F486365
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 942 | 338 | 941 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1906628|Ga0436365_1906628_42_821 |
| Length | 259 |
| Sequence | MGPGAQESREGSRLARAPELETSASHSAAAAERNEDSGHGARYVAIITDGNGRWAARRKLPVLAGHEAGADVVKARLRDAVDLGILELTVYSFSTENWSRPPAEVTGLMAMMGRRIEAETPELHDEGVRMRFIGRRSDPVPPELVKRMEWAEKLTAGNNRITLFVAFNYGGRAEILDAARSFSGQTEEEFRSHLYAPEMHDPDLIIRTSGERRSSNFLLWQGHYSELVFRDELWPDFSRDVFEQSLNEFAARRRRFGGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 163 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 173 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 198 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 199 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 204 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 205 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 213 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 214 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 331 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 332 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 334 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 338 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.55 |
| Nodule | 0 |
| Rhizoplane | 9.77 |
| Rhizosphere | 83.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009389 | 3300001979 | Bacteria | 3832 |
| 2 | JGI24743J22301_10044033 | 3300001991 | Bacteria | 900 |
| 3 | JGI24750J21931_1006886 | 3300002070 | Bacteria | 1423 |
| 4 | JGI25406J46586_10003068 | 3300003203 | Bacteria | 7861 |
| 5 | JGI25407J50210_10003770 | 3300003373 | Bacteria | 3658 |
| 6 | JGI25407J50210_10005022 | 3300003373 | Bacteria | 3234 |
| 7 | JGI25407J50210_10009964 | 3300003373 | Bacteria | 2414 |
| 8 | JGI25407J50210_10011690 | 3300003373 | Bacteria | 2246 |
| 9 | JGI25407J50210_10025068 | 3300003373 | Bacteria | 1546 |
| 10 | JGI25407J50210_10025262 | 3300003373 | Bacteria | 1540 |
| 11 | JGI25404J52841_10000671 | 3300003659 | Bacteria | 5227 |
| 12 | Ga0070676_10405820 | 3300005328 | Bacteria | 949 |
| 13 | Ga0070683_100567195 | 3300005329 | Bacteria | 1086 |
| 14 | Ga0070690_100330506 | 3300005330 | Bacteria | 1101 |
| 15 | Ga0068869_100151291 | 3300005334 | Bacteria | 1800 |
| 16 | Ga0068869_100170166 | 3300005334 | Bacteria | 1702 |
| 17 | Ga0070666_10005716 | 3300005335 | Bacteria | 7632 |
| 18 | Ga0070666_10011418 | 3300005335 | Bacteria | 5573 |
| 19 | Ga0070682_100076729 | 3300005337 | Bacteria | 2152 |
| 20 | Ga0070682_100165993 | 3300005337 | Bacteria | 1530 |
| 21 | Ga0070682_100281883 | 3300005337 | Bacteria | 1212 |
| 22 | Ga0070682_100376199 | 3300005337 | Bacteria | 1067 |
| 23 | Ga0068868_100022400 | 3300005338 | Bacteria | 4767 |
| 24 | Ga0070660_100092816 | 3300005339 | Bacteria | 2383 |
| 25 | Ga0070689_100397814 | 3300005340 | Bacteria | 1164 |
| 26 | Ga0070691_10000021 | 3300005341 | Bacteria | 45268 |
| 27 | Ga0070691_10027557 | 3300005341 | Bacteria | 2652 |
| 28 | Ga0070691_10031342 | 3300005341 | Bacteria | 2493 |
| 29 | Ga0070661_100257761 | 3300005344 | Bacteria | 1347 |
| 30 | Ga0070661_100361443 | 3300005344 | Bacteria | 1141 |
| 31 | Ga0070668_100006694 | 3300005347 | Bacteria | 8541 |
| 32 | Ga0070675_100034890 | 3300005354 | Bacteria | 4084 |
| 33 | Ga0070674_100389231 | 3300005356 | Bacteria | 1136 |
| 34 | Ga0070673_100051394 | 3300005364 | Bacteria | 3228 |
| 35 | Ga0070688_100053016 | 3300005365 | Bacteria | 2536 |
| 36 | Ga0070659_100000037 | 3300005366 | Bacteria | 113379 |
| 37 | Ga0070659_100021303 | 3300005366 | Bacteria | 4934 |
| 38 | Ga0070667_100051735 | 3300005367 | Bacteria | 3463 |
| 39 | Ga0070709_10107091 | 3300005434 | Bacteria | 1873 |
| 40 | Ga0070714_100003806 | 3300005435 | Bacteria | 11332 |
| 41 | Ga0070714_100007942 | 3300005435 | Bacteria | 8267 |
| 42 | Ga0070714_100023442 | 3300005435 | Bacteria | 5071 |
| 43 | Ga0070714_100046191 | 3300005435 | Bacteria | 3693 |
| 44 | Ga0070714_100068740 | 3300005435 | Bacteria | 3057 |
| 45 | Ga0070714_100293172 | 3300005435 | Bacteria | 1514 |
| 46 | Ga0070714_100453558 | 3300005435 | Bacteria | 1218 |
| 47 | Ga0070713_100067820 | 3300005436 | Bacteria | 3005 |
| 48 | Ga0070713_100104694 | 3300005436 | Bacteria | 2457 |
| 49 | Ga0070713_100183117 | 3300005436 | Bacteria | 1883 |
| 50 | Ga0070710_10000050 | 3300005437 | Bacteria | 56781 |
| 51 | Ga0070710_10111737 | 3300005437 | Bacteria | 1642 |
| 52 | Ga0070701_10125108 | 3300005438 | Bacteria | 1454 |
| 53 | Ga0070701_10385802 | 3300005438 | Bacteria | 884 |
| 54 | Ga0070711_100006655 | 3300005439 | Bacteria | 6986 |
| 55 | Ga0070711_100014891 | 3300005439 | Bacteria | 4912 |
| 56 | Ga0070711_100094329 | 3300005439 | Bacteria | 2163 |
| 57 | Ga0070711_100580962 | 3300005439 | Bacteria | 933 |
| 58 | Ga0070700_100000722 | 3300005441 | Bacteria | 16301 |
| 59 | Ga0070700_100006275 | 3300005441 | Bacteria | 6344 |
| 60 | Ga0070700_100040032 | 3300005441 | Bacteria | 2867 |
| 61 | Ga0070700_100194564 | 3300005441 | Bacteria | 1420 |
| 62 | Ga0070700_100350925 | 3300005441 | Bacteria | 1094 |
| 63 | Ga0070663_100095415 | 3300005455 | Bacteria | 2210 |
| 64 | Ga0070663_100387279 | 3300005455 | Bacteria | 1140 |
| 65 | Ga0070678_100039455 | 3300005456 | Bacteria | 3332 |
| 66 | Ga0070662_100417141 | 3300005457 | Bacteria | 1110 |
| 67 | Ga0068867_100188880 | 3300005459 | Bacteria | 1643 |
| 68 | Ga0068867_100808717 | 3300005459 | Bacteria | 836 |
| 69 | Ga0070685_10045942 | 3300005466 | Bacteria | 2506 |
| 70 | Ga0070685_10184968 | 3300005466 | Bacteria | 1344 |
| 71 | Ga0070698_100495889 | 3300005471 | Bacteria | 1159 |
| 72 | Ga0070679_100290078 | 3300005530 | Bacteria | 1588 |
| 73 | Ga0070684_100035669 | 3300005535 | Bacteria | 4258 |
| 74 | Ga0070684_100215866 | 3300005535 | Bacteria | 1749 |
| 75 | Ga0070684_100220518 | 3300005535 | Bacteria | 1730 |
| 76 | Ga0070684_100230599 | 3300005535 | Bacteria | 1691 |
| 77 | Ga0070684_100237483 | 3300005535 | Bacteria | 1665 |
| 78 | Ga0070686_100046138 | 3300005544 | Bacteria | 2748 |
| 79 | Ga0070686_100242452 | 3300005544 | Bacteria | 1313 |
| 80 | Ga0070695_100285073 | 3300005545 | Bacteria | 1215 |
| 81 | Ga0070696_100618212 | 3300005546 | Bacteria | 875 |
| 82 | Ga0070665_100000135 | 3300005548 | Bacteria | 138925 |
| 83 | Ga0070665_100064521 | 3300005548 | Bacteria | 3673 |
| 84 | Ga0070665_100119286 | 3300005548 | Bacteria | 2640 |
| 85 | Ga0070665_100303345 | 3300005548 | Bacteria | 1600 |
| 86 | Ga0070665_100303852 | 3300005548 | Bacteria | 1598 |
| 87 | Ga0070665_100382029 | 3300005548 | Bacteria | 1416 |
| 88 | Ga0070704_100101431 | 3300005549 | Bacteria | 2170 |
| 89 | Ga0070664_100017246 | 3300005564 | Bacteria | 5930 |
| 90 | Ga0070664_100052502 | 3300005564 | Bacteria | 3453 |
| 91 | Ga0070664_100344981 | 3300005564 | Bacteria | 1353 |
| 92 | Ga0068857_100112689 | 3300005577 | Bacteria | 2445 |
| 93 | Ga0068857_100642147 | 3300005577 | Bacteria | 1005 |
| 94 | Ga0068854_100219200 | 3300005578 | Bacteria | 1504 |
| 95 | Ga0068856_100002016 | 3300005614 | Bacteria | 21154 |
| 96 | Ga0068856_100037628 | 3300005614 | Bacteria | 4748 |
| 97 | Ga0070702_100118460 | 3300005615 | Bacteria | 1654 |
| 98 | Ga0070702_100360052 | 3300005615 | Bacteria | 1028 |
| 99 | Ga0068852_100166209 | 3300005616 | Bacteria | 2064 |
| 100 | Ga0068852_100583926 | 3300005616 | Bacteria | 1120 |
| 101 | Ga0068864_100002096 | 3300005618 | Bacteria | 16473 |
| 102 | Ga0068866_10031078 | 3300005718 | Bacteria | 2569 |
| 103 | Ga0068861_100001186 | 3300005719 | Bacteria | 16201 |
| 104 | Ga0068861_100088248 | 3300005719 | Bacteria | 2442 |
| 105 | Ga0068861_100104384 | 3300005719 | Bacteria | 2261 |
| 106 | Ga0068870_10058400 | 3300005840 | Bacteria | 2065 |
| 107 | Ga0068870_10171090 | 3300005840 | Bacteria | 1296 |
| 108 | Ga0068858_100000142 | 3300005842 | Bacteria | 75787 |
| 109 | Ga0068862_100178662 | 3300005844 | Bacteria | 1904 |
| 110 | Ga0068862_100360966 | 3300005844 | Bacteria | 1350 |
| 111 | Ga0068862_100672124 | 3300005844 | Bacteria | 1001 |
| 112 | Ga0081455_10017510 | 3300005937 | Bacteria | 6865 |
| 113 | Ga0081455_10019598 | 3300005937 | Bacteria | 6392 |
| 114 | Ga0081455_10022152 | 3300005937 | Bacteria | 5945 |
| 115 | Ga0081455_10025337 | 3300005937 | Bacteria | 5477 |
| 116 | Ga0081455_10057346 | 3300005937 | Bacteria | 3301 |
| 117 | Ga0081455_10063879 | 3300005937 | Bacteria | 3087 |
| 118 | Ga0081455_10101142 | 3300005937 | Bacteria | 2314 |
| 119 | Ga0081455_10142289 | 3300005937 | Bacteria | 1861 |
| 120 | Ga0081538_10000044 | 3300005981 | Bacteria | 115394 |
| 121 | Ga0081538_10000087 | 3300005981 | Bacteria | 88954 |
| 122 | Ga0081538_10000190 | 3300005981 | Bacteria | 67602 |
| 123 | Ga0081538_10000766 | 3300005981 | Bacteria | 35083 |
| 124 | Ga0081538_10002073 | 3300005981 | Bacteria | 19976 |
| 125 | Ga0081538_10002222 | 3300005981 | Bacteria | 19234 |
| 126 | Ga0081538_10004723 | 3300005981 | Bacteria | 12476 |
| 127 | Ga0081538_10005950 | 3300005981 | Bacteria | 10856 |
| 128 | Ga0081538_10007981 | 3300005981 | Bacteria | 9057 |
| 129 | Ga0081538_10013472 | 3300005981 | Bacteria | 6468 |
| 130 | Ga0081538_10014713 | 3300005981 | Bacteria | 6106 |
| 131 | Ga0081538_10015512 | 3300005981 | Bacteria | 5891 |
| 132 | Ga0081538_10017123 | 3300005981 | Bacteria | 5517 |
| 133 | Ga0081538_10017143 | 3300005981 | Bacteria | 5510 |
| 134 | Ga0081538_10017511 | 3300005981 | Bacteria | 5434 |
| 135 | Ga0081538_10023738 | 3300005981 | Bacteria | 4398 |
| 136 | Ga0081538_10026605 | 3300005981 | Bacteria | 4041 |
| 137 | Ga0081538_10094492 | 3300005981 | Bacteria | 1530 |
| 138 | Ga0081540_1000041 | 3300005983 | Bacteria | 136874 |
| 139 | Ga0081540_1001363 | 3300005983 | Bacteria | 21184 |
| 140 | Ga0081539_10002877 | 3300005985 | Bacteria | 22840 |
| 141 | Ga0081539_10004211 | 3300005985 | Bacteria | 16224 |
| 142 | Ga0081539_10038945 | 3300005985 | Bacteria | 2811 |
| 143 | Ga0070717_10000019 | 3300006028 | Bacteria | 178051 |
| 144 | Ga0070717_10007024 | 3300006028 | Bacteria | 8333 |
| 145 | Ga0070717_10008551 | 3300006028 | Bacteria | 7645 |
| 146 | Ga0075365_10002584 | 3300006038 | Bacteria | 8953 |
| 147 | Ga0075365_10005531 | 3300006038 | Bacteria | 6826 |
| 148 | Ga0075365_10042925 | 3300006038 | Bacteria | 2958 |
| 149 | Ga0075365_10136942 | 3300006038 | Bacteria | 1698 |
| 150 | Ga0075365_10219697 | 3300006038 | Bacteria | 1333 |
| 151 | Ga0075363_100029908 | 3300006048 | Bacteria | 2815 |
| 152 | Ga0075363_100062948 | 3300006048 | Bacteria | 2001 |
| 153 | Ga0075363_100160108 | 3300006048 | Bacteria | 1274 |
| 154 | Ga0075364_10007011 | 3300006051 | Bacteria | 6658 |
| 155 | Ga0075364_10508173 | 3300006051 | Bacteria | 824 |
| 156 | Ga0075432_10004604 | 3300006058 | Bacteria | 4694 |
| 157 | Ga0075432_10026857 | 3300006058 | Bacteria | 1979 |
| 158 | Ga0075432_10128566 | 3300006058 | Bacteria | 958 |
| 159 | Ga0070715_10034603 | 3300006163 | Bacteria | 2072 |
| 160 | Ga0070712_100000004 | 3300006175 | Bacteria | 215464 |
| 161 | Ga0070712_100002009 | 3300006175 | Bacteria | 12454 |
| 162 | Ga0070712_100009269 | 3300006175 | Bacteria | 6200 |
| 163 | Ga0070712_100013243 | 3300006175 | Bacteria | 5265 |
| 164 | Ga0070712_100851994 | 3300006175 | Bacteria | 784 |
| 165 | Ga0075367_10084473 | 3300006178 | Bacteria | 1925 |
| 166 | Ga0075428_100046559 | 3300006844 | Bacteria | 4764 |
| 167 | Ga0075428_100066684 | 3300006844 | Bacteria | 3941 |
| 168 | Ga0075430_100000277 | 3300006846 | Bacteria | 35951 |
| 169 | Ga0075430_100021746 | 3300006846 | Bacteria | 5452 |
| 170 | Ga0075430_100022807 | 3300006846 | Bacteria | 5323 |
| 171 | Ga0075430_100051964 | 3300006846 | Bacteria | 3451 |
| 172 | Ga0075430_100186547 | 3300006846 | Bacteria | 1724 |
| 173 | Ga0075430_100393300 | 3300006846 | Bacteria | 1144 |
| 174 | Ga0075431_100001949 | 3300006847 | Bacteria | 19692 |
| 175 | Ga0075431_100032339 | 3300006847 | Bacteria | 5391 |
| 176 | Ga0075431_100207840 | 3300006847 | Bacteria | 2001 |
| 177 | Ga0075431_100387477 | 3300006847 | Bacteria | 1400 |
| 178 | Ga0075431_100542830 | 3300006847 | Bacteria | 1150 |
| 179 | Ga0075431_100639750 | 3300006847 | Bacteria | 1045 |
| 180 | Ga0075433_10056171 | 3300006852 | Bacteria | 3438 |
| 181 | Ga0075433_10067739 | 3300006852 | Bacteria | 3133 |
| 182 | Ga0075433_10081739 | 3300006852 | Bacteria | 2849 |
| 183 | Ga0075434_100023133 | 3300006871 | Bacteria | 6053 |
| 184 | Ga0075429_100005448 | 3300006880 | Bacteria | 10962 |
| 185 | Ga0075429_100022506 | 3300006880 | Bacteria | 5464 |
| 186 | Ga0075429_100109912 | 3300006880 | Bacteria | 2410 |
| 187 | Ga0075429_100473889 | 3300006880 | Bacteria | 1097 |
| 188 | Ga0075429_100865911 | 3300006880 | Bacteria | 791 |
| 189 | Ga0075436_100020658 | 3300006914 | Bacteria | 4518 |
| 190 | Ga0075435_100065745 | 3300007076 | Bacteria | 2949 |
| 191 | Ga0075435_100142714 | 3300007076 | Bacteria | 2010 |
| 192 | Ga0111539_10003327 | 3300009094 | Bacteria | 21229 |
| 193 | Ga0111539_10044281 | 3300009094 | Bacteria | 5333 |
| 194 | Ga0111539_10057713 | 3300009094 | Bacteria | 4609 |
| 195 | Ga0111539_10069723 | 3300009094 | Bacteria | 4151 |
| 196 | Ga0111539_10082912 | 3300009094 | Bacteria | 3771 |
| 197 | Ga0111539_10330969 | 3300009094 | Bacteria | 1773 |
| 198 | Ga0111539_10448568 | 3300009094 | Bacteria | 1502 |
| 199 | Ga0111539_10713428 | 3300009094 | Bacteria | 1167 |
| 200 | Ga0105245_10006545 | 3300009098 | Bacteria | 10227 |
| 201 | Ga0105245_10012887 | 3300009098 | Bacteria | 7288 |
| 202 | Ga0105245_10013871 | 3300009098 | Bacteria | 7021 |
| 203 | Ga0105245_10035529 | 3300009098 | Bacteria | 4423 |
| 204 | Ga0105247_10000278 | 3300009101 | Bacteria | 47180 |
| 205 | Ga0105247_10265383 | 3300009101 | Bacteria | 1179 |
| 206 | Ga0105247_10551186 | 3300009101 | Bacteria | 848 |
| 207 | Ga0114129_10055555 | 3300009147 | Bacteria | 5548 |
| 208 | Ga0114129_10070350 | 3300009147 | Bacteria | 4879 |
| 209 | Ga0114129_10138603 | 3300009147 | Bacteria | 3337 |
| 210 | Ga0114129_10139126 | 3300009147 | Bacteria | 3329 |
| 211 | Ga0114129_10148059 | 3300009147 | Bacteria | 3215 |
| 212 | Ga0114129_10232254 | 3300009147 | Bacteria | 2484 |
| 213 | Ga0114129_10508850 | 3300009147 | Bacteria | 1572 |
| 214 | Ga0114129_10547039 | 3300009147 | Bacteria | 1506 |
| 215 | Ga0114129_10782757 | 3300009147 | Bacteria | 1219 |
| 216 | Ga0114129_11581042 | 3300009147 | Bacteria | 803 |
| 217 | Ga0105243_10271201 | 3300009148 | Bacteria | 1524 |
| 218 | Ga0105243_10316197 | 3300009148 | Bacteria | 1421 |
| 219 | Ga0105243_11039491 | 3300009148 | Bacteria | 824 |
| 220 | Ga0105242_10000533 | 3300009176 | Bacteria | 30003 |
| 221 | Ga0105242_10000921 | 3300009176 | Bacteria | 22877 |
| 222 | Ga0105242_10034928 | 3300009176 | Bacteria | 4031 |
| 223 | Ga0105242_10175064 | 3300009176 | Bacteria | 1888 |
| 224 | Ga0105248_10074184 | 3300009177 | Bacteria | 3824 |
| 225 | Ga0105248_11075962 | 3300009177 | Bacteria | 909 |
| 226 | Ga0105237_10000501 | 3300009545 | Bacteria | 55515 |
| 227 | Ga0105237_10798121 | 3300009545 | Bacteria | 951 |
| 228 | Ga0105238_10000055 | 3300009551 | Bacteria | 139232 |
| 229 | Ga0105249_10062901 | 3300009553 | Bacteria | 3408 |
| 230 | Ga0105249_10110695 | 3300009553 | Bacteria | 2596 |
| 231 | Ga0105249_10192817 | 3300009553 | Bacteria | 1990 |
| 232 | Ga0105239_10027346 | 3300010375 | Bacteria | 6279 |
| 233 | Ga0105239_10063989 | 3300010375 | Bacteria | 4038 |
| 234 | Ga0105239_10114635 | 3300010375 | Bacteria | 2989 |
| 235 | Ga0105239_10141763 | 3300010375 | Bacteria | 2679 |
| 236 | Ga0105239_10424499 | 3300010375 | Bacteria | 1506 |
| 237 | Ga0105239_10453533 | 3300010375 | Bacteria | 1455 |
| 238 | Ga0105246_10011340 | 3300011119 | Bacteria | 5532 |
| 239 | Ga0157318_1002707 | 3300012482 | Bacteria | 984 |
| 240 | Ga0157371_10205703 | 3300013102 | Bacteria | 1412 |
| 241 | Ga0157374_10007744 | 3300013296 | Bacteria | 9170 |
| 242 | Ga0157374_10134876 | 3300013296 | Bacteria | 2392 |
| 243 | Ga0163162_10047822 | 3300013306 | Bacteria | 4286 |
| 244 | Ga0163162_10345740 | 3300013306 | Bacteria | 1620 |
| 245 | Ga0163162_11086915 | 3300013306 | Bacteria | 906 |
| 246 | Ga0157372_10094032 | 3300013307 | Bacteria | 3412 |
| 247 | Ga0157372_10622725 | 3300013307 | Bacteria | 1257 |
| 248 | Ga0157372_10894288 | 3300013307 | Bacteria | 1030 |
| 249 | Ga0157375_10046031 | 3300013308 | Bacteria | 4250 |
| 250 | Ga0157375_10054962 | 3300013308 | Bacteria | 3923 |
| 251 | Ga0157375_10299622 | 3300013308 | Bacteria | 1771 |
| 252 | Ga0163163_10045286 | 3300014325 | Bacteria | 4318 |
| 253 | Ga0163163_10362079 | 3300014325 | Bacteria | 1507 |
| 254 | Ga0163163_10486483 | 3300014325 | Bacteria | 1295 |
| 255 | Ga0157380_10073581 | 3300014326 | Bacteria | 2771 |
| 256 | Ga0157377_10000686 | 3300014745 | Bacteria | 13991 |
| 257 | Ga0157379_10034982 | 3300014968 | Bacteria | 4478 |
| 258 | Ga0157379_10161357 | 3300014968 | Bacteria | 2023 |
| 259 | Ga0157379_10316085 | 3300014968 | Bacteria | 1425 |
| 260 | Ga0157379_10676433 | 3300014968 | Bacteria | 968 |
| 261 | Ga0157376_10065116 | 3300014969 | Bacteria | 3076 |
| 262 | Ga0163161_10084272 | 3300017792 | Bacteria | 2344 |
| 263 | Ga0163161_10569661 | 3300017792 | Bacteria | 930 |
| 264 | Ga0163161_10670557 | 3300017792 | Bacteria | 861 |
| 265 | Ga0213876_10010277 | 3300021384 | Bacteria | 5026 |
| 266 | Ga0213876_10014726 | 3300021384 | Bacteria | 4143 |
| 267 | Ga0213876_10077889 | 3300021384 | Bacteria | 1751 |
| 268 | Ga0213875_10006762 | 3300021388 | Bacteria | 5991 |
| 269 | Ga0213875_10007406 | 3300021388 | Bacteria | 5669 |
| 270 | Ga0213875_10083266 | 3300021388 | Bacteria | 1493 |
| 271 | Ga0207656_10035268 | 3300025321 | Bacteria | 2094 |
| 272 | Ga0207692_10000022 | 3300025898 | Bacteria | 56680 |
| 273 | Ga0207692_10047202 | 3300025898 | Bacteria | 2162 |
| 274 | Ga0207692_10219666 | 3300025898 | Bacteria | 1126 |
| 275 | Ga0207710_10113705 | 3300025900 | Bacteria | 1287 |
| 276 | Ga0207710_10189747 | 3300025900 | Bacteria | 1011 |
| 277 | Ga0207688_10002774 | 3300025901 | Bacteria | 9496 |
| 278 | Ga0207680_10002798 | 3300025903 | Bacteria | 8163 |
| 279 | Ga0207680_10015344 | 3300025903 | Bacteria | 3997 |
| 280 | Ga0207645_10276852 | 3300025907 | Bacteria | 1114 |
| 281 | Ga0207643_10022822 | 3300025908 | Bacteria | 3448 |
| 282 | Ga0207643_10108518 | 3300025908 | Bacteria | 1633 |
| 283 | Ga0207695_10488057 | 3300025913 | Bacteria | 1114 |
| 284 | Ga0207671_10002754 | 3300025914 | Bacteria | 18355 |
| 285 | Ga0207693_10000017 | 3300025915 | Bacteria | 139308 |
| 286 | Ga0207693_10000973 | 3300025915 | Bacteria | 25767 |
| 287 | Ga0207693_10002823 | 3300025915 | Bacteria | 15054 |
| 288 | Ga0207693_10021101 | 3300025915 | Bacteria | 5177 |
| 289 | Ga0207693_10344077 | 3300025915 | Bacteria | 1167 |
| 290 | Ga0207693_10470163 | 3300025915 | Bacteria | 982 |
| 291 | Ga0207663_10037118 | 3300025916 | Bacteria | 2936 |
| 292 | Ga0207663_10090650 | 3300025916 | Bacteria | 2027 |
| 293 | Ga0207662_10476135 | 3300025918 | Bacteria | 857 |
| 294 | Ga0207657_10017590 | 3300025919 | Bacteria | 6848 |
| 295 | Ga0207657_10142644 | 3300025919 | Bacteria | 1956 |
| 296 | Ga0207657_10286804 | 3300025919 | Bacteria | 1306 |
| 297 | Ga0207649_10126888 | 3300025920 | Bacteria | 1728 |
| 298 | Ga0207652_10421988 | 3300025921 | Bacteria | 1203 |
| 299 | Ga0207652_10760531 | 3300025921 | Bacteria | 862 |
| 300 | Ga0207681_10029892 | 3300025923 | Bacteria | 3547 |
| 301 | Ga0207681_10284200 | 3300025923 | Bacteria | 1304 |
| 302 | Ga0207681_10356059 | 3300025923 | Bacteria | 1173 |
| 303 | Ga0207694_10000063 | 3300025924 | Bacteria | 139700 |
| 304 | Ga0207694_10619936 | 3300025924 | Bacteria | 910 |
| 305 | Ga0207650_10519999 | 3300025925 | Bacteria | 996 |
| 306 | Ga0207659_10230975 | 3300025926 | Bacteria | 1492 |
| 307 | Ga0207687_10000073 | 3300025927 | Bacteria | 73917 |
| 308 | Ga0207687_10011907 | 3300025927 | Bacteria | 5688 |
| 309 | Ga0207687_10096766 | 3300025927 | Bacteria | 2164 |
| 310 | Ga0207687_10209394 | 3300025927 | Bacteria | 1529 |
| 311 | Ga0207687_10325597 | 3300025927 | Bacteria | 1245 |
| 312 | Ga0207700_10013143 | 3300025928 | Bacteria | 5374 |
| 313 | Ga0207700_10029400 | 3300025928 | Bacteria | 3877 |
| 314 | Ga0207700_10105953 | 3300025928 | Bacteria | 2253 |
| 315 | Ga0207664_10000004 | 3300025929 | Bacteria | 493014 |
| 316 | Ga0207664_10005280 | 3300025929 | Bacteria | 8827 |
| 317 | Ga0207664_10005496 | 3300025929 | Bacteria | 8664 |
| 318 | Ga0207664_10007154 | 3300025929 | Bacteria | 7737 |
| 319 | Ga0207664_10022205 | 3300025929 | Bacteria | 4735 |
| 320 | Ga0207664_10164987 | 3300025929 | Bacteria | 1892 |
| 321 | Ga0207664_10232263 | 3300025929 | Bacteria | 1604 |
| 322 | Ga0207644_10090148 | 3300025931 | Bacteria | 2284 |
| 323 | Ga0207690_10000268 | 3300025932 | Bacteria | 37289 |
| 324 | Ga0207690_10135083 | 3300025932 | Bacteria | 1810 |
| 325 | Ga0207706_10001334 | 3300025933 | Bacteria | 24700 |
| 326 | Ga0207706_10233332 | 3300025933 | Bacteria | 1609 |
| 327 | Ga0207706_10284140 | 3300025933 | Bacteria | 1443 |
| 328 | Ga0207686_10000073 | 3300025934 | Bacteria | 92009 |
| 329 | Ga0207686_10723543 | 3300025934 | Bacteria | 793 |
| 330 | Ga0207709_10592968 | 3300025935 | Bacteria | 876 |
| 331 | Ga0207704_10641004 | 3300025938 | Bacteria | 874 |
| 332 | Ga0207691_10093164 | 3300025940 | Bacteria | 2698 |
| 333 | Ga0207711_10157448 | 3300025941 | Bacteria | 2054 |
| 334 | Ga0207711_10727015 | 3300025941 | Bacteria | 926 |
| 335 | Ga0207661_10021334 | 3300025944 | Bacteria | 4851 |
| 336 | Ga0207661_10286777 | 3300025944 | Bacteria | 1473 |
| 337 | Ga0207661_10508505 | 3300025944 | Bacteria | 1101 |
| 338 | Ga0207679_10052464 | 3300025945 | Bacteria | 2991 |
| 339 | Ga0207679_10163399 | 3300025945 | Bacteria | 1825 |
| 340 | Ga0207651_10069787 | 3300025960 | Bacteria | 2483 |
| 341 | Ga0207712_10005003 | 3300025961 | Bacteria | 8382 |
| 342 | Ga0207712_10032585 | 3300025961 | Bacteria | 3518 |
| 343 | Ga0207712_10649700 | 3300025961 | Bacteria | 917 |
| 344 | Ga0207668_10021186 | 3300025972 | Bacteria | 4142 |
| 345 | Ga0207668_10129981 | 3300025972 | Bacteria | 1922 |
| 346 | Ga0207640_10073844 | 3300025981 | Bacteria | 2306 |
| 347 | Ga0207640_10101422 | 3300025981 | Bacteria | 2019 |
| 348 | Ga0207658_10108203 | 3300025986 | Bacteria | 2192 |
| 349 | Ga0207658_10241123 | 3300025986 | Bacteria | 1531 |
| 350 | Ga0207677_10066450 | 3300026023 | Bacteria | 2521 |
| 351 | Ga0207703_10001891 | 3300026035 | Bacteria | 18577 |
| 352 | Ga0207678_10112433 | 3300026067 | Bacteria | 2323 |
| 353 | Ga0207678_10129748 | 3300026067 | Bacteria | 2150 |
| 354 | Ga0207678_10135654 | 3300026067 | Bacteria | 2100 |
| 355 | Ga0207678_10198656 | 3300026067 | Bacteria | 1714 |
| 356 | Ga0207678_10344390 | 3300026067 | Bacteria | 1285 |
| 357 | Ga0207678_10430007 | 3300026067 | Bacteria | 1145 |
| 358 | Ga0207708_10052367 | 3300026075 | Bacteria | 3109 |
| 359 | Ga0207708_10060083 | 3300026075 | Bacteria | 2901 |
| 360 | Ga0207708_10060637 | 3300026075 | Bacteria | 2887 |
| 361 | Ga0207708_10147959 | 3300026075 | Bacteria | 1847 |
| 362 | Ga0207708_10219667 | 3300026075 | Bacteria | 1522 |
| 363 | Ga0207708_10286282 | 3300026075 | Bacteria | 1337 |
| 364 | Ga0207708_10740332 | 3300026075 | Bacteria | 843 |
| 365 | Ga0207702_10008203 | 3300026078 | Bacteria | 8828 |
| 366 | Ga0207641_10016945 | 3300026088 | Bacteria | 5965 |
| 367 | Ga0207648_10054278 | 3300026089 | Bacteria | 3501 |
| 368 | Ga0207648_10745061 | 3300026089 | Bacteria | 910 |
| 369 | Ga0207676_10085785 | 3300026095 | Bacteria | 2570 |
| 370 | Ga0207676_10217403 | 3300026095 | Bacteria | 1700 |
| 371 | Ga0207674_10134802 | 3300026116 | Bacteria | 2431 |
| 372 | Ga0207674_10159528 | 3300026116 | Bacteria | 2210 |
| 373 | Ga0207674_10220211 | 3300026116 | Bacteria | 1846 |
| 374 | Ga0207674_10671788 | 3300026116 | Bacteria | 1000 |
| 375 | Ga0207675_100000719 | 3300026118 | Bacteria | 32781 |
| 376 | Ga0207675_100092563 | 3300026118 | Bacteria | 2843 |
| 377 | Ga0207675_100201565 | 3300026118 | Bacteria | 1911 |
| 378 | Ga0207675_100303029 | 3300026118 | Bacteria | 1557 |
| 379 | Ga0207675_100466088 | 3300026118 | Bacteria | 1254 |
| 380 | Ga0207675_100721385 | 3300026118 | Bacteria | 1007 |
| 381 | Ga0207675_101176981 | 3300026118 | Bacteria | 787 |
| 382 | Ga0207683_10031350 | 3300026121 | Bacteria | 4613 |
| 383 | Ga0207683_10051363 | 3300026121 | Bacteria | 3612 |
| 384 | Ga0207428_10012187 | 3300027907 | Bacteria | 7562 |
| 385 | Ga0207428_10036725 | 3300027907 | Bacteria | 3993 |
| 386 | Ga0207428_10185293 | 3300027907 | Bacteria | 1571 |
| 387 | Ga0207428_10384330 | 3300027907 | Bacteria | 1029 |
| 388 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 389 | Ga0268266_10000264 | 3300028379 | Bacteria | 88067 |
| 390 | Ga0268266_10057759 | 3300028379 | Bacteria | 3339 |
| 391 | Ga0268266_10092201 | 3300028379 | Bacteria | 2658 |
| 392 | Ga0268265_10267271 | 3300028380 | Bacteria | 1524 |
| 393 | Ga0268264_10030488 | 3300028381 | Bacteria | 4420 |
| 394 | Ga0268264_10409716 | 3300028381 | Bacteria | 1305 |
| 395 | Ga0268264_10412576 | 3300028381 | Bacteria | 1301 |
| 396 | Ga0268264_10917993 | 3300028381 | Bacteria | 879 |
| 397 | Ga0265326_10000032 | 3300028558 | Bacteria | 94371 |
| 398 | Ga0265319_1003395 | 3300028563 | Bacteria | 8328 |
| 399 | Ga0265319_1003766 | 3300028563 | Bacteria | 7778 |
| 400 | Ga0265334_10000002 | 3300028573 | Bacteria | 325014 |
| 401 | Ga0265336_10013975 | 3300028666 | Bacteria | 2668 |
| 402 | Ga0265338_10008302 | 3300028800 | Bacteria | 12636 |
| 403 | Ga0265338_10495582 | 3300028800 | Bacteria | 860 |
| 404 | Ga0265320_10001697 | 3300031240 | Bacteria | 15654 |
| 405 | Ga0265320_10023535 | 3300031240 | Bacteria | 3277 |
| 406 | Ga0265320_10029734 | 3300031240 | Bacteria | 2825 |
| 407 | Ga0307408_100034402 | 3300031548 | Bacteria | 3550 |
| 408 | Ga0307408_100055586 | 3300031548 | Bacteria | 2867 |
| 409 | Ga0307408_100188629 | 3300031548 | Bacteria | 1659 |
| 410 | Ga0307408_100265352 | 3300031548 | Bacteria | 1423 |
| 411 | Ga0316576_10001238 | 3300031727 | Bacteria | 13509 |
| 412 | Ga0316578_10374019 | 3300031728 | Bacteria | 846 |
| 413 | Ga0307405_10019925 | 3300031731 | Bacteria | 3737 |
| 414 | Ga0307413_10013637 | 3300031824 | Bacteria | 4094 |
| 415 | Ga0307413_10023035 | 3300031824 | Bacteria | 3369 |
| 416 | Ga0307413_10410981 | 3300031824 | Bacteria | 1063 |
| 417 | Ga0307413_10533113 | 3300031824 | Bacteria | 949 |
| 418 | Ga0307410_10105222 | 3300031852 | Bacteria | 2031 |
| 419 | Ga0307410_10181587 | 3300031852 | Bacteria | 1593 |
| 420 | Ga0307406_10006019 | 3300031901 | Bacteria | 6662 |
| 421 | Ga0307406_10400162 | 3300031901 | Bacteria | 1088 |
| 422 | Ga0307407_10030557 | 3300031903 | Bacteria | 2907 |
| 423 | Ga0307407_10079745 | 3300031903 | Bacteria | 1976 |
| 424 | Ga0307407_10299372 | 3300031903 | Bacteria | 1121 |
| 425 | Ga0307407_10667528 | 3300031903 | Bacteria | 780 |
| 426 | Ga0307407_10673968 | 3300031903 | Bacteria | 777 |
| 427 | Ga0307412_10249233 | 3300031911 | Bacteria | 1378 |
| 428 | Ga0307409_100014219 | 3300031995 | Bacteria | 5164 |
| 429 | Ga0307409_100035350 | 3300031995 | Bacteria | 3661 |
| 430 | Ga0307409_100038646 | 3300031995 | Bacteria | 3532 |
| 431 | Ga0307409_100167739 | 3300031995 | Bacteria | 1929 |
| 432 | Ga0307409_100201451 | 3300031995 | Bacteria | 1781 |
| 433 | Ga0307409_100354368 | 3300031995 | Bacteria | 1386 |
| 434 | Ga0307409_100413403 | 3300031995 | Bacteria | 1292 |
| 435 | Ga0307409_100425361 | 3300031995 | Bacteria | 1275 |
| 436 | Ga0307409_100499365 | 3300031995 | Bacteria | 1184 |
| 437 | Ga0307409_100610253 | 3300031995 | Bacteria | 1079 |
| 438 | Ga0307409_100785936 | 3300031995 | Bacteria | 958 |
| 439 | Ga0307409_101143867 | 3300031995 | Bacteria | 800 |
| 440 | Ga0307416_100037603 | 3300032002 | Bacteria | 3726 |
| 441 | Ga0307416_100042807 | 3300032002 | Bacteria | 3539 |
| 442 | Ga0307416_100050194 | 3300032002 | Bacteria | 3324 |
| 443 | Ga0307416_100264861 | 3300032002 | Bacteria | 1683 |
| 444 | Ga0307416_100531346 | 3300032002 | Bacteria | 1246 |
| 445 | Ga0307416_100661098 | 3300032002 | Bacteria | 1131 |
| 446 | Ga0307414_10666834 | 3300032004 | Bacteria | 939 |
| 447 | Ga0307411_10360638 | 3300032005 | Bacteria | 1188 |
| 448 | Ga0307411_10968294 | 3300032005 | Bacteria | 760 |
| 449 | Ga0307415_100005350 | 3300032126 | Bacteria | 6802 |
| 450 | Ga0307415_100011024 | 3300032126 | Bacteria | 5150 |
| 451 | Ga0307415_100041656 | 3300032126 | Bacteria | 3051 |
| 452 | Ga0307415_100140600 | 3300032126 | Bacteria | 1843 |
| 453 | Ga0307415_100177561 | 3300032126 | Bacteria | 1667 |
| 454 | Ga0307415_100853468 | 3300032126 | Bacteria | 836 |
| 455 | Ga0373929_0033373 | 3300035085 | Bacteria | 1112 |
| 456 | Ga0373923_0177436 | 3300035111 | Bacteria | 978 |
| 457 | Ga0373954_0041938 | 3300035118 | Bacteria | 2134 |
| 458 | Ga0373960_0062442 | 3300035121 | Bacteria | 1133 |
| 459 | Ga0373955_0101654 | 3300035172 | Bacteria | 1651 |
| 460 | Ga0373961_0009850 | 3300035241 | Bacteria | 2343 |
| 461 | Ga0373962_0033523 | 3300035242 | Bacteria | 1418 |
| 462 | Ga0316574_0016972 | 3300035398 | Bacteria | 4251 |
| 463 | Ga0316574_0021673 | 3300035398 | Bacteria | 3818 |
| 464 | Ga0316574_0037326 | 3300035398 | Bacteria | 2979 |
| 465 | Ga0316574_0104882 | 3300035398 | Bacteria | 1810 |
| 466 | Ga0373924_0168182 | 3300035410 | Bacteria | 963 |
| 467 | Ga0373935_0176201 | 3300035692 | Bacteria | 1466 |
| 468 | Ga0373933_0050068 | 3300035724 | Bacteria | 2492 |
| 469 | Ga0373947_0209587 | 3300035725 | Bacteria | 1278 |
| 470 | Ga0373937_0034194 | 3300036401 | Bacteria | 4623 |
| 471 | Ga0373937_0052600 | 3300036401 | Bacteria | 3734 |
| 472 | Ga0316584_0002636 | 3300036712 | Bacteria | 11443 |
| 473 | Ga0395899_0126418 | 3300037312 | Bacteria | 1828 |
| 474 | Ga0395900_0010493 | 3300037418 | Bacteria | 9475 |
| 475 | Ga0395900_0016044 | 3300037418 | Bacteria | 7633 |
| 476 | Ga0395900_0060412 | 3300037418 | Bacteria | 3901 |
| 477 | Ga0395900_0133810 | 3300037418 | Bacteria | 2540 |
| 478 | Ga0395900_0187258 | 3300037418 | Bacteria | 2101 |
| 479 | Ga0395900_0401844 | 3300037418 | Bacteria | 1334 |
| 480 | Ga0395900_0457055 | 3300037418 | Bacteria | 1232 |
| 481 | Ga0395898_0004574 | 3300037466 | Bacteria | 15099 |
| 482 | Ga0395898_0004703 | 3300037466 | Bacteria | 14857 |
| 483 | Ga0395898_0026202 | 3300037466 | Bacteria | 5869 |
| 484 | Ga0395898_0068180 | 3300037466 | Bacteria | 3443 |
| 485 | Ga0395898_0198994 | 3300037466 | Bacteria | 1913 |
| 486 | Ga0395898_0244242 | 3300037466 | Bacteria | 1712 |
| 487 | Ga0395898_0479092 | 3300037466 | Bacteria | 1184 |
| 488 | Ga0395898_0536649 | 3300037466 | Bacteria | 1112 |
| 489 | Ga0395898_0585597 | 3300037466 | Bacteria | 1058 |
| 490 | Ga0395898_1065946 | 3300037466 | Bacteria | 742 |
| 491 | Ga0395905_0016135 | 3300037471 | Bacteria | 7100 |
| 492 | Ga0395905_0334614 | 3300037471 | Bacteria | 1405 |
| 493 | Ga0395905_0919456 | 3300037471 | Bacteria | 778 |
| 494 | Ga0436364_0010487 | 3300037853 | Bacteria | 3387 |
| 495 | Ga0436364_0394694 | 3300037853 | Bacteria | 1893 |
| 496 | Ga0436364_0542331 | 3300037853 | Bacteria | 3929 |
| 497 | Ga0436364_0786946 | 3300037853 | Bacteria | 1140 |
| 498 | Ga0436364_0927298 | 3300037853 | Bacteria | 5532 |
| 499 | Ga0436364_1261370 | 3300037853 | Bacteria | 2644 |
| 500 | Ga0395901_0013495 | 3300038443 | Bacteria | 8307 |
| 501 | Ga0395901_0070334 | 3300038443 | Bacteria | 3646 |
| 502 | Ga0395901_0078362 | 3300038443 | Bacteria | 3450 |
| 503 | Ga0395901_0149840 | 3300038443 | Bacteria | 2452 |
| 504 | Ga0395901_0246245 | 3300038443 | Bacteria | 1863 |
| 505 | Ga0395901_0257186 | 3300038443 | Bacteria | 1818 |
| 506 | Ga0395901_0265010 | 3300038443 | Bacteria | 1788 |
| 507 | Ga0395901_0280010 | 3300038443 | Bacteria | 1733 |
| 508 | Ga0395901_0342406 | 3300038443 | Bacteria | 1544 |
| 509 | Ga0395901_0668412 | 3300038443 | Bacteria | 1040 |
| 510 | Ga0436365_0193968 | 3300039437 | Bacteria | 16322 |
| 511 | Ga0436365_0571253 | 3300039437 | Bacteria | 1439 |
| 512 | Ga0436365_0571801 | 3300039437 | Bacteria | 6578 |
| 513 | Ga0436365_0656153 | 3300039437 | Bacteria | 6772 |
| 514 | Ga0436365_1161323 | 3300039437 | Bacteria | 19038 |
| 515 | Ga0436365_1365717 | 3300039437 | Bacteria | 8436 |
| 516 | Ga0436365_1793812 | 3300039437 | Bacteria | 7318 |
| 517 | Ga0436365_1906628 | 3300039437 | Bacteria | 963 |
| 518 | Ga0436363_0160959 | 3300039450 | Bacteria | 1270 |
| 519 | Ga0436363_0206518 | 3300039450 | Bacteria | 2900 |
| 520 | Ga0436363_0229649 | 3300039450 | Bacteria | 1582 |
| 521 | Ga0436363_1290946 | 3300039450 | Bacteria | 1802 |
| 522 | Ga0436363_1301125 | 3300039450 | Bacteria | 33245 |
| 523 | Ga0436363_1313806 | 3300039450 | Bacteria | 8226 |
| 524 | Ga0436362_0272703 | 3300039453 | Bacteria | 2333 |
| 525 | Ga0436362_0807641 | 3300039453 | Bacteria | 2333 |
| 526 | Ga0439465_0102177 | 3300041413 | Bacteria | 991 |
| 527 | Ga0451797_0396879 | 3300041453 | Bacteria | 1243 |
| 528 | Ga0451807_0784867 | 3300041486 | Bacteria | 885 |
| 529 | Ga0451833_1082468 | 3300041491 | Bacteria | 873 |
| 530 | Ga0451833_1482837 | 3300041491 | Bacteria | 1024 |
| 531 | Ga0451853_2330744 | 3300041512 | Bacteria | 1227 |
| 532 | Ga0439454_022580 | 3300042011 | Bacteria | 939 |
| 533 | Ga0439444_0004979 | 3300042437 | Bacteria | 1954 |
| 534 | Ga0439440_0016519 | 3300042993 | Bacteria | 1617 |
| 535 | Ga0466969_0022883 | 3300044656 | Bacteria | 3222 |
| 536 | Ga0466969_0110191 | 3300044656 | Bacteria | 1289 |
| 537 | Ga0466972_0098090 | 3300044658 | Bacteria | 1388 |
| 538 | Ga0466972_0119909 | 3300044658 | Bacteria | 1241 |
| 539 | Ga0466965_0111393 | 3300044683 | Bacteria | 1407 |
| 540 | Ga0466966_0075633 | 3300044684 | Bacteria | 2104 |
| 541 | Ga0466966_0177510 | 3300044684 | Bacteria | 1293 |
| 542 | Ga0466966_0184555 | 3300044684 | Bacteria | 1265 |
| 543 | Ga0466966_0230503 | 3300044684 | Bacteria | 1117 |
| 544 | Ga0466966_0505268 | 3300044684 | Bacteria | 727 |
| 545 | Ga0466961_0012908 | 3300044693 | Bacteria | 5344 |
| 546 | Ga0466961_0104361 | 3300044693 | Bacteria | 1785 |
| 547 | Ga0466961_0146831 | 3300044693 | Bacteria | 1474 |
| 548 | Ga0466961_0198627 | 3300044693 | Bacteria | 1241 |
| 549 | Ga0466963_0003469 | 3300044694 | Bacteria | 9041 |
| 550 | Ga0466963_0014498 | 3300044694 | Bacteria | 4861 |
| 551 | Ga0466963_0020293 | 3300044694 | Bacteria | 4178 |
| 552 | Ga0466963_0022549 | 3300044694 | Bacteria | 3988 |
| 553 | Ga0466963_0030215 | 3300044694 | Bacteria | 3494 |
| 554 | Ga0466963_0032565 | 3300044694 | Bacteria | 3377 |
| 555 | Ga0466963_0060313 | 3300044694 | Bacteria | 2533 |
| 556 | Ga0466963_0087079 | 3300044694 | Bacteria | 2123 |
| 557 | Ga0466963_0197286 | 3300044694 | Bacteria | 1407 |
| 558 | Ga0466963_0366336 | 3300044694 | Bacteria | 1015 |
| 559 | Ga0466963_0375387 | 3300044694 | Bacteria | 1002 |
| 560 | Ga0466963_0579692 | 3300044694 | Bacteria | 792 |
| 561 | Ga0466964_0064537 | 3300044706 | Bacteria | 1532 |
| 562 | Ga0466964_0146428 | 3300044706 | Bacteria | 1091 |
| 563 | Ga0466964_0209659 | 3300044706 | Bacteria | 940 |
| 564 | Ga0466971_0058920 | 3300044719 | Bacteria | 1734 |
| 565 | Ga0466971_0104322 | 3300044719 | Bacteria | 1305 |
| 566 | Ga0466971_0141714 | 3300044719 | Bacteria | 1119 |
| 567 | Ga0466971_0252611 | 3300044719 | Bacteria | 840 |
| 568 | Ga0466971_0281711 | 3300044719 | Bacteria | 796 |
| 569 | Ga0466968_0013257 | 3300044735 | Bacteria | 3240 |
| 570 | Ga0466968_0060447 | 3300044735 | Bacteria | 1634 |
| 571 | Ga0466968_0103062 | 3300044735 | Bacteria | 1276 |
| 572 | Ga0466968_0270902 | 3300044735 | Bacteria | 810 |
| 573 | Ga0466970_0013041 | 3300044765 | Bacteria | 4259 |
| 574 | Ga0466970_0055418 | 3300044765 | Bacteria | 2117 |
| 575 | Ga0466970_0163892 | 3300044765 | Bacteria | 1230 |
| 576 | Ga0466970_0266779 | 3300044765 | Bacteria | 961 |
| 577 | Ga0466957_0003722 | 3300044842 | Bacteria | 8429 |
| 578 | Ga0466957_0042699 | 3300044842 | Bacteria | 2744 |
| 579 | Ga0466957_0055689 | 3300044842 | Bacteria | 2417 |
| 580 | Ga0466957_0061850 | 3300044842 | Bacteria | 2299 |
| 581 | Ga0466960_0023962 | 3300044901 | Bacteria | 2748 |
| 582 | Ga0466960_0039569 | 3300044901 | Bacteria | 2225 |
| 583 | Ga0466960_0088201 | 3300044901 | Bacteria | 1576 |
| 584 | Ga0466960_0158178 | 3300044901 | Bacteria | 1215 |
| 585 | Ga0466960_0295115 | 3300044901 | Bacteria | 912 |
| 586 | Ga0466960_0323748 | 3300044901 | Bacteria | 874 |
| 587 | Ga0466960_0368959 | 3300044901 | Bacteria | 822 |
| 588 | Ga0466959_0007415 | 3300045049 | Bacteria | 7696 |
| 589 | Ga0466959_0011169 | 3300045049 | Bacteria | 6445 |
| 590 | Ga0466959_0020966 | 3300045049 | Bacteria | 4818 |
| 591 | Ga0466959_0031020 | 3300045049 | Bacteria | 3957 |
| 592 | Ga0466959_0051987 | 3300045049 | Bacteria | 3002 |
| 593 | Ga0466959_0072220 | 3300045049 | Bacteria | 2498 |
| 594 | Ga0466959_0118339 | 3300045049 | Bacteria | 1886 |
| 595 | Ga0466959_0180294 | 3300045049 | Bacteria | 1478 |
| 596 | Ga0466959_0251156 | 3300045049 | Bacteria | 1220 |
| 597 | Ga0466959_0309568 | 3300045049 | Bacteria | 1081 |
| 598 | Ga0466959_0419855 | 3300045049 | Bacteria | 908 |
| 599 | Ga0466958_0008325 | 3300045836 | Bacteria | 5746 |
| 600 | Ga0466958_0011172 | 3300045836 | Bacteria | 5051 |
| 601 | Ga0466958_0013642 | 3300045836 | Bacteria | 4631 |
| 602 | Ga0466958_0017342 | 3300045836 | Bacteria | 4160 |
| 603 | Ga0466958_0055073 | 3300045836 | Bacteria | 2413 |
| 604 | Ga0466958_0080476 | 3300045836 | Bacteria | 2004 |
| 605 | Ga0466958_0080554 | 3300045836 | Bacteria | 2003 |
| 606 | Ga0466958_0196257 | 3300045836 | Bacteria | 1284 |
| 607 | Ga0466958_0227943 | 3300045836 | Bacteria | 1189 |
| 608 | Ga0466958_0383485 | 3300045836 | Bacteria | 906 |
| 609 | Ga0466967_0001274 | 3300045976 | Bacteria | 14307 |
| 610 | Ga0466967_0011910 | 3300045976 | Bacteria | 6622 |
| 611 | Ga0466967_0058077 | 3300045976 | Bacteria | 3418 |
| 612 | Ga0466967_0064220 | 3300045976 | Bacteria | 3264 |
| 613 | Ga0466967_0069363 | 3300045976 | Bacteria | 3150 |
| 614 | Ga0466967_0085871 | 3300045976 | Bacteria | 2850 |
| 615 | Ga0466967_0098664 | 3300045976 | Bacteria | 2667 |
| 616 | Ga0466967_0130035 | 3300045976 | Bacteria | 2336 |
| 617 | Ga0466967_0314873 | 3300045976 | Bacteria | 1508 |
| 618 | Ga0466967_0571585 | 3300045976 | Bacteria | 1114 |
| 619 | Ga0466967_0592735 | 3300045976 | Bacteria | 1093 |
| 620 | Ga0466967_0596816 | 3300045976 | Bacteria | 1090 |
| 621 | Ga0466967_0662548 | 3300045976 | Bacteria | 1032 |
| 622 | Ga0466967_0719894 | 3300045976 | Bacteria | 989 |
| 623 | Ga0466967_0781103 | 3300045976 | Bacteria | 948 |
| 624 | Ga0466967_0833666 | 3300045976 | Bacteria | 916 |
| 625 | Ga0466967_1060849 | 3300045976 | Bacteria | 807 |
| 626 | Ga0495592_0021079 | 3300046454 | Bacteria | 4956 |
| 627 | Ga0495592_0120494 | 3300046454 | Bacteria | 1846 |
| 628 | Ga0495592_0265974 | 3300046454 | Bacteria | 1127 |
| 629 | Ga0495603_0037440 | 3300046455 | Bacteria | 2911 |
| 630 | Ga0495629_0001073 | 3300046459 | Bacteria | 21818 |
| 631 | Ga0495629_0079024 | 3300046459 | Bacteria | 2297 |
| 632 | Ga0495638_0013333 | 3300046460 | Bacteria | 5601 |
| 633 | Ga0495651_0002099 | 3300046462 | Bacteria | 15381 |
| 634 | Ga0495651_0114540 | 3300046462 | Bacteria | 1989 |
| 635 | Ga0495653_0045652 | 3300046463 | Bacteria | 3396 |
| 636 | Ga0495653_0321453 | 3300046463 | Bacteria | 1003 |
| 637 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 638 | Ga0495582_0221603 | 3300046473 | Bacteria | 1082 |
| 639 | Ga0495605_0094860 | 3300046474 | Bacteria | 1378 |
| 640 | Ga0495584_0089302 | 3300046491 | Bacteria | 1554 |
| 641 | Ga0495596_0080359 | 3300046500 | Bacteria | 1266 |
| 642 | Ga0495608_0008068 | 3300046511 | Bacteria | 7402 |
| 643 | Ga0495608_0309947 | 3300046511 | Bacteria | 976 |
| 644 | Ga0495618_0101668 | 3300046514 | Bacteria | 1840 |
| 645 | Ga0495620_0062548 | 3300046515 | Bacteria | 1546 |
| 646 | Ga0495620_0087738 | 3300046515 | Bacteria | 1251 |
| 647 | Ga0495630_0068252 | 3300046517 | Bacteria | 2673 |
| 648 | Ga0495630_0212702 | 3300046517 | Bacteria | 1476 |
| 649 | Ga0495631_0068989 | 3300046518 | Bacteria | 1529 |
| 650 | Ga0495632_0257852 | 3300046519 | Bacteria | 781 |
| 651 | Ga0495652_0000037 | 3300046529 | Bacteria | 133232 |
| 652 | Ga0495652_0149471 | 3300046529 | Bacteria | 1827 |
| 653 | Ga0495652_0183137 | 3300046529 | Bacteria | 1605 |
| 654 | Ga0495640_0017150 | 3300046533 | Bacteria | 5404 |
| 655 | Ga0495640_0064308 | 3300046533 | Bacteria | 2481 |
| 656 | Ga0495586_0339232 | 3300046535 | Bacteria | 863 |
| 657 | Ga0495587_0011445 | 3300046536 | Bacteria | 5622 |
| 658 | Ga0495609_0078974 | 3300046538 | Bacteria | 1440 |
| 659 | Ga0495667_0001823 | 3300046559 | Bacteria | 14140 |
| 660 | Ga0495656_0429945 | 3300046615 | Bacteria | 694 |
| 661 | Ga0495668_0114374 | 3300046616 | Bacteria | 1476 |
| 662 | Ga0495634_0022081 | 3300046642 | Bacteria | 4487 |
| 663 | Ga0495635_0048723 | 3300046663 | Bacteria | 2920 |
| 664 | Ga0495635_0558260 | 3300046663 | Bacteria | 750 |
| 665 | Ga0495657_0005941 | 3300046675 | Bacteria | 9590 |
| 666 | Ga0495599_0096771 | 3300046678 | Bacteria | 1840 |
| 667 | Ga0495599_0282846 | 3300046678 | Bacteria | 1004 |
| 668 | Ga0495623_0018239 | 3300046679 | Bacteria | 4532 |
| 669 | Ga0495646_0026711 | 3300046680 | Bacteria | 3624 |
| 670 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 671 | Ga0495589_0070961 | 3300046794 | Bacteria | 1703 |
| 672 | Ga0495600_0006420 | 3300046809 | Bacteria | 7158 |
| 673 | Ga0495600_0117833 | 3300046809 | Bacteria | 1728 |
| 674 | Ga0495604_0015258 | 3300047317 | Bacteria | 6133 |
| 675 | Ga0495604_0193820 | 3300047317 | Bacteria | 1414 |
| 676 | Ga0495674_0000030 | 3300047319 | Bacteria | 115975 |
| 677 | Ga0495674_0004844 | 3300047319 | Bacteria | 12946 |
| 678 | Ga0495672_0031867 | 3300047320 | Bacteria | 3287 |
| 679 | Ga0495672_0122459 | 3300047320 | Bacteria | 1380 |
| 680 | Ga0495672_0159078 | 3300047320 | Bacteria | 1163 |
| 681 | Ga0495672_0164190 | 3300047320 | Bacteria | 1139 |
| 682 | Ga0495676_0201175 | 3300047321 | Bacteria | 1384 |
| 683 | Ga0495680_0001510 | 3300047322 | Bacteria | 24912 |
| 684 | Ga0495680_0101687 | 3300047322 | Bacteria | 2141 |
| 685 | Ga0495680_0225701 | 3300047322 | Bacteria | 1335 |
| 686 | Ga0495675_0037207 | 3300047444 | Bacteria | 3099 |
| 687 | Ga0495675_0046462 | 3300047444 | Bacteria | 2764 |
| 688 | Ga0495677_0075084 | 3300047445 | Bacteria | 1263 |
| 689 | Ga0495684_0002969 | 3300047471 | Bacteria | 13357 |
| 690 | Ga0495684_0016341 | 3300047471 | Bacteria | 5714 |
| 691 | Ga0495684_0421340 | 3300047471 | Bacteria | 933 |
| 692 | Ga0495686_0072632 | 3300047472 | Bacteria | 2115 |
| 693 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 694 | Ga0495602_0011043 | 3300048088 | Bacteria | 9354 |
| 695 | Ga0496100_0036599 | 3300048903 | Bacteria | 3097 |
| 696 | Ga0496100_0042526 | 3300048903 | Bacteria | 2902 |
| 697 | Ga0496100_0165567 | 3300048903 | Bacteria | 1588 |
| 698 | Ga0496101_0028976 | 3300048904 | Bacteria | 3870 |
| 699 | Ga0496101_0048339 | 3300048904 | Bacteria | 3057 |
| 700 | Ga0496101_0053587 | 3300048904 | Bacteria | 2911 |
| 701 | Ga0496101_0403788 | 3300048904 | Bacteria | 1076 |
| 702 | Ga0496102_0000522 | 3300048905 | Bacteria | 41862 |
| 703 | Ga0496102_0002380 | 3300048905 | Bacteria | 16044 |
| 704 | Ga0496102_0007419 | 3300048905 | Bacteria | 9365 |
| 705 | Ga0496102_0054230 | 3300048905 | Bacteria | 3655 |
| 706 | Ga0496102_0180737 | 3300048905 | Bacteria | 1987 |
| 707 | Ga0496102_0558765 | 3300048905 | Bacteria | 1067 |
| 708 | Ga0496103_0000174 | 3300048906 | Bacteria | 67124 |
| 709 | Ga0496103_0002129 | 3300048906 | Bacteria | 12604 |
| 710 | Ga0496103_0075882 | 3300048906 | Bacteria | 2109 |
| 711 | Ga0496103_0101195 | 3300048906 | Bacteria | 1824 |
| 712 | Ga0496103_0176714 | 3300048906 | Bacteria | 1372 |
| 713 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 714 | Ga0496104_0007864 | 3300048907 | Bacteria | 9452 |
| 715 | Ga0496104_0008408 | 3300048907 | Bacteria | 9175 |
| 716 | Ga0496104_0018623 | 3300048907 | Bacteria | 6337 |
| 717 | Ga0496104_0030618 | 3300048907 | Bacteria | 5001 |
| 718 | Ga0496104_0618363 | 3300048907 | Bacteria | 993 |
| 719 | Ga0496104_0934405 | 3300048907 | Bacteria | 772 |
| 720 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 721 | Ga0496105_0006317 | 3300048908 | Bacteria | 9103 |
| 722 | Ga0496105_0040907 | 3300048908 | Bacteria | 3821 |
| 723 | Ga0496105_0046802 | 3300048908 | Bacteria | 3570 |
| 724 | Ga0496105_0069644 | 3300048908 | Bacteria | 2907 |
| 725 | Ga0496106_0006210 | 3300048909 | Bacteria | 8839 |
| 726 | Ga0496106_0019325 | 3300048909 | Bacteria | 5051 |
| 727 | Ga0496106_0023216 | 3300048909 | Bacteria | 4608 |
| 728 | Ga0496106_0190145 | 3300048909 | Bacteria | 1632 |
| 729 | Ga0496106_0594156 | 3300048909 | Bacteria | 887 |
| 730 | Ga0496106_0602108 | 3300048909 | Bacteria | 880 |
| 731 | Ga0496107_0003285 | 3300048910 | Bacteria | 10791 |
| 732 | Ga0496107_0014411 | 3300048910 | Bacteria | 5535 |
| 733 | Ga0496107_0098184 | 3300048910 | Bacteria | 2145 |
| 734 | Ga0496107_0105683 | 3300048910 | Bacteria | 2067 |
| 735 | Ga0496108_0006421 | 3300048911 | Bacteria | 9533 |
| 736 | Ga0496108_0089811 | 3300048911 | Bacteria | 2611 |
| 737 | Ga0496108_0177968 | 3300048911 | Bacteria | 1842 |
| 738 | Ga0496108_0288915 | 3300048911 | Bacteria | 1428 |
| 739 | Ga0496108_0470868 | 3300048911 | Bacteria | 1098 |
| 740 | Ga0496108_0911966 | 3300048911 | Bacteria | 754 |
| 741 | Ga0496109_0000552 | 3300048912 | Bacteria | 31654 |
| 742 | Ga0496109_0018048 | 3300048912 | Bacteria | 6194 |
| 743 | Ga0496109_0022852 | 3300048912 | Bacteria | 5542 |
| 744 | Ga0496109_0037440 | 3300048912 | Bacteria | 4382 |
| 745 | Ga0496109_0156371 | 3300048912 | Bacteria | 2135 |
| 746 | Ga0496109_0384564 | 3300048912 | Bacteria | 1326 |
| 747 | Ga0496109_0526413 | 3300048912 | Bacteria | 1116 |
| 748 | Ga0496110_0101325 | 3300048913 | Bacteria | 2581 |
| 749 | Ga0496110_0154488 | 3300048913 | Bacteria | 2079 |
| 750 | Ga0496110_0496227 | 3300048913 | Bacteria | 1112 |
| 751 | Ga0496110_0585472 | 3300048913 | Bacteria | 1013 |
| 752 | Ga0496111_0005951 | 3300048914 | Bacteria | 7868 |
| 753 | Ga0496111_0051797 | 3300048914 | Bacteria | 2964 |
| 754 | Ga0496111_0065395 | 3300048914 | Bacteria | 2639 |
| 755 | Ga0496111_0088313 | 3300048914 | Bacteria | 2270 |
| 756 | Ga0496111_0126076 | 3300048914 | Bacteria | 1893 |
| 757 | Ga0496111_0242957 | 3300048914 | Bacteria | 1337 |
| 758 | Ga0496112_0000200 | 3300048915 | Bacteria | 39289 |
| 759 | Ga0496112_0001981 | 3300048915 | Bacteria | 16186 |
| 760 | Ga0496112_0008935 | 3300048915 | Bacteria | 8995 |
| 761 | Ga0496112_0031970 | 3300048915 | Bacteria | 5108 |
| 762 | Ga0496112_0065627 | 3300048915 | Bacteria | 3582 |
| 763 | Ga0496112_0070152 | 3300048915 | Bacteria | 3463 |
| 764 | Ga0496112_0140296 | 3300048915 | Bacteria | 2386 |
| 765 | Ga0496112_0208420 | 3300048915 | Bacteria | 1912 |
| 766 | Ga0496112_0447125 | 3300048915 | Bacteria | 1230 |
| 767 | Ga0496112_0657959 | 3300048915 | Bacteria | 977 |
| 768 | Ga0496112_0864291 | 3300048915 | Bacteria | 827 |
| 769 | Ga0496113_0000234 | 3300048916 | Bacteria | 26164 |
| 770 | Ga0496113_0001428 | 3300048916 | Bacteria | 13264 |
| 771 | Ga0496113_0025783 | 3300048916 | Bacteria | 4195 |
| 772 | Ga0496113_0043838 | 3300048916 | Bacteria | 3312 |
| 773 | Ga0496113_0114179 | 3300048916 | Bacteria | 2106 |
| 774 | Ga0496113_0166290 | 3300048916 | Bacteria | 1745 |
| 775 | Ga0496113_0186135 | 3300048916 | Bacteria | 1647 |
| 776 | Ga0496113_0296630 | 3300048916 | Bacteria | 1294 |
| 777 | Ga0496114_0000039 | 3300048917 | Bacteria | 138486 |
| 778 | Ga0496114_0056238 | 3300048917 | Bacteria | 3283 |
| 779 | Ga0496114_0088870 | 3300048917 | Bacteria | 2621 |
| 780 | Ga0496114_0382847 | 3300048917 | Bacteria | 1245 |
| 781 | Ga0496114_0482149 | 3300048917 | Bacteria | 1097 |
| 782 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 783 | Ga0496115_0004161 | 3300048918 | Bacteria | 10448 |
| 784 | Ga0496119_0019221 | 3300048922 | Bacteria | 5045 |
| 785 | Ga0496119_0027970 | 3300048922 | Bacteria | 3861 |
| 786 | Ga0496121_0019533 | 3300048924 | Bacteria | 6767 |
| 787 | Ga0496124_0067218 | 3300048927 | Bacteria | 2983 |
| 788 | Ga0496124_0549330 | 3300048927 | Bacteria | 763 |
| 789 | Ga0496125_0096039 | 3300048928 | Bacteria | 2202 |
| 790 | Ga0496126_0068535 | 3300048929 | Bacteria | 3167 |
| 791 | Ga0501031_0025826 | 3300049568 | Bacteria | 3832 |
| 792 | Ga0501031_0054056 | 3300049568 | Bacteria | 2617 |
| 793 | Ga0501031_0162857 | 3300049568 | Bacteria | 1458 |
| 794 | Ga0501031_0215797 | 3300049568 | Bacteria | 1250 |
| 795 | Ga0501032_0166642 | 3300049569 | Bacteria | 1446 |
| 796 | Ga0501033_0029197 | 3300049570 | Bacteria | 4144 |
| 797 | Ga0501033_0428248 | 3300049570 | Bacteria | 921 |
| 798 | Ga0501034_0003187 | 3300049571 | Bacteria | 18874 |
| 799 | Ga0501034_0029121 | 3300049571 | Bacteria | 5614 |
| 800 | Ga0501034_0126926 | 3300049571 | Bacteria | 2536 |
| 801 | Ga0501034_0240468 | 3300049571 | Bacteria | 1757 |
| 802 | Ga0501034_0731497 | 3300049571 | Bacteria | 886 |
| 803 | Ga0501036_0062531 | 3300049572 | Bacteria | 3153 |
| 804 | Ga0501036_0213665 | 3300049572 | Bacteria | 1620 |
| 805 | Ga0501036_0516517 | 3300049572 | Bacteria | 993 |
| 806 | Ga0501038_0272233 | 3300049574 | Bacteria | 1335 |
| 807 | Ga0501039_0006140 | 3300049575 | Bacteria | 9120 |
| 808 | Ga0501039_0009459 | 3300049575 | Bacteria | 7430 |
| 809 | Ga0501039_0186510 | 3300049575 | Bacteria | 1631 |
| 810 | Ga0501039_0194688 | 3300049575 | Bacteria | 1594 |
| 811 | Ga0501039_0214824 | 3300049575 | Bacteria | 1512 |
| 812 | Ga0501041_0024569 | 3300049577 | Bacteria | 3618 |
| 813 | Ga0501042_0081992 | 3300049578 | Bacteria | 2312 |
| 814 | Ga0501042_0325411 | 3300049578 | Bacteria | 1111 |
| 815 | Ga0501042_0441600 | 3300049578 | Bacteria | 943 |
| 816 | Ga0501042_0468577 | 3300049578 | Bacteria | 914 |
| 817 | Ga0501042_0543539 | 3300049578 | Bacteria | 844 |
| 818 | Ga0501043_0310418 | 3300049579 | Bacteria | 1204 |
| 819 | Ga0501046_0073043 | 3300049580 | Bacteria | 2662 |
| 820 | Ga0501047_0057719 | 3300049581 | Bacteria | 3753 |
| 821 | Ga0501047_0162580 | 3300049581 | Bacteria | 2104 |
| 822 | Ga0501047_0297894 | 3300049581 | Bacteria | 1455 |
| 823 | Ga0501047_0499719 | 3300049581 | Bacteria | 1043 |
| 824 | Ga0501048_0006014 | 3300049582 | Bacteria | 9241 |
| 825 | Ga0501048_0055272 | 3300049582 | Bacteria | 2818 |
| 826 | Ga0501048_0350180 | 3300049582 | Bacteria | 1053 |
| 827 | Ga0501067_0028935 | 3300049583 | Bacteria | 3071 |
| 828 | Ga0501070_0026130 | 3300049586 | Bacteria | 4899 |
| 829 | Ga0501070_0261996 | 3300049586 | Bacteria | 1413 |
| 830 | Ga0501071_0061744 | 3300049587 | Bacteria | 2714 |
| 831 | Ga0501071_0168097 | 3300049587 | Bacteria | 1641 |
| 832 | Ga0501071_0179004 | 3300049587 | Bacteria | 1588 |
| 833 | Ga0501071_0460484 | 3300049587 | Bacteria | 974 |
| 834 | Ga0501072_0048610 | 3300049588 | Bacteria | 3341 |
| 835 | Ga0501072_0065940 | 3300049588 | Bacteria | 2856 |
| 836 | Ga0501072_0110400 | 3300049588 | Bacteria | 2189 |
| 837 | Ga0501072_0185227 | 3300049588 | Bacteria | 1661 |
| 838 | Ga0501073_0034340 | 3300049589 | Bacteria | 3610 |
| 839 | Ga0501073_0184547 | 3300049589 | Bacteria | 1444 |
| 840 | Ga0501074_0006507 | 3300049590 | Bacteria | 8437 |
| 841 | Ga0501074_0145653 | 3300049590 | Bacteria | 1694 |
| 842 | Ga0501074_0290348 | 3300049590 | Bacteria | 1162 |
| 843 | Ga0501075_0102721 | 3300049591 | Bacteria | 2171 |
| 844 | Ga0501075_0307525 | 3300049591 | Bacteria | 1208 |
| 845 | Ga0501076_0098262 | 3300049592 | Bacteria | 2358 |
| 846 | Ga0501076_0171516 | 3300049592 | Bacteria | 1768 |
| 847 | Ga0501076_0335675 | 3300049592 | Bacteria | 1240 |
| 848 | Ga0501077_0117919 | 3300049593 | Bacteria | 1682 |
| 849 | Ga0501079_0130747 | 3300049741 | Bacteria | 1954 |
| 850 | Ga0501079_0760195 | 3300049741 | Bacteria | 763 |
| 851 | Ga0501080_0101344 | 3300049742 | Bacteria | 2671 |
| 852 | Ga0501081_0133135 | 3300049743 | Bacteria | 1777 |
| 853 | Ga0501083_0005694 | 3300049744 | Bacteria | 8818 |
| 854 | Ga0501035_0050285 | 3300049822 | Bacteria | 3735 |
| 855 | Ga0501035_0077921 | 3300049822 | Bacteria | 2929 |
| 856 | Ga0501035_0290187 | 3300049822 | Bacteria | 1381 |
| 857 | Ga0501044_0041349 | 3300049823 | Bacteria | 4798 |
| 858 | Ga0501044_0089806 | 3300049823 | Bacteria | 3100 |
| 859 | Ga0501044_0418209 | 3300049823 | Bacteria | 1251 |
| 860 | Ga0501045_0022507 | 3300049824 | Bacteria | 4514 |
| 861 | Ga0501045_0035637 | 3300049824 | Bacteria | 3613 |
| 862 | Ga0501045_0049890 | 3300049824 | Bacteria | 3053 |
| 863 | Ga0501045_0085352 | 3300049824 | Bacteria | 2330 |
| 864 | Ga0501045_0387375 | 3300049824 | Bacteria | 1040 |
| 865 | Ga0501045_0554879 | 3300049824 | Bacteria | 852 |
| 866 | nmdc:mga00v17_199151_c1 | 3300050491 | Bacteria | 1294 |
| 867 | nmdc:mga00v17_360519_c1 | 3300050491 | Bacteria | 945 |
| 868 | nmdc:mga00v17_37737_c1 | 3300050491 | Bacteria | 2886 |
| 869 | nmdc:mga0yw44_122958_c1 | 3300050492 | Bacteria | 1673 |
| 870 | nmdc:mga0yw44_127290_c1 | 3300050492 | Bacteria | 1646 |
| 871 | nmdc:mga0yw44_239017_c1 | 3300050492 | Bacteria | 1207 |
| 872 | nmdc:mga0yw44_7514_c1 | 3300050492 | Bacteria | 5368 |
| 873 | nmdc:mga06z11_501394_c1 | 3300050494 | Bacteria | 735 |
| 874 | nmdc:mga05p37_142175_c1 | 3300050507 | Bacteria | 2939 |
| 875 | nmdc:mga05p37_150003_c1 | 3300050507 | Bacteria | 2852 |
| 876 | nmdc:mga05p37_2378_c1 | 3300050507 | Bacteria | 21906 |
| 877 | nmdc:mga05p37_250211_c1 | 3300050507 | Bacteria | 2126 |
| 878 | nmdc:mga05p37_413378_c1 | 3300050507 | Bacteria | 1572 |
| 879 | nmdc:mga05p37_553607_c1 | 3300050507 | Bacteria | 1309 |
| 880 | nmdc:mga05p37_648709_c1 | 3300050507 | Bacteria | 1182 |
| 881 | nmdc:mga05p37_86326_c1 | 3300050507 | Bacteria | 3867 |
| 882 | nmdc:mga09592_100817_c1 | 3300050508 | Bacteria | 1346 |
| 883 | nmdc:mga09592_57297_c1 | 3300050508 | Bacteria | 3293 |
| 884 | nmdc:mga09592_73589_c1 | 3300050508 | Bacteria | 2903 |
| 885 | nmdc:mga0qj67_149296_c1 | 3300050509 | Bacteria | 1896 |
| 886 | nmdc:mga0qj67_164512_c1 | 3300050509 | Bacteria | 1801 |
| 887 | nmdc:mga0qj67_249969_c1 | 3300050509 | Bacteria | 1439 |
| 888 | nmdc:mga0qj67_396170_c1 | 3300050509 | Bacteria | 1114 |
| 889 | nmdc:mga0qj67_435827_c1 | 3300050509 | Bacteria | 1056 |
| 890 | nmdc:mga0qj67_4977_c1 | 3300050509 | Bacteria | 9656 |
| 891 | nmdc:mga0qj67_8054_c1 | 3300050509 | Bacteria | 7800 |
| 892 | nmdc:mga06r32_12359_c1 | 3300050510 | Bacteria | 7700 |
| 893 | nmdc:mga06r32_26183_c1 | 3300050510 | Bacteria | 5435 |
| 894 | nmdc:mga06r32_6902_c1 | 3300050510 | Bacteria | 10208 |
| 895 | nmdc:mga08y16_11398_c1 | 3300050511 | Bacteria | 9341 |
| 896 | nmdc:mga08y16_16213_c1 | 3300050511 | Bacteria | 7834 |
| 897 | nmdc:mga08y16_212705_c1 | 3300050511 | Bacteria | 2002 |
| 898 | nmdc:mga08y16_222279_c1 | 3300050511 | Bacteria | 1955 |
| 899 | nmdc:mga08y16_291606_c1 | 3300050511 | Bacteria | 1682 |
| 900 | nmdc:mga08y16_829191_c1 | 3300050511 | Bacteria | 916 |
| 901 | nmdc:mga08y16_84912_c1 | 3300050511 | Bacteria | 3299 |
| 902 | nmdc:mga08y16_9364_c1 | 3300050511 | Bacteria | 10272 |
| 903 | nmdc:mga0n895_17599_c1 | 3300050512 | Bacteria | 6592 |
| 904 | nmdc:mga0n895_276630_c1 | 3300050512 | Bacteria | 1702 |
| 905 | nmdc:mga0n895_36727_c1 | 3300050512 | Bacteria | 4733 |
| 906 | nmdc:mga0rr50_115453_c1 | 3300050513 | Bacteria | 2130 |
| 907 | nmdc:mga0rr50_649258_c1 | 3300050513 | Bacteria | 900 |
| 908 | nmdc:mga0rr50_75744_c1 | 3300050513 | Bacteria | 2580 |
| 909 | nmdc:mga0a205_25902_c1 | 3300050515 | Bacteria | 5587 |
| 910 | nmdc:mga0a205_38823_c1 | 3300050515 | Bacteria | 4582 |
| 911 | nmdc:mga0a205_58039_c1 | 3300050515 | Bacteria | 3738 |
| 912 | Ga0495601_0000254 | 3300053077 | Bacteria | 28596 |
| 913 | Ga0495612_0044279 | 3300053078 | Bacteria | 1821 |
| 914 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 915 | Ga0495595_0009076 | 3300053084 | Bacteria | 4105 |
| 916 | Ga0495619_0011140 | 3300053085 | Bacteria | 5658 |
| 917 | Ga0495619_0015247 | 3300053085 | Bacteria | 4859 |
| 918 | Ga0495619_0287251 | 3300053085 | Bacteria | 1140 |
| 919 | Ga0500556_0001253 | 3300053104 | Bacteria | 11700 |
| 920 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 921 | Ga0500616_0000088 | 3300053153 | Bacteria | 191662 |
| 922 | Ga0500616_0011817 | 3300053153 | Bacteria | 5135 |
| 923 | Ga0500620_114463 | 3300053155 | Bacteria | 945 |
| 924 | Ga0501084_0043748 | 3300054114 | Bacteria | 3746 |
| 925 | Ga0501084_0106924 | 3300054114 | Bacteria | 2350 |
| 926 | Ga0501084_0184794 | 3300054114 | Bacteria | 1759 |
| 927 | Ga0501084_0189315 | 3300054114 | Bacteria | 1736 |
| 928 | Ga0590077_029539 | 3300059426 | Bacteria | 1193 |
| 929 | Ga0590077_040690 | 3300059426 | Bacteria | 1032 |
| 930 | Ga0501082_0039503 | 3300060353 | Bacteria | 4070 |
| 931 | Ga0501082_0238562 | 3300060353 | Bacteria | 1582 |
| 932 | Ga0501082_0584062 | 3300060353 | Bacteria | 977 |
| 933 | Ga0501082_0611188 | 3300060353 | Bacteria | 954 |
| 934 | Ga0466962_0013264 | 3300061719 | Bacteria | 3963 |
| 935 | Ga0466962_0013632 | 3300061719 | Bacteria | 3912 |
| 936 | Ga0466962_0067543 | 3300061719 | Bacteria | 1707 |
| 937 | Ga0466962_0099200 | 3300061719 | Bacteria | 1398 |
| 938 | Ga0466962_0157003 | 3300061719 | Bacteria | 1105 |
| 939 | Ga0466962_0209275 | 3300061719 | Bacteria | 954 |
| 940 | Ga0530510_0047037 | 3300061734 | Bacteria | 3117 |
| 941 | Ga0530510_0191461 | 3300061734 | Bacteria | 1518 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028380 | Ga0268265_10267271 | Ga0268265_102672712 | 181 |
| 2 | 3300038443 | Ga0395901_0265010 | Ga0395901_0265010_45_608 | 187 |
| 3 | 3300002070 | JGI24750J21931_1006886 | JGI24750J21931_10068862 | 188 |
| 4 | 3300037471 | Ga0395905_0919456 | Ga0395905_0919456_153_746 | 197 |
| 5 | 3300046615 | Ga0495656_0429945 | Ga0495656_0429945_16_609 | 197 |
| 6 | 3300048909 | Ga0496106_0023216 | Ga0496106_0023216_3965_4558 | 197 |
| 7 | 3300005435 | Ga0070714_100003806 | Ga0070714_1000038061 | 198 |
| 8 | 3300025929 | Ga0207664_10000004 | Ga0207664_10000004479 | 198 |
| 9 | 3300048905 | Ga0496102_0000522 | Ga0496102_0000522_20731_21330 | 199 |
| 10 | 3300048906 | Ga0496103_0000174 | Ga0496103_0000174_19712_20311 | 199 |
| 11 | 3300031548 | Ga0307408_100265352 | Ga0307408_1002653521 | 204 |
| 12 | 3300031824 | Ga0307413_10410981 | Ga0307413_104109812 | 204 |
| 13 | 3300031995 | Ga0307409_100014219 | Ga0307409_1000142194 | 204 |
| 14 | 3300032002 | Ga0307416_100042807 | Ga0307416_1000428073 | 204 |
| 15 | 3300006058 | Ga0075432_10026857 | Ga0075432_100268573 | 205 |
| 16 | 3300009147 | Ga0114129_10232254 | Ga0114129_102322542 | 205 |
| 17 | 3300050507 | nmdc:mga05p37_250211_c1 | nmdc:mga05p37_250211_c1_292_969 | 205 |
| 18 | 3300047472 | Ga0495686_0072632 | Ga0495686_0072632_612_1283 | 207 |
| 19 | 3300048914 | Ga0496111_0242957 | Ga0496111_0242957_334_963 | 207 |
| 20 | 3300053104 | Ga0500556_0001253 | Ga0500556_0001253_2298_2975 | 207 |
| 21 | 3300053153 | Ga0500616_0011817 | Ga0500616_0011817_2207_2884 | 207 |
| 22 | 3300044658 | Ga0466972_0098090 | Ga0466972_0098090_16_699 | 208 |
| 23 | 3300005549 | Ga0070704_100101431 | Ga0070704_1001014313 | 209 |
| 24 | 3300048909 | Ga0496106_0190145 | Ga0496106_0190145_252_914 | 209 |
| 25 | 3300048916 | Ga0496113_0114179 | Ga0496113_0114179_695_1357 | 209 |
| 26 | 3300049581 | Ga0501047_0499719 | Ga0501047_0499719_38_676 | 210 |
| 27 | 3300025923 | Ga0207681_10029892 | Ga0207681_100298922 | 211 |
| 28 | 3300048912 | Ga0496109_0526413 | Ga0496109_0526413_17_652 | 211 |
| 29 | 3300047320 | Ga0495672_0159078 | Ga0495672_0159078_473_1135 | 212 |
| 30 | 3300048915 | Ga0496112_0008935 | Ga0496112_0008935_3763_4413 | 212 |
| 31 | 3300048916 | Ga0496113_0000234 | Ga0496113_0000234_14756_15406 | 212 |
| 32 | 3300048929 | Ga0496126_0068535 | Ga0496126_0068535_619_1308 | 212 |
| 33 | 3300006880 | Ga0075429_100005448 | Ga0075429_1000054482 | 213 |
| 34 | 3300037418 | Ga0395900_0133810 | Ga0395900_0133810_1239_1922 | 213 |
| 35 | 3300037466 | Ga0395898_0198994 | Ga0395898_0198994_1183_1866 | 213 |
| 36 | 3300038443 | Ga0395901_0078362 | Ga0395901_0078362_1601_2284 | 213 |
| 37 | 3300050508 | nmdc:mga09592_100817_c1 | nmdc:mga09592_100817_c1_160_858 | 213 |
| 38 | 3300026067 | Ga0207678_10430007 | Ga0207678_104300072 | 214 |
| 39 | 3300045049 | Ga0466959_0180294 | Ga0466959_0180294_45_731 | 214 |
| 40 | 3300045836 | Ga0466958_0227943 | Ga0466958_0227943_72_758 | 214 |
| 41 | 3300006038 | Ga0075365_10136942 | Ga0075365_101369422 | 215 |
| 42 | 3300009147 | Ga0114129_10547039 | Ga0114129_105470391 | 215 |
| 43 | 3300021384 | Ga0213876_10077889 | Ga0213876_100778893 | 215 |
| 44 | 3300037853 | Ga0436364_1261370 | Ga0436364_1261370_1434_2084 | 215 |
| 45 | 3300039437 | Ga0436365_0656153 | Ga0436365_0656153_1183_1833 | 215 |
| 46 | 3300039453 | Ga0436362_0807641 | Ga0436362_0807641_1497_2147 | 215 |
| 47 | 3300044684 | Ga0466966_0505268 | Ga0466966_0505268_67_717 | 215 |
| 48 | 3300044706 | Ga0466964_0146428 | Ga0466964_0146428_366_1016 | 215 |
| 49 | 3300045049 | Ga0466959_0419855 | Ga0466959_0419855_231_881 | 215 |
| 50 | 3300045976 | Ga0466967_0719894 | Ga0466967_0719894_187_837 | 215 |
| 51 | 3300050491 | nmdc:mga00v17_37737_c1 | nmdc:mga00v17_37737_c1_1198_1878 | 215 |
| 52 | 3300050492 | nmdc:mga0yw44_122958_c1 | nmdc:mga0yw44_122958_c1_825_1505 | 215 |
| 53 | 3300050507 | nmdc:mga05p37_150003_c1 | nmdc:mga05p37_150003_c1_1091_1738 | 215 |
| 54 | 3300009098 | Ga0105245_10006545 | Ga0105245_100065455 | 216 |
| 55 | 3300009551 | Ga0105238_10000055 | Ga0105238_10000055116 | 216 |
| 56 | 3300046460 | Ga0495638_0013333 | Ga0495638_0013333_4549_5199 | 216 |
| 57 | 3300046517 | Ga0495630_0068252 | Ga0495630_0068252_18_668 | 216 |
| 58 | 3300046678 | Ga0495599_0096771 | Ga0495599_0096771_680_1330 | 216 |
| 59 | 3300047471 | Ga0495684_0421340 | Ga0495684_0421340_109_846 | 216 |
| 60 | 3300053077 | Ga0495601_0000254 | Ga0495601_0000254_25422_26072 | 216 |
| 61 | 3300003203 | JGI25406J46586_10003068 | JGI25406J46586_100030685 | 217 |
| 62 | 3300005328 | Ga0070676_10405820 | Ga0070676_104058202 | 217 |
| 63 | 3300005329 | Ga0070683_100567195 | Ga0070683_1005671952 | 217 |
| 64 | 3300005339 | Ga0070660_100092816 | Ga0070660_1000928163 | 217 |
| 65 | 3300005435 | Ga0070714_100293172 | Ga0070714_1002931722 | 217 |
| 66 | 3300005438 | Ga0070701_10125108 | Ga0070701_101251082 | 217 |
| 67 | 3300005439 | Ga0070711_100580962 | Ga0070711_1005809622 | 217 |
| 68 | 3300005441 | Ga0070700_100040032 | Ga0070700_1000400323 | 217 |
| 69 | 3300005441 | Ga0070700_100350925 | Ga0070700_1003509252 | 217 |
| 70 | 3300005455 | Ga0070663_100387279 | Ga0070663_1003872792 | 217 |
| 71 | 3300005457 | Ga0070662_100417141 | Ga0070662_1004171412 | 217 |
| 72 | 3300005459 | Ga0068867_100188880 | Ga0068867_1001888803 | 217 |
| 73 | 3300005530 | Ga0070679_100290078 | Ga0070679_1002900782 | 217 |
| 74 | 3300005535 | Ga0070684_100035669 | Ga0070684_1000356693 | 217 |
| 75 | 3300005535 | Ga0070684_100220518 | Ga0070684_1002205182 | 217 |
| 76 | 3300005535 | Ga0070684_100237483 | Ga0070684_1002374832 | 217 |
| 77 | 3300005544 | Ga0070686_100242452 | Ga0070686_1002424521 | 217 |
| 78 | 3300005564 | Ga0070664_100344981 | Ga0070664_1003449812 | 217 |
| 79 | 3300005577 | Ga0068857_100642147 | Ga0068857_1006421472 | 217 |
| 80 | 3300005615 | Ga0070702_100118460 | Ga0070702_1001184602 | 217 |
| 81 | 3300005616 | Ga0068852_100166209 | Ga0068852_1001662093 | 217 |
| 82 | 3300005616 | Ga0068852_100583926 | Ga0068852_1005839262 | 217 |
| 83 | 3300005840 | Ga0068870_10058400 | Ga0068870_100584002 | 217 |
| 84 | 3300005844 | Ga0068862_100360966 | Ga0068862_1003609662 | 217 |
| 85 | 3300005937 | Ga0081455_10063879 | Ga0081455_100638792 | 217 |
| 86 | 3300005937 | Ga0081455_10101142 | Ga0081455_101011421 | 217 |
| 87 | 3300005981 | Ga0081538_10007981 | Ga0081538_100079818 | 217 |
| 88 | 3300005985 | Ga0081539_10002877 | Ga0081539_1000287712 | 217 |
| 89 | 3300006058 | Ga0075432_10128566 | Ga0075432_101285662 | 217 |
| 90 | 3300006846 | Ga0075430_100021746 | Ga0075430_1000217464 | 217 |
| 91 | 3300006847 | Ga0075431_100542830 | Ga0075431_1005428302 | 217 |
| 92 | 3300006880 | Ga0075429_100473889 | Ga0075429_1004738892 | 217 |
| 93 | 3300009094 | Ga0111539_10057713 | Ga0111539_100577136 | 217 |
| 94 | 3300009094 | Ga0111539_10069723 | Ga0111539_100697231 | 217 |
| 95 | 3300009094 | Ga0111539_10448568 | Ga0111539_104485682 | 217 |
| 96 | 3300009101 | Ga0105247_10551186 | Ga0105247_105511862 | 217 |
| 97 | 3300009147 | Ga0114129_11581042 | Ga0114129_115810421 | 217 |
| 98 | 3300009148 | Ga0105243_11039491 | Ga0105243_110394911 | 217 |
| 99 | 3300010375 | Ga0105239_10453533 | Ga0105239_104535332 | 217 |
| 100 | 3300013306 | Ga0163162_10345740 | Ga0163162_103457402 | 217 |
| 101 | 3300013307 | Ga0157372_10622725 | Ga0157372_106227252 | 217 |
| 102 | 3300014325 | Ga0163163_10486483 | Ga0163163_104864832 | 217 |
| 103 | 3300025918 | Ga0207662_10476135 | Ga0207662_104761352 | 217 |
| 104 | 3300025919 | Ga0207657_10142644 | Ga0207657_101426442 | 217 |
| 105 | 3300025919 | Ga0207657_10286804 | Ga0207657_102868042 | 217 |
| 106 | 3300025921 | Ga0207652_10760531 | Ga0207652_107605312 | 217 |
| 107 | 3300025923 | Ga0207681_10284200 | Ga0207681_102842002 | 217 |
| 108 | 3300025929 | Ga0207664_10232263 | Ga0207664_102322632 | 217 |
| 109 | 3300025933 | Ga0207706_10284140 | Ga0207706_102841402 | 217 |
| 110 | 3300025934 | Ga0207686_10723543 | Ga0207686_107235432 | 217 |
| 111 | 3300025938 | Ga0207704_10641004 | Ga0207704_106410042 | 217 |
| 112 | 3300025940 | Ga0207691_10093164 | Ga0207691_100931642 | 217 |
| 113 | 3300025944 | Ga0207661_10021334 | Ga0207661_100213343 | 217 |
| 114 | 3300025944 | Ga0207661_10508505 | Ga0207661_105085052 | 217 |
| 115 | 3300025945 | Ga0207679_10052464 | Ga0207679_100524643 | 217 |
| 116 | 3300025981 | Ga0207640_10073844 | Ga0207640_100738442 | 217 |
| 117 | 3300026067 | Ga0207678_10198656 | Ga0207678_101986562 | 217 |
| 118 | 3300026075 | Ga0207708_10060083 | Ga0207708_100600834 | 217 |
| 119 | 3300026075 | Ga0207708_10060637 | Ga0207708_100606373 | 217 |
| 120 | 3300026075 | Ga0207708_10740332 | Ga0207708_107403321 | 217 |
| 121 | 3300026089 | Ga0207648_10054278 | Ga0207648_100542783 | 217 |
| 122 | 3300026095 | Ga0207676_10217403 | Ga0207676_102174033 | 217 |
| 123 | 3300026116 | Ga0207674_10159528 | Ga0207674_101595282 | 217 |
| 124 | 3300026116 | Ga0207674_10220211 | Ga0207674_102202112 | 217 |
| 125 | 3300026116 | Ga0207674_10671788 | Ga0207674_106717882 | 217 |
| 126 | 3300026118 | Ga0207675_101176981 | Ga0207675_1011769811 | 217 |
| 127 | 3300028381 | Ga0268264_10917993 | Ga0268264_109179931 | 217 |
| 128 | 3300028800 | Ga0265338_10495582 | Ga0265338_104955821 | 217 |
| 129 | 3300031240 | Ga0265320_10001697 | Ga0265320_100016975 | 217 |
| 130 | 3300031824 | Ga0307413_10023035 | Ga0307413_100230354 | 217 |
| 131 | 3300031824 | Ga0307413_10533113 | Ga0307413_105331132 | 217 |
| 132 | 3300031852 | Ga0307410_10105222 | Ga0307410_101052223 | 217 |
| 133 | 3300031901 | Ga0307406_10400162 | Ga0307406_104001622 | 217 |
| 134 | 3300031903 | Ga0307407_10299372 | Ga0307407_102993722 | 217 |
| 135 | 3300031903 | Ga0307407_10673968 | Ga0307407_106739681 | 217 |
| 136 | 3300031995 | Ga0307409_100035350 | Ga0307409_1000353503 | 217 |
| 137 | 3300031995 | Ga0307409_100413403 | Ga0307409_1004134032 | 217 |
| 138 | 3300031995 | Ga0307409_100610253 | Ga0307409_1006102532 | 217 |
| 139 | 3300031995 | Ga0307409_101143867 | Ga0307409_1011438671 | 217 |
| 140 | 3300032002 | Ga0307416_100661098 | Ga0307416_1006610982 | 217 |
| 141 | 3300032005 | Ga0307411_10360638 | Ga0307411_103606382 | 217 |
| 142 | 3300037466 | Ga0395898_0536649 | Ga0395898_0536649_118_780 | 217 |
| 143 | 3300038443 | Ga0395901_0149840 | Ga0395901_0149840_1304_1966 | 217 |
| 144 | 3300038443 | Ga0395901_0280010 | Ga0395901_0280010_1057_1719 | 217 |
| 145 | 3300039453 | Ga0436362_0272703 | Ga0436362_0272703_480_1157 | 217 |
| 146 | 3300041413 | Ga0439465_0102177 | Ga0439465_0102177_247_909 | 217 |
| 147 | 3300041453 | Ga0451797_0396879 | Ga0451797_0396879_29_691 | 217 |
| 148 | 3300042011 | Ga0439454_022580 | Ga0439454_022580_41_703 | 217 |
| 149 | 3300042437 | Ga0439444_0004979 | Ga0439444_0004979_1256_1918 | 217 |
| 150 | 3300044658 | Ga0466972_0119909 | Ga0466972_0119909_14_676 | 217 |
| 151 | 3300044684 | Ga0466966_0177510 | Ga0466966_0177510_335_997 | 217 |
| 152 | 3300044684 | Ga0466966_0184555 | Ga0466966_0184555_85_759 | 217 |
| 153 | 3300044693 | Ga0466961_0104361 | Ga0466961_0104361_917_1579 | 217 |
| 154 | 3300044694 | Ga0466963_0030215 | Ga0466963_0030215_169_831 | 217 |
| 155 | 3300044694 | Ga0466963_0032565 | Ga0466963_0032565_1683_2345 | 217 |
| 156 | 3300044694 | Ga0466963_0060313 | Ga0466963_0060313_1803_2465 | 217 |
| 157 | 3300044694 | Ga0466963_0087079 | Ga0466963_0087079_825_1487 | 217 |
| 158 | 3300044694 | Ga0466963_0197286 | Ga0466963_0197286_671_1333 | 217 |
| 159 | 3300044694 | Ga0466963_0366336 | Ga0466963_0366336_201_863 | 217 |
| 160 | 3300044694 | Ga0466963_0375387 | Ga0466963_0375387_260_922 | 217 |
| 161 | 3300044694 | Ga0466963_0579692 | Ga0466963_0579692_56_718 | 217 |
| 162 | 3300044706 | Ga0466964_0064537 | Ga0466964_0064537_155_817 | 217 |
| 163 | 3300044706 | Ga0466964_0209659 | Ga0466964_0209659_192_854 | 217 |
| 164 | 3300044719 | Ga0466971_0104322 | Ga0466971_0104322_152_814 | 217 |
| 165 | 3300044719 | Ga0466971_0281711 | Ga0466971_0281711_54_716 | 217 |
| 166 | 3300044842 | Ga0466957_0042699 | Ga0466957_0042699_767_1429 | 217 |
| 167 | 3300044842 | Ga0466957_0061850 | Ga0466957_0061850_985_1647 | 217 |
| 168 | 3300044901 | Ga0466960_0023962 | Ga0466960_0023962_1934_2596 | 217 |
| 169 | 3300044901 | Ga0466960_0039569 | Ga0466960_0039569_1467_2129 | 217 |
| 170 | 3300044901 | Ga0466960_0158178 | Ga0466960_0158178_369_1031 | 217 |
| 171 | 3300044901 | Ga0466960_0295115 | Ga0466960_0295115_87_749 | 217 |
| 172 | 3300044901 | Ga0466960_0323748 | Ga0466960_0323748_108_770 | 217 |
| 173 | 3300044901 | Ga0466960_0368959 | Ga0466960_0368959_15_677 | 217 |
| 174 | 3300045836 | Ga0466958_0080554 | Ga0466958_0080554_987_1649 | 217 |
| 175 | 3300045976 | Ga0466967_0001274 | Ga0466967_0001274_2154_2816 | 217 |
| 176 | 3300045976 | Ga0466967_0064220 | Ga0466967_0064220_2498_3160 | 217 |
| 177 | 3300045976 | Ga0466967_0069363 | Ga0466967_0069363_2259_2921 | 217 |
| 178 | 3300045976 | Ga0466967_0130035 | Ga0466967_0130035_1193_1855 | 217 |
| 179 | 3300045976 | Ga0466967_0314873 | Ga0466967_0314873_206_868 | 217 |
| 180 | 3300045976 | Ga0466967_0571585 | Ga0466967_0571585_15_677 | 217 |
| 181 | 3300045976 | Ga0466967_0596816 | Ga0466967_0596816_93_755 | 217 |
| 182 | 3300045976 | Ga0466967_0662548 | Ga0466967_0662548_356_1018 | 217 |
| 183 | 3300045976 | Ga0466967_0781103 | Ga0466967_0781103_191_853 | 217 |
| 184 | 3300045976 | Ga0466967_1060849 | Ga0466967_1060849_59_721 | 217 |
| 185 | 3300047320 | Ga0495672_0164190 | Ga0495672_0164190_53_715 | 217 |
| 186 | 3300048903 | Ga0496100_0036599 | Ga0496100_0036599_2241_2933 | 217 |
| 187 | 3300048904 | Ga0496101_0028976 | Ga0496101_0028976_1500_2192 | 217 |
| 188 | 3300048905 | Ga0496102_0007419 | Ga0496102_0007419_6420_7112 | 217 |
| 189 | 3300048906 | Ga0496103_0101195 | Ga0496103_0101195_927_1619 | 217 |
| 190 | 3300048909 | Ga0496106_0006210 | Ga0496106_0006210_1035_1727 | 217 |
| 191 | 3300048909 | Ga0496106_0594156 | Ga0496106_0594156_31_693 | 217 |
| 192 | 3300048910 | Ga0496107_0003285 | Ga0496107_0003285_454_1146 | 217 |
| 193 | 3300048911 | Ga0496108_0177968 | Ga0496108_0177968_883_1545 | 217 |
| 194 | 3300048913 | Ga0496110_0154488 | Ga0496110_0154488_14_676 | 217 |
| 195 | 3300048914 | Ga0496111_0126076 | Ga0496111_0126076_668_1330 | 217 |
| 196 | 3300048915 | Ga0496112_0070152 | Ga0496112_0070152_2296_2958 | 217 |
| 197 | 3300048915 | Ga0496112_0864291 | Ga0496112_0864291_118_780 | 217 |
| 198 | 3300048916 | Ga0496113_0186135 | Ga0496113_0186135_762_1424 | 217 |
| 199 | 3300048917 | Ga0496114_0056238 | Ga0496114_0056238_1702_2394 | 217 |
| 200 | 3300048917 | Ga0496114_0382847 | Ga0496114_0382847_352_1041 | 217 |
| 201 | 3300048917 | Ga0496114_0482149 | Ga0496114_0482149_311_973 | 217 |
| 202 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_157608_158297 | 217 |
| 203 | 3300048918 | Ga0496115_0004161 | Ga0496115_0004161_4419_5111 | 217 |
| 204 | 3300049568 | Ga0501031_0025826 | Ga0501031_0025826_1930_2592 | 217 |
| 205 | 3300049569 | Ga0501032_0166642 | Ga0501032_0166642_372_1034 | 217 |
| 206 | 3300049571 | Ga0501034_0240468 | Ga0501034_0240468_582_1244 | 217 |
| 207 | 3300049572 | Ga0501036_0062531 | Ga0501036_0062531_2262_2924 | 217 |
| 208 | 3300049572 | Ga0501036_0213665 | Ga0501036_0213665_140_802 | 217 |
| 209 | 3300049572 | Ga0501036_0516517 | Ga0501036_0516517_106_768 | 217 |
| 210 | 3300049575 | Ga0501039_0186510 | Ga0501039_0186510_285_947 | 217 |
| 211 | 3300049575 | Ga0501039_0214824 | Ga0501039_0214824_136_798 | 217 |
| 212 | 3300049577 | Ga0501041_0024569 | Ga0501041_0024569_1302_1964 | 217 |
| 213 | 3300049578 | Ga0501042_0325411 | Ga0501042_0325411_196_858 | 217 |
| 214 | 3300049582 | Ga0501048_0055272 | Ga0501048_0055272_1735_2397 | 217 |
| 215 | 3300049582 | Ga0501048_0350180 | Ga0501048_0350180_19_681 | 217 |
| 216 | 3300049586 | Ga0501070_0261996 | Ga0501070_0261996_47_709 | 217 |
| 217 | 3300049587 | Ga0501071_0061744 | Ga0501071_0061744_75_737 | 217 |
| 218 | 3300049587 | Ga0501071_0168097 | Ga0501071_0168097_396_1058 | 217 |
| 219 | 3300049588 | Ga0501072_0110400 | Ga0501072_0110400_935_1597 | 217 |
| 220 | 3300049589 | Ga0501073_0184547 | Ga0501073_0184547_670_1332 | 217 |
| 221 | 3300049590 | Ga0501074_0145653 | Ga0501074_0145653_217_879 | 217 |
| 222 | 3300049591 | Ga0501075_0102721 | Ga0501075_0102721_444_1106 | 217 |
| 223 | 3300049593 | Ga0501077_0117919 | Ga0501077_0117919_893_1555 | 217 |
| 224 | 3300049822 | Ga0501035_0077921 | Ga0501035_0077921_1157_1819 | 217 |
| 225 | 3300049823 | Ga0501044_0418209 | Ga0501044_0418209_304_966 | 217 |
| 226 | 3300049824 | Ga0501045_0022507 | Ga0501045_0022507_785_1447 | 217 |
| 227 | 3300049824 | Ga0501045_0085352 | Ga0501045_0085352_821_1483 | 217 |
| 228 | 3300049824 | Ga0501045_0387375 | Ga0501045_0387375_47_709 | 217 |
| 229 | 3300050509 | nmdc:mga0qj67_396170_c1 | nmdc:mga0qj67_396170_c1_103_765 | 217 |
| 230 | 3300050509 | nmdc:mga0qj67_4977_c1 | nmdc:mga0qj67_4977_c1_4760_5428 | 217 |
| 231 | 3300050511 | nmdc:mga08y16_212705_c1 | nmdc:mga08y16_212705_c1_649_1311 | 217 |
| 232 | 3300050511 | nmdc:mga08y16_222279_c1 | nmdc:mga08y16_222279_c1_31_693 | 217 |
| 233 | 3300050512 | nmdc:mga0n895_276630_c1 | nmdc:mga0n895_276630_c1_612_1274 | 217 |
| 234 | 3300054114 | Ga0501084_0184794 | Ga0501084_0184794_1050_1712 | 217 |
| 235 | 3300059426 | Ga0590077_029539 | Ga0590077_029539_270_932 | 217 |
| 236 | 3300060353 | Ga0501082_0584062 | Ga0501082_0584062_47_709 | 217 |
| 237 | 3300061719 | Ga0466962_0067543 | Ga0466962_0067543_303_965 | 217 |
| 238 | 3300061719 | Ga0466962_0157003 | Ga0466962_0157003_234_896 | 217 |
| 239 | 3300061734 | Ga0530510_0191461 | Ga0530510_0191461_621_1283 | 217 |
| 240 | 3300006175 | Ga0070712_100000004 | Ga0070712_100000004193 | 218 |
| 241 | 3300017792 | Ga0163161_10670557 | Ga0163161_106705572 | 218 |
| 242 | 3300021388 | Ga0213875_10083266 | Ga0213875_100832662 | 218 |
| 243 | 3300025915 | Ga0207693_10000017 | Ga0207693_1000001726 | 218 |
| 244 | 3300026067 | Ga0207678_10344390 | Ga0207678_103443902 | 218 |
| 245 | 3300037853 | Ga0436364_0394694 | Ga0436364_0394694_1145_1825 | 218 |
| 246 | 3300044683 | Ga0466965_0111393 | Ga0466965_0111393_196_867 | 218 |
| 247 | 3300045836 | Ga0466958_0383485 | Ga0466958_0383485_80_760 | 218 |
| 248 | 3300045976 | Ga0466967_0592735 | Ga0466967_0592735_74_739 | 218 |
| 249 | 3300049578 | Ga0501042_0543539 | Ga0501042_0543539_38_721 | 218 |
| 250 | 3300049592 | Ga0501076_0335675 | Ga0501076_0335675_192_857 | 218 |
| 251 | 3300049824 | Ga0501045_0554879 | Ga0501045_0554879_22_687 | 218 |
| 252 | 3300053085 | Ga0495619_0015247 | Ga0495619_0015247_1346_2041 | 218 |
| 253 | 3300054114 | Ga0501084_0106924 | Ga0501084_0106924_697_1362 | 218 |
| 254 | 3300061719 | Ga0466962_0209275 | Ga0466962_0209275_245_925 | 218 |
| 255 | 3300005334 | Ga0068869_100170166 | Ga0068869_1001701663 | 219 |
| 256 | 3300005337 | Ga0070682_100376199 | Ga0070682_1003761991 | 219 |
| 257 | 3300005455 | Ga0070663_100095415 | Ga0070663_1000954153 | 219 |
| 258 | 3300005459 | Ga0068867_100808717 | Ga0068867_1008087172 | 219 |
| 259 | 3300005535 | Ga0070684_100215866 | Ga0070684_1002158662 | 219 |
| 260 | 3300005535 | Ga0070684_100230599 | Ga0070684_1002305993 | 219 |
| 261 | 3300005564 | Ga0070664_100052502 | Ga0070664_1000525025 | 219 |
| 262 | 3300005718 | Ga0068866_10031078 | Ga0068866_100310783 | 219 |
| 263 | 3300005840 | Ga0068870_10171090 | Ga0068870_101710902 | 219 |
| 264 | 3300005844 | Ga0068862_100672124 | Ga0068862_1006721242 | 219 |
| 265 | 3300005937 | Ga0081455_10057346 | Ga0081455_100573461 | 219 |
| 266 | 3300005981 | Ga0081538_10013472 | Ga0081538_100134724 | 219 |
| 267 | 3300005981 | Ga0081538_10014713 | Ga0081538_100147133 | 219 |
| 268 | 3300006051 | Ga0075364_10508173 | Ga0075364_105081731 | 219 |
| 269 | 3300006847 | Ga0075431_100207840 | Ga0075431_1002078402 | 219 |
| 270 | 3300009148 | Ga0105243_10271201 | Ga0105243_102712011 | 219 |
| 271 | 3300010375 | Ga0105239_10424499 | Ga0105239_104244993 | 219 |
| 272 | 3300021384 | Ga0213876_10014726 | Ga0213876_100147264 | 219 |
| 273 | 3300025321 | Ga0207656_10035268 | Ga0207656_100352681 | 219 |
| 274 | 3300025908 | Ga0207643_10022822 | Ga0207643_100228222 | 219 |
| 275 | 3300025908 | Ga0207643_10108518 | Ga0207643_101085182 | 219 |
| 276 | 3300025923 | Ga0207681_10356059 | Ga0207681_103560592 | 219 |
| 277 | 3300025944 | Ga0207661_10286777 | Ga0207661_102867773 | 219 |
| 278 | 3300025961 | Ga0207712_10649700 | Ga0207712_106497001 | 219 |
| 279 | 3300026067 | Ga0207678_10112433 | Ga0207678_101124334 | 219 |
| 280 | 3300026075 | Ga0207708_10147959 | Ga0207708_101479592 | 219 |
| 281 | 3300026089 | Ga0207648_10745061 | Ga0207648_107450611 | 219 |
| 282 | 3300026118 | Ga0207675_100466088 | Ga0207675_1004660881 | 219 |
| 283 | 3300026118 | Ga0207675_100721385 | Ga0207675_1007213852 | 219 |
| 284 | 3300028379 | Ga0268266_10092201 | Ga0268266_100922013 | 219 |
| 285 | 3300028381 | Ga0268264_10412576 | Ga0268264_104125762 | 219 |
| 286 | 3300031548 | Ga0307408_100034402 | Ga0307408_1000344025 | 219 |
| 287 | 3300031731 | Ga0307405_10019925 | Ga0307405_100199252 | 219 |
| 288 | 3300031824 | Ga0307413_10013637 | Ga0307413_100136375 | 219 |
| 289 | 3300031901 | Ga0307406_10006019 | Ga0307406_100060194 | 219 |
| 290 | 3300031903 | Ga0307407_10030557 | Ga0307407_100305573 | 219 |
| 291 | 3300031903 | Ga0307407_10667528 | Ga0307407_106675281 | 219 |
| 292 | 3300031995 | Ga0307409_100038646 | Ga0307409_1000386462 | 219 |
| 293 | 3300031995 | Ga0307409_100167739 | Ga0307409_1001677392 | 219 |
| 294 | 3300031995 | Ga0307409_100354368 | Ga0307409_1003543682 | 219 |
| 295 | 3300031995 | Ga0307409_100425361 | Ga0307409_1004253612 | 219 |
| 296 | 3300031995 | Ga0307409_100499365 | Ga0307409_1004993652 | 219 |
| 297 | 3300031995 | Ga0307409_100785936 | Ga0307409_1007859362 | 219 |
| 298 | 3300032002 | Ga0307416_100050194 | Ga0307416_1000501944 | 219 |
| 299 | 3300032002 | Ga0307416_100531346 | Ga0307416_1005313462 | 219 |
| 300 | 3300032126 | Ga0307415_100005350 | Ga0307415_1000053506 | 219 |
| 301 | 3300032126 | Ga0307415_100011024 | Ga0307415_1000110245 | 219 |
| 302 | 3300032126 | Ga0307415_100041656 | Ga0307415_1000416566 | 219 |
| 303 | 3300032126 | Ga0307415_100853468 | Ga0307415_1008534681 | 219 |
| 304 | 3300037418 | Ga0395900_0401844 | Ga0395900_0401844_571_1233 | 219 |
| 305 | 3300038443 | Ga0395901_0668412 | Ga0395901_0668412_318_980 | 219 |
| 306 | 3300039437 | Ga0436365_0193968 | Ga0436365_0193968_13679_14362 | 219 |
| 307 | 3300044684 | Ga0466966_0075633 | Ga0466966_0075633_1175_1858 | 219 |
| 308 | 3300044735 | Ga0466968_0060447 | Ga0466968_0060447_491_1180 | 219 |
| 309 | 3300045049 | Ga0466959_0251156 | Ga0466959_0251156_67_756 | 219 |
| 310 | 3300045836 | Ga0466958_0196257 | Ga0466958_0196257_161_844 | 219 |
| 311 | 3300045976 | Ga0466967_0833666 | Ga0466967_0833666_42_713 | 219 |
| 312 | 3300046454 | Ga0495592_0120494 | Ga0495592_0120494_340_1038 | 219 |
| 313 | 3300046500 | Ga0495596_0080359 | Ga0495596_0080359_178_849 | 219 |
| 314 | 3300046515 | Ga0495620_0062548 | Ga0495620_0062548_617_1288 | 219 |
| 315 | 3300046515 | Ga0495620_0087738 | Ga0495620_0087738_156_827 | 219 |
| 316 | 3300046519 | Ga0495632_0257852 | Ga0495632_0257852_92_769 | 219 |
| 317 | 3300046535 | Ga0495586_0339232 | Ga0495586_0339232_79_816 | 219 |
| 318 | 3300048904 | Ga0496101_0403788 | Ga0496101_0403788_284_946 | 219 |
| 319 | 3300048906 | Ga0496103_0176714 | Ga0496103_0176714_544_1206 | 219 |
| 320 | 3300048909 | Ga0496106_0602108 | Ga0496106_0602108_28_699 | 219 |
| 321 | 3300048910 | Ga0496107_0105683 | Ga0496107_0105683_676_1338 | 219 |
| 322 | 3300048911 | Ga0496108_0288915 | Ga0496108_0288915_605_1276 | 219 |
| 323 | 3300048914 | Ga0496111_0088313 | Ga0496111_0088313_798_1460 | 219 |
| 324 | 3300048915 | Ga0496112_0657959 | Ga0496112_0657959_110_772 | 219 |
| 325 | 3300049568 | Ga0501031_0215797 | Ga0501031_0215797_418_1089 | 219 |
| 326 | 3300049822 | Ga0501035_0290187 | Ga0501035_0290187_449_1129 | 219 |
| 327 | 3300050507 | nmdc:mga05p37_86326_c1 | nmdc:mga05p37_86326_c1_329_1009 | 219 |
| 328 | 3300050511 | nmdc:mga08y16_84912_c1 | nmdc:mga08y16_84912_c1_1379_2059 | 219 |
| 329 | 3300053155 | Ga0500620_114463 | Ga0500620_114463_54_725 | 219 |
| 330 | 3300003373 | JGI25407J50210_10003770 | JGI25407J50210_100037704 | 220 |
| 331 | 3300003373 | JGI25407J50210_10005022 | JGI25407J50210_100050223 | 220 |
| 332 | 3300003373 | JGI25407J50210_10011690 | JGI25407J50210_100116902 | 220 |
| 333 | 3300005546 | Ga0070696_100618212 | Ga0070696_1006182121 | 220 |
| 334 | 3300005937 | Ga0081455_10025337 | Ga0081455_100253373 | 220 |
| 335 | 3300005981 | Ga0081538_10000766 | Ga0081538_1000076637 | 220 |
| 336 | 3300005981 | Ga0081538_10002073 | Ga0081538_1000207325 | 220 |
| 337 | 3300005981 | Ga0081538_10002222 | Ga0081538_1000222219 | 220 |
| 338 | 3300005981 | Ga0081538_10094492 | Ga0081538_100944922 | 220 |
| 339 | 3300005983 | Ga0081540_1001363 | Ga0081540_10013635 | 220 |
| 340 | 3300006175 | Ga0070712_100851994 | Ga0070712_1008519941 | 220 |
| 341 | 3300006847 | Ga0075431_100639750 | Ga0075431_1006397502 | 220 |
| 342 | 3300009147 | Ga0114129_10070350 | Ga0114129_100703503 | 220 |
| 343 | 3300009176 | Ga0105242_10000533 | Ga0105242_1000053311 | 220 |
| 344 | 3300013296 | Ga0157374_10134876 | Ga0157374_101348763 | 220 |
| 345 | 3300017792 | Ga0163161_10569661 | Ga0163161_105696612 | 220 |
| 346 | 3300021388 | Ga0213875_10006762 | Ga0213875_100067627 | 220 |
| 347 | 3300025913 | Ga0207695_10488057 | Ga0207695_104880572 | 220 |
| 348 | 3300025921 | Ga0207652_10421988 | Ga0207652_104219882 | 220 |
| 349 | 3300025934 | Ga0207686_10000073 | Ga0207686_1000007388 | 220 |
| 350 | 3300025972 | Ga0207668_10129981 | Ga0207668_101299812 | 220 |
| 351 | 3300028563 | Ga0265319_1003395 | Ga0265319_10033956 | 220 |
| 352 | 3300031240 | Ga0265320_10023535 | Ga0265320_100235355 | 220 |
| 353 | 3300031903 | Ga0307407_10079745 | Ga0307407_100797453 | 220 |
| 354 | 3300032002 | Ga0307416_100264861 | Ga0307416_1002648612 | 220 |
| 355 | 3300037418 | Ga0395900_0187258 | Ga0395900_0187258_669_1334 | 220 |
| 356 | 3300037418 | Ga0395900_0457055 | Ga0395900_0457055_429_1094 | 220 |
| 357 | 3300037466 | Ga0395898_0244242 | Ga0395898_0244242_260_925 | 220 |
| 358 | 3300037466 | Ga0395898_0479092 | Ga0395898_0479092_253_918 | 220 |
| 359 | 3300037471 | Ga0395905_0334614 | Ga0395905_0334614_485_1150 | 220 |
| 360 | 3300037853 | Ga0436364_0786946 | Ga0436364_0786946_410_1096 | 220 |
| 361 | 3300037853 | Ga0436364_0927298 | Ga0436364_0927298_3292_3975 | 220 |
| 362 | 3300038443 | Ga0395901_0070334 | Ga0395901_0070334_152_817 | 220 |
| 363 | 3300038443 | Ga0395901_0246245 | Ga0395901_0246245_985_1650 | 220 |
| 364 | 3300038443 | Ga0395901_0257186 | Ga0395901_0257186_614_1279 | 220 |
| 365 | 3300039437 | Ga0436365_0571801 | Ga0436365_0571801_1698_2384 | 220 |
| 366 | 3300039437 | Ga0436365_1906628 | Ga0436365_1906628_42_821 | 220 |
| 367 | 3300039450 | Ga0436363_0160959 | Ga0436363_0160959_230_922 | 220 |
| 368 | 3300039450 | Ga0436363_1290946 | Ga0436363_1290946_113_805 | 220 |
| 369 | 3300039450 | Ga0436363_1301125 | Ga0436363_1301125_7460_8146 | 220 |
| 370 | 3300041512 | Ga0451853_2330744 | Ga0451853_2330744_360_1025 | 220 |
| 371 | 3300044684 | Ga0466966_0230503 | Ga0466966_0230503_217_903 | 220 |
| 372 | 3300044693 | Ga0466961_0198627 | Ga0466961_0198627_223_909 | 220 |
| 373 | 3300044694 | Ga0466963_0003469 | Ga0466963_0003469_1973_2752 | 220 |
| 374 | 3300044694 | Ga0466963_0022549 | Ga0466963_0022549_2802_3488 | 220 |
| 375 | 3300044719 | Ga0466971_0058920 | Ga0466971_0058920_728_1414 | 220 |
| 376 | 3300044719 | Ga0466971_0141714 | Ga0466971_0141714_88_867 | 220 |
| 377 | 3300044735 | Ga0466968_0103062 | Ga0466968_0103062_525_1211 | 220 |
| 378 | 3300044765 | Ga0466970_0055418 | Ga0466970_0055418_1036_1815 | 220 |
| 379 | 3300044842 | Ga0466957_0003722 | Ga0466957_0003722_5438_6217 | 220 |
| 380 | 3300045049 | Ga0466959_0020966 | Ga0466959_0020966_1644_2423 | 220 |
| 381 | 3300045049 | Ga0466959_0051987 | Ga0466959_0051987_1043_1729 | 220 |
| 382 | 3300045049 | Ga0466959_0118339 | Ga0466959_0118339_1004_1696 | 220 |
| 383 | 3300045836 | Ga0466958_0011172 | Ga0466958_0011172_2075_2854 | 220 |
| 384 | 3300045836 | Ga0466958_0017342 | Ga0466958_0017342_1999_2685 | 220 |
| 385 | 3300045976 | Ga0466967_0058077 | Ga0466967_0058077_1873_2652 | 220 |
| 386 | 3300048907 | Ga0496104_0934405 | Ga0496104_0934405_16_729 | 220 |
| 387 | 3300048912 | Ga0496109_0000552 | Ga0496109_0000552_19575_20255 | 220 |
| 388 | 3300048913 | Ga0496110_0585472 | Ga0496110_0585472_80_760 | 220 |
| 389 | 3300048915 | Ga0496112_0000200 | Ga0496112_0000200_18881_19573 | 220 |
| 390 | 3300048916 | Ga0496113_0166290 | Ga0496113_0166290_167_868 | 220 |
| 391 | 3300049568 | Ga0501031_0162857 | Ga0501031_0162857_757_1431 | 220 |
| 392 | 3300049578 | Ga0501042_0081992 | Ga0501042_0081992_739_1413 | 220 |
| 393 | 3300049578 | Ga0501042_0468577 | Ga0501042_0468577_215_886 | 220 |
| 394 | 3300049579 | Ga0501043_0310418 | Ga0501043_0310418_360_1034 | 220 |
| 395 | 3300049588 | Ga0501072_0048610 | Ga0501072_0048610_1036_1710 | 220 |
| 396 | 3300049741 | Ga0501079_0130747 | Ga0501079_0130747_258_932 | 220 |
| 397 | 3300049741 | Ga0501079_0760195 | Ga0501079_0760195_22_687 | 220 |
| 398 | 3300049824 | Ga0501045_0035637 | Ga0501045_0035637_945_1619 | 220 |
| 399 | 3300050511 | nmdc:mga08y16_829191_c1 | nmdc:mga08y16_829191_c1_42_716 | 220 |
| 400 | 3300054114 | Ga0501084_0189315 | Ga0501084_0189315_592_1266 | 220 |
| 401 | 3300060353 | Ga0501082_0238562 | Ga0501082_0238562_181_855 | 220 |
| 402 | 3300060353 | Ga0501082_0611188 | Ga0501082_0611188_163_834 | 220 |
| 403 | 3300061719 | Ga0466962_0013264 | Ga0466962_0013264_2012_2698 | 220 |
| 404 | 3300001991 | JGI24743J22301_10044033 | JGI24743J22301_100440331 | 221 |
| 405 | 3300003373 | JGI25407J50210_10009964 | JGI25407J50210_100099642 | 221 |
| 406 | 3300003373 | JGI25407J50210_10025068 | JGI25407J50210_100250682 | 221 |
| 407 | 3300003373 | JGI25407J50210_10025262 | JGI25407J50210_100252622 | 221 |
| 408 | 3300005330 | Ga0070690_100330506 | Ga0070690_1003305061 | 221 |
| 409 | 3300005334 | Ga0068869_100151291 | Ga0068869_1001512913 | 221 |
| 410 | 3300005335 | Ga0070666_10005716 | Ga0070666_100057167 | 221 |
| 411 | 3300005335 | Ga0070666_10011418 | Ga0070666_100114182 | 221 |
| 412 | 3300005337 | Ga0070682_100165993 | Ga0070682_1001659933 | 221 |
| 413 | 3300005337 | Ga0070682_100281883 | Ga0070682_1002818832 | 221 |
| 414 | 3300005338 | Ga0068868_100022400 | Ga0068868_1000224003 | 221 |
| 415 | 3300005341 | Ga0070691_10000021 | Ga0070691_1000002126 | 221 |
| 416 | 3300005341 | Ga0070691_10027557 | Ga0070691_100275572 | 221 |
| 417 | 3300005341 | Ga0070691_10031342 | Ga0070691_100313423 | 221 |
| 418 | 3300005344 | Ga0070661_100257761 | Ga0070661_1002577612 | 221 |
| 419 | 3300005344 | Ga0070661_100361443 | Ga0070661_1003614431 | 221 |
| 420 | 3300005347 | Ga0070668_100006694 | Ga0070668_1000066948 | 221 |
| 421 | 3300005354 | Ga0070675_100034890 | Ga0070675_1000348904 | 221 |
| 422 | 3300005356 | Ga0070674_100389231 | Ga0070674_1003892311 | 221 |
| 423 | 3300005364 | Ga0070673_100051394 | Ga0070673_1000513943 | 221 |
| 424 | 3300005365 | Ga0070688_100053016 | Ga0070688_1000530163 | 221 |
| 425 | 3300005366 | Ga0070659_100021303 | Ga0070659_1000213035 | 221 |
| 426 | 3300005367 | Ga0070667_100051735 | Ga0070667_1000517352 | 221 |
| 427 | 3300005434 | Ga0070709_10107091 | Ga0070709_101070912 | 221 |
| 428 | 3300005435 | Ga0070714_100007942 | Ga0070714_1000079422 | 221 |
| 429 | 3300005435 | Ga0070714_100023442 | Ga0070714_1000234424 | 221 |
| 430 | 3300005435 | Ga0070714_100068740 | Ga0070714_1000687404 | 221 |
| 431 | 3300005435 | Ga0070714_100453558 | Ga0070714_1004535581 | 221 |
| 432 | 3300005436 | Ga0070713_100067820 | Ga0070713_1000678201 | 221 |
| 433 | 3300005436 | Ga0070713_100104694 | Ga0070713_1001046943 | 221 |
| 434 | 3300005436 | Ga0070713_100183117 | Ga0070713_1001831173 | 221 |
| 435 | 3300005437 | Ga0070710_10111737 | Ga0070710_101117372 | 221 |
| 436 | 3300005438 | Ga0070701_10385802 | Ga0070701_103858021 | 221 |
| 437 | 3300005439 | Ga0070711_100006655 | Ga0070711_1000066557 | 221 |
| 438 | 3300005439 | Ga0070711_100094329 | Ga0070711_1000943292 | 221 |
| 439 | 3300005441 | Ga0070700_100000722 | Ga0070700_1000007221 | 221 |
| 440 | 3300005441 | Ga0070700_100006275 | Ga0070700_1000062754 | 221 |
| 441 | 3300005466 | Ga0070685_10045942 | Ga0070685_100459422 | 221 |
| 442 | 3300005545 | Ga0070695_100285073 | Ga0070695_1002850731 | 221 |
| 443 | 3300005548 | Ga0070665_100064521 | Ga0070665_1000645212 | 221 |
| 444 | 3300005548 | Ga0070665_100119286 | Ga0070665_1001192863 | 221 |
| 445 | 3300005548 | Ga0070665_100303345 | Ga0070665_1003033453 | 221 |
| 446 | 3300005548 | Ga0070665_100303852 | Ga0070665_1003038522 | 221 |
| 447 | 3300005564 | Ga0070664_100017246 | Ga0070664_1000172464 | 221 |
| 448 | 3300005577 | Ga0068857_100112689 | Ga0068857_1001126893 | 221 |
| 449 | 3300005578 | Ga0068854_100219200 | Ga0068854_1002192002 | 221 |
| 450 | 3300005614 | Ga0068856_100002016 | Ga0068856_1000020163 | 221 |
| 451 | 3300005614 | Ga0068856_100037628 | Ga0068856_1000376283 | 221 |
| 452 | 3300005615 | Ga0070702_100360052 | Ga0070702_1003600522 | 221 |
| 453 | 3300005618 | Ga0068864_100002096 | Ga0068864_1000020964 | 221 |
| 454 | 3300005719 | Ga0068861_100001186 | Ga0068861_1000011864 | 221 |
| 455 | 3300005719 | Ga0068861_100088248 | Ga0068861_1000882483 | 221 |
| 456 | 3300005719 | Ga0068861_100104384 | Ga0068861_1001043842 | 221 |
| 457 | 3300005844 | Ga0068862_100178662 | Ga0068862_1001786622 | 221 |
| 458 | 3300005937 | Ga0081455_10017510 | Ga0081455_100175107 | 221 |
| 459 | 3300005937 | Ga0081455_10019598 | Ga0081455_100195986 | 221 |
| 460 | 3300005937 | Ga0081455_10022152 | Ga0081455_100221527 | 221 |
| 461 | 3300005937 | Ga0081455_10142289 | Ga0081455_101422893 | 221 |
| 462 | 3300005981 | Ga0081538_10000044 | Ga0081538_1000004433 | 221 |
| 463 | 3300005981 | Ga0081538_10000087 | Ga0081538_1000008786 | 221 |
| 464 | 3300005981 | Ga0081538_10000190 | Ga0081538_1000019058 | 221 |
| 465 | 3300005981 | Ga0081538_10004723 | Ga0081538_100047236 | 221 |
| 466 | 3300005981 | Ga0081538_10005950 | Ga0081538_100059508 | 221 |
| 467 | 3300005981 | Ga0081538_10015512 | Ga0081538_100155125 | 221 |
| 468 | 3300005981 | Ga0081538_10017123 | Ga0081538_100171235 | 221 |
| 469 | 3300005981 | Ga0081538_10017143 | Ga0081538_100171436 | 221 |
| 470 | 3300005981 | Ga0081538_10017511 | Ga0081538_100175113 | 221 |
| 471 | 3300005981 | Ga0081538_10026605 | Ga0081538_100266053 | 221 |
| 472 | 3300005985 | Ga0081539_10038945 | Ga0081539_100389455 | 221 |
| 473 | 3300006028 | Ga0070717_10007024 | Ga0070717_100070247 | 221 |
| 474 | 3300006028 | Ga0070717_10008551 | Ga0070717_100085514 | 221 |
| 475 | 3300006038 | Ga0075365_10042925 | Ga0075365_100429253 | 221 |
| 476 | 3300006048 | Ga0075363_100029908 | Ga0075363_1000299083 | 221 |
| 477 | 3300006048 | Ga0075363_100062948 | Ga0075363_1000629483 | 221 |
| 478 | 3300006058 | Ga0075432_10004604 | Ga0075432_100046044 | 221 |
| 479 | 3300006175 | Ga0070712_100002009 | Ga0070712_1000020092 | 221 |
| 480 | 3300006175 | Ga0070712_100009269 | Ga0070712_1000092693 | 221 |
| 481 | 3300006844 | Ga0075428_100046559 | Ga0075428_1000465594 | 221 |
| 482 | 3300006844 | Ga0075428_100066684 | Ga0075428_1000666844 | 221 |
| 483 | 3300006846 | Ga0075430_100000277 | Ga0075430_10000027718 | 221 |
| 484 | 3300006846 | Ga0075430_100022807 | Ga0075430_1000228072 | 221 |
| 485 | 3300006846 | Ga0075430_100051964 | Ga0075430_1000519645 | 221 |
| 486 | 3300006846 | Ga0075430_100186547 | Ga0075430_1001865473 | 221 |
| 487 | 3300006847 | Ga0075431_100032339 | Ga0075431_1000323393 | 221 |
| 488 | 3300006847 | Ga0075431_100387477 | Ga0075431_1003874772 | 221 |
| 489 | 3300006852 | Ga0075433_10056171 | Ga0075433_100561715 | 221 |
| 490 | 3300006852 | Ga0075433_10081739 | Ga0075433_100817392 | 221 |
| 491 | 3300006880 | Ga0075429_100022506 | Ga0075429_1000225064 | 221 |
| 492 | 3300006880 | Ga0075429_100109912 | Ga0075429_1001099122 | 221 |
| 493 | 3300006880 | Ga0075429_100865911 | Ga0075429_1008659112 | 221 |
| 494 | 3300006914 | Ga0075436_100020658 | Ga0075436_1000206584 | 221 |
| 495 | 3300007076 | Ga0075435_100065745 | Ga0075435_1000657454 | 221 |
| 496 | 3300009094 | Ga0111539_10044281 | Ga0111539_100442814 | 221 |
| 497 | 3300009094 | Ga0111539_10082912 | Ga0111539_100829124 | 221 |
| 498 | 3300009094 | Ga0111539_10330969 | Ga0111539_103309692 | 221 |
| 499 | 3300009094 | Ga0111539_10713428 | Ga0111539_107134281 | 221 |
| 500 | 3300009098 | Ga0105245_10012887 | Ga0105245_100128879 | 221 |
| 501 | 3300009098 | Ga0105245_10035529 | Ga0105245_100355294 | 221 |
| 502 | 3300009147 | Ga0114129_10055555 | Ga0114129_100555553 | 221 |
| 503 | 3300009147 | Ga0114129_10148059 | Ga0114129_101480592 | 221 |
| 504 | 3300009147 | Ga0114129_10508850 | Ga0114129_105088502 | 221 |
| 505 | 3300009147 | Ga0114129_10782757 | Ga0114129_107827572 | 221 |
| 506 | 3300009176 | Ga0105242_10034928 | Ga0105242_100349286 | 221 |
| 507 | 3300009177 | Ga0105248_10074184 | Ga0105248_100741844 | 221 |
| 508 | 3300009545 | Ga0105237_10000501 | Ga0105237_1000050127 | 221 |
| 509 | 3300009553 | Ga0105249_10062901 | Ga0105249_100629013 | 221 |
| 510 | 3300009553 | Ga0105249_10192817 | Ga0105249_101928171 | 221 |
| 511 | 3300010375 | Ga0105239_10063989 | Ga0105239_100639894 | 221 |
| 512 | 3300010375 | Ga0105239_10114635 | Ga0105239_101146352 | 221 |
| 513 | 3300010375 | Ga0105239_10141763 | Ga0105239_101417634 | 221 |
| 514 | 3300011119 | Ga0105246_10011340 | Ga0105246_100113403 | 221 |
| 515 | 3300012482 | Ga0157318_1002707 | Ga0157318_10027072 | 221 |
| 516 | 3300013102 | Ga0157371_10205703 | Ga0157371_102057031 | 221 |
| 517 | 3300013296 | Ga0157374_10007744 | Ga0157374_100077446 | 221 |
| 518 | 3300013306 | Ga0163162_10047822 | Ga0163162_100478225 | 221 |
| 519 | 3300013306 | Ga0163162_11086915 | Ga0163162_110869152 | 221 |
| 520 | 3300013307 | Ga0157372_10094032 | Ga0157372_100940323 | 221 |
| 521 | 3300013307 | Ga0157372_10894288 | Ga0157372_108942882 | 221 |
| 522 | 3300013308 | Ga0157375_10054962 | Ga0157375_100549624 | 221 |
| 523 | 3300013308 | Ga0157375_10299622 | Ga0157375_102996223 | 221 |
| 524 | 3300014325 | Ga0163163_10045286 | Ga0163163_100452865 | 221 |
| 525 | 3300014325 | Ga0163163_10362079 | Ga0163163_103620792 | 221 |
| 526 | 3300014326 | Ga0157380_10073581 | Ga0157380_100735813 | 221 |
| 527 | 3300014745 | Ga0157377_10000686 | Ga0157377_1000068611 | 221 |
| 528 | 3300014968 | Ga0157379_10316085 | Ga0157379_103160852 | 221 |
| 529 | 3300014968 | Ga0157379_10676433 | Ga0157379_106764332 | 221 |
| 530 | 3300017792 | Ga0163161_10084272 | Ga0163161_100842722 | 221 |
| 531 | 3300021384 | Ga0213876_10010277 | Ga0213876_100102775 | 221 |
| 532 | 3300021388 | Ga0213875_10007406 | Ga0213875_100074066 | 221 |
| 533 | 3300025898 | Ga0207692_10047202 | Ga0207692_100472023 | 221 |
| 534 | 3300025900 | Ga0207710_10189747 | Ga0207710_101897471 | 221 |
| 535 | 3300025901 | Ga0207688_10002774 | Ga0207688_100027746 | 221 |
| 536 | 3300025903 | Ga0207680_10002798 | Ga0207680_100027985 | 221 |
| 537 | 3300025903 | Ga0207680_10015344 | Ga0207680_100153444 | 221 |
| 538 | 3300025907 | Ga0207645_10276852 | Ga0207645_102768522 | 221 |
| 539 | 3300025914 | Ga0207671_10002754 | Ga0207671_1000275411 | 221 |
| 540 | 3300025915 | Ga0207693_10000973 | Ga0207693_100009735 | 221 |
| 541 | 3300025915 | Ga0207693_10021101 | Ga0207693_100211014 | 221 |
| 542 | 3300025915 | Ga0207693_10344077 | Ga0207693_103440771 | 221 |
| 543 | 3300025915 | Ga0207693_10470163 | Ga0207693_104701631 | 221 |
| 544 | 3300025916 | Ga0207663_10037118 | Ga0207663_100371182 | 221 |
| 545 | 3300025916 | Ga0207663_10090650 | Ga0207663_100906502 | 221 |
| 546 | 3300025920 | Ga0207649_10126888 | Ga0207649_101268881 | 221 |
| 547 | 3300025924 | Ga0207694_10619936 | Ga0207694_106199362 | 221 |
| 548 | 3300025925 | Ga0207650_10519999 | Ga0207650_105199992 | 221 |
| 549 | 3300025926 | Ga0207659_10230975 | Ga0207659_102309752 | 221 |
| 550 | 3300025927 | Ga0207687_10011907 | Ga0207687_100119076 | 221 |
| 551 | 3300025927 | Ga0207687_10209394 | Ga0207687_102093943 | 221 |
| 552 | 3300025927 | Ga0207687_10325597 | Ga0207687_103255972 | 221 |
| 553 | 3300025928 | Ga0207700_10013143 | Ga0207700_100131433 | 221 |
| 554 | 3300025928 | Ga0207700_10029400 | Ga0207700_100294003 | 221 |
| 555 | 3300025928 | Ga0207700_10105953 | Ga0207700_101059532 | 221 |
| 556 | 3300025929 | Ga0207664_10005280 | Ga0207664_100052805 | 221 |
| 557 | 3300025929 | Ga0207664_10005496 | Ga0207664_100054963 | 221 |
| 558 | 3300025929 | Ga0207664_10022205 | Ga0207664_100222054 | 221 |
| 559 | 3300025929 | Ga0207664_10164987 | Ga0207664_101649872 | 221 |
| 560 | 3300025931 | Ga0207644_10090148 | Ga0207644_100901482 | 221 |
| 561 | 3300025932 | Ga0207690_10135083 | Ga0207690_101350832 | 221 |
| 562 | 3300025933 | Ga0207706_10001334 | Ga0207706_1000133423 | 221 |
| 563 | 3300025933 | Ga0207706_10233332 | Ga0207706_102333322 | 221 |
| 564 | 3300025941 | Ga0207711_10157448 | Ga0207711_101574482 | 221 |
| 565 | 3300025945 | Ga0207679_10163399 | Ga0207679_101633992 | 221 |
| 566 | 3300025960 | Ga0207651_10069787 | Ga0207651_100697873 | 221 |
| 567 | 3300025961 | Ga0207712_10005003 | Ga0207712_100050035 | 221 |
| 568 | 3300025972 | Ga0207668_10021186 | Ga0207668_100211863 | 221 |
| 569 | 3300025981 | Ga0207640_10101422 | Ga0207640_101014222 | 221 |
| 570 | 3300025986 | Ga0207658_10241123 | Ga0207658_102411232 | 221 |
| 571 | 3300026023 | Ga0207677_10066450 | Ga0207677_100664502 | 221 |
| 572 | 3300026067 | Ga0207678_10129748 | Ga0207678_101297482 | 221 |
| 573 | 3300026067 | Ga0207678_10135654 | Ga0207678_101356542 | 221 |
| 574 | 3300026075 | Ga0207708_10052367 | Ga0207708_100523674 | 221 |
| 575 | 3300026075 | Ga0207708_10286282 | Ga0207708_102862821 | 221 |
| 576 | 3300026078 | Ga0207702_10008203 | Ga0207702_100082035 | 221 |
| 577 | 3300026088 | Ga0207641_10016945 | Ga0207641_100169454 | 221 |
| 578 | 3300026095 | Ga0207676_10085785 | Ga0207676_100857851 | 221 |
| 579 | 3300026116 | Ga0207674_10134802 | Ga0207674_101348022 | 221 |
| 580 | 3300026118 | Ga0207675_100000719 | Ga0207675_10000071920 | 221 |
| 581 | 3300026118 | Ga0207675_100092563 | Ga0207675_1000925632 | 221 |
| 582 | 3300026118 | Ga0207675_100201565 | Ga0207675_1002015652 | 221 |
| 583 | 3300026118 | Ga0207675_100303029 | Ga0207675_1003030292 | 221 |
| 584 | 3300026121 | Ga0207683_10051363 | Ga0207683_100513633 | 221 |
| 585 | 3300027907 | Ga0207428_10036725 | Ga0207428_100367253 | 221 |
| 586 | 3300027907 | Ga0207428_10185293 | Ga0207428_101852932 | 221 |
| 587 | 3300027907 | Ga0207428_10384330 | Ga0207428_103843302 | 221 |
| 588 | 3300028379 | Ga0268266_10000264 | Ga0268266_1000026414 | 221 |
| 589 | 3300028379 | Ga0268266_10057759 | Ga0268266_100577591 | 221 |
| 590 | 3300031548 | Ga0307408_100055586 | Ga0307408_1000555863 | 221 |
| 591 | 3300031548 | Ga0307408_100188629 | Ga0307408_1001886292 | 221 |
| 592 | 3300031727 | Ga0316576_10001238 | Ga0316576_100012386 | 221 |
| 593 | 3300031728 | Ga0316578_10374019 | Ga0316578_103740191 | 221 |
| 594 | 3300031852 | Ga0307410_10181587 | Ga0307410_101815872 | 221 |
| 595 | 3300031911 | Ga0307412_10249233 | Ga0307412_102492332 | 221 |
| 596 | 3300031995 | Ga0307409_100201451 | Ga0307409_1002014512 | 221 |
| 597 | 3300032002 | Ga0307416_100037603 | Ga0307416_1000376033 | 221 |
| 598 | 3300032004 | Ga0307414_10666834 | Ga0307414_106668342 | 221 |
| 599 | 3300032005 | Ga0307411_10968294 | Ga0307411_109682941 | 221 |
| 600 | 3300032126 | Ga0307415_100140600 | Ga0307415_1001406002 | 221 |
| 601 | 3300035085 | Ga0373929_0033373 | Ga0373929_0033373_244_921 | 221 |
| 602 | 3300035111 | Ga0373923_0177436 | Ga0373923_0177436_197_898 | 221 |
| 603 | 3300035118 | Ga0373954_0041938 | Ga0373954_0041938_840_1541 | 221 |
| 604 | 3300035121 | Ga0373960_0062442 | Ga0373960_0062442_248_925 | 221 |
| 605 | 3300035172 | Ga0373955_0101654 | Ga0373955_0101654_32_733 | 221 |
| 606 | 3300035241 | Ga0373961_0009850 | Ga0373961_0009850_995_1672 | 221 |
| 607 | 3300035242 | Ga0373962_0033523 | Ga0373962_0033523_295_972 | 221 |
| 608 | 3300035398 | Ga0316574_0016972 | Ga0316574_0016972_1096_1833 | 221 |
| 609 | 3300035398 | Ga0316574_0021673 | Ga0316574_0021673_3073_3744 | 221 |
| 610 | 3300035398 | Ga0316574_0037326 | Ga0316574_0037326_158_832 | 221 |
| 611 | 3300035398 | Ga0316574_0104882 | Ga0316574_0104882_67_804 | 221 |
| 612 | 3300035410 | Ga0373924_0168182 | Ga0373924_0168182_160_861 | 221 |
| 613 | 3300035692 | Ga0373935_0176201 | Ga0373935_0176201_210_911 | 221 |
| 614 | 3300035724 | Ga0373933_0050068 | Ga0373933_0050068_396_1097 | 221 |
| 615 | 3300035725 | Ga0373947_0209587 | Ga0373947_0209587_127_828 | 221 |
| 616 | 3300036401 | Ga0373937_0034194 | Ga0373937_0034194_2740_3408 | 221 |
| 617 | 3300036401 | Ga0373937_0052600 | Ga0373937_0052600_2972_3673 | 221 |
| 618 | 3300036712 | Ga0316584_0002636 | Ga0316584_0002636_4512_5183 | 221 |
| 619 | 3300037418 | Ga0395900_0016044 | Ga0395900_0016044_3207_3905 | 221 |
| 620 | 3300037466 | Ga0395898_0004574 | Ga0395898_0004574_3629_4327 | 221 |
| 621 | 3300037466 | Ga0395898_0068180 | Ga0395898_0068180_2196_2873 | 221 |
| 622 | 3300037466 | Ga0395898_0585597 | Ga0395898_0585597_273_941 | 221 |
| 623 | 3300037466 | Ga0395898_1065946 | Ga0395898_1065946_27_704 | 221 |
| 624 | 3300037853 | Ga0436364_0010487 | Ga0436364_0010487_2041_2748 | 221 |
| 625 | 3300037853 | Ga0436364_0542331 | Ga0436364_0542331_1660_2373 | 221 |
| 626 | 3300039437 | Ga0436365_0571253 | Ga0436365_0571253_368_1126 | 221 |
| 627 | 3300039437 | Ga0436365_1161323 | Ga0436365_1161323_2399_3106 | 221 |
| 628 | 3300039437 | Ga0436365_1365717 | Ga0436365_1365717_5568_6281 | 221 |
| 629 | 3300039437 | Ga0436365_1793812 | Ga0436365_1793812_2412_3119 | 221 |
| 630 | 3300039450 | Ga0436363_0206518 | Ga0436363_0206518_699_1406 | 221 |
| 631 | 3300039450 | Ga0436363_0229649 | Ga0436363_0229649_644_1333 | 221 |
| 632 | 3300039450 | Ga0436363_1313806 | Ga0436363_1313806_500_1207 | 221 |
| 633 | 3300041491 | Ga0451833_1082468 | Ga0451833_1082468_109_789 | 221 |
| 634 | 3300041491 | Ga0451833_1482837 | Ga0451833_1482837_11_691 | 221 |
| 635 | 3300042993 | Ga0439440_0016519 | Ga0439440_0016519_459_1139 | 221 |
| 636 | 3300044656 | Ga0466969_0022883 | Ga0466969_0022883_1580_2278 | 221 |
| 637 | 3300044656 | Ga0466969_0110191 | Ga0466969_0110191_50_763 | 221 |
| 638 | 3300044693 | Ga0466961_0012908 | Ga0466961_0012908_3722_4420 | 221 |
| 639 | 3300044693 | Ga0466961_0146831 | Ga0466961_0146831_626_1339 | 221 |
| 640 | 3300044694 | Ga0466963_0014498 | Ga0466963_0014498_197_916 | 221 |
| 641 | 3300044694 | Ga0466963_0020293 | Ga0466963_0020293_2220_2918 | 221 |
| 642 | 3300044719 | Ga0466971_0252611 | Ga0466971_0252611_99_824 | 221 |
| 643 | 3300044735 | Ga0466968_0013257 | Ga0466968_0013257_1234_1908 | 221 |
| 644 | 3300044735 | Ga0466968_0270902 | Ga0466968_0270902_77_778 | 221 |
| 645 | 3300044765 | Ga0466970_0163892 | Ga0466970_0163892_88_786 | 221 |
| 646 | 3300044765 | Ga0466970_0266779 | Ga0466970_0266779_70_789 | 221 |
| 647 | 3300044842 | Ga0466957_0055689 | Ga0466957_0055689_242_940 | 221 |
| 648 | 3300044901 | Ga0466960_0088201 | Ga0466960_0088201_393_1067 | 221 |
| 649 | 3300045049 | Ga0466959_0007415 | Ga0466959_0007415_3824_4522 | 221 |
| 650 | 3300045049 | Ga0466959_0011169 | Ga0466959_0011169_1950_2648 | 221 |
| 651 | 3300045049 | Ga0466959_0031020 | Ga0466959_0031020_1030_1743 | 221 |
| 652 | 3300045049 | Ga0466959_0072220 | Ga0466959_0072220_1065_1820 | 221 |
| 653 | 3300045049 | Ga0466959_0309568 | Ga0466959_0309568_247_957 | 221 |
| 654 | 3300045836 | Ga0466958_0008325 | Ga0466958_0008325_4747_5433 | 221 |
| 655 | 3300045836 | Ga0466958_0013642 | Ga0466958_0013642_2153_2851 | 221 |
| 656 | 3300045836 | Ga0466958_0055073 | Ga0466958_0055073_770_1507 | 221 |
| 657 | 3300045836 | Ga0466958_0080476 | Ga0466958_0080476_123_842 | 221 |
| 658 | 3300045976 | Ga0466967_0011910 | Ga0466967_0011910_1776_2495 | 221 |
| 659 | 3300045976 | Ga0466967_0085871 | Ga0466967_0085871_595_1308 | 221 |
| 660 | 3300045976 | Ga0466967_0098664 | Ga0466967_0098664_372_1064 | 221 |
| 661 | 3300046454 | Ga0495592_0021079 | Ga0495592_0021079_352_1053 | 221 |
| 662 | 3300046459 | Ga0495629_0001073 | Ga0495629_0001073_5756_6421 | 221 |
| 663 | 3300046459 | Ga0495629_0079024 | Ga0495629_0079024_803_1504 | 221 |
| 664 | 3300046462 | Ga0495651_0002099 | Ga0495651_0002099_1972_2673 | 221 |
| 665 | 3300046463 | Ga0495653_0045652 | Ga0495653_0045652_446_1147 | 221 |
| 666 | 3300046463 | Ga0495653_0321453 | Ga0495653_0321453_87_755 | 221 |
| 667 | 3300046474 | Ga0495605_0094860 | Ga0495605_0094860_344_1018 | 221 |
| 668 | 3300046491 | Ga0495584_0089302 | Ga0495584_0089302_183_860 | 221 |
| 669 | 3300046511 | Ga0495608_0008068 | Ga0495608_0008068_1828_2529 | 221 |
| 670 | 3300046511 | Ga0495608_0309947 | Ga0495608_0309947_67_735 | 221 |
| 671 | 3300046514 | Ga0495618_0101668 | Ga0495618_0101668_47_748 | 221 |
| 672 | 3300046517 | Ga0495630_0212702 | Ga0495630_0212702_333_1034 | 221 |
| 673 | 3300046518 | Ga0495631_0068989 | Ga0495631_0068989_671_1348 | 221 |
| 674 | 3300046529 | Ga0495652_0149471 | Ga0495652_0149471_38_757 | 221 |
| 675 | 3300046529 | Ga0495652_0183137 | Ga0495652_0183137_553_1254 | 221 |
| 676 | 3300046533 | Ga0495640_0064308 | Ga0495640_0064308_1396_2097 | 221 |
| 677 | 3300046538 | Ga0495609_0078974 | Ga0495609_0078974_331_1008 | 221 |
| 678 | 3300046559 | Ga0495667_0001823 | Ga0495667_0001823_13215_13916 | 221 |
| 679 | 3300046616 | Ga0495668_0114374 | Ga0495668_0114374_190_864 | 221 |
| 680 | 3300046642 | Ga0495634_0022081 | Ga0495634_0022081_451_1152 | 221 |
| 681 | 3300046663 | Ga0495635_0048723 | Ga0495635_0048723_283_984 | 221 |
| 682 | 3300046663 | Ga0495635_0558260 | Ga0495635_0558260_36_737 | 221 |
| 683 | 3300046675 | Ga0495657_0005941 | Ga0495657_0005941_1785_2486 | 221 |
| 684 | 3300046678 | Ga0495599_0282846 | Ga0495599_0282846_208_909 | 221 |
| 685 | 3300046679 | Ga0495623_0018239 | Ga0495623_0018239_1951_2652 | 221 |
| 686 | 3300046680 | Ga0495646_0026711 | Ga0495646_0026711_2663_3364 | 221 |
| 687 | 3300046794 | Ga0495589_0070961 | Ga0495589_0070961_43_720 | 221 |
| 688 | 3300046809 | Ga0495600_0006420 | Ga0495600_0006420_4552_5253 | 221 |
| 689 | 3300046809 | Ga0495600_0117833 | Ga0495600_0117833_436_1104 | 221 |
| 690 | 3300047317 | Ga0495604_0015258 | Ga0495604_0015258_3367_4068 | 221 |
| 691 | 3300047317 | Ga0495604_0193820 | Ga0495604_0193820_688_1356 | 221 |
| 692 | 3300047319 | Ga0495674_0004844 | Ga0495674_0004844_7281_7982 | 221 |
| 693 | 3300047322 | Ga0495680_0001510 | Ga0495680_0001510_22044_22745 | 221 |
| 694 | 3300047322 | Ga0495680_0101687 | Ga0495680_0101687_673_1341 | 221 |
| 695 | 3300047444 | Ga0495675_0046462 | Ga0495675_0046462_1109_1810 | 221 |
| 696 | 3300047445 | Ga0495677_0075084 | Ga0495677_0075084_69_746 | 221 |
| 697 | 3300047471 | Ga0495684_0002969 | Ga0495684_0002969_133_882 | 221 |
| 698 | 3300047471 | Ga0495684_0016341 | Ga0495684_0016341_1863_2564 | 221 |
| 699 | 3300048088 | Ga0495602_0011043 | Ga0495602_0011043_6269_6970 | 221 |
| 700 | 3300048903 | Ga0496100_0042526 | Ga0496100_0042526_1347_2015 | 221 |
| 701 | 3300048904 | Ga0496101_0053587 | Ga0496101_0053587_984_1652 | 221 |
| 702 | 3300048905 | Ga0496102_0054230 | Ga0496102_0054230_1001_1687 | 221 |
| 703 | 3300048905 | Ga0496102_0180737 | Ga0496102_0180737_360_1028 | 221 |
| 704 | 3300048907 | Ga0496104_0007864 | Ga0496104_0007864_5206_5874 | 221 |
| 705 | 3300048907 | Ga0496104_0008408 | Ga0496104_0008408_7482_8183 | 221 |
| 706 | 3300048907 | Ga0496104_0030618 | Ga0496104_0030618_3750_4418 | 221 |
| 707 | 3300048907 | Ga0496104_0618363 | Ga0496104_0618363_151_834 | 221 |
| 708 | 3300048908 | Ga0496105_0040907 | Ga0496105_0040907_1270_1938 | 221 |
| 709 | 3300048908 | Ga0496105_0046802 | Ga0496105_0046802_1880_2548 | 221 |
| 710 | 3300048908 | Ga0496105_0069644 | Ga0496105_0069644_148_831 | 221 |
| 711 | 3300048910 | Ga0496107_0098184 | Ga0496107_0098184_48_731 | 221 |
| 712 | 3300048911 | Ga0496108_0006421 | Ga0496108_0006421_6641_7309 | 221 |
| 713 | 3300048911 | Ga0496108_0470868 | Ga0496108_0470868_320_1003 | 221 |
| 714 | 3300048911 | Ga0496108_0911966 | Ga0496108_0911966_29_712 | 221 |
| 715 | 3300048912 | Ga0496109_0018048 | Ga0496109_0018048_1289_1972 | 221 |
| 716 | 3300048912 | Ga0496109_0022852 | Ga0496109_0022852_1411_2079 | 221 |
| 717 | 3300048912 | Ga0496109_0037440 | Ga0496109_0037440_3318_4001 | 221 |
| 718 | 3300048912 | Ga0496109_0384564 | Ga0496109_0384564_47_748 | 221 |
| 719 | 3300048913 | Ga0496110_0101325 | Ga0496110_0101325_1763_2431 | 221 |
| 720 | 3300048913 | Ga0496110_0496227 | Ga0496110_0496227_50_733 | 221 |
| 721 | 3300048914 | Ga0496111_0051797 | Ga0496111_0051797_2261_2944 | 221 |
| 722 | 3300048914 | Ga0496111_0065395 | Ga0496111_0065395_715_1383 | 221 |
| 723 | 3300048915 | Ga0496112_0001981 | Ga0496112_0001981_102_803 | 221 |
| 724 | 3300048915 | Ga0496112_0031970 | Ga0496112_0031970_817_1485 | 221 |
| 725 | 3300048915 | Ga0496112_0065627 | Ga0496112_0065627_472_1155 | 221 |
| 726 | 3300048915 | Ga0496112_0140296 | Ga0496112_0140296_21_704 | 221 |
| 727 | 3300048915 | Ga0496112_0447125 | Ga0496112_0447125_220_903 | 221 |
| 728 | 3300048916 | Ga0496113_0001428 | Ga0496113_0001428_8246_8914 | 221 |
| 729 | 3300048916 | Ga0496113_0043838 | Ga0496113_0043838_1786_2469 | 221 |
| 730 | 3300048916 | Ga0496113_0296630 | Ga0496113_0296630_522_1205 | 221 |
| 731 | 3300048917 | Ga0496114_0000039 | Ga0496114_0000039_115231_115896 | 221 |
| 732 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_19040_19705 | 221 |
| 733 | 3300048922 | Ga0496119_0027970 | Ga0496119_0027970_2520_3188 | 221 |
| 734 | 3300048924 | Ga0496121_0019533 | Ga0496121_0019533_1026_1694 | 221 |
| 735 | 3300048927 | Ga0496124_0067218 | Ga0496124_0067218_1264_1932 | 221 |
| 736 | 3300048927 | Ga0496124_0549330 | Ga0496124_0549330_35_703 | 221 |
| 737 | 3300048928 | Ga0496125_0096039 | Ga0496125_0096039_952_1620 | 221 |
| 738 | 3300049568 | Ga0501031_0054056 | Ga0501031_0054056_1669_2364 | 221 |
| 739 | 3300049570 | Ga0501033_0029197 | Ga0501033_0029197_2460_3137 | 221 |
| 740 | 3300049570 | Ga0501033_0428248 | Ga0501033_0428248_175_849 | 221 |
| 741 | 3300049571 | Ga0501034_0003187 | Ga0501034_0003187_13691_14365 | 221 |
| 742 | 3300049571 | Ga0501034_0126926 | Ga0501034_0126926_557_1231 | 221 |
| 743 | 3300049571 | Ga0501034_0731497 | Ga0501034_0731497_152_826 | 221 |
| 744 | 3300049574 | Ga0501038_0272233 | Ga0501038_0272233_576_1256 | 221 |
| 745 | 3300049575 | Ga0501039_0006140 | Ga0501039_0006140_3341_4021 | 221 |
| 746 | 3300049575 | Ga0501039_0009459 | Ga0501039_0009459_914_1591 | 221 |
| 747 | 3300049575 | Ga0501039_0194688 | Ga0501039_0194688_415_1095 | 221 |
| 748 | 3300049578 | Ga0501042_0441600 | Ga0501042_0441600_73_750 | 221 |
| 749 | 3300049580 | Ga0501046_0073043 | Ga0501046_0073043_1031_1708 | 221 |
| 750 | 3300049581 | Ga0501047_0057719 | Ga0501047_0057719_1944_2630 | 221 |
| 751 | 3300049581 | Ga0501047_0162580 | Ga0501047_0162580_1212_1886 | 221 |
| 752 | 3300049581 | Ga0501047_0297894 | Ga0501047_0297894_514_1191 | 221 |
| 753 | 3300049582 | Ga0501048_0006014 | Ga0501048_0006014_1251_1928 | 221 |
| 754 | 3300049583 | Ga0501067_0028935 | Ga0501067_0028935_1277_1954 | 221 |
| 755 | 3300049586 | Ga0501070_0026130 | Ga0501070_0026130_514_1191 | 221 |
| 756 | 3300049587 | Ga0501071_0179004 | Ga0501071_0179004_130_816 | 221 |
| 757 | 3300049587 | Ga0501071_0460484 | Ga0501071_0460484_238_912 | 221 |
| 758 | 3300049588 | Ga0501072_0065940 | Ga0501072_0065940_156_842 | 221 |
| 759 | 3300049588 | Ga0501072_0185227 | Ga0501072_0185227_708_1385 | 221 |
| 760 | 3300049589 | Ga0501073_0034340 | Ga0501073_0034340_1668_2345 | 221 |
| 761 | 3300049590 | Ga0501074_0006507 | Ga0501074_0006507_7688_8365 | 221 |
| 762 | 3300049590 | Ga0501074_0290348 | Ga0501074_0290348_366_1046 | 221 |
| 763 | 3300049591 | Ga0501075_0307525 | Ga0501075_0307525_96_773 | 221 |
| 764 | 3300049592 | Ga0501076_0171516 | Ga0501076_0171516_255_935 | 221 |
| 765 | 3300049742 | Ga0501080_0101344 | Ga0501080_0101344_1088_1765 | 221 |
| 766 | 3300049743 | Ga0501081_0133135 | Ga0501081_0133135_304_990 | 221 |
| 767 | 3300049744 | Ga0501083_0005694 | Ga0501083_0005694_6190_6876 | 221 |
| 768 | 3300049822 | Ga0501035_0050285 | Ga0501035_0050285_834_1511 | 221 |
| 769 | 3300049823 | Ga0501044_0041349 | Ga0501044_0041349_4096_4770 | 221 |
| 770 | 3300049823 | Ga0501044_0089806 | Ga0501044_0089806_1157_1834 | 221 |
| 771 | 3300049824 | Ga0501045_0049890 | Ga0501045_0049890_38_718 | 221 |
| 772 | 3300050491 | nmdc:mga00v17_360519_c1 | nmdc:mga00v17_360519_c1_46_720 | 221 |
| 773 | 3300050492 | nmdc:mga0yw44_127290_c1 | nmdc:mga0yw44_127290_c1_642_1322 | 221 |
| 774 | 3300050494 | nmdc:mga06z11_501394_c1 | nmdc:mga06z11_501394_c1_14_688 | 221 |
| 775 | 3300050507 | nmdc:mga05p37_2378_c1 | nmdc:mga05p37_2378_c1_3268_3945 | 221 |
| 776 | 3300050507 | nmdc:mga05p37_553607_c1 | nmdc:mga05p37_553607_c1_63_740 | 221 |
| 777 | 3300050507 | nmdc:mga05p37_648709_c1 | nmdc:mga05p37_648709_c1_174_851 | 221 |
| 778 | 3300050508 | nmdc:mga09592_57297_c1 | nmdc:mga09592_57297_c1_1844_2521 | 221 |
| 779 | 3300050508 | nmdc:mga09592_73589_c1 | nmdc:mga09592_73589_c1_730_1407 | 221 |
| 780 | 3300050509 | nmdc:mga0qj67_149296_c1 | nmdc:mga0qj67_149296_c1_828_1505 | 221 |
| 781 | 3300050509 | nmdc:mga0qj67_164512_c1 | nmdc:mga0qj67_164512_c1_732_1409 | 221 |
| 782 | 3300050509 | nmdc:mga0qj67_249969_c1 | nmdc:mga0qj67_249969_c1_133_804 | 221 |
| 783 | 3300050509 | nmdc:mga0qj67_8054_c1 | nmdc:mga0qj67_8054_c1_6075_6752 | 221 |
| 784 | 3300050510 | nmdc:mga06r32_12359_c1 | nmdc:mga06r32_12359_c1_3686_4363 | 221 |
| 785 | 3300050510 | nmdc:mga06r32_26183_c1 | nmdc:mga06r32_26183_c1_1592_2260 | 221 |
| 786 | 3300050511 | nmdc:mga08y16_11398_c1 | nmdc:mga08y16_11398_c1_6600_7268 | 221 |
| 787 | 3300050511 | nmdc:mga08y16_16213_c1 | nmdc:mga08y16_16213_c1_2201_2878 | 221 |
| 788 | 3300050511 | nmdc:mga08y16_291606_c1 | nmdc:mga08y16_291606_c1_956_1630 | 221 |
| 789 | 3300050512 | nmdc:mga0n895_36727_c1 | nmdc:mga0n895_36727_c1_4004_4672 | 221 |
| 790 | 3300050513 | nmdc:mga0rr50_649258_c1 | nmdc:mga0rr50_649258_c1_178_855 | 221 |
| 791 | 3300050513 | nmdc:mga0rr50_75744_c1 | nmdc:mga0rr50_75744_c1_1224_1892 | 221 |
| 792 | 3300050515 | nmdc:mga0a205_38823_c1 | nmdc:mga0a205_38823_c1_1765_2442 | 221 |
| 793 | 3300050515 | nmdc:mga0a205_58039_c1 | nmdc:mga0a205_58039_c1_1265_1933 | 221 |
| 794 | 3300053078 | Ga0495612_0044279 | Ga0495612_0044279_844_1545 | 221 |
| 795 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_291677_292342 | 221 |
| 796 | 3300053084 | Ga0495595_0009076 | Ga0495595_0009076_2130_2831 | 221 |
| 797 | 3300053085 | Ga0495619_0011140 | Ga0495619_0011140_1615_2283 | 221 |
| 798 | 3300053085 | Ga0495619_0287251 | Ga0495619_0287251_187_882 | 221 |
| 799 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_380346_381011 | 221 |
| 800 | 3300053153 | Ga0500616_0000088 | Ga0500616_0000088_10293_11144 | 221 |
| 801 | 3300054114 | Ga0501084_0043748 | Ga0501084_0043748_2140_2817 | 221 |
| 802 | 3300059426 | Ga0590077_040690 | Ga0590077_040690_339_1016 | 221 |
| 803 | 3300060353 | Ga0501082_0039503 | Ga0501082_0039503_1059_1736 | 221 |
| 804 | 3300061719 | Ga0466962_0013632 | Ga0466962_0013632_1008_1706 | 221 |
| 805 | 3300061719 | Ga0466962_0099200 | Ga0466962_0099200_137_823 | 221 |
| 806 | 3300061734 | Ga0530510_0047037 | Ga0530510_0047037_1120_1806 | 221 |
| 807 | 3300001979 | JGI24740J21852_10009389 | JGI24740J21852_100093893 | 222 |
| 808 | 3300003659 | JGI25404J52841_10000671 | JGI25404J52841_100006716 | 222 |
| 809 | 3300005337 | Ga0070682_100076729 | Ga0070682_1000767293 | 222 |
| 810 | 3300005340 | Ga0070689_100397814 | Ga0070689_1003978142 | 222 |
| 811 | 3300005366 | Ga0070659_100000037 | Ga0070659_100000037102 | 222 |
| 812 | 3300005435 | Ga0070714_100046191 | Ga0070714_1000461915 | 222 |
| 813 | 3300005437 | Ga0070710_10000050 | Ga0070710_1000005042 | 222 |
| 814 | 3300005439 | Ga0070711_100014891 | Ga0070711_1000148913 | 222 |
| 815 | 3300005441 | Ga0070700_100194564 | Ga0070700_1001945642 | 222 |
| 816 | 3300005456 | Ga0070678_100039455 | Ga0070678_1000394552 | 222 |
| 817 | 3300005466 | Ga0070685_10184968 | Ga0070685_101849682 | 222 |
| 818 | 3300005471 | Ga0070698_100495889 | Ga0070698_1004958892 | 222 |
| 819 | 3300005544 | Ga0070686_100046138 | Ga0070686_1000461382 | 222 |
| 820 | 3300005548 | Ga0070665_100000135 | Ga0070665_100000135116 | 222 |
| 821 | 3300005548 | Ga0070665_100382029 | Ga0070665_1003820292 | 222 |
| 822 | 3300005842 | Ga0068858_100000142 | Ga0068858_10000014264 | 222 |
| 823 | 3300005981 | Ga0081538_10023738 | Ga0081538_100237384 | 222 |
| 824 | 3300005983 | Ga0081540_1000041 | Ga0081540_100004182 | 222 |
| 825 | 3300005985 | Ga0081539_10004211 | Ga0081539_1000421113 | 222 |
| 826 | 3300006028 | Ga0070717_10000019 | Ga0070717_10000019157 | 222 |
| 827 | 3300006038 | Ga0075365_10002584 | Ga0075365_100025849 | 222 |
| 828 | 3300006038 | Ga0075365_10005531 | Ga0075365_100055319 | 222 |
| 829 | 3300006038 | Ga0075365_10219697 | Ga0075365_102196972 | 222 |
| 830 | 3300006048 | Ga0075363_100160108 | Ga0075363_1001601082 | 222 |
| 831 | 3300006051 | Ga0075364_10007011 | Ga0075364_100070118 | 222 |
| 832 | 3300006163 | Ga0070715_10034603 | Ga0070715_100346032 | 222 |
| 833 | 3300006175 | Ga0070712_100013243 | Ga0070712_1000132432 | 222 |
| 834 | 3300006178 | Ga0075367_10084473 | Ga0075367_100844733 | 222 |
| 835 | 3300006846 | Ga0075430_100393300 | Ga0075430_1003933002 | 222 |
| 836 | 3300006847 | Ga0075431_100001949 | Ga0075431_10000194913 | 222 |
| 837 | 3300006852 | Ga0075433_10067739 | Ga0075433_100677393 | 222 |
| 838 | 3300006871 | Ga0075434_100023133 | Ga0075434_1000231334 | 222 |
| 839 | 3300007076 | Ga0075435_100142714 | Ga0075435_1001427142 | 222 |
| 840 | 3300009094 | Ga0111539_10003327 | Ga0111539_100033279 | 222 |
| 841 | 3300009098 | Ga0105245_10013871 | Ga0105245_100138712 | 222 |
| 842 | 3300009101 | Ga0105247_10000278 | Ga0105247_1000027827 | 222 |
| 843 | 3300009101 | Ga0105247_10265383 | Ga0105247_102653832 | 222 |
| 844 | 3300009147 | Ga0114129_10138603 | Ga0114129_101386033 | 222 |
| 845 | 3300009147 | Ga0114129_10139126 | Ga0114129_101391262 | 222 |
| 846 | 3300009148 | Ga0105243_10316197 | Ga0105243_103161973 | 222 |
| 847 | 3300009176 | Ga0105242_10000921 | Ga0105242_1000092120 | 222 |
| 848 | 3300009176 | Ga0105242_10175064 | Ga0105242_101750642 | 222 |
| 849 | 3300009177 | Ga0105248_11075962 | Ga0105248_110759621 | 222 |
| 850 | 3300009545 | Ga0105237_10798121 | Ga0105237_107981211 | 222 |
| 851 | 3300009553 | Ga0105249_10110695 | Ga0105249_101106951 | 222 |
| 852 | 3300010375 | Ga0105239_10027346 | Ga0105239_100273463 | 222 |
| 853 | 3300013308 | Ga0157375_10046031 | Ga0157375_100460313 | 222 |
| 854 | 3300014968 | Ga0157379_10034982 | Ga0157379_100349823 | 222 |
| 855 | 3300014968 | Ga0157379_10161357 | Ga0157379_101613573 | 222 |
| 856 | 3300014969 | Ga0157376_10065116 | Ga0157376_100651163 | 222 |
| 857 | 3300025898 | Ga0207692_10000022 | Ga0207692_1000002227 | 222 |
| 858 | 3300025898 | Ga0207692_10219666 | Ga0207692_102196662 | 222 |
| 859 | 3300025900 | Ga0207710_10113705 | Ga0207710_101137052 | 222 |
| 860 | 3300025915 | Ga0207693_10002823 | Ga0207693_100028238 | 222 |
| 861 | 3300025919 | Ga0207657_10017590 | Ga0207657_100175904 | 222 |
| 862 | 3300025924 | Ga0207694_10000063 | Ga0207694_1000006326 | 222 |
| 863 | 3300025927 | Ga0207687_10000073 | Ga0207687_1000007329 | 222 |
| 864 | 3300025927 | Ga0207687_10096766 | Ga0207687_100967662 | 222 |
| 865 | 3300025929 | Ga0207664_10007154 | Ga0207664_100071544 | 222 |
| 866 | 3300025932 | Ga0207690_10000268 | Ga0207690_1000026817 | 222 |
| 867 | 3300025935 | Ga0207709_10592968 | Ga0207709_105929682 | 222 |
| 868 | 3300025941 | Ga0207711_10727015 | Ga0207711_107270151 | 222 |
| 869 | 3300025961 | Ga0207712_10032585 | Ga0207712_100325852 | 222 |
| 870 | 3300025986 | Ga0207658_10108203 | Ga0207658_101082033 | 222 |
| 871 | 3300026035 | Ga0207703_10001891 | Ga0207703_100018914 | 222 |
| 872 | 3300026075 | Ga0207708_10219667 | Ga0207708_102196672 | 222 |
| 873 | 3300026121 | Ga0207683_10031350 | Ga0207683_100313506 | 222 |
| 874 | 3300027907 | Ga0207428_10012187 | Ga0207428_100121874 | 222 |
| 875 | 3300028379 | Ga0268266_10000056 | Ga0268266_10000056265 | 222 |
| 876 | 3300028381 | Ga0268264_10030488 | Ga0268264_100304884 | 222 |
| 877 | 3300028381 | Ga0268264_10409716 | Ga0268264_104097162 | 222 |
| 878 | 3300028558 | Ga0265326_10000032 | Ga0265326_1000003212 | 222 |
| 879 | 3300028563 | Ga0265319_1003766 | Ga0265319_10037667 | 222 |
| 880 | 3300028573 | Ga0265334_10000002 | Ga0265334_1000000228 | 222 |
| 881 | 3300028666 | Ga0265336_10013975 | Ga0265336_100139752 | 222 |
| 882 | 3300028800 | Ga0265338_10008302 | Ga0265338_100083025 | 222 |
| 883 | 3300031240 | Ga0265320_10029734 | Ga0265320_100297343 | 222 |
| 884 | 3300032126 | Ga0307415_100177561 | Ga0307415_1001775612 | 222 |
| 885 | 3300037312 | Ga0395899_0126418 | Ga0395899_0126418_1125_1796 | 222 |
| 886 | 3300037418 | Ga0395900_0010493 | Ga0395900_0010493_4851_5522 | 222 |
| 887 | 3300037418 | Ga0395900_0060412 | Ga0395900_0060412_1042_1716 | 222 |
| 888 | 3300037466 | Ga0395898_0004703 | Ga0395898_0004703_13506_14177 | 222 |
| 889 | 3300037466 | Ga0395898_0026202 | Ga0395898_0026202_371_1045 | 222 |
| 890 | 3300037471 | Ga0395905_0016135 | Ga0395905_0016135_4259_4930 | 222 |
| 891 | 3300038443 | Ga0395901_0013495 | Ga0395901_0013495_7185_7859 | 222 |
| 892 | 3300038443 | Ga0395901_0342406 | Ga0395901_0342406_225_896 | 222 |
| 893 | 3300041486 | Ga0451807_0784867 | Ga0451807_0784867_204_872 | 222 |
| 894 | 3300044765 | Ga0466970_0013041 | Ga0466970_0013041_3267_3983 | 222 |
| 895 | 3300046454 | Ga0495592_0265974 | Ga0495592_0265974_416_1087 | 222 |
| 896 | 3300046455 | Ga0495603_0037440 | Ga0495603_0037440_681_1355 | 222 |
| 897 | 3300046462 | Ga0495651_0114540 | Ga0495651_0114540_90_761 | 222 |
| 898 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_163870_164541 | 222 |
| 899 | 3300046473 | Ga0495582_0221603 | Ga0495582_0221603_35_709 | 222 |
| 900 | 3300046529 | Ga0495652_0000037 | Ga0495652_0000037_107813_108484 | 222 |
| 901 | 3300046533 | Ga0495640_0017150 | Ga0495640_0017150_2441_3115 | 222 |
| 902 | 3300046536 | Ga0495587_0011445 | Ga0495587_0011445_444_1112 | 222 |
| 903 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_287476_288147 | 222 |
| 904 | 3300047319 | Ga0495674_0000030 | Ga0495674_0000030_108019_108693 | 222 |
| 905 | 3300047320 | Ga0495672_0031867 | Ga0495672_0031867_1455_2171 | 222 |
| 906 | 3300047320 | Ga0495672_0122459 | Ga0495672_0122459_545_1213 | 222 |
| 907 | 3300047321 | Ga0495676_0201175 | Ga0495676_0201175_217_891 | 222 |
| 908 | 3300047322 | Ga0495680_0225701 | Ga0495680_0225701_606_1274 | 222 |
| 909 | 3300047444 | Ga0495675_0037207 | Ga0495675_0037207_579_1247 | 222 |
| 910 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_251894_252562 | 222 |
| 911 | 3300048903 | Ga0496100_0165567 | Ga0496100_0165567_487_1161 | 222 |
| 912 | 3300048904 | Ga0496101_0048339 | Ga0496101_0048339_1805_2479 | 222 |
| 913 | 3300048905 | Ga0496102_0002380 | Ga0496102_0002380_8736_9410 | 222 |
| 914 | 3300048905 | Ga0496102_0558765 | Ga0496102_0558765_271_948 | 222 |
| 915 | 3300048906 | Ga0496103_0002129 | Ga0496103_0002129_4148_4822 | 222 |
| 916 | 3300048906 | Ga0496103_0075882 | Ga0496103_0075882_1340_2014 | 222 |
| 917 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_354055_354723 | 222 |
| 918 | 3300048907 | Ga0496104_0018623 | Ga0496104_0018623_4898_5572 | 222 |
| 919 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_121076_121744 | 222 |
| 920 | 3300048908 | Ga0496105_0006317 | Ga0496105_0006317_5476_6147 | 222 |
| 921 | 3300048909 | Ga0496106_0019325 | Ga0496106_0019325_230_904 | 222 |
| 922 | 3300048910 | Ga0496107_0014411 | Ga0496107_0014411_688_1362 | 222 |
| 923 | 3300048911 | Ga0496108_0089811 | Ga0496108_0089811_1172_1846 | 222 |
| 924 | 3300048912 | Ga0496109_0156371 | Ga0496109_0156371_752_1426 | 222 |
| 925 | 3300048914 | Ga0496111_0005951 | Ga0496111_0005951_2291_2965 | 222 |
| 926 | 3300048915 | Ga0496112_0208420 | Ga0496112_0208420_34_708 | 222 |
| 927 | 3300048916 | Ga0496113_0025783 | Ga0496113_0025783_2257_2931 | 222 |
| 928 | 3300048917 | Ga0496114_0088870 | Ga0496114_0088870_753_1427 | 222 |
| 929 | 3300048922 | Ga0496119_0019221 | Ga0496119_0019221_3616_4284 | 222 |
| 930 | 3300049571 | Ga0501034_0029121 | Ga0501034_0029121_3704_4387 | 222 |
| 931 | 3300049592 | Ga0501076_0098262 | Ga0501076_0098262_981_1652 | 222 |
| 932 | 3300050491 | nmdc:mga00v17_199151_c1 | nmdc:mga00v17_199151_c1_546_1217 | 222 |
| 933 | 3300050492 | nmdc:mga0yw44_239017_c1 | nmdc:mga0yw44_239017_c1_339_1010 | 222 |
| 934 | 3300050492 | nmdc:mga0yw44_7514_c1 | nmdc:mga0yw44_7514_c1_2167_2838 | 222 |
| 935 | 3300050507 | nmdc:mga05p37_142175_c1 | nmdc:mga05p37_142175_c1_730_1401 | 222 |
| 936 | 3300050507 | nmdc:mga05p37_413378_c1 | nmdc:mga05p37_413378_c1_198_869 | 222 |
| 937 | 3300050509 | nmdc:mga0qj67_435827_c1 | nmdc:mga0qj67_435827_c1_61_732 | 222 |
| 938 | 3300050510 | nmdc:mga06r32_6902_c1 | nmdc:mga06r32_6902_c1_731_1402 | 222 |
| 939 | 3300050511 | nmdc:mga08y16_9364_c1 | nmdc:mga08y16_9364_c1_4613_5284 | 222 |
| 940 | 3300050512 | nmdc:mga0n895_17599_c1 | nmdc:mga0n895_17599_c1_2628_3299 | 222 |
| 941 | 3300050513 | nmdc:mga0rr50_115453_c1 | nmdc:mga0rr50_115453_c1_394_1098 | 222 |
| 942 | 3300050515 | nmdc:mga0a205_25902_c1 | nmdc:mga0a205_25902_c1_3614_4285 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4onc-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 | 0.9588 | 3 | 217 |
| 4onc-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 | 0.9575 | 3 | 219 |
| 2vg3-assembly1.cif.gz_A | rv2361 with citronellyl pyrophosphate | 0.9545 | 3 | 219 |
| 1x07-assembly1.cif.gz_A | crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp | 0.9543 | 4 | 211 |
| 6w2l-assembly1.cif.gz_A | crystal structure of human dehydrodolichyl diphosphate synthase (ngbr/dhdds) in complex with mg and ipp | 0.9506 | 2 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XJ03_13_283_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9598 | 2 | 212 | 3.40.1180.10 |
| 2vg2A01 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9583 | 3 | 214 | 3.40.1180.10 |
| af_Q5FC21_4_262_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9575 | 2 | 212 | 3.40.1180.10 |
| af_Q99KU1_5_249_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9554 | 2 | 212 | 3.40.1180.10 |
| af_O14171_12_259_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9552 | 2 | 213 | 3.40.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0LNI3-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9968 | 4 | 136 |
GO:0000287
GO:0005829 GO:0008834 GO:0016094 GO:0030145 GO:0045547 |
| AF-A0A3C0PPZ8-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.989 | 1 | 117 |
GO:0016094
GO:0045547 |
| AF-A0A833D0S6-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9833 | 4 | 138 |
GO:0016094
GO:0045547 |
| AF-A0A2E0GQ45-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.982 | 4 | 141 |
GO:0016094
GO:0045547 |
| AF-A0A7W0N335-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9817 | 12 | 137 |
GO:0008834
GO:0016094 GO:0045547 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar