F486365

General Info

Members Datasets Scaffolds Average Seq Length
942 338 941 224

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1906628|Ga0436365_1906628_42_821
Length 259
Sequence MGPGAQESREGSRLARAPELETSASHSAAAAERNEDSGHGARYVAIITDGNGRWAARRKLPVLAGHEAGADVVKARLRDAVDLGILELTVYSFSTENWSRPPAEVTGLMAMMGRRIEAETPELHDEGVRMRFIGRRSDPVPPELVKRMEWAEKLTAGNNRITLFVAFNYGGRAEILDAARSFSGQTEEEFRSHLYAPEMHDPDLIIRTSGERRSSNFLLWQGHYSELVFRDELWPDFSRDVFEQSLNEFAARRRRFGGR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
156 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
204 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
205 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
328 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
331 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 9.77
Rhizosphere 83.86
Stem 0
Stem Tuber 0
Unclassified 3.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009389 3300001979 Bacteria 3832
2 JGI24743J22301_10044033 3300001991 Bacteria 900
3 JGI24750J21931_1006886 3300002070 Bacteria 1423
4 JGI25406J46586_10003068 3300003203 Bacteria 7861
5 JGI25407J50210_10003770 3300003373 Bacteria 3658
6 JGI25407J50210_10005022 3300003373 Bacteria 3234
7 JGI25407J50210_10009964 3300003373 Bacteria 2414
8 JGI25407J50210_10011690 3300003373 Bacteria 2246
9 JGI25407J50210_10025068 3300003373 Bacteria 1546
10 JGI25407J50210_10025262 3300003373 Bacteria 1540
11 JGI25404J52841_10000671 3300003659 Bacteria 5227
12 Ga0070676_10405820 3300005328 Bacteria 949
13 Ga0070683_100567195 3300005329 Bacteria 1086
14 Ga0070690_100330506 3300005330 Bacteria 1101
15 Ga0068869_100151291 3300005334 Bacteria 1800
16 Ga0068869_100170166 3300005334 Bacteria 1702
17 Ga0070666_10005716 3300005335 Bacteria 7632
18 Ga0070666_10011418 3300005335 Bacteria 5573
19 Ga0070682_100076729 3300005337 Bacteria 2152
20 Ga0070682_100165993 3300005337 Bacteria 1530
21 Ga0070682_100281883 3300005337 Bacteria 1212
22 Ga0070682_100376199 3300005337 Bacteria 1067
23 Ga0068868_100022400 3300005338 Bacteria 4767
24 Ga0070660_100092816 3300005339 Bacteria 2383
25 Ga0070689_100397814 3300005340 Bacteria 1164
26 Ga0070691_10000021 3300005341 Bacteria 45268
27 Ga0070691_10027557 3300005341 Bacteria 2652
28 Ga0070691_10031342 3300005341 Bacteria 2493
29 Ga0070661_100257761 3300005344 Bacteria 1347
30 Ga0070661_100361443 3300005344 Bacteria 1141
31 Ga0070668_100006694 3300005347 Bacteria 8541
32 Ga0070675_100034890 3300005354 Bacteria 4084
33 Ga0070674_100389231 3300005356 Bacteria 1136
34 Ga0070673_100051394 3300005364 Bacteria 3228
35 Ga0070688_100053016 3300005365 Bacteria 2536
36 Ga0070659_100000037 3300005366 Bacteria 113379
37 Ga0070659_100021303 3300005366 Bacteria 4934
38 Ga0070667_100051735 3300005367 Bacteria 3463
39 Ga0070709_10107091 3300005434 Bacteria 1873
40 Ga0070714_100003806 3300005435 Bacteria 11332
41 Ga0070714_100007942 3300005435 Bacteria 8267
42 Ga0070714_100023442 3300005435 Bacteria 5071
43 Ga0070714_100046191 3300005435 Bacteria 3693
44 Ga0070714_100068740 3300005435 Bacteria 3057
45 Ga0070714_100293172 3300005435 Bacteria 1514
46 Ga0070714_100453558 3300005435 Bacteria 1218
47 Ga0070713_100067820 3300005436 Bacteria 3005
48 Ga0070713_100104694 3300005436 Bacteria 2457
49 Ga0070713_100183117 3300005436 Bacteria 1883
50 Ga0070710_10000050 3300005437 Bacteria 56781
51 Ga0070710_10111737 3300005437 Bacteria 1642
52 Ga0070701_10125108 3300005438 Bacteria 1454
53 Ga0070701_10385802 3300005438 Bacteria 884
54 Ga0070711_100006655 3300005439 Bacteria 6986
55 Ga0070711_100014891 3300005439 Bacteria 4912
56 Ga0070711_100094329 3300005439 Bacteria 2163
57 Ga0070711_100580962 3300005439 Bacteria 933
58 Ga0070700_100000722 3300005441 Bacteria 16301
59 Ga0070700_100006275 3300005441 Bacteria 6344
60 Ga0070700_100040032 3300005441 Bacteria 2867
61 Ga0070700_100194564 3300005441 Bacteria 1420
62 Ga0070700_100350925 3300005441 Bacteria 1094
63 Ga0070663_100095415 3300005455 Bacteria 2210
64 Ga0070663_100387279 3300005455 Bacteria 1140
65 Ga0070678_100039455 3300005456 Bacteria 3332
66 Ga0070662_100417141 3300005457 Bacteria 1110
67 Ga0068867_100188880 3300005459 Bacteria 1643
68 Ga0068867_100808717 3300005459 Bacteria 836
69 Ga0070685_10045942 3300005466 Bacteria 2506
70 Ga0070685_10184968 3300005466 Bacteria 1344
71 Ga0070698_100495889 3300005471 Bacteria 1159
72 Ga0070679_100290078 3300005530 Bacteria 1588
73 Ga0070684_100035669 3300005535 Bacteria 4258
74 Ga0070684_100215866 3300005535 Bacteria 1749
75 Ga0070684_100220518 3300005535 Bacteria 1730
76 Ga0070684_100230599 3300005535 Bacteria 1691
77 Ga0070684_100237483 3300005535 Bacteria 1665
78 Ga0070686_100046138 3300005544 Bacteria 2748
79 Ga0070686_100242452 3300005544 Bacteria 1313
80 Ga0070695_100285073 3300005545 Bacteria 1215
81 Ga0070696_100618212 3300005546 Bacteria 875
82 Ga0070665_100000135 3300005548 Bacteria 138925
83 Ga0070665_100064521 3300005548 Bacteria 3673
84 Ga0070665_100119286 3300005548 Bacteria 2640
85 Ga0070665_100303345 3300005548 Bacteria 1600
86 Ga0070665_100303852 3300005548 Bacteria 1598
87 Ga0070665_100382029 3300005548 Bacteria 1416
88 Ga0070704_100101431 3300005549 Bacteria 2170
89 Ga0070664_100017246 3300005564 Bacteria 5930
90 Ga0070664_100052502 3300005564 Bacteria 3453
91 Ga0070664_100344981 3300005564 Bacteria 1353
92 Ga0068857_100112689 3300005577 Bacteria 2445
93 Ga0068857_100642147 3300005577 Bacteria 1005
94 Ga0068854_100219200 3300005578 Bacteria 1504
95 Ga0068856_100002016 3300005614 Bacteria 21154
96 Ga0068856_100037628 3300005614 Bacteria 4748
97 Ga0070702_100118460 3300005615 Bacteria 1654
98 Ga0070702_100360052 3300005615 Bacteria 1028
99 Ga0068852_100166209 3300005616 Bacteria 2064
100 Ga0068852_100583926 3300005616 Bacteria 1120
101 Ga0068864_100002096 3300005618 Bacteria 16473
102 Ga0068866_10031078 3300005718 Bacteria 2569
103 Ga0068861_100001186 3300005719 Bacteria 16201
104 Ga0068861_100088248 3300005719 Bacteria 2442
105 Ga0068861_100104384 3300005719 Bacteria 2261
106 Ga0068870_10058400 3300005840 Bacteria 2065
107 Ga0068870_10171090 3300005840 Bacteria 1296
108 Ga0068858_100000142 3300005842 Bacteria 75787
109 Ga0068862_100178662 3300005844 Bacteria 1904
110 Ga0068862_100360966 3300005844 Bacteria 1350
111 Ga0068862_100672124 3300005844 Bacteria 1001
112 Ga0081455_10017510 3300005937 Bacteria 6865
113 Ga0081455_10019598 3300005937 Bacteria 6392
114 Ga0081455_10022152 3300005937 Bacteria 5945
115 Ga0081455_10025337 3300005937 Bacteria 5477
116 Ga0081455_10057346 3300005937 Bacteria 3301
117 Ga0081455_10063879 3300005937 Bacteria 3087
118 Ga0081455_10101142 3300005937 Bacteria 2314
119 Ga0081455_10142289 3300005937 Bacteria 1861
120 Ga0081538_10000044 3300005981 Bacteria 115394
121 Ga0081538_10000087 3300005981 Bacteria 88954
122 Ga0081538_10000190 3300005981 Bacteria 67602
123 Ga0081538_10000766 3300005981 Bacteria 35083
124 Ga0081538_10002073 3300005981 Bacteria 19976
125 Ga0081538_10002222 3300005981 Bacteria 19234
126 Ga0081538_10004723 3300005981 Bacteria 12476
127 Ga0081538_10005950 3300005981 Bacteria 10856
128 Ga0081538_10007981 3300005981 Bacteria 9057
129 Ga0081538_10013472 3300005981 Bacteria 6468
130 Ga0081538_10014713 3300005981 Bacteria 6106
131 Ga0081538_10015512 3300005981 Bacteria 5891
132 Ga0081538_10017123 3300005981 Bacteria 5517
133 Ga0081538_10017143 3300005981 Bacteria 5510
134 Ga0081538_10017511 3300005981 Bacteria 5434
135 Ga0081538_10023738 3300005981 Bacteria 4398
136 Ga0081538_10026605 3300005981 Bacteria 4041
137 Ga0081538_10094492 3300005981 Bacteria 1530
138 Ga0081540_1000041 3300005983 Bacteria 136874
139 Ga0081540_1001363 3300005983 Bacteria 21184
140 Ga0081539_10002877 3300005985 Bacteria 22840
141 Ga0081539_10004211 3300005985 Bacteria 16224
142 Ga0081539_10038945 3300005985 Bacteria 2811
143 Ga0070717_10000019 3300006028 Bacteria 178051
144 Ga0070717_10007024 3300006028 Bacteria 8333
145 Ga0070717_10008551 3300006028 Bacteria 7645
146 Ga0075365_10002584 3300006038 Bacteria 8953
147 Ga0075365_10005531 3300006038 Bacteria 6826
148 Ga0075365_10042925 3300006038 Bacteria 2958
149 Ga0075365_10136942 3300006038 Bacteria 1698
150 Ga0075365_10219697 3300006038 Bacteria 1333
151 Ga0075363_100029908 3300006048 Bacteria 2815
152 Ga0075363_100062948 3300006048 Bacteria 2001
153 Ga0075363_100160108 3300006048 Bacteria 1274
154 Ga0075364_10007011 3300006051 Bacteria 6658
155 Ga0075364_10508173 3300006051 Bacteria 824
156 Ga0075432_10004604 3300006058 Bacteria 4694
157 Ga0075432_10026857 3300006058 Bacteria 1979
158 Ga0075432_10128566 3300006058 Bacteria 958
159 Ga0070715_10034603 3300006163 Bacteria 2072
160 Ga0070712_100000004 3300006175 Bacteria 215464
161 Ga0070712_100002009 3300006175 Bacteria 12454
162 Ga0070712_100009269 3300006175 Bacteria 6200
163 Ga0070712_100013243 3300006175 Bacteria 5265
164 Ga0070712_100851994 3300006175 Bacteria 784
165 Ga0075367_10084473 3300006178 Bacteria 1925
166 Ga0075428_100046559 3300006844 Bacteria 4764
167 Ga0075428_100066684 3300006844 Bacteria 3941
168 Ga0075430_100000277 3300006846 Bacteria 35951
169 Ga0075430_100021746 3300006846 Bacteria 5452
170 Ga0075430_100022807 3300006846 Bacteria 5323
171 Ga0075430_100051964 3300006846 Bacteria 3451
172 Ga0075430_100186547 3300006846 Bacteria 1724
173 Ga0075430_100393300 3300006846 Bacteria 1144
174 Ga0075431_100001949 3300006847 Bacteria 19692
175 Ga0075431_100032339 3300006847 Bacteria 5391
176 Ga0075431_100207840 3300006847 Bacteria 2001
177 Ga0075431_100387477 3300006847 Bacteria 1400
178 Ga0075431_100542830 3300006847 Bacteria 1150
179 Ga0075431_100639750 3300006847 Bacteria 1045
180 Ga0075433_10056171 3300006852 Bacteria 3438
181 Ga0075433_10067739 3300006852 Bacteria 3133
182 Ga0075433_10081739 3300006852 Bacteria 2849
183 Ga0075434_100023133 3300006871 Bacteria 6053
184 Ga0075429_100005448 3300006880 Bacteria 10962
185 Ga0075429_100022506 3300006880 Bacteria 5464
186 Ga0075429_100109912 3300006880 Bacteria 2410
187 Ga0075429_100473889 3300006880 Bacteria 1097
188 Ga0075429_100865911 3300006880 Bacteria 791
189 Ga0075436_100020658 3300006914 Bacteria 4518
190 Ga0075435_100065745 3300007076 Bacteria 2949
191 Ga0075435_100142714 3300007076 Bacteria 2010
192 Ga0111539_10003327 3300009094 Bacteria 21229
193 Ga0111539_10044281 3300009094 Bacteria 5333
194 Ga0111539_10057713 3300009094 Bacteria 4609
195 Ga0111539_10069723 3300009094 Bacteria 4151
196 Ga0111539_10082912 3300009094 Bacteria 3771
197 Ga0111539_10330969 3300009094 Bacteria 1773
198 Ga0111539_10448568 3300009094 Bacteria 1502
199 Ga0111539_10713428 3300009094 Bacteria 1167
200 Ga0105245_10006545 3300009098 Bacteria 10227
201 Ga0105245_10012887 3300009098 Bacteria 7288
202 Ga0105245_10013871 3300009098 Bacteria 7021
203 Ga0105245_10035529 3300009098 Bacteria 4423
204 Ga0105247_10000278 3300009101 Bacteria 47180
205 Ga0105247_10265383 3300009101 Bacteria 1179
206 Ga0105247_10551186 3300009101 Bacteria 848
207 Ga0114129_10055555 3300009147 Bacteria 5548
208 Ga0114129_10070350 3300009147 Bacteria 4879
209 Ga0114129_10138603 3300009147 Bacteria 3337
210 Ga0114129_10139126 3300009147 Bacteria 3329
211 Ga0114129_10148059 3300009147 Bacteria 3215
212 Ga0114129_10232254 3300009147 Bacteria 2484
213 Ga0114129_10508850 3300009147 Bacteria 1572
214 Ga0114129_10547039 3300009147 Bacteria 1506
215 Ga0114129_10782757 3300009147 Bacteria 1219
216 Ga0114129_11581042 3300009147 Bacteria 803
217 Ga0105243_10271201 3300009148 Bacteria 1524
218 Ga0105243_10316197 3300009148 Bacteria 1421
219 Ga0105243_11039491 3300009148 Bacteria 824
220 Ga0105242_10000533 3300009176 Bacteria 30003
221 Ga0105242_10000921 3300009176 Bacteria 22877
222 Ga0105242_10034928 3300009176 Bacteria 4031
223 Ga0105242_10175064 3300009176 Bacteria 1888
224 Ga0105248_10074184 3300009177 Bacteria 3824
225 Ga0105248_11075962 3300009177 Bacteria 909
226 Ga0105237_10000501 3300009545 Bacteria 55515
227 Ga0105237_10798121 3300009545 Bacteria 951
228 Ga0105238_10000055 3300009551 Bacteria 139232
229 Ga0105249_10062901 3300009553 Bacteria 3408
230 Ga0105249_10110695 3300009553 Bacteria 2596
231 Ga0105249_10192817 3300009553 Bacteria 1990
232 Ga0105239_10027346 3300010375 Bacteria 6279
233 Ga0105239_10063989 3300010375 Bacteria 4038
234 Ga0105239_10114635 3300010375 Bacteria 2989
235 Ga0105239_10141763 3300010375 Bacteria 2679
236 Ga0105239_10424499 3300010375 Bacteria 1506
237 Ga0105239_10453533 3300010375 Bacteria 1455
238 Ga0105246_10011340 3300011119 Bacteria 5532
239 Ga0157318_1002707 3300012482 Bacteria 984
240 Ga0157371_10205703 3300013102 Bacteria 1412
241 Ga0157374_10007744 3300013296 Bacteria 9170
242 Ga0157374_10134876 3300013296 Bacteria 2392
243 Ga0163162_10047822 3300013306 Bacteria 4286
244 Ga0163162_10345740 3300013306 Bacteria 1620
245 Ga0163162_11086915 3300013306 Bacteria 906
246 Ga0157372_10094032 3300013307 Bacteria 3412
247 Ga0157372_10622725 3300013307 Bacteria 1257
248 Ga0157372_10894288 3300013307 Bacteria 1030
249 Ga0157375_10046031 3300013308 Bacteria 4250
250 Ga0157375_10054962 3300013308 Bacteria 3923
251 Ga0157375_10299622 3300013308 Bacteria 1771
252 Ga0163163_10045286 3300014325 Bacteria 4318
253 Ga0163163_10362079 3300014325 Bacteria 1507
254 Ga0163163_10486483 3300014325 Bacteria 1295
255 Ga0157380_10073581 3300014326 Bacteria 2771
256 Ga0157377_10000686 3300014745 Bacteria 13991
257 Ga0157379_10034982 3300014968 Bacteria 4478
258 Ga0157379_10161357 3300014968 Bacteria 2023
259 Ga0157379_10316085 3300014968 Bacteria 1425
260 Ga0157379_10676433 3300014968 Bacteria 968
261 Ga0157376_10065116 3300014969 Bacteria 3076
262 Ga0163161_10084272 3300017792 Bacteria 2344
263 Ga0163161_10569661 3300017792 Bacteria 930
264 Ga0163161_10670557 3300017792 Bacteria 861
265 Ga0213876_10010277 3300021384 Bacteria 5026
266 Ga0213876_10014726 3300021384 Bacteria 4143
267 Ga0213876_10077889 3300021384 Bacteria 1751
268 Ga0213875_10006762 3300021388 Bacteria 5991
269 Ga0213875_10007406 3300021388 Bacteria 5669
270 Ga0213875_10083266 3300021388 Bacteria 1493
271 Ga0207656_10035268 3300025321 Bacteria 2094
272 Ga0207692_10000022 3300025898 Bacteria 56680
273 Ga0207692_10047202 3300025898 Bacteria 2162
274 Ga0207692_10219666 3300025898 Bacteria 1126
275 Ga0207710_10113705 3300025900 Bacteria 1287
276 Ga0207710_10189747 3300025900 Bacteria 1011
277 Ga0207688_10002774 3300025901 Bacteria 9496
278 Ga0207680_10002798 3300025903 Bacteria 8163
279 Ga0207680_10015344 3300025903 Bacteria 3997
280 Ga0207645_10276852 3300025907 Bacteria 1114
281 Ga0207643_10022822 3300025908 Bacteria 3448
282 Ga0207643_10108518 3300025908 Bacteria 1633
283 Ga0207695_10488057 3300025913 Bacteria 1114
284 Ga0207671_10002754 3300025914 Bacteria 18355
285 Ga0207693_10000017 3300025915 Bacteria 139308
286 Ga0207693_10000973 3300025915 Bacteria 25767
287 Ga0207693_10002823 3300025915 Bacteria 15054
288 Ga0207693_10021101 3300025915 Bacteria 5177
289 Ga0207693_10344077 3300025915 Bacteria 1167
290 Ga0207693_10470163 3300025915 Bacteria 982
291 Ga0207663_10037118 3300025916 Bacteria 2936
292 Ga0207663_10090650 3300025916 Bacteria 2027
293 Ga0207662_10476135 3300025918 Bacteria 857
294 Ga0207657_10017590 3300025919 Bacteria 6848
295 Ga0207657_10142644 3300025919 Bacteria 1956
296 Ga0207657_10286804 3300025919 Bacteria 1306
297 Ga0207649_10126888 3300025920 Bacteria 1728
298 Ga0207652_10421988 3300025921 Bacteria 1203
299 Ga0207652_10760531 3300025921 Bacteria 862
300 Ga0207681_10029892 3300025923 Bacteria 3547
301 Ga0207681_10284200 3300025923 Bacteria 1304
302 Ga0207681_10356059 3300025923 Bacteria 1173
303 Ga0207694_10000063 3300025924 Bacteria 139700
304 Ga0207694_10619936 3300025924 Bacteria 910
305 Ga0207650_10519999 3300025925 Bacteria 996
306 Ga0207659_10230975 3300025926 Bacteria 1492
307 Ga0207687_10000073 3300025927 Bacteria 73917
308 Ga0207687_10011907 3300025927 Bacteria 5688
309 Ga0207687_10096766 3300025927 Bacteria 2164
310 Ga0207687_10209394 3300025927 Bacteria 1529
311 Ga0207687_10325597 3300025927 Bacteria 1245
312 Ga0207700_10013143 3300025928 Bacteria 5374
313 Ga0207700_10029400 3300025928 Bacteria 3877
314 Ga0207700_10105953 3300025928 Bacteria 2253
315 Ga0207664_10000004 3300025929 Bacteria 493014
316 Ga0207664_10005280 3300025929 Bacteria 8827
317 Ga0207664_10005496 3300025929 Bacteria 8664
318 Ga0207664_10007154 3300025929 Bacteria 7737
319 Ga0207664_10022205 3300025929 Bacteria 4735
320 Ga0207664_10164987 3300025929 Bacteria 1892
321 Ga0207664_10232263 3300025929 Bacteria 1604
322 Ga0207644_10090148 3300025931 Bacteria 2284
323 Ga0207690_10000268 3300025932 Bacteria 37289
324 Ga0207690_10135083 3300025932 Bacteria 1810
325 Ga0207706_10001334 3300025933 Bacteria 24700
326 Ga0207706_10233332 3300025933 Bacteria 1609
327 Ga0207706_10284140 3300025933 Bacteria 1443
328 Ga0207686_10000073 3300025934 Bacteria 92009
329 Ga0207686_10723543 3300025934 Bacteria 793
330 Ga0207709_10592968 3300025935 Bacteria 876
331 Ga0207704_10641004 3300025938 Bacteria 874
332 Ga0207691_10093164 3300025940 Bacteria 2698
333 Ga0207711_10157448 3300025941 Bacteria 2054
334 Ga0207711_10727015 3300025941 Bacteria 926
335 Ga0207661_10021334 3300025944 Bacteria 4851
336 Ga0207661_10286777 3300025944 Bacteria 1473
337 Ga0207661_10508505 3300025944 Bacteria 1101
338 Ga0207679_10052464 3300025945 Bacteria 2991
339 Ga0207679_10163399 3300025945 Bacteria 1825
340 Ga0207651_10069787 3300025960 Bacteria 2483
341 Ga0207712_10005003 3300025961 Bacteria 8382
342 Ga0207712_10032585 3300025961 Bacteria 3518
343 Ga0207712_10649700 3300025961 Bacteria 917
344 Ga0207668_10021186 3300025972 Bacteria 4142
345 Ga0207668_10129981 3300025972 Bacteria 1922
346 Ga0207640_10073844 3300025981 Bacteria 2306
347 Ga0207640_10101422 3300025981 Bacteria 2019
348 Ga0207658_10108203 3300025986 Bacteria 2192
349 Ga0207658_10241123 3300025986 Bacteria 1531
350 Ga0207677_10066450 3300026023 Bacteria 2521
351 Ga0207703_10001891 3300026035 Bacteria 18577
352 Ga0207678_10112433 3300026067 Bacteria 2323
353 Ga0207678_10129748 3300026067 Bacteria 2150
354 Ga0207678_10135654 3300026067 Bacteria 2100
355 Ga0207678_10198656 3300026067 Bacteria 1714
356 Ga0207678_10344390 3300026067 Bacteria 1285
357 Ga0207678_10430007 3300026067 Bacteria 1145
358 Ga0207708_10052367 3300026075 Bacteria 3109
359 Ga0207708_10060083 3300026075 Bacteria 2901
360 Ga0207708_10060637 3300026075 Bacteria 2887
361 Ga0207708_10147959 3300026075 Bacteria 1847
362 Ga0207708_10219667 3300026075 Bacteria 1522
363 Ga0207708_10286282 3300026075 Bacteria 1337
364 Ga0207708_10740332 3300026075 Bacteria 843
365 Ga0207702_10008203 3300026078 Bacteria 8828
366 Ga0207641_10016945 3300026088 Bacteria 5965
367 Ga0207648_10054278 3300026089 Bacteria 3501
368 Ga0207648_10745061 3300026089 Bacteria 910
369 Ga0207676_10085785 3300026095 Bacteria 2570
370 Ga0207676_10217403 3300026095 Bacteria 1700
371 Ga0207674_10134802 3300026116 Bacteria 2431
372 Ga0207674_10159528 3300026116 Bacteria 2210
373 Ga0207674_10220211 3300026116 Bacteria 1846
374 Ga0207674_10671788 3300026116 Bacteria 1000
375 Ga0207675_100000719 3300026118 Bacteria 32781
376 Ga0207675_100092563 3300026118 Bacteria 2843
377 Ga0207675_100201565 3300026118 Bacteria 1911
378 Ga0207675_100303029 3300026118 Bacteria 1557
379 Ga0207675_100466088 3300026118 Bacteria 1254
380 Ga0207675_100721385 3300026118 Bacteria 1007
381 Ga0207675_101176981 3300026118 Bacteria 787
382 Ga0207683_10031350 3300026121 Bacteria 4613
383 Ga0207683_10051363 3300026121 Bacteria 3612
384 Ga0207428_10012187 3300027907 Bacteria 7562
385 Ga0207428_10036725 3300027907 Bacteria 3993
386 Ga0207428_10185293 3300027907 Bacteria 1571
387 Ga0207428_10384330 3300027907 Bacteria 1029
388 Ga0268266_10000056 3300028379 Bacteria 289176
389 Ga0268266_10000264 3300028379 Bacteria 88067
390 Ga0268266_10057759 3300028379 Bacteria 3339
391 Ga0268266_10092201 3300028379 Bacteria 2658
392 Ga0268265_10267271 3300028380 Bacteria 1524
393 Ga0268264_10030488 3300028381 Bacteria 4420
394 Ga0268264_10409716 3300028381 Bacteria 1305
395 Ga0268264_10412576 3300028381 Bacteria 1301
396 Ga0268264_10917993 3300028381 Bacteria 879
397 Ga0265326_10000032 3300028558 Bacteria 94371
398 Ga0265319_1003395 3300028563 Bacteria 8328
399 Ga0265319_1003766 3300028563 Bacteria 7778
400 Ga0265334_10000002 3300028573 Bacteria 325014
401 Ga0265336_10013975 3300028666 Bacteria 2668
402 Ga0265338_10008302 3300028800 Bacteria 12636
403 Ga0265338_10495582 3300028800 Bacteria 860
404 Ga0265320_10001697 3300031240 Bacteria 15654
405 Ga0265320_10023535 3300031240 Bacteria 3277
406 Ga0265320_10029734 3300031240 Bacteria 2825
407 Ga0307408_100034402 3300031548 Bacteria 3550
408 Ga0307408_100055586 3300031548 Bacteria 2867
409 Ga0307408_100188629 3300031548 Bacteria 1659
410 Ga0307408_100265352 3300031548 Bacteria 1423
411 Ga0316576_10001238 3300031727 Bacteria 13509
412 Ga0316578_10374019 3300031728 Bacteria 846
413 Ga0307405_10019925 3300031731 Bacteria 3737
414 Ga0307413_10013637 3300031824 Bacteria 4094
415 Ga0307413_10023035 3300031824 Bacteria 3369
416 Ga0307413_10410981 3300031824 Bacteria 1063
417 Ga0307413_10533113 3300031824 Bacteria 949
418 Ga0307410_10105222 3300031852 Bacteria 2031
419 Ga0307410_10181587 3300031852 Bacteria 1593
420 Ga0307406_10006019 3300031901 Bacteria 6662
421 Ga0307406_10400162 3300031901 Bacteria 1088
422 Ga0307407_10030557 3300031903 Bacteria 2907
423 Ga0307407_10079745 3300031903 Bacteria 1976
424 Ga0307407_10299372 3300031903 Bacteria 1121
425 Ga0307407_10667528 3300031903 Bacteria 780
426 Ga0307407_10673968 3300031903 Bacteria 777
427 Ga0307412_10249233 3300031911 Bacteria 1378
428 Ga0307409_100014219 3300031995 Bacteria 5164
429 Ga0307409_100035350 3300031995 Bacteria 3661
430 Ga0307409_100038646 3300031995 Bacteria 3532
431 Ga0307409_100167739 3300031995 Bacteria 1929
432 Ga0307409_100201451 3300031995 Bacteria 1781
433 Ga0307409_100354368 3300031995 Bacteria 1386
434 Ga0307409_100413403 3300031995 Bacteria 1292
435 Ga0307409_100425361 3300031995 Bacteria 1275
436 Ga0307409_100499365 3300031995 Bacteria 1184
437 Ga0307409_100610253 3300031995 Bacteria 1079
438 Ga0307409_100785936 3300031995 Bacteria 958
439 Ga0307409_101143867 3300031995 Bacteria 800
440 Ga0307416_100037603 3300032002 Bacteria 3726
441 Ga0307416_100042807 3300032002 Bacteria 3539
442 Ga0307416_100050194 3300032002 Bacteria 3324
443 Ga0307416_100264861 3300032002 Bacteria 1683
444 Ga0307416_100531346 3300032002 Bacteria 1246
445 Ga0307416_100661098 3300032002 Bacteria 1131
446 Ga0307414_10666834 3300032004 Bacteria 939
447 Ga0307411_10360638 3300032005 Bacteria 1188
448 Ga0307411_10968294 3300032005 Bacteria 760
449 Ga0307415_100005350 3300032126 Bacteria 6802
450 Ga0307415_100011024 3300032126 Bacteria 5150
451 Ga0307415_100041656 3300032126 Bacteria 3051
452 Ga0307415_100140600 3300032126 Bacteria 1843
453 Ga0307415_100177561 3300032126 Bacteria 1667
454 Ga0307415_100853468 3300032126 Bacteria 836
455 Ga0373929_0033373 3300035085 Bacteria 1112
456 Ga0373923_0177436 3300035111 Bacteria 978
457 Ga0373954_0041938 3300035118 Bacteria 2134
458 Ga0373960_0062442 3300035121 Bacteria 1133
459 Ga0373955_0101654 3300035172 Bacteria 1651
460 Ga0373961_0009850 3300035241 Bacteria 2343
461 Ga0373962_0033523 3300035242 Bacteria 1418
462 Ga0316574_0016972 3300035398 Bacteria 4251
463 Ga0316574_0021673 3300035398 Bacteria 3818
464 Ga0316574_0037326 3300035398 Bacteria 2979
465 Ga0316574_0104882 3300035398 Bacteria 1810
466 Ga0373924_0168182 3300035410 Bacteria 963
467 Ga0373935_0176201 3300035692 Bacteria 1466
468 Ga0373933_0050068 3300035724 Bacteria 2492
469 Ga0373947_0209587 3300035725 Bacteria 1278
470 Ga0373937_0034194 3300036401 Bacteria 4623
471 Ga0373937_0052600 3300036401 Bacteria 3734
472 Ga0316584_0002636 3300036712 Bacteria 11443
473 Ga0395899_0126418 3300037312 Bacteria 1828
474 Ga0395900_0010493 3300037418 Bacteria 9475
475 Ga0395900_0016044 3300037418 Bacteria 7633
476 Ga0395900_0060412 3300037418 Bacteria 3901
477 Ga0395900_0133810 3300037418 Bacteria 2540
478 Ga0395900_0187258 3300037418 Bacteria 2101
479 Ga0395900_0401844 3300037418 Bacteria 1334
480 Ga0395900_0457055 3300037418 Bacteria 1232
481 Ga0395898_0004574 3300037466 Bacteria 15099
482 Ga0395898_0004703 3300037466 Bacteria 14857
483 Ga0395898_0026202 3300037466 Bacteria 5869
484 Ga0395898_0068180 3300037466 Bacteria 3443
485 Ga0395898_0198994 3300037466 Bacteria 1913
486 Ga0395898_0244242 3300037466 Bacteria 1712
487 Ga0395898_0479092 3300037466 Bacteria 1184
488 Ga0395898_0536649 3300037466 Bacteria 1112
489 Ga0395898_0585597 3300037466 Bacteria 1058
490 Ga0395898_1065946 3300037466 Bacteria 742
491 Ga0395905_0016135 3300037471 Bacteria 7100
492 Ga0395905_0334614 3300037471 Bacteria 1405
493 Ga0395905_0919456 3300037471 Bacteria 778
494 Ga0436364_0010487 3300037853 Bacteria 3387
495 Ga0436364_0394694 3300037853 Bacteria 1893
496 Ga0436364_0542331 3300037853 Bacteria 3929
497 Ga0436364_0786946 3300037853 Bacteria 1140
498 Ga0436364_0927298 3300037853 Bacteria 5532
499 Ga0436364_1261370 3300037853 Bacteria 2644
500 Ga0395901_0013495 3300038443 Bacteria 8307
501 Ga0395901_0070334 3300038443 Bacteria 3646
502 Ga0395901_0078362 3300038443 Bacteria 3450
503 Ga0395901_0149840 3300038443 Bacteria 2452
504 Ga0395901_0246245 3300038443 Bacteria 1863
505 Ga0395901_0257186 3300038443 Bacteria 1818
506 Ga0395901_0265010 3300038443 Bacteria 1788
507 Ga0395901_0280010 3300038443 Bacteria 1733
508 Ga0395901_0342406 3300038443 Bacteria 1544
509 Ga0395901_0668412 3300038443 Bacteria 1040
510 Ga0436365_0193968 3300039437 Bacteria 16322
511 Ga0436365_0571253 3300039437 Bacteria 1439
512 Ga0436365_0571801 3300039437 Bacteria 6578
513 Ga0436365_0656153 3300039437 Bacteria 6772
514 Ga0436365_1161323 3300039437 Bacteria 19038
515 Ga0436365_1365717 3300039437 Bacteria 8436
516 Ga0436365_1793812 3300039437 Bacteria 7318
517 Ga0436365_1906628 3300039437 Bacteria 963
518 Ga0436363_0160959 3300039450 Bacteria 1270
519 Ga0436363_0206518 3300039450 Bacteria 2900
520 Ga0436363_0229649 3300039450 Bacteria 1582
521 Ga0436363_1290946 3300039450 Bacteria 1802
522 Ga0436363_1301125 3300039450 Bacteria 33245
523 Ga0436363_1313806 3300039450 Bacteria 8226
524 Ga0436362_0272703 3300039453 Bacteria 2333
525 Ga0436362_0807641 3300039453 Bacteria 2333
526 Ga0439465_0102177 3300041413 Bacteria 991
527 Ga0451797_0396879 3300041453 Bacteria 1243
528 Ga0451807_0784867 3300041486 Bacteria 885
529 Ga0451833_1082468 3300041491 Bacteria 873
530 Ga0451833_1482837 3300041491 Bacteria 1024
531 Ga0451853_2330744 3300041512 Bacteria 1227
532 Ga0439454_022580 3300042011 Bacteria 939
533 Ga0439444_0004979 3300042437 Bacteria 1954
534 Ga0439440_0016519 3300042993 Bacteria 1617
535 Ga0466969_0022883 3300044656 Bacteria 3222
536 Ga0466969_0110191 3300044656 Bacteria 1289
537 Ga0466972_0098090 3300044658 Bacteria 1388
538 Ga0466972_0119909 3300044658 Bacteria 1241
539 Ga0466965_0111393 3300044683 Bacteria 1407
540 Ga0466966_0075633 3300044684 Bacteria 2104
541 Ga0466966_0177510 3300044684 Bacteria 1293
542 Ga0466966_0184555 3300044684 Bacteria 1265
543 Ga0466966_0230503 3300044684 Bacteria 1117
544 Ga0466966_0505268 3300044684 Bacteria 727
545 Ga0466961_0012908 3300044693 Bacteria 5344
546 Ga0466961_0104361 3300044693 Bacteria 1785
547 Ga0466961_0146831 3300044693 Bacteria 1474
548 Ga0466961_0198627 3300044693 Bacteria 1241
549 Ga0466963_0003469 3300044694 Bacteria 9041
550 Ga0466963_0014498 3300044694 Bacteria 4861
551 Ga0466963_0020293 3300044694 Bacteria 4178
552 Ga0466963_0022549 3300044694 Bacteria 3988
553 Ga0466963_0030215 3300044694 Bacteria 3494
554 Ga0466963_0032565 3300044694 Bacteria 3377
555 Ga0466963_0060313 3300044694 Bacteria 2533
556 Ga0466963_0087079 3300044694 Bacteria 2123
557 Ga0466963_0197286 3300044694 Bacteria 1407
558 Ga0466963_0366336 3300044694 Bacteria 1015
559 Ga0466963_0375387 3300044694 Bacteria 1002
560 Ga0466963_0579692 3300044694 Bacteria 792
561 Ga0466964_0064537 3300044706 Bacteria 1532
562 Ga0466964_0146428 3300044706 Bacteria 1091
563 Ga0466964_0209659 3300044706 Bacteria 940
564 Ga0466971_0058920 3300044719 Bacteria 1734
565 Ga0466971_0104322 3300044719 Bacteria 1305
566 Ga0466971_0141714 3300044719 Bacteria 1119
567 Ga0466971_0252611 3300044719 Bacteria 840
568 Ga0466971_0281711 3300044719 Bacteria 796
569 Ga0466968_0013257 3300044735 Bacteria 3240
570 Ga0466968_0060447 3300044735 Bacteria 1634
571 Ga0466968_0103062 3300044735 Bacteria 1276
572 Ga0466968_0270902 3300044735 Bacteria 810
573 Ga0466970_0013041 3300044765 Bacteria 4259
574 Ga0466970_0055418 3300044765 Bacteria 2117
575 Ga0466970_0163892 3300044765 Bacteria 1230
576 Ga0466970_0266779 3300044765 Bacteria 961
577 Ga0466957_0003722 3300044842 Bacteria 8429
578 Ga0466957_0042699 3300044842 Bacteria 2744
579 Ga0466957_0055689 3300044842 Bacteria 2417
580 Ga0466957_0061850 3300044842 Bacteria 2299
581 Ga0466960_0023962 3300044901 Bacteria 2748
582 Ga0466960_0039569 3300044901 Bacteria 2225
583 Ga0466960_0088201 3300044901 Bacteria 1576
584 Ga0466960_0158178 3300044901 Bacteria 1215
585 Ga0466960_0295115 3300044901 Bacteria 912
586 Ga0466960_0323748 3300044901 Bacteria 874
587 Ga0466960_0368959 3300044901 Bacteria 822
588 Ga0466959_0007415 3300045049 Bacteria 7696
589 Ga0466959_0011169 3300045049 Bacteria 6445
590 Ga0466959_0020966 3300045049 Bacteria 4818
591 Ga0466959_0031020 3300045049 Bacteria 3957
592 Ga0466959_0051987 3300045049 Bacteria 3002
593 Ga0466959_0072220 3300045049 Bacteria 2498
594 Ga0466959_0118339 3300045049 Bacteria 1886
595 Ga0466959_0180294 3300045049 Bacteria 1478
596 Ga0466959_0251156 3300045049 Bacteria 1220
597 Ga0466959_0309568 3300045049 Bacteria 1081
598 Ga0466959_0419855 3300045049 Bacteria 908
599 Ga0466958_0008325 3300045836 Bacteria 5746
600 Ga0466958_0011172 3300045836 Bacteria 5051
601 Ga0466958_0013642 3300045836 Bacteria 4631
602 Ga0466958_0017342 3300045836 Bacteria 4160
603 Ga0466958_0055073 3300045836 Bacteria 2413
604 Ga0466958_0080476 3300045836 Bacteria 2004
605 Ga0466958_0080554 3300045836 Bacteria 2003
606 Ga0466958_0196257 3300045836 Bacteria 1284
607 Ga0466958_0227943 3300045836 Bacteria 1189
608 Ga0466958_0383485 3300045836 Bacteria 906
609 Ga0466967_0001274 3300045976 Bacteria 14307
610 Ga0466967_0011910 3300045976 Bacteria 6622
611 Ga0466967_0058077 3300045976 Bacteria 3418
612 Ga0466967_0064220 3300045976 Bacteria 3264
613 Ga0466967_0069363 3300045976 Bacteria 3150
614 Ga0466967_0085871 3300045976 Bacteria 2850
615 Ga0466967_0098664 3300045976 Bacteria 2667
616 Ga0466967_0130035 3300045976 Bacteria 2336
617 Ga0466967_0314873 3300045976 Bacteria 1508
618 Ga0466967_0571585 3300045976 Bacteria 1114
619 Ga0466967_0592735 3300045976 Bacteria 1093
620 Ga0466967_0596816 3300045976 Bacteria 1090
621 Ga0466967_0662548 3300045976 Bacteria 1032
622 Ga0466967_0719894 3300045976 Bacteria 989
623 Ga0466967_0781103 3300045976 Bacteria 948
624 Ga0466967_0833666 3300045976 Bacteria 916
625 Ga0466967_1060849 3300045976 Bacteria 807
626 Ga0495592_0021079 3300046454 Bacteria 4956
627 Ga0495592_0120494 3300046454 Bacteria 1846
628 Ga0495592_0265974 3300046454 Bacteria 1127
629 Ga0495603_0037440 3300046455 Bacteria 2911
630 Ga0495629_0001073 3300046459 Bacteria 21818
631 Ga0495629_0079024 3300046459 Bacteria 2297
632 Ga0495638_0013333 3300046460 Bacteria 5601
633 Ga0495651_0002099 3300046462 Bacteria 15381
634 Ga0495651_0114540 3300046462 Bacteria 1989
635 Ga0495653_0045652 3300046463 Bacteria 3396
636 Ga0495653_0321453 3300046463 Bacteria 1003
637 Ga0495582_0000001 3300046473 Bacteria 252434
638 Ga0495582_0221603 3300046473 Bacteria 1082
639 Ga0495605_0094860 3300046474 Bacteria 1378
640 Ga0495584_0089302 3300046491 Bacteria 1554
641 Ga0495596_0080359 3300046500 Bacteria 1266
642 Ga0495608_0008068 3300046511 Bacteria 7402
643 Ga0495608_0309947 3300046511 Bacteria 976
644 Ga0495618_0101668 3300046514 Bacteria 1840
645 Ga0495620_0062548 3300046515 Bacteria 1546
646 Ga0495620_0087738 3300046515 Bacteria 1251
647 Ga0495630_0068252 3300046517 Bacteria 2673
648 Ga0495630_0212702 3300046517 Bacteria 1476
649 Ga0495631_0068989 3300046518 Bacteria 1529
650 Ga0495632_0257852 3300046519 Bacteria 781
651 Ga0495652_0000037 3300046529 Bacteria 133232
652 Ga0495652_0149471 3300046529 Bacteria 1827
653 Ga0495652_0183137 3300046529 Bacteria 1605
654 Ga0495640_0017150 3300046533 Bacteria 5404
655 Ga0495640_0064308 3300046533 Bacteria 2481
656 Ga0495586_0339232 3300046535 Bacteria 863
657 Ga0495587_0011445 3300046536 Bacteria 5622
658 Ga0495609_0078974 3300046538 Bacteria 1440
659 Ga0495667_0001823 3300046559 Bacteria 14140
660 Ga0495656_0429945 3300046615 Bacteria 694
661 Ga0495668_0114374 3300046616 Bacteria 1476
662 Ga0495634_0022081 3300046642 Bacteria 4487
663 Ga0495635_0048723 3300046663 Bacteria 2920
664 Ga0495635_0558260 3300046663 Bacteria 750
665 Ga0495657_0005941 3300046675 Bacteria 9590
666 Ga0495599_0096771 3300046678 Bacteria 1840
667 Ga0495599_0282846 3300046678 Bacteria 1004
668 Ga0495623_0018239 3300046679 Bacteria 4532
669 Ga0495646_0026711 3300046680 Bacteria 3624
670 Ga0495658_0000002 3300046683 Bacteria 309651
671 Ga0495589_0070961 3300046794 Bacteria 1703
672 Ga0495600_0006420 3300046809 Bacteria 7158
673 Ga0495600_0117833 3300046809 Bacteria 1728
674 Ga0495604_0015258 3300047317 Bacteria 6133
675 Ga0495604_0193820 3300047317 Bacteria 1414
676 Ga0495674_0000030 3300047319 Bacteria 115975
677 Ga0495674_0004844 3300047319 Bacteria 12946
678 Ga0495672_0031867 3300047320 Bacteria 3287
679 Ga0495672_0122459 3300047320 Bacteria 1380
680 Ga0495672_0159078 3300047320 Bacteria 1163
681 Ga0495672_0164190 3300047320 Bacteria 1139
682 Ga0495676_0201175 3300047321 Bacteria 1384
683 Ga0495680_0001510 3300047322 Bacteria 24912
684 Ga0495680_0101687 3300047322 Bacteria 2141
685 Ga0495680_0225701 3300047322 Bacteria 1335
686 Ga0495675_0037207 3300047444 Bacteria 3099
687 Ga0495675_0046462 3300047444 Bacteria 2764
688 Ga0495677_0075084 3300047445 Bacteria 1263
689 Ga0495684_0002969 3300047471 Bacteria 13357
690 Ga0495684_0016341 3300047471 Bacteria 5714
691 Ga0495684_0421340 3300047471 Bacteria 933
692 Ga0495686_0072632 3300047472 Bacteria 2115
693 Ga0495602_0000007 3300048088 Bacteria 273212
694 Ga0495602_0011043 3300048088 Bacteria 9354
695 Ga0496100_0036599 3300048903 Bacteria 3097
696 Ga0496100_0042526 3300048903 Bacteria 2902
697 Ga0496100_0165567 3300048903 Bacteria 1588
698 Ga0496101_0028976 3300048904 Bacteria 3870
699 Ga0496101_0048339 3300048904 Bacteria 3057
700 Ga0496101_0053587 3300048904 Bacteria 2911
701 Ga0496101_0403788 3300048904 Bacteria 1076
702 Ga0496102_0000522 3300048905 Bacteria 41862
703 Ga0496102_0002380 3300048905 Bacteria 16044
704 Ga0496102_0007419 3300048905 Bacteria 9365
705 Ga0496102_0054230 3300048905 Bacteria 3655
706 Ga0496102_0180737 3300048905 Bacteria 1987
707 Ga0496102_0558765 3300048905 Bacteria 1067
708 Ga0496103_0000174 3300048906 Bacteria 67124
709 Ga0496103_0002129 3300048906 Bacteria 12604
710 Ga0496103_0075882 3300048906 Bacteria 2109
711 Ga0496103_0101195 3300048906 Bacteria 1824
712 Ga0496103_0176714 3300048906 Bacteria 1372
713 Ga0496104_0000015 3300048907 Bacteria 374530
714 Ga0496104_0007864 3300048907 Bacteria 9452
715 Ga0496104_0008408 3300048907 Bacteria 9175
716 Ga0496104_0018623 3300048907 Bacteria 6337
717 Ga0496104_0030618 3300048907 Bacteria 5001
718 Ga0496104_0618363 3300048907 Bacteria 993
719 Ga0496104_0934405 3300048907 Bacteria 772
720 Ga0496105_0000004 3300048908 Bacteria 475798
721 Ga0496105_0006317 3300048908 Bacteria 9103
722 Ga0496105_0040907 3300048908 Bacteria 3821
723 Ga0496105_0046802 3300048908 Bacteria 3570
724 Ga0496105_0069644 3300048908 Bacteria 2907
725 Ga0496106_0006210 3300048909 Bacteria 8839
726 Ga0496106_0019325 3300048909 Bacteria 5051
727 Ga0496106_0023216 3300048909 Bacteria 4608
728 Ga0496106_0190145 3300048909 Bacteria 1632
729 Ga0496106_0594156 3300048909 Bacteria 887
730 Ga0496106_0602108 3300048909 Bacteria 880
731 Ga0496107_0003285 3300048910 Bacteria 10791
732 Ga0496107_0014411 3300048910 Bacteria 5535
733 Ga0496107_0098184 3300048910 Bacteria 2145
734 Ga0496107_0105683 3300048910 Bacteria 2067
735 Ga0496108_0006421 3300048911 Bacteria 9533
736 Ga0496108_0089811 3300048911 Bacteria 2611
737 Ga0496108_0177968 3300048911 Bacteria 1842
738 Ga0496108_0288915 3300048911 Bacteria 1428
739 Ga0496108_0470868 3300048911 Bacteria 1098
740 Ga0496108_0911966 3300048911 Bacteria 754
741 Ga0496109_0000552 3300048912 Bacteria 31654
742 Ga0496109_0018048 3300048912 Bacteria 6194
743 Ga0496109_0022852 3300048912 Bacteria 5542
744 Ga0496109_0037440 3300048912 Bacteria 4382
745 Ga0496109_0156371 3300048912 Bacteria 2135
746 Ga0496109_0384564 3300048912 Bacteria 1326
747 Ga0496109_0526413 3300048912 Bacteria 1116
748 Ga0496110_0101325 3300048913 Bacteria 2581
749 Ga0496110_0154488 3300048913 Bacteria 2079
750 Ga0496110_0496227 3300048913 Bacteria 1112
751 Ga0496110_0585472 3300048913 Bacteria 1013
752 Ga0496111_0005951 3300048914 Bacteria 7868
753 Ga0496111_0051797 3300048914 Bacteria 2964
754 Ga0496111_0065395 3300048914 Bacteria 2639
755 Ga0496111_0088313 3300048914 Bacteria 2270
756 Ga0496111_0126076 3300048914 Bacteria 1893
757 Ga0496111_0242957 3300048914 Bacteria 1337
758 Ga0496112_0000200 3300048915 Bacteria 39289
759 Ga0496112_0001981 3300048915 Bacteria 16186
760 Ga0496112_0008935 3300048915 Bacteria 8995
761 Ga0496112_0031970 3300048915 Bacteria 5108
762 Ga0496112_0065627 3300048915 Bacteria 3582
763 Ga0496112_0070152 3300048915 Bacteria 3463
764 Ga0496112_0140296 3300048915 Bacteria 2386
765 Ga0496112_0208420 3300048915 Bacteria 1912
766 Ga0496112_0447125 3300048915 Bacteria 1230
767 Ga0496112_0657959 3300048915 Bacteria 977
768 Ga0496112_0864291 3300048915 Bacteria 827
769 Ga0496113_0000234 3300048916 Bacteria 26164
770 Ga0496113_0001428 3300048916 Bacteria 13264
771 Ga0496113_0025783 3300048916 Bacteria 4195
772 Ga0496113_0043838 3300048916 Bacteria 3312
773 Ga0496113_0114179 3300048916 Bacteria 2106
774 Ga0496113_0166290 3300048916 Bacteria 1745
775 Ga0496113_0186135 3300048916 Bacteria 1647
776 Ga0496113_0296630 3300048916 Bacteria 1294
777 Ga0496114_0000039 3300048917 Bacteria 138486
778 Ga0496114_0056238 3300048917 Bacteria 3283
779 Ga0496114_0088870 3300048917 Bacteria 2621
780 Ga0496114_0382847 3300048917 Bacteria 1245
781 Ga0496114_0482149 3300048917 Bacteria 1097
782 Ga0496115_0000011 3300048918 Bacteria 222529
783 Ga0496115_0004161 3300048918 Bacteria 10448
784 Ga0496119_0019221 3300048922 Bacteria 5045
785 Ga0496119_0027970 3300048922 Bacteria 3861
786 Ga0496121_0019533 3300048924 Bacteria 6767
787 Ga0496124_0067218 3300048927 Bacteria 2983
788 Ga0496124_0549330 3300048927 Bacteria 763
789 Ga0496125_0096039 3300048928 Bacteria 2202
790 Ga0496126_0068535 3300048929 Bacteria 3167
791 Ga0501031_0025826 3300049568 Bacteria 3832
792 Ga0501031_0054056 3300049568 Bacteria 2617
793 Ga0501031_0162857 3300049568 Bacteria 1458
794 Ga0501031_0215797 3300049568 Bacteria 1250
795 Ga0501032_0166642 3300049569 Bacteria 1446
796 Ga0501033_0029197 3300049570 Bacteria 4144
797 Ga0501033_0428248 3300049570 Bacteria 921
798 Ga0501034_0003187 3300049571 Bacteria 18874
799 Ga0501034_0029121 3300049571 Bacteria 5614
800 Ga0501034_0126926 3300049571 Bacteria 2536
801 Ga0501034_0240468 3300049571 Bacteria 1757
802 Ga0501034_0731497 3300049571 Bacteria 886
803 Ga0501036_0062531 3300049572 Bacteria 3153
804 Ga0501036_0213665 3300049572 Bacteria 1620
805 Ga0501036_0516517 3300049572 Bacteria 993
806 Ga0501038_0272233 3300049574 Bacteria 1335
807 Ga0501039_0006140 3300049575 Bacteria 9120
808 Ga0501039_0009459 3300049575 Bacteria 7430
809 Ga0501039_0186510 3300049575 Bacteria 1631
810 Ga0501039_0194688 3300049575 Bacteria 1594
811 Ga0501039_0214824 3300049575 Bacteria 1512
812 Ga0501041_0024569 3300049577 Bacteria 3618
813 Ga0501042_0081992 3300049578 Bacteria 2312
814 Ga0501042_0325411 3300049578 Bacteria 1111
815 Ga0501042_0441600 3300049578 Bacteria 943
816 Ga0501042_0468577 3300049578 Bacteria 914
817 Ga0501042_0543539 3300049578 Bacteria 844
818 Ga0501043_0310418 3300049579 Bacteria 1204
819 Ga0501046_0073043 3300049580 Bacteria 2662
820 Ga0501047_0057719 3300049581 Bacteria 3753
821 Ga0501047_0162580 3300049581 Bacteria 2104
822 Ga0501047_0297894 3300049581 Bacteria 1455
823 Ga0501047_0499719 3300049581 Bacteria 1043
824 Ga0501048_0006014 3300049582 Bacteria 9241
825 Ga0501048_0055272 3300049582 Bacteria 2818
826 Ga0501048_0350180 3300049582 Bacteria 1053
827 Ga0501067_0028935 3300049583 Bacteria 3071
828 Ga0501070_0026130 3300049586 Bacteria 4899
829 Ga0501070_0261996 3300049586 Bacteria 1413
830 Ga0501071_0061744 3300049587 Bacteria 2714
831 Ga0501071_0168097 3300049587 Bacteria 1641
832 Ga0501071_0179004 3300049587 Bacteria 1588
833 Ga0501071_0460484 3300049587 Bacteria 974
834 Ga0501072_0048610 3300049588 Bacteria 3341
835 Ga0501072_0065940 3300049588 Bacteria 2856
836 Ga0501072_0110400 3300049588 Bacteria 2189
837 Ga0501072_0185227 3300049588 Bacteria 1661
838 Ga0501073_0034340 3300049589 Bacteria 3610
839 Ga0501073_0184547 3300049589 Bacteria 1444
840 Ga0501074_0006507 3300049590 Bacteria 8437
841 Ga0501074_0145653 3300049590 Bacteria 1694
842 Ga0501074_0290348 3300049590 Bacteria 1162
843 Ga0501075_0102721 3300049591 Bacteria 2171
844 Ga0501075_0307525 3300049591 Bacteria 1208
845 Ga0501076_0098262 3300049592 Bacteria 2358
846 Ga0501076_0171516 3300049592 Bacteria 1768
847 Ga0501076_0335675 3300049592 Bacteria 1240
848 Ga0501077_0117919 3300049593 Bacteria 1682
849 Ga0501079_0130747 3300049741 Bacteria 1954
850 Ga0501079_0760195 3300049741 Bacteria 763
851 Ga0501080_0101344 3300049742 Bacteria 2671
852 Ga0501081_0133135 3300049743 Bacteria 1777
853 Ga0501083_0005694 3300049744 Bacteria 8818
854 Ga0501035_0050285 3300049822 Bacteria 3735
855 Ga0501035_0077921 3300049822 Bacteria 2929
856 Ga0501035_0290187 3300049822 Bacteria 1381
857 Ga0501044_0041349 3300049823 Bacteria 4798
858 Ga0501044_0089806 3300049823 Bacteria 3100
859 Ga0501044_0418209 3300049823 Bacteria 1251
860 Ga0501045_0022507 3300049824 Bacteria 4514
861 Ga0501045_0035637 3300049824 Bacteria 3613
862 Ga0501045_0049890 3300049824 Bacteria 3053
863 Ga0501045_0085352 3300049824 Bacteria 2330
864 Ga0501045_0387375 3300049824 Bacteria 1040
865 Ga0501045_0554879 3300049824 Bacteria 852
866 nmdc:mga00v17_199151_c1 3300050491 Bacteria 1294
867 nmdc:mga00v17_360519_c1 3300050491 Bacteria 945
868 nmdc:mga00v17_37737_c1 3300050491 Bacteria 2886
869 nmdc:mga0yw44_122958_c1 3300050492 Bacteria 1673
870 nmdc:mga0yw44_127290_c1 3300050492 Bacteria 1646
871 nmdc:mga0yw44_239017_c1 3300050492 Bacteria 1207
872 nmdc:mga0yw44_7514_c1 3300050492 Bacteria 5368
873 nmdc:mga06z11_501394_c1 3300050494 Bacteria 735
874 nmdc:mga05p37_142175_c1 3300050507 Bacteria 2939
875 nmdc:mga05p37_150003_c1 3300050507 Bacteria 2852
876 nmdc:mga05p37_2378_c1 3300050507 Bacteria 21906
877 nmdc:mga05p37_250211_c1 3300050507 Bacteria 2126
878 nmdc:mga05p37_413378_c1 3300050507 Bacteria 1572
879 nmdc:mga05p37_553607_c1 3300050507 Bacteria 1309
880 nmdc:mga05p37_648709_c1 3300050507 Bacteria 1182
881 nmdc:mga05p37_86326_c1 3300050507 Bacteria 3867
882 nmdc:mga09592_100817_c1 3300050508 Bacteria 1346
883 nmdc:mga09592_57297_c1 3300050508 Bacteria 3293
884 nmdc:mga09592_73589_c1 3300050508 Bacteria 2903
885 nmdc:mga0qj67_149296_c1 3300050509 Bacteria 1896
886 nmdc:mga0qj67_164512_c1 3300050509 Bacteria 1801
887 nmdc:mga0qj67_249969_c1 3300050509 Bacteria 1439
888 nmdc:mga0qj67_396170_c1 3300050509 Bacteria 1114
889 nmdc:mga0qj67_435827_c1 3300050509 Bacteria 1056
890 nmdc:mga0qj67_4977_c1 3300050509 Bacteria 9656
891 nmdc:mga0qj67_8054_c1 3300050509 Bacteria 7800
892 nmdc:mga06r32_12359_c1 3300050510 Bacteria 7700
893 nmdc:mga06r32_26183_c1 3300050510 Bacteria 5435
894 nmdc:mga06r32_6902_c1 3300050510 Bacteria 10208
895 nmdc:mga08y16_11398_c1 3300050511 Bacteria 9341
896 nmdc:mga08y16_16213_c1 3300050511 Bacteria 7834
897 nmdc:mga08y16_212705_c1 3300050511 Bacteria 2002
898 nmdc:mga08y16_222279_c1 3300050511 Bacteria 1955
899 nmdc:mga08y16_291606_c1 3300050511 Bacteria 1682
900 nmdc:mga08y16_829191_c1 3300050511 Bacteria 916
901 nmdc:mga08y16_84912_c1 3300050511 Bacteria 3299
902 nmdc:mga08y16_9364_c1 3300050511 Bacteria 10272
903 nmdc:mga0n895_17599_c1 3300050512 Bacteria 6592
904 nmdc:mga0n895_276630_c1 3300050512 Bacteria 1702
905 nmdc:mga0n895_36727_c1 3300050512 Bacteria 4733
906 nmdc:mga0rr50_115453_c1 3300050513 Bacteria 2130
907 nmdc:mga0rr50_649258_c1 3300050513 Bacteria 900
908 nmdc:mga0rr50_75744_c1 3300050513 Bacteria 2580
909 nmdc:mga0a205_25902_c1 3300050515 Bacteria 5587
910 nmdc:mga0a205_38823_c1 3300050515 Bacteria 4582
911 nmdc:mga0a205_58039_c1 3300050515 Bacteria 3738
912 Ga0495601_0000254 3300053077 Bacteria 28596
913 Ga0495612_0044279 3300053078 Bacteria 1821
914 Ga0495655_0000002 3300053083 Bacteria 312752
915 Ga0495595_0009076 3300053084 Bacteria 4105
916 Ga0495619_0011140 3300053085 Bacteria 5658
917 Ga0495619_0015247 3300053085 Bacteria 4859
918 Ga0495619_0287251 3300053085 Bacteria 1140
919 Ga0500556_0001253 3300053104 Bacteria 11700
920 Ga0500628_000001 3300053129 Bacteria 564074
921 Ga0500616_0000088 3300053153 Bacteria 191662
922 Ga0500616_0011817 3300053153 Bacteria 5135
923 Ga0500620_114463 3300053155 Bacteria 945
924 Ga0501084_0043748 3300054114 Bacteria 3746
925 Ga0501084_0106924 3300054114 Bacteria 2350
926 Ga0501084_0184794 3300054114 Bacteria 1759
927 Ga0501084_0189315 3300054114 Bacteria 1736
928 Ga0590077_029539 3300059426 Bacteria 1193
929 Ga0590077_040690 3300059426 Bacteria 1032
930 Ga0501082_0039503 3300060353 Bacteria 4070
931 Ga0501082_0238562 3300060353 Bacteria 1582
932 Ga0501082_0584062 3300060353 Bacteria 977
933 Ga0501082_0611188 3300060353 Bacteria 954
934 Ga0466962_0013264 3300061719 Bacteria 3963
935 Ga0466962_0013632 3300061719 Bacteria 3912
936 Ga0466962_0067543 3300061719 Bacteria 1707
937 Ga0466962_0099200 3300061719 Bacteria 1398
938 Ga0466962_0157003 3300061719 Bacteria 1105
939 Ga0466962_0209275 3300061719 Bacteria 954
940 Ga0530510_0047037 3300061734 Bacteria 3117
941 Ga0530510_0191461 3300061734 Bacteria 1518

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028380 Ga0268265_10267271 Ga0268265_102672712 181
2 3300038443 Ga0395901_0265010 Ga0395901_0265010_45_608 187
3 3300002070 JGI24750J21931_1006886 JGI24750J21931_10068862 188
4 3300037471 Ga0395905_0919456 Ga0395905_0919456_153_746 197
5 3300046615 Ga0495656_0429945 Ga0495656_0429945_16_609 197
6 3300048909 Ga0496106_0023216 Ga0496106_0023216_3965_4558 197
7 3300005435 Ga0070714_100003806 Ga0070714_1000038061 198
8 3300025929 Ga0207664_10000004 Ga0207664_10000004479 198
9 3300048905 Ga0496102_0000522 Ga0496102_0000522_20731_21330 199
10 3300048906 Ga0496103_0000174 Ga0496103_0000174_19712_20311 199
11 3300031548 Ga0307408_100265352 Ga0307408_1002653521 204
12 3300031824 Ga0307413_10410981 Ga0307413_104109812 204
13 3300031995 Ga0307409_100014219 Ga0307409_1000142194 204
14 3300032002 Ga0307416_100042807 Ga0307416_1000428073 204
15 3300006058 Ga0075432_10026857 Ga0075432_100268573 205
16 3300009147 Ga0114129_10232254 Ga0114129_102322542 205
17 3300050507 nmdc:mga05p37_250211_c1 nmdc:mga05p37_250211_c1_292_969 205
18 3300047472 Ga0495686_0072632 Ga0495686_0072632_612_1283 207
19 3300048914 Ga0496111_0242957 Ga0496111_0242957_334_963 207
20 3300053104 Ga0500556_0001253 Ga0500556_0001253_2298_2975 207
21 3300053153 Ga0500616_0011817 Ga0500616_0011817_2207_2884 207
22 3300044658 Ga0466972_0098090 Ga0466972_0098090_16_699 208
23 3300005549 Ga0070704_100101431 Ga0070704_1001014313 209
24 3300048909 Ga0496106_0190145 Ga0496106_0190145_252_914 209
25 3300048916 Ga0496113_0114179 Ga0496113_0114179_695_1357 209
26 3300049581 Ga0501047_0499719 Ga0501047_0499719_38_676 210
27 3300025923 Ga0207681_10029892 Ga0207681_100298922 211
28 3300048912 Ga0496109_0526413 Ga0496109_0526413_17_652 211
29 3300047320 Ga0495672_0159078 Ga0495672_0159078_473_1135 212
30 3300048915 Ga0496112_0008935 Ga0496112_0008935_3763_4413 212
31 3300048916 Ga0496113_0000234 Ga0496113_0000234_14756_15406 212
32 3300048929 Ga0496126_0068535 Ga0496126_0068535_619_1308 212
33 3300006880 Ga0075429_100005448 Ga0075429_1000054482 213
34 3300037418 Ga0395900_0133810 Ga0395900_0133810_1239_1922 213
35 3300037466 Ga0395898_0198994 Ga0395898_0198994_1183_1866 213
36 3300038443 Ga0395901_0078362 Ga0395901_0078362_1601_2284 213
37 3300050508 nmdc:mga09592_100817_c1 nmdc:mga09592_100817_c1_160_858 213
38 3300026067 Ga0207678_10430007 Ga0207678_104300072 214
39 3300045049 Ga0466959_0180294 Ga0466959_0180294_45_731 214
40 3300045836 Ga0466958_0227943 Ga0466958_0227943_72_758 214
41 3300006038 Ga0075365_10136942 Ga0075365_101369422 215
42 3300009147 Ga0114129_10547039 Ga0114129_105470391 215
43 3300021384 Ga0213876_10077889 Ga0213876_100778893 215
44 3300037853 Ga0436364_1261370 Ga0436364_1261370_1434_2084 215
45 3300039437 Ga0436365_0656153 Ga0436365_0656153_1183_1833 215
46 3300039453 Ga0436362_0807641 Ga0436362_0807641_1497_2147 215
47 3300044684 Ga0466966_0505268 Ga0466966_0505268_67_717 215
48 3300044706 Ga0466964_0146428 Ga0466964_0146428_366_1016 215
49 3300045049 Ga0466959_0419855 Ga0466959_0419855_231_881 215
50 3300045976 Ga0466967_0719894 Ga0466967_0719894_187_837 215
51 3300050491 nmdc:mga00v17_37737_c1 nmdc:mga00v17_37737_c1_1198_1878 215
52 3300050492 nmdc:mga0yw44_122958_c1 nmdc:mga0yw44_122958_c1_825_1505 215
53 3300050507 nmdc:mga05p37_150003_c1 nmdc:mga05p37_150003_c1_1091_1738 215
54 3300009098 Ga0105245_10006545 Ga0105245_100065455 216
55 3300009551 Ga0105238_10000055 Ga0105238_10000055116 216
56 3300046460 Ga0495638_0013333 Ga0495638_0013333_4549_5199 216
57 3300046517 Ga0495630_0068252 Ga0495630_0068252_18_668 216
58 3300046678 Ga0495599_0096771 Ga0495599_0096771_680_1330 216
59 3300047471 Ga0495684_0421340 Ga0495684_0421340_109_846 216
60 3300053077 Ga0495601_0000254 Ga0495601_0000254_25422_26072 216
61 3300003203 JGI25406J46586_10003068 JGI25406J46586_100030685 217
62 3300005328 Ga0070676_10405820 Ga0070676_104058202 217
63 3300005329 Ga0070683_100567195 Ga0070683_1005671952 217
64 3300005339 Ga0070660_100092816 Ga0070660_1000928163 217
65 3300005435 Ga0070714_100293172 Ga0070714_1002931722 217
66 3300005438 Ga0070701_10125108 Ga0070701_101251082 217
67 3300005439 Ga0070711_100580962 Ga0070711_1005809622 217
68 3300005441 Ga0070700_100040032 Ga0070700_1000400323 217
69 3300005441 Ga0070700_100350925 Ga0070700_1003509252 217
70 3300005455 Ga0070663_100387279 Ga0070663_1003872792 217
71 3300005457 Ga0070662_100417141 Ga0070662_1004171412 217
72 3300005459 Ga0068867_100188880 Ga0068867_1001888803 217
73 3300005530 Ga0070679_100290078 Ga0070679_1002900782 217
74 3300005535 Ga0070684_100035669 Ga0070684_1000356693 217
75 3300005535 Ga0070684_100220518 Ga0070684_1002205182 217
76 3300005535 Ga0070684_100237483 Ga0070684_1002374832 217
77 3300005544 Ga0070686_100242452 Ga0070686_1002424521 217
78 3300005564 Ga0070664_100344981 Ga0070664_1003449812 217
79 3300005577 Ga0068857_100642147 Ga0068857_1006421472 217
80 3300005615 Ga0070702_100118460 Ga0070702_1001184602 217
81 3300005616 Ga0068852_100166209 Ga0068852_1001662093 217
82 3300005616 Ga0068852_100583926 Ga0068852_1005839262 217
83 3300005840 Ga0068870_10058400 Ga0068870_100584002 217
84 3300005844 Ga0068862_100360966 Ga0068862_1003609662 217
85 3300005937 Ga0081455_10063879 Ga0081455_100638792 217
86 3300005937 Ga0081455_10101142 Ga0081455_101011421 217
87 3300005981 Ga0081538_10007981 Ga0081538_100079818 217
88 3300005985 Ga0081539_10002877 Ga0081539_1000287712 217
89 3300006058 Ga0075432_10128566 Ga0075432_101285662 217
90 3300006846 Ga0075430_100021746 Ga0075430_1000217464 217
91 3300006847 Ga0075431_100542830 Ga0075431_1005428302 217
92 3300006880 Ga0075429_100473889 Ga0075429_1004738892 217
93 3300009094 Ga0111539_10057713 Ga0111539_100577136 217
94 3300009094 Ga0111539_10069723 Ga0111539_100697231 217
95 3300009094 Ga0111539_10448568 Ga0111539_104485682 217
96 3300009101 Ga0105247_10551186 Ga0105247_105511862 217
97 3300009147 Ga0114129_11581042 Ga0114129_115810421 217
98 3300009148 Ga0105243_11039491 Ga0105243_110394911 217
99 3300010375 Ga0105239_10453533 Ga0105239_104535332 217
100 3300013306 Ga0163162_10345740 Ga0163162_103457402 217
101 3300013307 Ga0157372_10622725 Ga0157372_106227252 217
102 3300014325 Ga0163163_10486483 Ga0163163_104864832 217
103 3300025918 Ga0207662_10476135 Ga0207662_104761352 217
104 3300025919 Ga0207657_10142644 Ga0207657_101426442 217
105 3300025919 Ga0207657_10286804 Ga0207657_102868042 217
106 3300025921 Ga0207652_10760531 Ga0207652_107605312 217
107 3300025923 Ga0207681_10284200 Ga0207681_102842002 217
108 3300025929 Ga0207664_10232263 Ga0207664_102322632 217
109 3300025933 Ga0207706_10284140 Ga0207706_102841402 217
110 3300025934 Ga0207686_10723543 Ga0207686_107235432 217
111 3300025938 Ga0207704_10641004 Ga0207704_106410042 217
112 3300025940 Ga0207691_10093164 Ga0207691_100931642 217
113 3300025944 Ga0207661_10021334 Ga0207661_100213343 217
114 3300025944 Ga0207661_10508505 Ga0207661_105085052 217
115 3300025945 Ga0207679_10052464 Ga0207679_100524643 217
116 3300025981 Ga0207640_10073844 Ga0207640_100738442 217
117 3300026067 Ga0207678_10198656 Ga0207678_101986562 217
118 3300026075 Ga0207708_10060083 Ga0207708_100600834 217
119 3300026075 Ga0207708_10060637 Ga0207708_100606373 217
120 3300026075 Ga0207708_10740332 Ga0207708_107403321 217
121 3300026089 Ga0207648_10054278 Ga0207648_100542783 217
122 3300026095 Ga0207676_10217403 Ga0207676_102174033 217
123 3300026116 Ga0207674_10159528 Ga0207674_101595282 217
124 3300026116 Ga0207674_10220211 Ga0207674_102202112 217
125 3300026116 Ga0207674_10671788 Ga0207674_106717882 217
126 3300026118 Ga0207675_101176981 Ga0207675_1011769811 217
127 3300028381 Ga0268264_10917993 Ga0268264_109179931 217
128 3300028800 Ga0265338_10495582 Ga0265338_104955821 217
129 3300031240 Ga0265320_10001697 Ga0265320_100016975 217
130 3300031824 Ga0307413_10023035 Ga0307413_100230354 217
131 3300031824 Ga0307413_10533113 Ga0307413_105331132 217
132 3300031852 Ga0307410_10105222 Ga0307410_101052223 217
133 3300031901 Ga0307406_10400162 Ga0307406_104001622 217
134 3300031903 Ga0307407_10299372 Ga0307407_102993722 217
135 3300031903 Ga0307407_10673968 Ga0307407_106739681 217
136 3300031995 Ga0307409_100035350 Ga0307409_1000353503 217
137 3300031995 Ga0307409_100413403 Ga0307409_1004134032 217
138 3300031995 Ga0307409_100610253 Ga0307409_1006102532 217
139 3300031995 Ga0307409_101143867 Ga0307409_1011438671 217
140 3300032002 Ga0307416_100661098 Ga0307416_1006610982 217
141 3300032005 Ga0307411_10360638 Ga0307411_103606382 217
142 3300037466 Ga0395898_0536649 Ga0395898_0536649_118_780 217
143 3300038443 Ga0395901_0149840 Ga0395901_0149840_1304_1966 217
144 3300038443 Ga0395901_0280010 Ga0395901_0280010_1057_1719 217
145 3300039453 Ga0436362_0272703 Ga0436362_0272703_480_1157 217
146 3300041413 Ga0439465_0102177 Ga0439465_0102177_247_909 217
147 3300041453 Ga0451797_0396879 Ga0451797_0396879_29_691 217
148 3300042011 Ga0439454_022580 Ga0439454_022580_41_703 217
149 3300042437 Ga0439444_0004979 Ga0439444_0004979_1256_1918 217
150 3300044658 Ga0466972_0119909 Ga0466972_0119909_14_676 217
151 3300044684 Ga0466966_0177510 Ga0466966_0177510_335_997 217
152 3300044684 Ga0466966_0184555 Ga0466966_0184555_85_759 217
153 3300044693 Ga0466961_0104361 Ga0466961_0104361_917_1579 217
154 3300044694 Ga0466963_0030215 Ga0466963_0030215_169_831 217
155 3300044694 Ga0466963_0032565 Ga0466963_0032565_1683_2345 217
156 3300044694 Ga0466963_0060313 Ga0466963_0060313_1803_2465 217
157 3300044694 Ga0466963_0087079 Ga0466963_0087079_825_1487 217
158 3300044694 Ga0466963_0197286 Ga0466963_0197286_671_1333 217
159 3300044694 Ga0466963_0366336 Ga0466963_0366336_201_863 217
160 3300044694 Ga0466963_0375387 Ga0466963_0375387_260_922 217
161 3300044694 Ga0466963_0579692 Ga0466963_0579692_56_718 217
162 3300044706 Ga0466964_0064537 Ga0466964_0064537_155_817 217
163 3300044706 Ga0466964_0209659 Ga0466964_0209659_192_854 217
164 3300044719 Ga0466971_0104322 Ga0466971_0104322_152_814 217
165 3300044719 Ga0466971_0281711 Ga0466971_0281711_54_716 217
166 3300044842 Ga0466957_0042699 Ga0466957_0042699_767_1429 217
167 3300044842 Ga0466957_0061850 Ga0466957_0061850_985_1647 217
168 3300044901 Ga0466960_0023962 Ga0466960_0023962_1934_2596 217
169 3300044901 Ga0466960_0039569 Ga0466960_0039569_1467_2129 217
170 3300044901 Ga0466960_0158178 Ga0466960_0158178_369_1031 217
171 3300044901 Ga0466960_0295115 Ga0466960_0295115_87_749 217
172 3300044901 Ga0466960_0323748 Ga0466960_0323748_108_770 217
173 3300044901 Ga0466960_0368959 Ga0466960_0368959_15_677 217
174 3300045836 Ga0466958_0080554 Ga0466958_0080554_987_1649 217
175 3300045976 Ga0466967_0001274 Ga0466967_0001274_2154_2816 217
176 3300045976 Ga0466967_0064220 Ga0466967_0064220_2498_3160 217
177 3300045976 Ga0466967_0069363 Ga0466967_0069363_2259_2921 217
178 3300045976 Ga0466967_0130035 Ga0466967_0130035_1193_1855 217
179 3300045976 Ga0466967_0314873 Ga0466967_0314873_206_868 217
180 3300045976 Ga0466967_0571585 Ga0466967_0571585_15_677 217
181 3300045976 Ga0466967_0596816 Ga0466967_0596816_93_755 217
182 3300045976 Ga0466967_0662548 Ga0466967_0662548_356_1018 217
183 3300045976 Ga0466967_0781103 Ga0466967_0781103_191_853 217
184 3300045976 Ga0466967_1060849 Ga0466967_1060849_59_721 217
185 3300047320 Ga0495672_0164190 Ga0495672_0164190_53_715 217
186 3300048903 Ga0496100_0036599 Ga0496100_0036599_2241_2933 217
187 3300048904 Ga0496101_0028976 Ga0496101_0028976_1500_2192 217
188 3300048905 Ga0496102_0007419 Ga0496102_0007419_6420_7112 217
189 3300048906 Ga0496103_0101195 Ga0496103_0101195_927_1619 217
190 3300048909 Ga0496106_0006210 Ga0496106_0006210_1035_1727 217
191 3300048909 Ga0496106_0594156 Ga0496106_0594156_31_693 217
192 3300048910 Ga0496107_0003285 Ga0496107_0003285_454_1146 217
193 3300048911 Ga0496108_0177968 Ga0496108_0177968_883_1545 217
194 3300048913 Ga0496110_0154488 Ga0496110_0154488_14_676 217
195 3300048914 Ga0496111_0126076 Ga0496111_0126076_668_1330 217
196 3300048915 Ga0496112_0070152 Ga0496112_0070152_2296_2958 217
197 3300048915 Ga0496112_0864291 Ga0496112_0864291_118_780 217
198 3300048916 Ga0496113_0186135 Ga0496113_0186135_762_1424 217
199 3300048917 Ga0496114_0056238 Ga0496114_0056238_1702_2394 217
200 3300048917 Ga0496114_0382847 Ga0496114_0382847_352_1041 217
201 3300048917 Ga0496114_0482149 Ga0496114_0482149_311_973 217
202 3300048918 Ga0496115_0000011 Ga0496115_0000011_157608_158297 217
203 3300048918 Ga0496115_0004161 Ga0496115_0004161_4419_5111 217
204 3300049568 Ga0501031_0025826 Ga0501031_0025826_1930_2592 217
205 3300049569 Ga0501032_0166642 Ga0501032_0166642_372_1034 217
206 3300049571 Ga0501034_0240468 Ga0501034_0240468_582_1244 217
207 3300049572 Ga0501036_0062531 Ga0501036_0062531_2262_2924 217
208 3300049572 Ga0501036_0213665 Ga0501036_0213665_140_802 217
209 3300049572 Ga0501036_0516517 Ga0501036_0516517_106_768 217
210 3300049575 Ga0501039_0186510 Ga0501039_0186510_285_947 217
211 3300049575 Ga0501039_0214824 Ga0501039_0214824_136_798 217
212 3300049577 Ga0501041_0024569 Ga0501041_0024569_1302_1964 217
213 3300049578 Ga0501042_0325411 Ga0501042_0325411_196_858 217
214 3300049582 Ga0501048_0055272 Ga0501048_0055272_1735_2397 217
215 3300049582 Ga0501048_0350180 Ga0501048_0350180_19_681 217
216 3300049586 Ga0501070_0261996 Ga0501070_0261996_47_709 217
217 3300049587 Ga0501071_0061744 Ga0501071_0061744_75_737 217
218 3300049587 Ga0501071_0168097 Ga0501071_0168097_396_1058 217
219 3300049588 Ga0501072_0110400 Ga0501072_0110400_935_1597 217
220 3300049589 Ga0501073_0184547 Ga0501073_0184547_670_1332 217
221 3300049590 Ga0501074_0145653 Ga0501074_0145653_217_879 217
222 3300049591 Ga0501075_0102721 Ga0501075_0102721_444_1106 217
223 3300049593 Ga0501077_0117919 Ga0501077_0117919_893_1555 217
224 3300049822 Ga0501035_0077921 Ga0501035_0077921_1157_1819 217
225 3300049823 Ga0501044_0418209 Ga0501044_0418209_304_966 217
226 3300049824 Ga0501045_0022507 Ga0501045_0022507_785_1447 217
227 3300049824 Ga0501045_0085352 Ga0501045_0085352_821_1483 217
228 3300049824 Ga0501045_0387375 Ga0501045_0387375_47_709 217
229 3300050509 nmdc:mga0qj67_396170_c1 nmdc:mga0qj67_396170_c1_103_765 217
230 3300050509 nmdc:mga0qj67_4977_c1 nmdc:mga0qj67_4977_c1_4760_5428 217
231 3300050511 nmdc:mga08y16_212705_c1 nmdc:mga08y16_212705_c1_649_1311 217
232 3300050511 nmdc:mga08y16_222279_c1 nmdc:mga08y16_222279_c1_31_693 217
233 3300050512 nmdc:mga0n895_276630_c1 nmdc:mga0n895_276630_c1_612_1274 217
234 3300054114 Ga0501084_0184794 Ga0501084_0184794_1050_1712 217
235 3300059426 Ga0590077_029539 Ga0590077_029539_270_932 217
236 3300060353 Ga0501082_0584062 Ga0501082_0584062_47_709 217
237 3300061719 Ga0466962_0067543 Ga0466962_0067543_303_965 217
238 3300061719 Ga0466962_0157003 Ga0466962_0157003_234_896 217
239 3300061734 Ga0530510_0191461 Ga0530510_0191461_621_1283 217
240 3300006175 Ga0070712_100000004 Ga0070712_100000004193 218
241 3300017792 Ga0163161_10670557 Ga0163161_106705572 218
242 3300021388 Ga0213875_10083266 Ga0213875_100832662 218
243 3300025915 Ga0207693_10000017 Ga0207693_1000001726 218
244 3300026067 Ga0207678_10344390 Ga0207678_103443902 218
245 3300037853 Ga0436364_0394694 Ga0436364_0394694_1145_1825 218
246 3300044683 Ga0466965_0111393 Ga0466965_0111393_196_867 218
247 3300045836 Ga0466958_0383485 Ga0466958_0383485_80_760 218
248 3300045976 Ga0466967_0592735 Ga0466967_0592735_74_739 218
249 3300049578 Ga0501042_0543539 Ga0501042_0543539_38_721 218
250 3300049592 Ga0501076_0335675 Ga0501076_0335675_192_857 218
251 3300049824 Ga0501045_0554879 Ga0501045_0554879_22_687 218
252 3300053085 Ga0495619_0015247 Ga0495619_0015247_1346_2041 218
253 3300054114 Ga0501084_0106924 Ga0501084_0106924_697_1362 218
254 3300061719 Ga0466962_0209275 Ga0466962_0209275_245_925 218
255 3300005334 Ga0068869_100170166 Ga0068869_1001701663 219
256 3300005337 Ga0070682_100376199 Ga0070682_1003761991 219
257 3300005455 Ga0070663_100095415 Ga0070663_1000954153 219
258 3300005459 Ga0068867_100808717 Ga0068867_1008087172 219
259 3300005535 Ga0070684_100215866 Ga0070684_1002158662 219
260 3300005535 Ga0070684_100230599 Ga0070684_1002305993 219
261 3300005564 Ga0070664_100052502 Ga0070664_1000525025 219
262 3300005718 Ga0068866_10031078 Ga0068866_100310783 219
263 3300005840 Ga0068870_10171090 Ga0068870_101710902 219
264 3300005844 Ga0068862_100672124 Ga0068862_1006721242 219
265 3300005937 Ga0081455_10057346 Ga0081455_100573461 219
266 3300005981 Ga0081538_10013472 Ga0081538_100134724 219
267 3300005981 Ga0081538_10014713 Ga0081538_100147133 219
268 3300006051 Ga0075364_10508173 Ga0075364_105081731 219
269 3300006847 Ga0075431_100207840 Ga0075431_1002078402 219
270 3300009148 Ga0105243_10271201 Ga0105243_102712011 219
271 3300010375 Ga0105239_10424499 Ga0105239_104244993 219
272 3300021384 Ga0213876_10014726 Ga0213876_100147264 219
273 3300025321 Ga0207656_10035268 Ga0207656_100352681 219
274 3300025908 Ga0207643_10022822 Ga0207643_100228222 219
275 3300025908 Ga0207643_10108518 Ga0207643_101085182 219
276 3300025923 Ga0207681_10356059 Ga0207681_103560592 219
277 3300025944 Ga0207661_10286777 Ga0207661_102867773 219
278 3300025961 Ga0207712_10649700 Ga0207712_106497001 219
279 3300026067 Ga0207678_10112433 Ga0207678_101124334 219
280 3300026075 Ga0207708_10147959 Ga0207708_101479592 219
281 3300026089 Ga0207648_10745061 Ga0207648_107450611 219
282 3300026118 Ga0207675_100466088 Ga0207675_1004660881 219
283 3300026118 Ga0207675_100721385 Ga0207675_1007213852 219
284 3300028379 Ga0268266_10092201 Ga0268266_100922013 219
285 3300028381 Ga0268264_10412576 Ga0268264_104125762 219
286 3300031548 Ga0307408_100034402 Ga0307408_1000344025 219
287 3300031731 Ga0307405_10019925 Ga0307405_100199252 219
288 3300031824 Ga0307413_10013637 Ga0307413_100136375 219
289 3300031901 Ga0307406_10006019 Ga0307406_100060194 219
290 3300031903 Ga0307407_10030557 Ga0307407_100305573 219
291 3300031903 Ga0307407_10667528 Ga0307407_106675281 219
292 3300031995 Ga0307409_100038646 Ga0307409_1000386462 219
293 3300031995 Ga0307409_100167739 Ga0307409_1001677392 219
294 3300031995 Ga0307409_100354368 Ga0307409_1003543682 219
295 3300031995 Ga0307409_100425361 Ga0307409_1004253612 219
296 3300031995 Ga0307409_100499365 Ga0307409_1004993652 219
297 3300031995 Ga0307409_100785936 Ga0307409_1007859362 219
298 3300032002 Ga0307416_100050194 Ga0307416_1000501944 219
299 3300032002 Ga0307416_100531346 Ga0307416_1005313462 219
300 3300032126 Ga0307415_100005350 Ga0307415_1000053506 219
301 3300032126 Ga0307415_100011024 Ga0307415_1000110245 219
302 3300032126 Ga0307415_100041656 Ga0307415_1000416566 219
303 3300032126 Ga0307415_100853468 Ga0307415_1008534681 219
304 3300037418 Ga0395900_0401844 Ga0395900_0401844_571_1233 219
305 3300038443 Ga0395901_0668412 Ga0395901_0668412_318_980 219
306 3300039437 Ga0436365_0193968 Ga0436365_0193968_13679_14362 219
307 3300044684 Ga0466966_0075633 Ga0466966_0075633_1175_1858 219
308 3300044735 Ga0466968_0060447 Ga0466968_0060447_491_1180 219
309 3300045049 Ga0466959_0251156 Ga0466959_0251156_67_756 219
310 3300045836 Ga0466958_0196257 Ga0466958_0196257_161_844 219
311 3300045976 Ga0466967_0833666 Ga0466967_0833666_42_713 219
312 3300046454 Ga0495592_0120494 Ga0495592_0120494_340_1038 219
313 3300046500 Ga0495596_0080359 Ga0495596_0080359_178_849 219
314 3300046515 Ga0495620_0062548 Ga0495620_0062548_617_1288 219
315 3300046515 Ga0495620_0087738 Ga0495620_0087738_156_827 219
316 3300046519 Ga0495632_0257852 Ga0495632_0257852_92_769 219
317 3300046535 Ga0495586_0339232 Ga0495586_0339232_79_816 219
318 3300048904 Ga0496101_0403788 Ga0496101_0403788_284_946 219
319 3300048906 Ga0496103_0176714 Ga0496103_0176714_544_1206 219
320 3300048909 Ga0496106_0602108 Ga0496106_0602108_28_699 219
321 3300048910 Ga0496107_0105683 Ga0496107_0105683_676_1338 219
322 3300048911 Ga0496108_0288915 Ga0496108_0288915_605_1276 219
323 3300048914 Ga0496111_0088313 Ga0496111_0088313_798_1460 219
324 3300048915 Ga0496112_0657959 Ga0496112_0657959_110_772 219
325 3300049568 Ga0501031_0215797 Ga0501031_0215797_418_1089 219
326 3300049822 Ga0501035_0290187 Ga0501035_0290187_449_1129 219
327 3300050507 nmdc:mga05p37_86326_c1 nmdc:mga05p37_86326_c1_329_1009 219
328 3300050511 nmdc:mga08y16_84912_c1 nmdc:mga08y16_84912_c1_1379_2059 219
329 3300053155 Ga0500620_114463 Ga0500620_114463_54_725 219
330 3300003373 JGI25407J50210_10003770 JGI25407J50210_100037704 220
331 3300003373 JGI25407J50210_10005022 JGI25407J50210_100050223 220
332 3300003373 JGI25407J50210_10011690 JGI25407J50210_100116902 220
333 3300005546 Ga0070696_100618212 Ga0070696_1006182121 220
334 3300005937 Ga0081455_10025337 Ga0081455_100253373 220
335 3300005981 Ga0081538_10000766 Ga0081538_1000076637 220
336 3300005981 Ga0081538_10002073 Ga0081538_1000207325 220
337 3300005981 Ga0081538_10002222 Ga0081538_1000222219 220
338 3300005981 Ga0081538_10094492 Ga0081538_100944922 220
339 3300005983 Ga0081540_1001363 Ga0081540_10013635 220
340 3300006175 Ga0070712_100851994 Ga0070712_1008519941 220
341 3300006847 Ga0075431_100639750 Ga0075431_1006397502 220
342 3300009147 Ga0114129_10070350 Ga0114129_100703503 220
343 3300009176 Ga0105242_10000533 Ga0105242_1000053311 220
344 3300013296 Ga0157374_10134876 Ga0157374_101348763 220
345 3300017792 Ga0163161_10569661 Ga0163161_105696612 220
346 3300021388 Ga0213875_10006762 Ga0213875_100067627 220
347 3300025913 Ga0207695_10488057 Ga0207695_104880572 220
348 3300025921 Ga0207652_10421988 Ga0207652_104219882 220
349 3300025934 Ga0207686_10000073 Ga0207686_1000007388 220
350 3300025972 Ga0207668_10129981 Ga0207668_101299812 220
351 3300028563 Ga0265319_1003395 Ga0265319_10033956 220
352 3300031240 Ga0265320_10023535 Ga0265320_100235355 220
353 3300031903 Ga0307407_10079745 Ga0307407_100797453 220
354 3300032002 Ga0307416_100264861 Ga0307416_1002648612 220
355 3300037418 Ga0395900_0187258 Ga0395900_0187258_669_1334 220
356 3300037418 Ga0395900_0457055 Ga0395900_0457055_429_1094 220
357 3300037466 Ga0395898_0244242 Ga0395898_0244242_260_925 220
358 3300037466 Ga0395898_0479092 Ga0395898_0479092_253_918 220
359 3300037471 Ga0395905_0334614 Ga0395905_0334614_485_1150 220
360 3300037853 Ga0436364_0786946 Ga0436364_0786946_410_1096 220
361 3300037853 Ga0436364_0927298 Ga0436364_0927298_3292_3975 220
362 3300038443 Ga0395901_0070334 Ga0395901_0070334_152_817 220
363 3300038443 Ga0395901_0246245 Ga0395901_0246245_985_1650 220
364 3300038443 Ga0395901_0257186 Ga0395901_0257186_614_1279 220
365 3300039437 Ga0436365_0571801 Ga0436365_0571801_1698_2384 220
366 3300039437 Ga0436365_1906628 Ga0436365_1906628_42_821 220
367 3300039450 Ga0436363_0160959 Ga0436363_0160959_230_922 220
368 3300039450 Ga0436363_1290946 Ga0436363_1290946_113_805 220
369 3300039450 Ga0436363_1301125 Ga0436363_1301125_7460_8146 220
370 3300041512 Ga0451853_2330744 Ga0451853_2330744_360_1025 220
371 3300044684 Ga0466966_0230503 Ga0466966_0230503_217_903 220
372 3300044693 Ga0466961_0198627 Ga0466961_0198627_223_909 220
373 3300044694 Ga0466963_0003469 Ga0466963_0003469_1973_2752 220
374 3300044694 Ga0466963_0022549 Ga0466963_0022549_2802_3488 220
375 3300044719 Ga0466971_0058920 Ga0466971_0058920_728_1414 220
376 3300044719 Ga0466971_0141714 Ga0466971_0141714_88_867 220
377 3300044735 Ga0466968_0103062 Ga0466968_0103062_525_1211 220
378 3300044765 Ga0466970_0055418 Ga0466970_0055418_1036_1815 220
379 3300044842 Ga0466957_0003722 Ga0466957_0003722_5438_6217 220
380 3300045049 Ga0466959_0020966 Ga0466959_0020966_1644_2423 220
381 3300045049 Ga0466959_0051987 Ga0466959_0051987_1043_1729 220
382 3300045049 Ga0466959_0118339 Ga0466959_0118339_1004_1696 220
383 3300045836 Ga0466958_0011172 Ga0466958_0011172_2075_2854 220
384 3300045836 Ga0466958_0017342 Ga0466958_0017342_1999_2685 220
385 3300045976 Ga0466967_0058077 Ga0466967_0058077_1873_2652 220
386 3300048907 Ga0496104_0934405 Ga0496104_0934405_16_729 220
387 3300048912 Ga0496109_0000552 Ga0496109_0000552_19575_20255 220
388 3300048913 Ga0496110_0585472 Ga0496110_0585472_80_760 220
389 3300048915 Ga0496112_0000200 Ga0496112_0000200_18881_19573 220
390 3300048916 Ga0496113_0166290 Ga0496113_0166290_167_868 220
391 3300049568 Ga0501031_0162857 Ga0501031_0162857_757_1431 220
392 3300049578 Ga0501042_0081992 Ga0501042_0081992_739_1413 220
393 3300049578 Ga0501042_0468577 Ga0501042_0468577_215_886 220
394 3300049579 Ga0501043_0310418 Ga0501043_0310418_360_1034 220
395 3300049588 Ga0501072_0048610 Ga0501072_0048610_1036_1710 220
396 3300049741 Ga0501079_0130747 Ga0501079_0130747_258_932 220
397 3300049741 Ga0501079_0760195 Ga0501079_0760195_22_687 220
398 3300049824 Ga0501045_0035637 Ga0501045_0035637_945_1619 220
399 3300050511 nmdc:mga08y16_829191_c1 nmdc:mga08y16_829191_c1_42_716 220
400 3300054114 Ga0501084_0189315 Ga0501084_0189315_592_1266 220
401 3300060353 Ga0501082_0238562 Ga0501082_0238562_181_855 220
402 3300060353 Ga0501082_0611188 Ga0501082_0611188_163_834 220
403 3300061719 Ga0466962_0013264 Ga0466962_0013264_2012_2698 220
404 3300001991 JGI24743J22301_10044033 JGI24743J22301_100440331 221
405 3300003373 JGI25407J50210_10009964 JGI25407J50210_100099642 221
406 3300003373 JGI25407J50210_10025068 JGI25407J50210_100250682 221
407 3300003373 JGI25407J50210_10025262 JGI25407J50210_100252622 221
408 3300005330 Ga0070690_100330506 Ga0070690_1003305061 221
409 3300005334 Ga0068869_100151291 Ga0068869_1001512913 221
410 3300005335 Ga0070666_10005716 Ga0070666_100057167 221
411 3300005335 Ga0070666_10011418 Ga0070666_100114182 221
412 3300005337 Ga0070682_100165993 Ga0070682_1001659933 221
413 3300005337 Ga0070682_100281883 Ga0070682_1002818832 221
414 3300005338 Ga0068868_100022400 Ga0068868_1000224003 221
415 3300005341 Ga0070691_10000021 Ga0070691_1000002126 221
416 3300005341 Ga0070691_10027557 Ga0070691_100275572 221
417 3300005341 Ga0070691_10031342 Ga0070691_100313423 221
418 3300005344 Ga0070661_100257761 Ga0070661_1002577612 221
419 3300005344 Ga0070661_100361443 Ga0070661_1003614431 221
420 3300005347 Ga0070668_100006694 Ga0070668_1000066948 221
421 3300005354 Ga0070675_100034890 Ga0070675_1000348904 221
422 3300005356 Ga0070674_100389231 Ga0070674_1003892311 221
423 3300005364 Ga0070673_100051394 Ga0070673_1000513943 221
424 3300005365 Ga0070688_100053016 Ga0070688_1000530163 221
425 3300005366 Ga0070659_100021303 Ga0070659_1000213035 221
426 3300005367 Ga0070667_100051735 Ga0070667_1000517352 221
427 3300005434 Ga0070709_10107091 Ga0070709_101070912 221
428 3300005435 Ga0070714_100007942 Ga0070714_1000079422 221
429 3300005435 Ga0070714_100023442 Ga0070714_1000234424 221
430 3300005435 Ga0070714_100068740 Ga0070714_1000687404 221
431 3300005435 Ga0070714_100453558 Ga0070714_1004535581 221
432 3300005436 Ga0070713_100067820 Ga0070713_1000678201 221
433 3300005436 Ga0070713_100104694 Ga0070713_1001046943 221
434 3300005436 Ga0070713_100183117 Ga0070713_1001831173 221
435 3300005437 Ga0070710_10111737 Ga0070710_101117372 221
436 3300005438 Ga0070701_10385802 Ga0070701_103858021 221
437 3300005439 Ga0070711_100006655 Ga0070711_1000066557 221
438 3300005439 Ga0070711_100094329 Ga0070711_1000943292 221
439 3300005441 Ga0070700_100000722 Ga0070700_1000007221 221
440 3300005441 Ga0070700_100006275 Ga0070700_1000062754 221
441 3300005466 Ga0070685_10045942 Ga0070685_100459422 221
442 3300005545 Ga0070695_100285073 Ga0070695_1002850731 221
443 3300005548 Ga0070665_100064521 Ga0070665_1000645212 221
444 3300005548 Ga0070665_100119286 Ga0070665_1001192863 221
445 3300005548 Ga0070665_100303345 Ga0070665_1003033453 221
446 3300005548 Ga0070665_100303852 Ga0070665_1003038522 221
447 3300005564 Ga0070664_100017246 Ga0070664_1000172464 221
448 3300005577 Ga0068857_100112689 Ga0068857_1001126893 221
449 3300005578 Ga0068854_100219200 Ga0068854_1002192002 221
450 3300005614 Ga0068856_100002016 Ga0068856_1000020163 221
451 3300005614 Ga0068856_100037628 Ga0068856_1000376283 221
452 3300005615 Ga0070702_100360052 Ga0070702_1003600522 221
453 3300005618 Ga0068864_100002096 Ga0068864_1000020964 221
454 3300005719 Ga0068861_100001186 Ga0068861_1000011864 221
455 3300005719 Ga0068861_100088248 Ga0068861_1000882483 221
456 3300005719 Ga0068861_100104384 Ga0068861_1001043842 221
457 3300005844 Ga0068862_100178662 Ga0068862_1001786622 221
458 3300005937 Ga0081455_10017510 Ga0081455_100175107 221
459 3300005937 Ga0081455_10019598 Ga0081455_100195986 221
460 3300005937 Ga0081455_10022152 Ga0081455_100221527 221
461 3300005937 Ga0081455_10142289 Ga0081455_101422893 221
462 3300005981 Ga0081538_10000044 Ga0081538_1000004433 221
463 3300005981 Ga0081538_10000087 Ga0081538_1000008786 221
464 3300005981 Ga0081538_10000190 Ga0081538_1000019058 221
465 3300005981 Ga0081538_10004723 Ga0081538_100047236 221
466 3300005981 Ga0081538_10005950 Ga0081538_100059508 221
467 3300005981 Ga0081538_10015512 Ga0081538_100155125 221
468 3300005981 Ga0081538_10017123 Ga0081538_100171235 221
469 3300005981 Ga0081538_10017143 Ga0081538_100171436 221
470 3300005981 Ga0081538_10017511 Ga0081538_100175113 221
471 3300005981 Ga0081538_10026605 Ga0081538_100266053 221
472 3300005985 Ga0081539_10038945 Ga0081539_100389455 221
473 3300006028 Ga0070717_10007024 Ga0070717_100070247 221
474 3300006028 Ga0070717_10008551 Ga0070717_100085514 221
475 3300006038 Ga0075365_10042925 Ga0075365_100429253 221
476 3300006048 Ga0075363_100029908 Ga0075363_1000299083 221
477 3300006048 Ga0075363_100062948 Ga0075363_1000629483 221
478 3300006058 Ga0075432_10004604 Ga0075432_100046044 221
479 3300006175 Ga0070712_100002009 Ga0070712_1000020092 221
480 3300006175 Ga0070712_100009269 Ga0070712_1000092693 221
481 3300006844 Ga0075428_100046559 Ga0075428_1000465594 221
482 3300006844 Ga0075428_100066684 Ga0075428_1000666844 221
483 3300006846 Ga0075430_100000277 Ga0075430_10000027718 221
484 3300006846 Ga0075430_100022807 Ga0075430_1000228072 221
485 3300006846 Ga0075430_100051964 Ga0075430_1000519645 221
486 3300006846 Ga0075430_100186547 Ga0075430_1001865473 221
487 3300006847 Ga0075431_100032339 Ga0075431_1000323393 221
488 3300006847 Ga0075431_100387477 Ga0075431_1003874772 221
489 3300006852 Ga0075433_10056171 Ga0075433_100561715 221
490 3300006852 Ga0075433_10081739 Ga0075433_100817392 221
491 3300006880 Ga0075429_100022506 Ga0075429_1000225064 221
492 3300006880 Ga0075429_100109912 Ga0075429_1001099122 221
493 3300006880 Ga0075429_100865911 Ga0075429_1008659112 221
494 3300006914 Ga0075436_100020658 Ga0075436_1000206584 221
495 3300007076 Ga0075435_100065745 Ga0075435_1000657454 221
496 3300009094 Ga0111539_10044281 Ga0111539_100442814 221
497 3300009094 Ga0111539_10082912 Ga0111539_100829124 221
498 3300009094 Ga0111539_10330969 Ga0111539_103309692 221
499 3300009094 Ga0111539_10713428 Ga0111539_107134281 221
500 3300009098 Ga0105245_10012887 Ga0105245_100128879 221
501 3300009098 Ga0105245_10035529 Ga0105245_100355294 221
502 3300009147 Ga0114129_10055555 Ga0114129_100555553 221
503 3300009147 Ga0114129_10148059 Ga0114129_101480592 221
504 3300009147 Ga0114129_10508850 Ga0114129_105088502 221
505 3300009147 Ga0114129_10782757 Ga0114129_107827572 221
506 3300009176 Ga0105242_10034928 Ga0105242_100349286 221
507 3300009177 Ga0105248_10074184 Ga0105248_100741844 221
508 3300009545 Ga0105237_10000501 Ga0105237_1000050127 221
509 3300009553 Ga0105249_10062901 Ga0105249_100629013 221
510 3300009553 Ga0105249_10192817 Ga0105249_101928171 221
511 3300010375 Ga0105239_10063989 Ga0105239_100639894 221
512 3300010375 Ga0105239_10114635 Ga0105239_101146352 221
513 3300010375 Ga0105239_10141763 Ga0105239_101417634 221
514 3300011119 Ga0105246_10011340 Ga0105246_100113403 221
515 3300012482 Ga0157318_1002707 Ga0157318_10027072 221
516 3300013102 Ga0157371_10205703 Ga0157371_102057031 221
517 3300013296 Ga0157374_10007744 Ga0157374_100077446 221
518 3300013306 Ga0163162_10047822 Ga0163162_100478225 221
519 3300013306 Ga0163162_11086915 Ga0163162_110869152 221
520 3300013307 Ga0157372_10094032 Ga0157372_100940323 221
521 3300013307 Ga0157372_10894288 Ga0157372_108942882 221
522 3300013308 Ga0157375_10054962 Ga0157375_100549624 221
523 3300013308 Ga0157375_10299622 Ga0157375_102996223 221
524 3300014325 Ga0163163_10045286 Ga0163163_100452865 221
525 3300014325 Ga0163163_10362079 Ga0163163_103620792 221
526 3300014326 Ga0157380_10073581 Ga0157380_100735813 221
527 3300014745 Ga0157377_10000686 Ga0157377_1000068611 221
528 3300014968 Ga0157379_10316085 Ga0157379_103160852 221
529 3300014968 Ga0157379_10676433 Ga0157379_106764332 221
530 3300017792 Ga0163161_10084272 Ga0163161_100842722 221
531 3300021384 Ga0213876_10010277 Ga0213876_100102775 221
532 3300021388 Ga0213875_10007406 Ga0213875_100074066 221
533 3300025898 Ga0207692_10047202 Ga0207692_100472023 221
534 3300025900 Ga0207710_10189747 Ga0207710_101897471 221
535 3300025901 Ga0207688_10002774 Ga0207688_100027746 221
536 3300025903 Ga0207680_10002798 Ga0207680_100027985 221
537 3300025903 Ga0207680_10015344 Ga0207680_100153444 221
538 3300025907 Ga0207645_10276852 Ga0207645_102768522 221
539 3300025914 Ga0207671_10002754 Ga0207671_1000275411 221
540 3300025915 Ga0207693_10000973 Ga0207693_100009735 221
541 3300025915 Ga0207693_10021101 Ga0207693_100211014 221
542 3300025915 Ga0207693_10344077 Ga0207693_103440771 221
543 3300025915 Ga0207693_10470163 Ga0207693_104701631 221
544 3300025916 Ga0207663_10037118 Ga0207663_100371182 221
545 3300025916 Ga0207663_10090650 Ga0207663_100906502 221
546 3300025920 Ga0207649_10126888 Ga0207649_101268881 221
547 3300025924 Ga0207694_10619936 Ga0207694_106199362 221
548 3300025925 Ga0207650_10519999 Ga0207650_105199992 221
549 3300025926 Ga0207659_10230975 Ga0207659_102309752 221
550 3300025927 Ga0207687_10011907 Ga0207687_100119076 221
551 3300025927 Ga0207687_10209394 Ga0207687_102093943 221
552 3300025927 Ga0207687_10325597 Ga0207687_103255972 221
553 3300025928 Ga0207700_10013143 Ga0207700_100131433 221
554 3300025928 Ga0207700_10029400 Ga0207700_100294003 221
555 3300025928 Ga0207700_10105953 Ga0207700_101059532 221
556 3300025929 Ga0207664_10005280 Ga0207664_100052805 221
557 3300025929 Ga0207664_10005496 Ga0207664_100054963 221
558 3300025929 Ga0207664_10022205 Ga0207664_100222054 221
559 3300025929 Ga0207664_10164987 Ga0207664_101649872 221
560 3300025931 Ga0207644_10090148 Ga0207644_100901482 221
561 3300025932 Ga0207690_10135083 Ga0207690_101350832 221
562 3300025933 Ga0207706_10001334 Ga0207706_1000133423 221
563 3300025933 Ga0207706_10233332 Ga0207706_102333322 221
564 3300025941 Ga0207711_10157448 Ga0207711_101574482 221
565 3300025945 Ga0207679_10163399 Ga0207679_101633992 221
566 3300025960 Ga0207651_10069787 Ga0207651_100697873 221
567 3300025961 Ga0207712_10005003 Ga0207712_100050035 221
568 3300025972 Ga0207668_10021186 Ga0207668_100211863 221
569 3300025981 Ga0207640_10101422 Ga0207640_101014222 221
570 3300025986 Ga0207658_10241123 Ga0207658_102411232 221
571 3300026023 Ga0207677_10066450 Ga0207677_100664502 221
572 3300026067 Ga0207678_10129748 Ga0207678_101297482 221
573 3300026067 Ga0207678_10135654 Ga0207678_101356542 221
574 3300026075 Ga0207708_10052367 Ga0207708_100523674 221
575 3300026075 Ga0207708_10286282 Ga0207708_102862821 221
576 3300026078 Ga0207702_10008203 Ga0207702_100082035 221
577 3300026088 Ga0207641_10016945 Ga0207641_100169454 221
578 3300026095 Ga0207676_10085785 Ga0207676_100857851 221
579 3300026116 Ga0207674_10134802 Ga0207674_101348022 221
580 3300026118 Ga0207675_100000719 Ga0207675_10000071920 221
581 3300026118 Ga0207675_100092563 Ga0207675_1000925632 221
582 3300026118 Ga0207675_100201565 Ga0207675_1002015652 221
583 3300026118 Ga0207675_100303029 Ga0207675_1003030292 221
584 3300026121 Ga0207683_10051363 Ga0207683_100513633 221
585 3300027907 Ga0207428_10036725 Ga0207428_100367253 221
586 3300027907 Ga0207428_10185293 Ga0207428_101852932 221
587 3300027907 Ga0207428_10384330 Ga0207428_103843302 221
588 3300028379 Ga0268266_10000264 Ga0268266_1000026414 221
589 3300028379 Ga0268266_10057759 Ga0268266_100577591 221
590 3300031548 Ga0307408_100055586 Ga0307408_1000555863 221
591 3300031548 Ga0307408_100188629 Ga0307408_1001886292 221
592 3300031727 Ga0316576_10001238 Ga0316576_100012386 221
593 3300031728 Ga0316578_10374019 Ga0316578_103740191 221
594 3300031852 Ga0307410_10181587 Ga0307410_101815872 221
595 3300031911 Ga0307412_10249233 Ga0307412_102492332 221
596 3300031995 Ga0307409_100201451 Ga0307409_1002014512 221
597 3300032002 Ga0307416_100037603 Ga0307416_1000376033 221
598 3300032004 Ga0307414_10666834 Ga0307414_106668342 221
599 3300032005 Ga0307411_10968294 Ga0307411_109682941 221
600 3300032126 Ga0307415_100140600 Ga0307415_1001406002 221
601 3300035085 Ga0373929_0033373 Ga0373929_0033373_244_921 221
602 3300035111 Ga0373923_0177436 Ga0373923_0177436_197_898 221
603 3300035118 Ga0373954_0041938 Ga0373954_0041938_840_1541 221
604 3300035121 Ga0373960_0062442 Ga0373960_0062442_248_925 221
605 3300035172 Ga0373955_0101654 Ga0373955_0101654_32_733 221
606 3300035241 Ga0373961_0009850 Ga0373961_0009850_995_1672 221
607 3300035242 Ga0373962_0033523 Ga0373962_0033523_295_972 221
608 3300035398 Ga0316574_0016972 Ga0316574_0016972_1096_1833 221
609 3300035398 Ga0316574_0021673 Ga0316574_0021673_3073_3744 221
610 3300035398 Ga0316574_0037326 Ga0316574_0037326_158_832 221
611 3300035398 Ga0316574_0104882 Ga0316574_0104882_67_804 221
612 3300035410 Ga0373924_0168182 Ga0373924_0168182_160_861 221
613 3300035692 Ga0373935_0176201 Ga0373935_0176201_210_911 221
614 3300035724 Ga0373933_0050068 Ga0373933_0050068_396_1097 221
615 3300035725 Ga0373947_0209587 Ga0373947_0209587_127_828 221
616 3300036401 Ga0373937_0034194 Ga0373937_0034194_2740_3408 221
617 3300036401 Ga0373937_0052600 Ga0373937_0052600_2972_3673 221
618 3300036712 Ga0316584_0002636 Ga0316584_0002636_4512_5183 221
619 3300037418 Ga0395900_0016044 Ga0395900_0016044_3207_3905 221
620 3300037466 Ga0395898_0004574 Ga0395898_0004574_3629_4327 221
621 3300037466 Ga0395898_0068180 Ga0395898_0068180_2196_2873 221
622 3300037466 Ga0395898_0585597 Ga0395898_0585597_273_941 221
623 3300037466 Ga0395898_1065946 Ga0395898_1065946_27_704 221
624 3300037853 Ga0436364_0010487 Ga0436364_0010487_2041_2748 221
625 3300037853 Ga0436364_0542331 Ga0436364_0542331_1660_2373 221
626 3300039437 Ga0436365_0571253 Ga0436365_0571253_368_1126 221
627 3300039437 Ga0436365_1161323 Ga0436365_1161323_2399_3106 221
628 3300039437 Ga0436365_1365717 Ga0436365_1365717_5568_6281 221
629 3300039437 Ga0436365_1793812 Ga0436365_1793812_2412_3119 221
630 3300039450 Ga0436363_0206518 Ga0436363_0206518_699_1406 221
631 3300039450 Ga0436363_0229649 Ga0436363_0229649_644_1333 221
632 3300039450 Ga0436363_1313806 Ga0436363_1313806_500_1207 221
633 3300041491 Ga0451833_1082468 Ga0451833_1082468_109_789 221
634 3300041491 Ga0451833_1482837 Ga0451833_1482837_11_691 221
635 3300042993 Ga0439440_0016519 Ga0439440_0016519_459_1139 221
636 3300044656 Ga0466969_0022883 Ga0466969_0022883_1580_2278 221
637 3300044656 Ga0466969_0110191 Ga0466969_0110191_50_763 221
638 3300044693 Ga0466961_0012908 Ga0466961_0012908_3722_4420 221
639 3300044693 Ga0466961_0146831 Ga0466961_0146831_626_1339 221
640 3300044694 Ga0466963_0014498 Ga0466963_0014498_197_916 221
641 3300044694 Ga0466963_0020293 Ga0466963_0020293_2220_2918 221
642 3300044719 Ga0466971_0252611 Ga0466971_0252611_99_824 221
643 3300044735 Ga0466968_0013257 Ga0466968_0013257_1234_1908 221
644 3300044735 Ga0466968_0270902 Ga0466968_0270902_77_778 221
645 3300044765 Ga0466970_0163892 Ga0466970_0163892_88_786 221
646 3300044765 Ga0466970_0266779 Ga0466970_0266779_70_789 221
647 3300044842 Ga0466957_0055689 Ga0466957_0055689_242_940 221
648 3300044901 Ga0466960_0088201 Ga0466960_0088201_393_1067 221
649 3300045049 Ga0466959_0007415 Ga0466959_0007415_3824_4522 221
650 3300045049 Ga0466959_0011169 Ga0466959_0011169_1950_2648 221
651 3300045049 Ga0466959_0031020 Ga0466959_0031020_1030_1743 221
652 3300045049 Ga0466959_0072220 Ga0466959_0072220_1065_1820 221
653 3300045049 Ga0466959_0309568 Ga0466959_0309568_247_957 221
654 3300045836 Ga0466958_0008325 Ga0466958_0008325_4747_5433 221
655 3300045836 Ga0466958_0013642 Ga0466958_0013642_2153_2851 221
656 3300045836 Ga0466958_0055073 Ga0466958_0055073_770_1507 221
657 3300045836 Ga0466958_0080476 Ga0466958_0080476_123_842 221
658 3300045976 Ga0466967_0011910 Ga0466967_0011910_1776_2495 221
659 3300045976 Ga0466967_0085871 Ga0466967_0085871_595_1308 221
660 3300045976 Ga0466967_0098664 Ga0466967_0098664_372_1064 221
661 3300046454 Ga0495592_0021079 Ga0495592_0021079_352_1053 221
662 3300046459 Ga0495629_0001073 Ga0495629_0001073_5756_6421 221
663 3300046459 Ga0495629_0079024 Ga0495629_0079024_803_1504 221
664 3300046462 Ga0495651_0002099 Ga0495651_0002099_1972_2673 221
665 3300046463 Ga0495653_0045652 Ga0495653_0045652_446_1147 221
666 3300046463 Ga0495653_0321453 Ga0495653_0321453_87_755 221
667 3300046474 Ga0495605_0094860 Ga0495605_0094860_344_1018 221
668 3300046491 Ga0495584_0089302 Ga0495584_0089302_183_860 221
669 3300046511 Ga0495608_0008068 Ga0495608_0008068_1828_2529 221
670 3300046511 Ga0495608_0309947 Ga0495608_0309947_67_735 221
671 3300046514 Ga0495618_0101668 Ga0495618_0101668_47_748 221
672 3300046517 Ga0495630_0212702 Ga0495630_0212702_333_1034 221
673 3300046518 Ga0495631_0068989 Ga0495631_0068989_671_1348 221
674 3300046529 Ga0495652_0149471 Ga0495652_0149471_38_757 221
675 3300046529 Ga0495652_0183137 Ga0495652_0183137_553_1254 221
676 3300046533 Ga0495640_0064308 Ga0495640_0064308_1396_2097 221
677 3300046538 Ga0495609_0078974 Ga0495609_0078974_331_1008 221
678 3300046559 Ga0495667_0001823 Ga0495667_0001823_13215_13916 221
679 3300046616 Ga0495668_0114374 Ga0495668_0114374_190_864 221
680 3300046642 Ga0495634_0022081 Ga0495634_0022081_451_1152 221
681 3300046663 Ga0495635_0048723 Ga0495635_0048723_283_984 221
682 3300046663 Ga0495635_0558260 Ga0495635_0558260_36_737 221
683 3300046675 Ga0495657_0005941 Ga0495657_0005941_1785_2486 221
684 3300046678 Ga0495599_0282846 Ga0495599_0282846_208_909 221
685 3300046679 Ga0495623_0018239 Ga0495623_0018239_1951_2652 221
686 3300046680 Ga0495646_0026711 Ga0495646_0026711_2663_3364 221
687 3300046794 Ga0495589_0070961 Ga0495589_0070961_43_720 221
688 3300046809 Ga0495600_0006420 Ga0495600_0006420_4552_5253 221
689 3300046809 Ga0495600_0117833 Ga0495600_0117833_436_1104 221
690 3300047317 Ga0495604_0015258 Ga0495604_0015258_3367_4068 221
691 3300047317 Ga0495604_0193820 Ga0495604_0193820_688_1356 221
692 3300047319 Ga0495674_0004844 Ga0495674_0004844_7281_7982 221
693 3300047322 Ga0495680_0001510 Ga0495680_0001510_22044_22745 221
694 3300047322 Ga0495680_0101687 Ga0495680_0101687_673_1341 221
695 3300047444 Ga0495675_0046462 Ga0495675_0046462_1109_1810 221
696 3300047445 Ga0495677_0075084 Ga0495677_0075084_69_746 221
697 3300047471 Ga0495684_0002969 Ga0495684_0002969_133_882 221
698 3300047471 Ga0495684_0016341 Ga0495684_0016341_1863_2564 221
699 3300048088 Ga0495602_0011043 Ga0495602_0011043_6269_6970 221
700 3300048903 Ga0496100_0042526 Ga0496100_0042526_1347_2015 221
701 3300048904 Ga0496101_0053587 Ga0496101_0053587_984_1652 221
702 3300048905 Ga0496102_0054230 Ga0496102_0054230_1001_1687 221
703 3300048905 Ga0496102_0180737 Ga0496102_0180737_360_1028 221
704 3300048907 Ga0496104_0007864 Ga0496104_0007864_5206_5874 221
705 3300048907 Ga0496104_0008408 Ga0496104_0008408_7482_8183 221
706 3300048907 Ga0496104_0030618 Ga0496104_0030618_3750_4418 221
707 3300048907 Ga0496104_0618363 Ga0496104_0618363_151_834 221
708 3300048908 Ga0496105_0040907 Ga0496105_0040907_1270_1938 221
709 3300048908 Ga0496105_0046802 Ga0496105_0046802_1880_2548 221
710 3300048908 Ga0496105_0069644 Ga0496105_0069644_148_831 221
711 3300048910 Ga0496107_0098184 Ga0496107_0098184_48_731 221
712 3300048911 Ga0496108_0006421 Ga0496108_0006421_6641_7309 221
713 3300048911 Ga0496108_0470868 Ga0496108_0470868_320_1003 221
714 3300048911 Ga0496108_0911966 Ga0496108_0911966_29_712 221
715 3300048912 Ga0496109_0018048 Ga0496109_0018048_1289_1972 221
716 3300048912 Ga0496109_0022852 Ga0496109_0022852_1411_2079 221
717 3300048912 Ga0496109_0037440 Ga0496109_0037440_3318_4001 221
718 3300048912 Ga0496109_0384564 Ga0496109_0384564_47_748 221
719 3300048913 Ga0496110_0101325 Ga0496110_0101325_1763_2431 221
720 3300048913 Ga0496110_0496227 Ga0496110_0496227_50_733 221
721 3300048914 Ga0496111_0051797 Ga0496111_0051797_2261_2944 221
722 3300048914 Ga0496111_0065395 Ga0496111_0065395_715_1383 221
723 3300048915 Ga0496112_0001981 Ga0496112_0001981_102_803 221
724 3300048915 Ga0496112_0031970 Ga0496112_0031970_817_1485 221
725 3300048915 Ga0496112_0065627 Ga0496112_0065627_472_1155 221
726 3300048915 Ga0496112_0140296 Ga0496112_0140296_21_704 221
727 3300048915 Ga0496112_0447125 Ga0496112_0447125_220_903 221
728 3300048916 Ga0496113_0001428 Ga0496113_0001428_8246_8914 221
729 3300048916 Ga0496113_0043838 Ga0496113_0043838_1786_2469 221
730 3300048916 Ga0496113_0296630 Ga0496113_0296630_522_1205 221
731 3300048917 Ga0496114_0000039 Ga0496114_0000039_115231_115896 221
732 3300048918 Ga0496115_0000011 Ga0496115_0000011_19040_19705 221
733 3300048922 Ga0496119_0027970 Ga0496119_0027970_2520_3188 221
734 3300048924 Ga0496121_0019533 Ga0496121_0019533_1026_1694 221
735 3300048927 Ga0496124_0067218 Ga0496124_0067218_1264_1932 221
736 3300048927 Ga0496124_0549330 Ga0496124_0549330_35_703 221
737 3300048928 Ga0496125_0096039 Ga0496125_0096039_952_1620 221
738 3300049568 Ga0501031_0054056 Ga0501031_0054056_1669_2364 221
739 3300049570 Ga0501033_0029197 Ga0501033_0029197_2460_3137 221
740 3300049570 Ga0501033_0428248 Ga0501033_0428248_175_849 221
741 3300049571 Ga0501034_0003187 Ga0501034_0003187_13691_14365 221
742 3300049571 Ga0501034_0126926 Ga0501034_0126926_557_1231 221
743 3300049571 Ga0501034_0731497 Ga0501034_0731497_152_826 221
744 3300049574 Ga0501038_0272233 Ga0501038_0272233_576_1256 221
745 3300049575 Ga0501039_0006140 Ga0501039_0006140_3341_4021 221
746 3300049575 Ga0501039_0009459 Ga0501039_0009459_914_1591 221
747 3300049575 Ga0501039_0194688 Ga0501039_0194688_415_1095 221
748 3300049578 Ga0501042_0441600 Ga0501042_0441600_73_750 221
749 3300049580 Ga0501046_0073043 Ga0501046_0073043_1031_1708 221
750 3300049581 Ga0501047_0057719 Ga0501047_0057719_1944_2630 221
751 3300049581 Ga0501047_0162580 Ga0501047_0162580_1212_1886 221
752 3300049581 Ga0501047_0297894 Ga0501047_0297894_514_1191 221
753 3300049582 Ga0501048_0006014 Ga0501048_0006014_1251_1928 221
754 3300049583 Ga0501067_0028935 Ga0501067_0028935_1277_1954 221
755 3300049586 Ga0501070_0026130 Ga0501070_0026130_514_1191 221
756 3300049587 Ga0501071_0179004 Ga0501071_0179004_130_816 221
757 3300049587 Ga0501071_0460484 Ga0501071_0460484_238_912 221
758 3300049588 Ga0501072_0065940 Ga0501072_0065940_156_842 221
759 3300049588 Ga0501072_0185227 Ga0501072_0185227_708_1385 221
760 3300049589 Ga0501073_0034340 Ga0501073_0034340_1668_2345 221
761 3300049590 Ga0501074_0006507 Ga0501074_0006507_7688_8365 221
762 3300049590 Ga0501074_0290348 Ga0501074_0290348_366_1046 221
763 3300049591 Ga0501075_0307525 Ga0501075_0307525_96_773 221
764 3300049592 Ga0501076_0171516 Ga0501076_0171516_255_935 221
765 3300049742 Ga0501080_0101344 Ga0501080_0101344_1088_1765 221
766 3300049743 Ga0501081_0133135 Ga0501081_0133135_304_990 221
767 3300049744 Ga0501083_0005694 Ga0501083_0005694_6190_6876 221
768 3300049822 Ga0501035_0050285 Ga0501035_0050285_834_1511 221
769 3300049823 Ga0501044_0041349 Ga0501044_0041349_4096_4770 221
770 3300049823 Ga0501044_0089806 Ga0501044_0089806_1157_1834 221
771 3300049824 Ga0501045_0049890 Ga0501045_0049890_38_718 221
772 3300050491 nmdc:mga00v17_360519_c1 nmdc:mga00v17_360519_c1_46_720 221
773 3300050492 nmdc:mga0yw44_127290_c1 nmdc:mga0yw44_127290_c1_642_1322 221
774 3300050494 nmdc:mga06z11_501394_c1 nmdc:mga06z11_501394_c1_14_688 221
775 3300050507 nmdc:mga05p37_2378_c1 nmdc:mga05p37_2378_c1_3268_3945 221
776 3300050507 nmdc:mga05p37_553607_c1 nmdc:mga05p37_553607_c1_63_740 221
777 3300050507 nmdc:mga05p37_648709_c1 nmdc:mga05p37_648709_c1_174_851 221
778 3300050508 nmdc:mga09592_57297_c1 nmdc:mga09592_57297_c1_1844_2521 221
779 3300050508 nmdc:mga09592_73589_c1 nmdc:mga09592_73589_c1_730_1407 221
780 3300050509 nmdc:mga0qj67_149296_c1 nmdc:mga0qj67_149296_c1_828_1505 221
781 3300050509 nmdc:mga0qj67_164512_c1 nmdc:mga0qj67_164512_c1_732_1409 221
782 3300050509 nmdc:mga0qj67_249969_c1 nmdc:mga0qj67_249969_c1_133_804 221
783 3300050509 nmdc:mga0qj67_8054_c1 nmdc:mga0qj67_8054_c1_6075_6752 221
784 3300050510 nmdc:mga06r32_12359_c1 nmdc:mga06r32_12359_c1_3686_4363 221
785 3300050510 nmdc:mga06r32_26183_c1 nmdc:mga06r32_26183_c1_1592_2260 221
786 3300050511 nmdc:mga08y16_11398_c1 nmdc:mga08y16_11398_c1_6600_7268 221
787 3300050511 nmdc:mga08y16_16213_c1 nmdc:mga08y16_16213_c1_2201_2878 221
788 3300050511 nmdc:mga08y16_291606_c1 nmdc:mga08y16_291606_c1_956_1630 221
789 3300050512 nmdc:mga0n895_36727_c1 nmdc:mga0n895_36727_c1_4004_4672 221
790 3300050513 nmdc:mga0rr50_649258_c1 nmdc:mga0rr50_649258_c1_178_855 221
791 3300050513 nmdc:mga0rr50_75744_c1 nmdc:mga0rr50_75744_c1_1224_1892 221
792 3300050515 nmdc:mga0a205_38823_c1 nmdc:mga0a205_38823_c1_1765_2442 221
793 3300050515 nmdc:mga0a205_58039_c1 nmdc:mga0a205_58039_c1_1265_1933 221
794 3300053078 Ga0495612_0044279 Ga0495612_0044279_844_1545 221
795 3300053083 Ga0495655_0000002 Ga0495655_0000002_291677_292342 221
796 3300053084 Ga0495595_0009076 Ga0495595_0009076_2130_2831 221
797 3300053085 Ga0495619_0011140 Ga0495619_0011140_1615_2283 221
798 3300053085 Ga0495619_0287251 Ga0495619_0287251_187_882 221
799 3300053129 Ga0500628_000001 Ga0500628_000001_380346_381011 221
800 3300053153 Ga0500616_0000088 Ga0500616_0000088_10293_11144 221
801 3300054114 Ga0501084_0043748 Ga0501084_0043748_2140_2817 221
802 3300059426 Ga0590077_040690 Ga0590077_040690_339_1016 221
803 3300060353 Ga0501082_0039503 Ga0501082_0039503_1059_1736 221
804 3300061719 Ga0466962_0013632 Ga0466962_0013632_1008_1706 221
805 3300061719 Ga0466962_0099200 Ga0466962_0099200_137_823 221
806 3300061734 Ga0530510_0047037 Ga0530510_0047037_1120_1806 221
807 3300001979 JGI24740J21852_10009389 JGI24740J21852_100093893 222
808 3300003659 JGI25404J52841_10000671 JGI25404J52841_100006716 222
809 3300005337 Ga0070682_100076729 Ga0070682_1000767293 222
810 3300005340 Ga0070689_100397814 Ga0070689_1003978142 222
811 3300005366 Ga0070659_100000037 Ga0070659_100000037102 222
812 3300005435 Ga0070714_100046191 Ga0070714_1000461915 222
813 3300005437 Ga0070710_10000050 Ga0070710_1000005042 222
814 3300005439 Ga0070711_100014891 Ga0070711_1000148913 222
815 3300005441 Ga0070700_100194564 Ga0070700_1001945642 222
816 3300005456 Ga0070678_100039455 Ga0070678_1000394552 222
817 3300005466 Ga0070685_10184968 Ga0070685_101849682 222
818 3300005471 Ga0070698_100495889 Ga0070698_1004958892 222
819 3300005544 Ga0070686_100046138 Ga0070686_1000461382 222
820 3300005548 Ga0070665_100000135 Ga0070665_100000135116 222
821 3300005548 Ga0070665_100382029 Ga0070665_1003820292 222
822 3300005842 Ga0068858_100000142 Ga0068858_10000014264 222
823 3300005981 Ga0081538_10023738 Ga0081538_100237384 222
824 3300005983 Ga0081540_1000041 Ga0081540_100004182 222
825 3300005985 Ga0081539_10004211 Ga0081539_1000421113 222
826 3300006028 Ga0070717_10000019 Ga0070717_10000019157 222
827 3300006038 Ga0075365_10002584 Ga0075365_100025849 222
828 3300006038 Ga0075365_10005531 Ga0075365_100055319 222
829 3300006038 Ga0075365_10219697 Ga0075365_102196972 222
830 3300006048 Ga0075363_100160108 Ga0075363_1001601082 222
831 3300006051 Ga0075364_10007011 Ga0075364_100070118 222
832 3300006163 Ga0070715_10034603 Ga0070715_100346032 222
833 3300006175 Ga0070712_100013243 Ga0070712_1000132432 222
834 3300006178 Ga0075367_10084473 Ga0075367_100844733 222
835 3300006846 Ga0075430_100393300 Ga0075430_1003933002 222
836 3300006847 Ga0075431_100001949 Ga0075431_10000194913 222
837 3300006852 Ga0075433_10067739 Ga0075433_100677393 222
838 3300006871 Ga0075434_100023133 Ga0075434_1000231334 222
839 3300007076 Ga0075435_100142714 Ga0075435_1001427142 222
840 3300009094 Ga0111539_10003327 Ga0111539_100033279 222
841 3300009098 Ga0105245_10013871 Ga0105245_100138712 222
842 3300009101 Ga0105247_10000278 Ga0105247_1000027827 222
843 3300009101 Ga0105247_10265383 Ga0105247_102653832 222
844 3300009147 Ga0114129_10138603 Ga0114129_101386033 222
845 3300009147 Ga0114129_10139126 Ga0114129_101391262 222
846 3300009148 Ga0105243_10316197 Ga0105243_103161973 222
847 3300009176 Ga0105242_10000921 Ga0105242_1000092120 222
848 3300009176 Ga0105242_10175064 Ga0105242_101750642 222
849 3300009177 Ga0105248_11075962 Ga0105248_110759621 222
850 3300009545 Ga0105237_10798121 Ga0105237_107981211 222
851 3300009553 Ga0105249_10110695 Ga0105249_101106951 222
852 3300010375 Ga0105239_10027346 Ga0105239_100273463 222
853 3300013308 Ga0157375_10046031 Ga0157375_100460313 222
854 3300014968 Ga0157379_10034982 Ga0157379_100349823 222
855 3300014968 Ga0157379_10161357 Ga0157379_101613573 222
856 3300014969 Ga0157376_10065116 Ga0157376_100651163 222
857 3300025898 Ga0207692_10000022 Ga0207692_1000002227 222
858 3300025898 Ga0207692_10219666 Ga0207692_102196662 222
859 3300025900 Ga0207710_10113705 Ga0207710_101137052 222
860 3300025915 Ga0207693_10002823 Ga0207693_100028238 222
861 3300025919 Ga0207657_10017590 Ga0207657_100175904 222
862 3300025924 Ga0207694_10000063 Ga0207694_1000006326 222
863 3300025927 Ga0207687_10000073 Ga0207687_1000007329 222
864 3300025927 Ga0207687_10096766 Ga0207687_100967662 222
865 3300025929 Ga0207664_10007154 Ga0207664_100071544 222
866 3300025932 Ga0207690_10000268 Ga0207690_1000026817 222
867 3300025935 Ga0207709_10592968 Ga0207709_105929682 222
868 3300025941 Ga0207711_10727015 Ga0207711_107270151 222
869 3300025961 Ga0207712_10032585 Ga0207712_100325852 222
870 3300025986 Ga0207658_10108203 Ga0207658_101082033 222
871 3300026035 Ga0207703_10001891 Ga0207703_100018914 222
872 3300026075 Ga0207708_10219667 Ga0207708_102196672 222
873 3300026121 Ga0207683_10031350 Ga0207683_100313506 222
874 3300027907 Ga0207428_10012187 Ga0207428_100121874 222
875 3300028379 Ga0268266_10000056 Ga0268266_10000056265 222
876 3300028381 Ga0268264_10030488 Ga0268264_100304884 222
877 3300028381 Ga0268264_10409716 Ga0268264_104097162 222
878 3300028558 Ga0265326_10000032 Ga0265326_1000003212 222
879 3300028563 Ga0265319_1003766 Ga0265319_10037667 222
880 3300028573 Ga0265334_10000002 Ga0265334_1000000228 222
881 3300028666 Ga0265336_10013975 Ga0265336_100139752 222
882 3300028800 Ga0265338_10008302 Ga0265338_100083025 222
883 3300031240 Ga0265320_10029734 Ga0265320_100297343 222
884 3300032126 Ga0307415_100177561 Ga0307415_1001775612 222
885 3300037312 Ga0395899_0126418 Ga0395899_0126418_1125_1796 222
886 3300037418 Ga0395900_0010493 Ga0395900_0010493_4851_5522 222
887 3300037418 Ga0395900_0060412 Ga0395900_0060412_1042_1716 222
888 3300037466 Ga0395898_0004703 Ga0395898_0004703_13506_14177 222
889 3300037466 Ga0395898_0026202 Ga0395898_0026202_371_1045 222
890 3300037471 Ga0395905_0016135 Ga0395905_0016135_4259_4930 222
891 3300038443 Ga0395901_0013495 Ga0395901_0013495_7185_7859 222
892 3300038443 Ga0395901_0342406 Ga0395901_0342406_225_896 222
893 3300041486 Ga0451807_0784867 Ga0451807_0784867_204_872 222
894 3300044765 Ga0466970_0013041 Ga0466970_0013041_3267_3983 222
895 3300046454 Ga0495592_0265974 Ga0495592_0265974_416_1087 222
896 3300046455 Ga0495603_0037440 Ga0495603_0037440_681_1355 222
897 3300046462 Ga0495651_0114540 Ga0495651_0114540_90_761 222
898 3300046473 Ga0495582_0000001 Ga0495582_0000001_163870_164541 222
899 3300046473 Ga0495582_0221603 Ga0495582_0221603_35_709 222
900 3300046529 Ga0495652_0000037 Ga0495652_0000037_107813_108484 222
901 3300046533 Ga0495640_0017150 Ga0495640_0017150_2441_3115 222
902 3300046536 Ga0495587_0011445 Ga0495587_0011445_444_1112 222
903 3300046683 Ga0495658_0000002 Ga0495658_0000002_287476_288147 222
904 3300047319 Ga0495674_0000030 Ga0495674_0000030_108019_108693 222
905 3300047320 Ga0495672_0031867 Ga0495672_0031867_1455_2171 222
906 3300047320 Ga0495672_0122459 Ga0495672_0122459_545_1213 222
907 3300047321 Ga0495676_0201175 Ga0495676_0201175_217_891 222
908 3300047322 Ga0495680_0225701 Ga0495680_0225701_606_1274 222
909 3300047444 Ga0495675_0037207 Ga0495675_0037207_579_1247 222
910 3300048088 Ga0495602_0000007 Ga0495602_0000007_251894_252562 222
911 3300048903 Ga0496100_0165567 Ga0496100_0165567_487_1161 222
912 3300048904 Ga0496101_0048339 Ga0496101_0048339_1805_2479 222
913 3300048905 Ga0496102_0002380 Ga0496102_0002380_8736_9410 222
914 3300048905 Ga0496102_0558765 Ga0496102_0558765_271_948 222
915 3300048906 Ga0496103_0002129 Ga0496103_0002129_4148_4822 222
916 3300048906 Ga0496103_0075882 Ga0496103_0075882_1340_2014 222
917 3300048907 Ga0496104_0000015 Ga0496104_0000015_354055_354723 222
918 3300048907 Ga0496104_0018623 Ga0496104_0018623_4898_5572 222
919 3300048908 Ga0496105_0000004 Ga0496105_0000004_121076_121744 222
920 3300048908 Ga0496105_0006317 Ga0496105_0006317_5476_6147 222
921 3300048909 Ga0496106_0019325 Ga0496106_0019325_230_904 222
922 3300048910 Ga0496107_0014411 Ga0496107_0014411_688_1362 222
923 3300048911 Ga0496108_0089811 Ga0496108_0089811_1172_1846 222
924 3300048912 Ga0496109_0156371 Ga0496109_0156371_752_1426 222
925 3300048914 Ga0496111_0005951 Ga0496111_0005951_2291_2965 222
926 3300048915 Ga0496112_0208420 Ga0496112_0208420_34_708 222
927 3300048916 Ga0496113_0025783 Ga0496113_0025783_2257_2931 222
928 3300048917 Ga0496114_0088870 Ga0496114_0088870_753_1427 222
929 3300048922 Ga0496119_0019221 Ga0496119_0019221_3616_4284 222
930 3300049571 Ga0501034_0029121 Ga0501034_0029121_3704_4387 222
931 3300049592 Ga0501076_0098262 Ga0501076_0098262_981_1652 222
932 3300050491 nmdc:mga00v17_199151_c1 nmdc:mga00v17_199151_c1_546_1217 222
933 3300050492 nmdc:mga0yw44_239017_c1 nmdc:mga0yw44_239017_c1_339_1010 222
934 3300050492 nmdc:mga0yw44_7514_c1 nmdc:mga0yw44_7514_c1_2167_2838 222
935 3300050507 nmdc:mga05p37_142175_c1 nmdc:mga05p37_142175_c1_730_1401 222
936 3300050507 nmdc:mga05p37_413378_c1 nmdc:mga05p37_413378_c1_198_869 222
937 3300050509 nmdc:mga0qj67_435827_c1 nmdc:mga0qj67_435827_c1_61_732 222
938 3300050510 nmdc:mga06r32_6902_c1 nmdc:mga06r32_6902_c1_731_1402 222
939 3300050511 nmdc:mga08y16_9364_c1 nmdc:mga08y16_9364_c1_4613_5284 222
940 3300050512 nmdc:mga0n895_17599_c1 nmdc:mga0n895_17599_c1_2628_3299 222
941 3300050513 nmdc:mga0rr50_115453_c1 nmdc:mga0rr50_115453_c1_394_1098 222
942 3300050515 nmdc:mga0a205_25902_c1 nmdc:mga0a205_25902_c1_3614_4285 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

47

257

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4onc-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9588 3 217
4onc-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9575 3 219
2vg3-assembly1.cif.gz_A rv2361 with citronellyl pyrophosphate 0.9545 3 219
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9543 4 211
6w2l-assembly1.cif.gz_A crystal structure of human dehydrodolichyl diphosphate synthase (ngbr/dhdds) in complex with mg and ipp 0.9506 2 211
ID Description Score Start End Superfamily
af_Q9XJ03_13_283_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9598 2 212 3.40.1180.10
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9583 3 214 3.40.1180.10
af_Q5FC21_4_262_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9575 2 212 3.40.1180.10
af_Q99KU1_5_249_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9554 2 212 3.40.1180.10
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9552 2 213 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A7W0LNI3-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9968 4 136 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0030145
GO:0045547
AF-A0A3C0PPZ8-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.989 1 117 GO:0016094
GO:0045547
AF-A0A833D0S6-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9833 4 138 GO:0016094
GO:0045547
AF-A0A2E0GQ45-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.982 4 141 GO:0016094
GO:0045547
AF-A0A7W0N335-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9817 12 137 GO:0008834
GO:0016094
GO:0045547

Feature Viewer

pLDDT pTM Quality
91.15 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map