249_124270642 106
587 3300013100 Ga0157373_10027757 Ga0157373_100277573 106
588 3300013100 Ga0157373_10061564 Ga0157373_100615641 106
589 3300013102 Ga0157371_10025702 Ga0157371_100257024 106
590 3300013102 Ga0157371_10076620 Ga0157371_100766202 106
591 3300013105 Ga0157369_10000457 Ga0157369_100004572 106
592 3300013105 Ga0157369_10041372 Ga0157369_100413725 106
593 3300014968 Ga0157379_10053629 Ga0157379_100536292 106
594 3300025321 Ga0207656_10372467 Ga0207656_103724672 106
595 3300025903 Ga0207680_10055789 Ga0207680_100557892 106
596 3300025907 Ga0207645_10005127 Ga0207645_100051276 106
597 3300025909 Ga0207705_10113817 Ga0207705_101138173 106
598 3300025913 Ga0207695_10018769 Ga0207695_100187697 106
599 3300025919 Ga0207657_10014904 Ga0207657_100149045 106
600 3300025919 Ga0207657_10092466 Ga0207657_100924662 106
601 3300025920 Ga0207649_10213874 Ga0207649_102138742 106
602 3300025925 Ga0207650_10047240 Ga0207650_100472403 106
603 3300025925 Ga0207650_10222605 Ga0207650_102226051 106
604 3300025932 Ga0207690_10011885 Ga0207690_100118854 106
605 3300025932 Ga0207690_10304873 Ga0207690_103048732 106
606 3300025933 Ga0207706_10307425 Ga0207706_103074251 106
607 3300025941 Ga0207711_10003388 Ga0207711_1000338811 106
608 3300025941 Ga0207711_11664807 Ga0207711_116648072 106
609 3300025944 Ga0207661_10384409 Ga0207661_103844092 106
610 3300025949 Ga0207667_10006833 Ga0207667_100068339 106
611 3300025949 Ga0207667_10086411 Ga0207667_100864115 106
612 3300025986 Ga0207658_10012412 Ga0207658_100124122 106
613 3300025986 Ga0207658_10039859 Ga0207658_100398594 106
614 3300025986 Ga0207658_11080238 Ga0207658_110802382 106
615 3300025986 Ga0207658_11827643 Ga0207658_118276431 106
616 3300026023 Ga0207677_10180400 Ga0207677_101804003 106
617 3300026035 Ga0207703_10411617 Ga0207703_104116172 106
618 3300026067 Ga0207678_10027597 Ga0207678_100275975 106
619 3300026067 Ga0207678_10084766 Ga0207678_100847662 106
620 3300026078 Ga0207702_10045035 Ga0207702_100450353 106
621 3300026088 Ga0207641_10012508 Ga0207641_100125089 106
622 3300026089 Ga0207648_10104585 Ga0207648_101045853 106
623 3300026116 Ga0207674_10001057 Ga0207674_1000105724 106
624 3300026116 Ga0207674_10098050 Ga0207674_100980502 106
625 3300026118 Ga0207675_100517290 Ga0207675_1005172901 106
626 3300026142 Ga0207698_10002246 Ga0207698_100022464 106
627 3300026142 Ga0207698_10203429 Ga0207698_102034292 106
628 3300026142 Ga0207698_12498212 Ga0207698_124982121 106
629 3300028379 Ga0268266_10030267 Ga0268266_100302675 106
630 3300028380 Ga0268265_10020109 Ga0268265_100201095 106
631 3300028381 Ga0268264_10016442 Ga0268264_100164424 106
632 3300031548 Ga0307408_100118065 Ga0307408_1001180652 106
633 3300031548 Ga0307408_100343269 Ga0307408_1003432692 106
634 3300031731 Ga0307405_10039077 Ga0307405_100390772 106
635 3300031731 Ga0307405_10082817 Ga0307405_100828173 106
636 3300031824 Ga0307413_11285145 Ga0307413_112851451 106
637 3300031852 Ga0307410_10062242 Ga0307410_100622423 106
638 3300031852 Ga0307410_10086647 Ga0307410_100866472 106
639 3300031901 Ga0307406_10022227 Ga0307406_100222274 106
640 3300031901 Ga0307406_10481494 Ga0307406_104814942 106
641 3300031901 Ga0307406_11610412 Ga0307406_116104121 106
642 3300031903 Ga0307407_10530843 Ga0307407_105308432 106
643 3300031903 Ga0307407_10661251 Ga0307407_106612512 106
644 3300031911 Ga0307412_10006486 Ga0307412_100064862 106
645 3300031911 Ga0307412_10063942 Ga0307412_100639423 106
646 3300031995 Ga0307409_101140802 Ga0307409_1011408022 106
647 3300032002 Ga0307416_100048216 Ga0307416_1000482164 106
648 3300032002 Ga0307416_100243883 Ga0307416_1002438832 106
649 3300032004 Ga0307414_10537695 Ga0307414_105376952 106
650 3300032005 Ga0307411_10487207 Ga0307411_104872072 106
651 3300032126 Ga0307415_100012333 Ga0307415_1000123333 106
652 3300032126 Ga0307415_100079878 Ga0307415_1000798782 106
653 3300037312 Ga0395899_0550667 Ga0395899_0550667_155_526 106
654 3300037312 Ga0395899_0684988 Ga0395899_0684988_115_480 106
655 3300037312 Ga0395899_0705834 Ga0395899_0705834_174_533 106
656 3300037418 Ga0395900_0025967 Ga0395900_0025967_1928_2299 106
657 3300037418 Ga0395900_0046815 Ga0395900_0046815_332_700 106
658 3300037418 Ga0395900_0143347 Ga0395900_0143347_1223_1594 106
659 3300037418 Ga0395900_0168130 Ga0395900_0168130_285_644 106
660 3300037418 Ga0395900_0352040 Ga0395900_0352040_20_379 106
661 3300037466 Ga0395898_0099013 Ga0395898_0099013_1006_1374 106
662 3300037466 Ga0395898_0145415 Ga0395898_0145415_1798_2157 106
663 3300037466 Ga0395898_1126888 Ga0395898_1126888_185_559 106
664 3300037471 Ga0395905_0018990 Ga0395905_0018990_1750_2124 106
665 3300037471 Ga0395905_0072818 Ga0395905_0072818_1690_2049 106
666 3300037471 Ga0395905_0119430 Ga0395905_0119430_237_596 106
667 3300037471 Ga0395905_0132180 Ga0395905_0132180_907_1272 106
668 3300037471 Ga0395905_0161418 Ga0395905_0161418_943_1302 106
669 3300037471 Ga0395905_0461580 Ga0395905_0461580_157_516 106
670 3300037471 Ga0395905_0649891 Ga0395905_0649891_147_515 106
671 3300038443 Ga0395901_0010390 Ga0395901_0010390_445_804 106
672 3300038443 Ga0395901_0085261 Ga0395901_0085261_2724_3083 106
673 3300038443 Ga0395901_0181397 Ga0395901_0181397_1509_1868 106
674 3300038443 Ga0395901_0391934 Ga0395901_0391934_748_1113 106
675 3300038443 Ga0395901_1044486 Ga0395901_1044486_112_486 106
676 3300044765 Ga0466970_0595448 Ga0466970_0595448_236_625 106
677 3300044842 Ga0466957_0094351 Ga0466957_0094351_672_1073 106
678 3300045049 Ga0466959_0509724 Ga0466959_0509724_389_778 106
679 3300045976 Ga0466967_0168554 Ga0466967_0168554_293_664 106
680 3300046616 Ga0495668_0668634 Ga0495668_0668634_161_529 106
681 3300048912 Ga0496109_1562982 Ga0496109_1562982_38_421 106
682 3300048913 Ga0496110_0083978 Ga0496110_0083978_762_1139 106
683 3300048917 Ga0496114_0000130 Ga0496114_0000130_39642_40010 106
684 3300048917 Ga0496114_1110497 Ga0496114_1110497_116_493 106
685 3300049583 Ga0501067_0076212 Ga0501067_0076212_957_1328 106
686 3300001989 JGI24739J22299_10005106 JGI24739J22299_100051063 107
687 3300001990 JGI24737J22298_10000422 JGI24737J22298_100004222 107
688 3300002067 JGI24735J21928_10055911 JGI24735J21928_100559112 107
689 3300002075 JGI24738J21930_10001939 JGI24738J21930_100019392 107
690 3300005327 Ga0070658_10023474 Ga0070658_100234742 107
691 3300005327 Ga0070658_10130728 Ga0070658_101307282 107
692 3300005329 Ga0070683_100000644 Ga0070683_10000064413 107
693 3300005329 Ga0070683_101531359 Ga0070683_1015313591 107
694 3300005330 Ga0070690_100168729 Ga0070690_1001687292 107
695 3300005331 Ga0070670_100011264 Ga0070670_1000112642 107
696 3300005331 Ga0070670_100044913 Ga0070670_1000449132 107
697 3300005331 Ga0070670_100829920 Ga0070670_1008299202 107
698 3300005335 Ga0070666_10000346 Ga0070666_1000034620 107
699 3300005335 Ga0070666_10018053 Ga0070666_100180535 107
700 3300005335 Ga0070666_10022405 Ga0070666_100224053 107
701 3300005337 Ga0070682_100107007 Ga0070682_1001070072 107
702 3300005338 Ga0068868_100033307 Ga0068868_1000333073 107
703 3300005339 Ga0070660_100000350 Ga0070660_1000003504 107
704 3300005339 Ga0070660_100062648 Ga0070660_1000626483 107
705 3300005344 Ga0070661_100000536 Ga0070661_1000005362 107
706 3300005344 Ga0070661_100006434 Ga0070661_1000064344 107
707 3300005354 Ga0070675_100116649 Ga0070675_1001166492 107
708 3300005354 Ga0070675_100219839 Ga0070675_1002198391 107
709 3300005355 Ga0070671_100020835 Ga0070671_1000208353 107
710 3300005355 Ga0070671_100026271 Ga0070671_1000262715 107
711 3300005355 Ga0070671_100071087 Ga0070671_1000710873 107
712 3300005364 Ga0070673_100017318 Ga0070673_1000173185 107
713 3300005364 Ga0070673_100058691 Ga0070673_1000586914 107
714 3300005364 Ga0070673_100685767 Ga0070673_1006857672 107
715 3300005366 Ga0070659_100000139 Ga0070659_10000013913 107
716 3300005366 Ga0070659_100617677 Ga0070659_1006176771 107
717 3300005367 Ga0070667_100011453 Ga0070667_1000114534 107
718 3300005367 Ga0070667_100011779 Ga0070667_1000117794 107
719 3300005435 Ga0070714_100128294 Ga0070714_1001282942 107
720 3300005455 Ga0070663_100045477 Ga0070663_1000454774 107
721 3300005456 Ga0070678_100387912 Ga0070678_1003879122 107
722 3300005457 Ga0070662_100000024 Ga0070662_10000002444 107
723 3300005457 Ga0070662_100910392 Ga0070662_1009103921 107
724 3300005535 Ga0070684_100033437 Ga0070684_1000334373 107
725 3300005539 Ga0068853_100000342 Ga0068853_1000003425 107
726 3300005543 Ga0070672_100006707 Ga0070672_1000067072 107
727 3300005543 Ga0070672_100042656 Ga0070672_1000426562 107
728 3300005543 Ga0070672_101554667 Ga0070672_1015546672 107
729 3300005544 Ga0070686_100066840 Ga0070686_1000668402 107
730 3300005546 Ga0070696_100250881 Ga0070696_1002508812 107
731 3300005547 Ga0070693_100000870 Ga0070693_1000008702 107
732 3300005548 Ga0070665_100014111 Ga0070665_1000141115 107
733 3300005563 Ga0068855_100021596 Ga0068855_1000215968 107
734 3300005564 Ga0070664_100000082 Ga0070664_10000008211 107
735 3300005564 Ga0070664_100000446 Ga0070664_1000004467 107
736 3300005578 Ga0068854_100421151 Ga0068854_1004211511 107
737 3300005614 Ga0068856_100002271 Ga0068856_1000022714 107
738 3300005616 Ga0068852_100000442 Ga0068852_1000004426 107
739 3300005616 Ga0068852_100054137 Ga0068852_1000541372 107
740 3300005617 Ga0068859_100628853 Ga0068859_1006288532 107
741 3300005618 Ga0068864_100023721 Ga0068864_1000237215 107
742 3300005834 Ga0068851_10030480 Ga0068851_100304802 107
743 3300005841 Ga0068863_100020844 Ga0068863_1000208444 107
744 3300005841 Ga0068863_100275138 Ga0068863_1002751381 107
745 3300005842 Ga0068858_100001843 Ga0068858_1000018433 107
746 3300005842 Ga0068858_100218889 Ga0068858_1002188893 107
747 3300006237 Ga0097621_100009747 Ga0097621_1000097475 107
748 3300006237 Ga0097621_100074060 Ga0097621_1000740603 107
749 3300006237 Ga0097621_100230514 Ga0097621_1002305143 107
750 3300006358 Ga0068871_100011780 Ga0068871_1000117802 107
751 3300006358 Ga0068871_100036381 Ga0068871_1000363814 107
752 3300006931 Ga0097620_100330704 Ga0097620_1003307043 107
753 3300006931 Ga0097620_100628902 Ga0097620_1006289022 107
754 3300009174 Ga0105241_10271244 Ga0105241_102712442 107
755 3300009177 Ga0105248_10000059 Ga0105248_1000005981 107
756 3300009177 Ga0105248_10010113 Ga0105248_100101139 107
757 3300009177 Ga0105248_10925557 Ga0105248_109255572 107
758 3300010375 Ga0105239_10354061 Ga0105239_103540612 107
759 3300011119 Ga0105246_11262195 Ga0105246_112621951 107
760 3300013100 Ga0157373_10021409 Ga0157373_100214094 107
761 3300013102 Ga0157371_10001377 Ga0157371_100013772 107
762 3300013296 Ga0157374_10009657 Ga0157374_100096576 107
763 3300013296 Ga0157374_10490086 Ga0157374_104900861 107
764 3300013297 Ga0157378_10430906 Ga0157378_104309062 107
765 3300013306 Ga0163162_10007460 Ga0163162_100074609 107
766 3300013306 Ga0163162_10148629 Ga0163162_101486292 107
767 3300013308 Ga0157375_10004536 Ga0157375_100045364 107
768 3300013308 Ga0157375_10234026 Ga0157375_102340262 107
769 3300014325 Ga0163163_10001588 Ga0163163_100015885 107
770 3300014325 Ga0163163_10011294 Ga0163163_100112945 107
771 3300014969 Ga0157376_10159828 Ga0157376_101598283 107
772 3300025903 Ga0207680_10000874 Ga0207680_100008744 107
773 3300025903 Ga0207680_10059338 Ga0207680_100593382 107
774 3300025904 Ga0207647_10019612 Ga0207647_100196122 107
775 3300025909 Ga0207705_10000062 Ga0207705_1000006242 107
776 3300025914 Ga0207671_10457803 Ga0207671_104578032 107
777 3300025919 Ga0207657_10000015 Ga0207657_10000015151 107
778 3300025920 Ga0207649_10000264 Ga0207649_1000026424 107
779 3300025920 Ga0207649_10070690 Ga0207649_100706902 107
780 3300025921 Ga0207652_10621600 Ga0207652_106216001 107
781 3300025925 Ga0207650_10006533 Ga0207650_100065334 107
782 3300025925 Ga0207650_10027132 Ga0207650_100271324 107
783 3300025925 Ga0207650_10768661 Ga0207650_107686612 107
784 3300025926 Ga0207659_10211331 Ga0207659_102113312 107
785 3300025929 Ga0207664_10324223 Ga0207664_103242232 107
786 3300025931 Ga0207644_10003121 Ga0207644_1000312110 107
787 3300025931 Ga0207644_10005596 Ga0207644_100055965 107
788 3300025931 Ga0207644_10036823 Ga0207644_100368233 107
789 3300025932 Ga0207690_10000032 Ga0207690_1000003245 107
790 3300025932 Ga0207690_11001532 Ga0207690_110015322 107
791 3300025933 Ga0207706_10000032 Ga0207706_10000032115 107
792 3300025933 Ga0207706_10147339 Ga0207706_101473392 107
793 3300025937 Ga0207669_10659457 Ga0207669_106594571 107
794 3300025937 Ga0207669_10862618 Ga0207669_108626181 107
795 3300025940 Ga0207691_10037688 Ga0207691_100376884 107
796 3300025940 Ga0207691_10415376 Ga0207691_104153762 107
797 3300025941 Ga0207711_10000476 Ga0207711_1000047612 107
798 3300025941 Ga0207711_10003405 Ga0207711_100034054 107
799 3300025944 Ga0207661_10007272 Ga0207661_100072728 107
800 3300025944 Ga0207661_10074005 Ga0207661_100740053 107
801 3300025945 Ga0207679_10008801 Ga0207679_100088012 107
802 3300025945 Ga0207679_10019442 Ga0207679_100194423 107
803 3300025945 Ga0207679_11002128 Ga0207679_110021282 107
804 3300025949 Ga0207667_10117262 Ga0207667_101172622 107
805 3300025960 Ga0207651_10001385 Ga0207651_100013855 107
806 3300025960 Ga0207651_10006626 Ga0207651_100066263 107
807 3300025960 Ga0207651_10371764 Ga0207651_103717642 107
808 3300025960 Ga0207651_10407530 Ga0207651_104075302 107
809 3300025981 Ga0207640_10025454 Ga0207640_100254542 107
810 3300025981 Ga0207640_10597914 Ga0207640_105979142 107
811 3300025986 Ga0207658_10012532 Ga0207658_100125322 107
812 3300025986 Ga0207658_10028041 Ga0207658_100280413 107
813 3300026023 Ga0207677_10027828 Ga0207677_100278283 107
814 3300026035 Ga0207703_10061367 Ga0207703_100613673 107
815 3300026035 Ga0207703_10087145 Ga0207703_100871453 107
816 3300026041 Ga0207639_10012166 Ga0207639_100121662 107
817 3300026067 Ga0207678_10066035 Ga0207678_100660352 107
818 3300026078 Ga0207702_10000072 Ga0207702_1000007219 107
819 3300026088 Ga0207641_10161978 Ga0207641_101619782 107
820 3300026088 Ga0207641_10590610 Ga0207641_105906101 107
821 3300026089 Ga0207648_10108667 Ga0207648_101086673 107
822 3300026095 Ga0207676_10010149 Ga0207676_100101494 107
823 3300026095 Ga0207676_10021705 Ga0207676_100217053 107
824 3300026116 Ga0207674_10392382 Ga0207674_103923822 107
825 3300026121 Ga0207683_10155374 Ga0207683_101553742 107
826 3300026142 Ga0207698_10000401 Ga0207698_100004016 107
827 3300026142 Ga0207698_10373548 Ga0207698_103735482 107
828 3300026142 Ga0207698_11296417 Ga0207698_112964172 107
829 3300028379 Ga0268266_10011662 Ga0268266_100116624 107
830 3300028379 Ga0268266_10022624 Ga0268266_100226245 107
831 3300031548 Ga0307408_100434449 Ga0307408_1004344492 107
832 3300031731 Ga0307405_10118719 Ga0307405_101187193 107
833 3300031995 Ga0307409_101735873 Ga0307409_1017358732 107
834 3300032002 Ga0307416_101518818 Ga0307416_1015188181 107
835 3300032126 Ga0307415_100239797 Ga0307415_1002397973 107
836 3300032126 Ga0307415_101889983 Ga0307415_1018899831 107
837 3300035090 Ga0373949_0222039 Ga0373949_0222039_74_436 107
838 3300035121 Ga0373960_0048676 Ga0373960_0048676_482_853 107
839 3300035121 Ga0373960_0294607 Ga0373960_0294607_73_429 107
840 3300035170 Ga0373943_0701021 Ga0373943_0701021_11_376 107
841 3300035207 Ga0373942_0063085 Ga0373942_0063085_675_1046 107
842 3300035241 Ga0373961_0106608 Ga0373961_0106608_355_726 107
843 3300035242 Ga0373962_0056396 Ga0373962_0056396_432_803 107
844 3300035691 Ga0373931_0163811 Ga0373931_0163811_107_478 107
845 3300037418 Ga0395900_0271030 Ga0395900_0271030_889_1260 107
846 3300037466 Ga0395898_0080689 Ga0395898_0080689_1001_1372 107
847 3300037466 Ga0395898_0233448 Ga0395898_0233448_684_1055 107
848 3300037471 Ga0395905_0044686 Ga0395905_0044686_2602_2973 107
849 3300037471 Ga0395905_0094601 Ga0395905_0094601_1251_1622 107
850 3300037471 Ga0395905_1227166 Ga0395905_1227166_197_565 107
851 3300037471 Ga0395905_1463891 Ga0395905_1463891_94_456 107
852 3300038443 Ga0395901_0985980 Ga0395901_0985980_331_702 107
853 3300044656 Ga0466969_0132382 Ga0466969_0132382_342_725 107
854 3300044684 Ga0466966_0050183 Ga0466966_0050183_961_1344 107
855 3300044693 Ga0466961_0087877 Ga0466961_0087877_290_673 107
856 3300045049 Ga0466959_0591742 Ga0466959_0591742_95_466 107
857 3300048903 Ga0496100_1053907 Ga0496100_1053907_49_411 107
858 3300048905 Ga0496102_1076188 Ga0496102_1076188_240_608 107
859 3300048907 Ga0496104_0233993 Ga0496104_0233993_1210_1581 107
860 3300048909 Ga0496106_0873921 Ga0496106_0873921_46_414 107
861 3300048911 Ga0496108_0019106 Ga0496108_0019106_98_466 107
862 3300048912 Ga0496109_0010272 Ga0496109_0010272_3647_4015 107
863 3300048912 Ga0496109_0284682 Ga0496109_0284682_1014_1385 107
864 3300048913 Ga0496110_0058937 Ga0496110_0058937_72_440 107
865 3300048914 Ga0496111_0006573 Ga0496111_0006573_4398_4766 107
866 3300048914 Ga0496111_0085326 Ga0496111_0085326_975_1346 107
867 3300048915 Ga0496112_0007106 Ga0496112_0007106_8365_8733 107
868 3300048915 Ga0496112_0342629 Ga0496112_0342629_674_1045 107
869 3300005329 Ga0070683_100083467 Ga0070683_1000834672 108
870 3300005336 Ga0070680_100004746 Ga0070680_1000047466 108
871 3300005458 Ga0070681_10039471 Ga0070681_100394712 108
872 3300005539 Ga0068853_100947246 Ga0068853_1009472462 108
873 3300005578 Ga0068854_100039529 Ga0068854_1000395292 108
874 3300005614 Ga0068856_101842204 Ga0068856_1018422042 108
875 3300005616 Ga0068852_100011074 Ga0068852_1000110744 108
876 3300013100 Ga0157373_10028490 Ga0157373_100284904 108
877 3300013102 Ga0157371_10031308 Ga0157371_100313084 108
878 3300013104 Ga0157370_10018260 Ga0157370_100182606 108
879 3300013307 Ga0157372_12896285 Ga0157372_128962851 108
880 3300020069 Ga0197907_10985389 Ga0197907_109853892 108
881 3300020070 Ga0206356_11773638 Ga0206356_117736382 108
882 3300020081 Ga0206354_11653543 Ga0206354_116535432 108
883 3300020082 Ga0206353_10677093 Ga0206353_106770934 108
884 3300022467 Ga0224712_10345548 Ga0224712_103455482 108
885 3300025912 Ga0207707_11107345 Ga0207707_111073452 108
886 3300025917 Ga0207660_10003522 Ga0207660_100035226 108
887 3300025949 Ga0207667_10012957 Ga0207667_100129577 108
888 3300026078 Ga0207702_10556833 Ga0207702_105568332 108
889 3300026116 Ga0207674_10027289 Ga0207674_100272893 108
890 3300026142 Ga0207698_10005358 Ga0207698_100053583 108
891 3300037418 Ga0395900_0059192 Ga0395900_0059192_1104_1475 108
892 3300037466 Ga0395898_0004581 Ga0395898_0004581_7058_7429 108
893 3300037471 Ga0395905_0047313 Ga0395905_0047313_2692_3063 108
894 3300038443 Ga0395901_0020018 Ga0395901_0020018_5861_6232 108
895 3300044694 Ga0466963_0115074 Ga0466963_0115074_855_1238 108
896 3300044842 Ga0466957_0118526 Ga0466957_0118526_912_1295 108
897 3300048915 Ga0496112_0158361 Ga0496112_0158361_174_545 108
898 3300005544 Ga0070686_100870845 Ga0070686_1008708451 109
899 3300025949 Ga0207667_10086548 Ga0207667_100865484 109
900 3300046525 Ga0495663_0041496 Ga0495663_0041496_601_963 109
901 3300046684 Ga0495669_0000398 Ga0495669_0000398_6056_6418 109
902 3300047323 Ga0495683_0128025 Ga0495683_0128025_120_482 109
903 3300047445 Ga0495677_0072553 Ga0495677_0072553_476_838 109
904 3300053083 Ga0495655_0006404 Ga0495655_0006404_1309_1671 109
905 3300001915 JGI24741J21665_1006508 JGI24741J21665_10065083 110
906 3300001979 JGI24740J21852_10005667 JGI24740J21852_100056674 110
907 3300001989 JGI24739J22299_10011414 JGI24739J22299_100114145 110
908 3300002067 JGI24735J21928_10007891 JGI24735J21928_100078914 110
909 3300005327 Ga0070658_10218497 Ga0070658_102184971 110
910 3300005327 Ga0070658_11878739 Ga0070658_118787391 110
911 3300005336 Ga0070680_100195661 Ga0070680_1001956613 110
912 3300005337 Ga0070682_100017248 Ga0070682_1000172483 110
913 3300005344 Ga0070661_100089346 Ga0070661_1000893462 110
914 3300005345 Ga0070692_10076721 Ga0070692_100767213 110
915 3300005366 Ga0070659_100580947 Ga0070659_1005809471 110
916 3300005366 Ga0070659_101495815 Ga0070659_1014958151 110
917 3300005435 Ga0070714_100186984 Ga0070714_1001869842 110
918 3300005436 Ga0070713_100186690 Ga0070713_1001866903 110
919 3300005455 Ga0070663_100016745 Ga0070663_1000167453 110
920 3300005457 Ga0070662_100031305 Ga0070662_1000313054 110
921 3300005530 Ga0070679_100917471 Ga0070679_1009174712 110
922 3300005535 Ga0070684_100043691 Ga0070684_1000436915 110
923 3300005539 Ga0068853_100087423 Ga0068853_1000874232 110
924 3300005563 Ga0068855_100092966 Ga0068855_1000929662 110
925 3300005577 Ga0068857_100640955 Ga0068857_1006409552 110
926 3300005578 Ga0068854_100279902 Ga0068854_1002799022 110
927 3300009174 Ga0105241_11532887 Ga0105241_115328872 110
928 3300013100 Ga0157373_11572309 Ga0157373_115723091 110
929 3300013102 Ga0157371_10499551 Ga0157371_104995512 110
930 3300013102 Ga0157371_10541687 Ga0157371_105416871 110
931 3300013307 Ga0157372_10173303 Ga0157372_101733032 110
932 3300025909 Ga0207705_10309627 Ga0207705_103096272 110
933 3300025912 Ga0207707_10404128 Ga0207707_104041282 110
934 3300025917 Ga0207660_10030369 Ga0207660_100303692 110
935 3300025919 Ga0207657_10044733 Ga0207657_100447333 110
936 3300025920 Ga0207649_10281478 Ga0207649_102814782 110
937 3300025921 Ga0207652_10028353 Ga0207652_100283533 110
938 3300025928 Ga0207700_10808072 Ga0207700_108080721 110
939 3300025929 Ga0207664_10022983 Ga0207664_100229833 110
940 3300025932 Ga0207690_10031694 Ga0207690_100316944 110
941 3300025933 Ga0207706_10036477 Ga0207706_100364774 110
942 3300025949 Ga0207667_10230328 Ga0207667_102303283 110
943 3300026067 Ga0207678_10016250 Ga0207678_100162504 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03840

SecG

Preprotein translocase SecG subunit

14

58

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w1m-assembly1.cif.gz_D cryo-em structure of human cohesin-ctcf-dna complex 0.9078 2 68
4abm-assembly1.cif.gz_A crystal structure of chmp4b hairpin 0.8958 2 69
6thk-assembly1.cif.gz_A structural mechanism of pyocin s5 import into pseudomonas aeruginosa 0.8917 4 74
3jc1-assembly1.cif.gz_Ab electron cryo-microscopy of the ist1-chmp1b escrt-iii copolymer 0.8893 2 73
6wg3-assembly1.cif.gz_D cryo-em structure of human cohesin-nipbl-dna complex 0.8803 2 69
ID Description Score Start End Superfamily
4k2oA02 Special;Helix non-globular;Helix Hairpins; 0.912 1 72 6.10.140.680
af_D3ZWV8_556_669_6.10.140.680 Special;Helix non-globular;Helix Hairpins; 0.9047 1 72 6.10.140.680
af_Q8I560_31_409_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8991 2 67 1.25.40.10
af_Q8I560_72_417_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8991 2 67 1.25.40.10
1setA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8819 2 69 1.10.287.40
ID Description Score Start End GO Terms
AF-A0A2E6H2X1-F1-model_v4 C4-type zinc ribbon domain-containing protein 0.9006 2 72
AF-A0A2D8NYS1-F1-model_v4 deleted 0.8951 5 77
AF-A0A1I8G8F7-F1-model_v4 TPR_MLP1_2 domain-containing protein 0.8938 2 74 GO:0005794
GO:0031267
GO:0048193
AF-A0A3R7VQD1-F1-model_v4 Uncharacterized protein 0.893 2 79 GO:0016020
AF-A0A2E7GD68-F1-model_v4 deleted 0.892 2 73

Feature Viewer

pLDDT pTM Quality
74.03 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map