F486336

General Info

Members Datasets Scaffolds Average Seq Length
941 581 731 349

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0052810|Ga0466963_0052810_1107_2351
Length 414
Sequence MRSRIHEFSVVPANAGAHNHRTRLLRHLGAASVPDHHGLWLWVPDRHSRCSLVRDDSGVWRMSETLSADMLKPVEDRGGVAQPLLEVKGLTKHFPVRGDLFSARKTVRAVDDVSFAVMKGETVGIVGESGCGKSTTARLLMHLMARDAGDIVYDGMQVGASLSLRELRRGMQMVFQDSYASLNPRLTVEESIAFGPKVHGMADGAARKLARELLGKVGLRPDIFANRYPHEISGGQRQRVNIARALALSPRLVILDEAVSALDKSVEAQVLNLLADLKREFGLTYLFISHDLNVVRYISDRVLVMYLGEVVELGPVDEVWDHPAHPYTRALLAAMPSSDPDRRTETPPISGDPPNPIDPPPGCRFHTRCPFAEPLCAKATPKLTALDKMGHEAACYMAIAGSGHSRAPKGVNAA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
23 2547132374 Acidovorax radicis N35 Isolate Unclassified
24 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
25 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2643221717 Acidovorax sp. Root267 Isolate Unclassified
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355199
33 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
34 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
35 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
36 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
37 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
38 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
39 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
40 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
41 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
42 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
43 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
44 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
45 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
46 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
47 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
48 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
49 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
50 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
51 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
52 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
53 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
54 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
55 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
64 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
65 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
66 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
67 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
68 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
69 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
70 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
71 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
72 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
73 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
74 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
75 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
76 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
77 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
78 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
79 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
80 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
81 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
92 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
93 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
94 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
95 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
96 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
97 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
98 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
99 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
100 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
101 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
102 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
103 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
104 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
105 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
106 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
107 2922368715
108 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
109 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
110 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
111 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
112 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
113 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
114 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
115 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
116 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
117 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
118 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
119 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
120 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
121 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
122 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
123 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
124 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
125 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
126 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
127 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
128 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
129 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
130 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
131 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
132 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
133 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
134 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
135 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
136 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
137 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
138 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
139 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
140 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
141 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
142 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
143 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
144 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
145 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
146 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
147 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
148 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
149 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
150 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
151 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
152 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
153 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
154 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
155 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
156 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
157 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
158 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
159 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
160 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
161 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
162 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
163 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
164 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
165 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
166 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
167 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
168 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
169 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
170 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
171 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
172 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
173 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
174 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
175 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
176 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
177 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
178 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
179 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
180 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
181 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
182 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
183 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
184 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
185 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
186 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
187 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
188 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
189 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
190 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
191 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
192 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
193 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
194 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
195 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
196 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
197 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
198 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
199 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
200 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
201 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
202 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
203 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
204 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
205 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
206 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
207 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
208 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
209 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
210 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
211 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
212 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
213 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
214 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
215 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
216 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
217 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
218 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
219 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
220 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
221 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
222 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
223 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
224 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
225 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
226 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
227 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
228 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
229 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
230 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
231 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
232 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
233 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
234 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
235 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
236 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
237 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
238 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
239 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
240 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
241 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
242 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
243 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
244 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
245 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
246 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
247 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
248 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
249 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
250 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
251 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
252 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
253 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
254 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
255 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
256 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
257 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
258 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
259 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
260 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
261 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
262 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
263 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
264 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
265 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
266 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
267 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
268 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
269 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
270 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
271 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
272 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
275 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
279 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
281 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
326 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
327 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
328 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
329 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
331 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
335 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
336 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
337 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
338 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
339 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
340 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
341 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
342 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
343 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
344 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
345 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
346 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
347 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
348 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
349 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
350 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
351 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
352 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
353 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
354 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
355 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
356 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
357 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
358 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
359 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
360 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
361 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
362 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
363 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
364 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
365 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
366 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
367 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
368 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
369 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
370 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
371 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
372 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
373 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
374 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
375 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
376 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
377 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
378 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
379 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
380 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
381 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
382 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
383 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
384 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
385 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
386 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
387 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
388 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
389 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
390 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
391 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
392 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
393 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
394 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
395 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
396 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
397 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
398 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
399 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
400 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
401 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
402 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
403 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
404 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
405 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
406 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
407 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
408 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
409 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
410 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
411 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
412 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
413 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
414 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
415 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
416 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
417 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
418 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
419 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
420 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
421 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
422 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
423 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
424 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
425 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
426 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
427 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
428 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
429 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
430 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
431 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
432 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
433 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
434 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
435 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
436 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
437 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
438 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
439 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
440 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
441 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
442 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
443 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
444 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
445 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
446 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
447 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
448 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
449 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
450 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
451 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
452 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
453 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
454 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
455 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
456 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
457 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
458 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
459 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
460 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
461 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
462 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
463 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
464 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
465 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
466 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
467 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
468 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
469 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
470 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
471 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
472 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
473 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
474 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
475 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
476 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
477 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
478 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
479 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
480 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
481 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
482 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
483 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
484 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
485 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
486 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
487 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
488 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
489 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
490 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
491 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
492 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
493 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
494 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
495 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
496 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
497 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
498 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
499 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
500 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
501 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
502 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
503 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
504 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
505 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
506 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
507 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
508 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
509 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
510 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
511 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
512 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
513 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
514 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
515 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
516 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
517 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
518 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
519 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
520 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
521 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
522 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
523 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
524 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
525 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
526 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
527 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
528 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
529 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
530 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
531 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
532 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
533 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
534 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
535 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
536 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
537 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
538 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
539 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
540 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
541 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
542 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
543 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
544 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
545 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
546 641522639 Methylobacterium sp. 4-46 Isolate Nodule
547 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
548 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
549 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
550 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
551 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
552 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
553 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
554 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
555 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
556 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
557 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
558 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
559 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
560 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
561 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
562 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
563 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
564 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
565 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
566 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
567 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
568 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
569 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
570 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
571 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
572 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
573 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
574 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
575 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
576 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
577 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
578 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
579 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
580 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
581 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.85
Metatranscriptomes 0
Isolates 22.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.62
Nodule 17.22
Rhizoplane 4.68
Rhizosphere 47.93
Stem 0
Stem Tuber 0
Unclassified 14.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10013094 3300002077 Bacteria 1675
2 JGI24742J22300_10010775 3300002244 Bacteria 1514
3 JGI25151J46595_10002288 3300003187 Bacteria 11731
4 JGI25406J46586_10000089 3300003203 Bacteria 41556
5 JGI25406J46586_10000885 3300003203 Bacteria 14114
6 JGI25153J46596_10001792 3300003215 Bacteria 12743
7 JGI25153J46596_10003025 3300003215 Bacteria 9506
8 JGI25153J46596_10003136 3300003215 Bacteria 9321
9 JGI25160J50197_1003913 3300003354 Bacteria 6520
10 Ga0055524_1008182 3300003775 Bacteria 4367
11 Ga0055534_1011189 3300003784 Bacteria 1838
12 Ga0055531_10002428 3300003794 Bacteria 12474
13 Ga0055543_1001518 3300004625 Bacteria 9106
14 Ga0065165_1000415 3300005262 Bacteria 67666
15 Ga0065165_1027223 3300005262 Bacteria 1867
16 Ga0070658_10161160 3300005327 Bacteria 1882
17 Ga0070683_100203991 3300005329 Bacteria 1878
18 Ga0070670_100210685 3300005331 Bacteria 1690
19 Ga0068869_100021516 3300005334 Bacteria 4438
20 Ga0068869_100060160 3300005334 Bacteria 2783
21 Ga0070666_10234444 3300005335 Bacteria 1297
22 Ga0070680_100042682 3300005336 Bacteria 3681
23 Ga0068868_100042187 3300005338 Bacteria 3559
24 Ga0070661_100041101 3300005344 Bacteria 3374
25 Ga0070668_100052513 3300005347 Bacteria 3141
26 Ga0070668_100177828 3300005347 Bacteria 1736
27 Ga0070669_100317280 3300005353 Bacteria 1258
28 Ga0070671_100062733 3300005355 Bacteria 3094
29 Ga0070659_100321938 3300005366 Bacteria 1293
30 Ga0070667_100222752 3300005367 Bacteria 1679
31 Ga0070709_10012512 3300005434 Bacteria 4750
32 Ga0070709_10031036 3300005434 Bacteria 3212
33 Ga0070709_10031633 3300005434 Bacteria 3184
34 Ga0070714_100037004 3300005435 Bacteria 4098
35 Ga0070714_100207818 3300005435 Bacteria 1793
36 Ga0070713_100029100 3300005436 Bacteria 4370
37 Ga0070710_10011173 3300005437 Bacteria 4430
38 Ga0070711_100007005 3300005439 Bacteria 6841
39 Ga0070711_100009020 3300005439 Bacteria 6124
40 Ga0070700_100045927 3300005441 Bacteria 2696
41 Ga0070708_100272628 3300005445 Bacteria 1592
42 Ga0070663_100009181 3300005455 Bacteria 6115
43 Ga0070663_100085005 3300005455 Bacteria 2334
44 Ga0070662_100023244 3300005457 Bacteria 4256
45 Ga0070685_10261494 3300005466 Bacteria 1151
46 Ga0070699_100144977 3300005518 Bacteria 2098
47 Ga0070679_100003707 3300005530 Bacteria 14002
48 Ga0070697_100131997 3300005536 Bacteria 2095
49 Ga0070672_100214609 3300005543 Bacteria 1613
50 Ga0070672_100288666 3300005543 Bacteria 1388
51 Ga0070665_100006118 3300005548 Bacteria 12305
52 Ga0070665_100034010 3300005548 Bacteria 5126
53 Ga0070665_100067568 3300005548 Bacteria 3584
54 Ga0070665_100130352 3300005548 Bacteria 2517
55 Ga0070665_100277326 3300005548 Bacteria 1678
56 Ga0068855_100005214 3300005563 Bacteria 15852
57 Ga0068855_100292750 3300005563 Bacteria 1805
58 Ga0070664_100046714 3300005564 Bacteria 3657
59 Ga0068857_100066434 3300005577 Bacteria 3209
60 Ga0068852_100295347 3300005616 Bacteria 1567
61 Ga0068852_100335321 3300005616 Bacteria 1473
62 Ga0068859_100150655 3300005617 Bacteria 2401
63 Ga0068864_100016160 3300005618 Bacteria 6211
64 Ga0068864_100038317 3300005618 Bacteria 4094
65 Ga0068861_100035761 3300005719 Bacteria 3681
66 Ga0068863_100130928 3300005841 Bacteria 2395
67 Ga0068860_100003866 3300005843 Bacteria 15387
68 Ga0068862_100462748 3300005844 Bacteria 1197
69 Ga0081455_10002667 3300005937 Bacteria 21110
70 Ga0081455_10012598 3300005937 Bacteria 8428
71 Ga0081455_10034832 3300005937 Bacteria 4507
72 Ga0081538_10002323 3300005981 Bacteria 18774
73 Ga0081540_1001266 3300005983 Bacteria 22020
74 Ga0081540_1004882 3300005983 Bacteria 10100
75 Ga0081540_1010416 3300005983 Bacteria 6301
76 Ga0081540_1010842 3300005983 Bacteria 6126
77 Ga0081540_1012305 3300005983 Bacteria 5647
78 Ga0081540_1020381 3300005983 Bacteria 3991
79 Ga0081540_1021353 3300005983 Bacteria 3860
80 Ga0081540_1030298 3300005983 Bacteria 2999
81 Ga0081540_1032237 3300005983 Bacteria 2865
82 Ga0081540_1032288 3300005983 Bacteria 2862
83 Ga0081539_10000461 3300005985 Bacteria 86158
84 Ga0081539_10000729 3300005985 Bacteria 65907
85 Ga0081539_10031929 3300005985 Bacteria 3235
86 Ga0081539_10034529 3300005985 Bacteria 3057
87 Ga0081539_10066952 3300005985 Bacteria 1945
88 Ga0070717_10019858 3300006028 Bacteria 5276
89 Ga0070717_10032483 3300006028 Bacteria 4207
90 Ga0075365_10013935 3300006038 Bacteria 4824
91 Ga0075365_10022911 3300006038 Bacteria 3920
92 Ga0075365_10044304 3300006038 Bacteria 2914
93 Ga0075365_10064888 3300006038 Bacteria 2447
94 Ga0075365_10165135 3300006038 Bacteria 1544
95 Ga0075368_10046201 3300006042 Bacteria 1722
96 Ga0075363_100003826 3300006048 Bacteria 6487
97 Ga0075363_100012251 3300006048 Bacteria 4129
98 Ga0075363_100074714 3300006048 Bacteria 1846
99 Ga0075364_10058583 3300006051 Bacteria 2524
100 Ga0075364_10132637 3300006051 Bacteria 1672
101 Ga0075364_10225373 3300006051 Bacteria 1273
102 Ga0070716_100001412 3300006173 Bacteria 10658
103 Ga0070716_100107414 3300006173 Bacteria 1723
104 Ga0070712_100196056 3300006175 Bacteria 1583
105 Ga0075367_10042045 3300006178 Bacteria 2673
106 Ga0075367_10209436 3300006178 Bacteria 1219
107 Ga0075369_10040322 3300006186 Bacteria 1995
108 Ga0075369_10043865 3300006186 Bacteria 1920
109 Ga0075366_10136676 3300006195 Bacteria 1480
110 Ga0075366_10208068 3300006195 Bacteria 1190
111 Ga0097621_100078810 3300006237 Bacteria 2737
112 Ga0075370_10068260 3300006353 Bacteria 2030
113 Ga0075434_100131833 3300006871 Bacteria 2519
114 Ga0068865_100015327 3300006881 Bacteria 4887
115 Ga0097620_100150655 3300006931 Bacteria 2401
116 Ga0099824_1006403 3300006942 Bacteria 16176
117 Ga0099824_1018082 3300006942 Bacteria 5888
118 Ga0099822_1007370 3300006943 Bacteria 14235
119 Ga0099823_1037610 3300006944 Bacteria 3651
120 Ga0099794_10002308 3300007265 Bacteria 7006
121 Ga0099795_10003024 3300007788 Bacteria 4095
122 Ga0099795_10009882 3300007788 Bacteria 2786
123 Ga0105240_10023702 3300009093 Bacteria 8106
124 Ga0105240_10285015 3300009093 Bacteria 1896
125 Ga0105240_10332893 3300009093 Bacteria 1727
126 Ga0111539_10038338 3300009094 Bacteria 5780
127 Ga0114129_10131915 3300009147 Bacteria 3430
128 Ga0105241_10040522 3300009174 Bacteria 3517
129 Ga0105241_10142573 3300009174 Bacteria 1952
130 Ga0105242_10274808 3300009176 Bacteria 1528
131 Ga0105242_10325543 3300009176 Bacteria 1411
132 Ga0105248_10163693 3300009177 Bacteria 2508
133 Ga0105248_10169254 3300009177 Bacteria 2463
134 Ga0105237_10027033 3300009545 Bacteria 5860
135 Ga0105237_10235116 3300009545 Bacteria 1834
136 Ga0105238_10256670 3300009551 Bacteria 1727
137 Ga0105249_10108707 3300009553 Bacteria 2618
138 Ga0105249_10458408 3300009553 Bacteria 1314
139 Ga0099796_10010340 3300010159 Bacteria 2562
140 Ga0099796_10022278 3300010159 Bacteria 1963
141 Ga0105239_10078922 3300010375 Bacteria 3623
142 Ga0105239_10115267 3300010375 Bacteria 2981
143 Ga0105239_10186334 3300010375 Bacteria 2322
144 Ga0105239_10223417 3300010375 Bacteria 2112
145 Ga0105246_10072422 3300011119 Bacteria 2429
146 Ga0105246_10097168 3300011119 Bacteria 2136
147 Ga0157370_10031488 3300013104 Bacteria 5187
148 Ga0157374_10295269 3300013296 Bacteria 1602
149 Ga0157378_10139081 3300013297 Bacteria 2253
150 Ga0163162_10087204 3300013306 Bacteria 3199
151 Ga0157375_10314033 3300013308 Bacteria 1731
152 Ga0163163_10024312 3300014325 Bacteria 5765
153 Ga0163163_10067992 3300014325 Bacteria 3544
154 Ga0163163_10275411 3300014325 Bacteria 1734
155 Ga0157379_10062470 3300014968 Bacteria 3331
156 Ga0214544_1000003 3300021320 Bacteria 643752
157 Ga0214542_1000022 3300021321 Bacteria 193578
158 Ga0214545_1000010 3300021324 Bacteria 193578
159 Ga0214545_1031015 3300021324 Bacteria 2207
160 Ga0214543_1000035 3300021327 Bacteria 183100
161 Ga0213872_10043969 3300021361 Bacteria 2034
162 Ga0209677_100902 3300025253 Bacteria 14537
163 Ga0209148_1000784 3300025254 Bacteria 23607
164 Ga0209233_1000543 3300025261 Bacteria 21222
165 Ga0209233_1000561 3300025261 Bacteria 19886
166 Ga0209233_1008323 3300025261 Bacteria 3219
167 Ga0209455_1001661 3300025272 Bacteria 9638
168 Ga0209675_1001296 3300025291 Bacteria 14851
169 Ga0209564_1002283 3300025295 Bacteria 15636
170 Ga0209564_1008629 3300025295 Bacteria 4995
171 Ga0209758_1000015 3300025297 Bacteria 851943
172 Ga0209758_1000306 3300025297 Bacteria 95362
173 Ga0209758_1000701 3300025297 Bacteria 49677
174 Ga0209758_1001694 3300025297 Bacteria 24817
175 Ga0209758_1004530 3300025297 Bacteria 11502
176 Ga0209256_1000272 3300025299 Bacteria 90458
177 Ga0209256_1021845 3300025299 Bacteria 1952
178 Ga0207426_1000217 3300025302 Bacteria 136180
179 Ga0207426_1001117 3300025302 Bacteria 24608
180 Ga0207426_1008688 3300025302 Bacteria 4075
181 Ga0207426_1012705 3300025302 Bacteria 3153
182 Ga0209257_1001260 3300025304 Bacteria 31244
183 Ga0209257_1007750 3300025304 Bacteria 6387
184 Ga0209257_1015800 3300025304 Bacteria 3106
185 Ga0207692_10010351 3300025898 Bacteria 3927
186 Ga0207688_10057283 3300025901 Bacteria 2190
187 Ga0207647_10012036 3300025904 Bacteria 6038
188 Ga0207685_10013754 3300025905 Bacteria 2513
189 Ga0207699_10001724 3300025906 Bacteria 10355
190 Ga0207699_10028905 3300025906 Bacteria 3086
191 Ga0207699_10047208 3300025906 Bacteria 2524
192 Ga0207643_10034912 3300025908 Bacteria 2818
193 Ga0207654_10016718 3300025911 Bacteria 3823
194 Ga0207654_10019788 3300025911 Bacteria 3559
195 Ga0207654_10056358 3300025911 Bacteria 2279
196 Ga0207695_10057666 3300025913 Bacteria 4034
197 Ga0207695_10338728 3300025913 Bacteria 1392
198 Ga0207671_10025812 3300025914 Bacteria 4409
199 Ga0207671_10149214 3300025914 Bacteria 1806
200 Ga0207671_10198784 3300025914 Bacteria 1565
201 Ga0207671_10298843 3300025914 Bacteria 1272
202 Ga0207693_10002818 3300025915 Bacteria 15062
203 Ga0207663_10004235 3300025916 Bacteria 7116
204 Ga0207663_10011381 3300025916 Bacteria 4776
205 Ga0207660_10202889 3300025917 Bacteria 1549
206 Ga0207662_10086259 3300025918 Bacteria 1924
207 Ga0207657_10165202 3300025919 Bacteria 1796
208 Ga0207657_10183138 3300025919 Bacteria 1692
209 Ga0207649_10040585 3300025920 Bacteria 2829
210 Ga0207652_10264786 3300025921 Bacteria 1550
211 Ga0207694_10143116 3300025924 Bacteria 1923
212 Ga0207694_10153665 3300025924 Bacteria 1855
213 Ga0207694_10240496 3300025924 Bacteria 1479
214 Ga0207694_10281173 3300025924 Bacteria 1367
215 Ga0207687_10069486 3300025927 Bacteria 2512
216 Ga0207700_10012595 3300025928 Bacteria 5463
217 Ga0207700_10015399 3300025928 Bacteria 5044
218 Ga0207664_10009218 3300025929 Bacteria 6915
219 Ga0207664_10060839 3300025929 Bacteria 3011
220 Ga0207664_10139733 3300025929 Bacteria 2047
221 Ga0207644_10086400 3300025931 Bacteria 2329
222 Ga0207690_10350574 3300025932 Bacteria 1167
223 Ga0207706_10097345 3300025933 Bacteria 2588
224 Ga0207706_10412083 3300025933 Bacteria 1171
225 Ga0207709_10013681 3300025935 Bacteria 4476
226 Ga0207670_10145871 3300025936 Bacteria 1750
227 Ga0207669_10031041 3300025937 Bacteria 2979
228 Ga0207665_10002759 3300025939 Bacteria 11767
229 Ga0207665_10050012 3300025939 Bacteria 2810
230 Ga0207665_10061168 3300025939 Bacteria 2552
231 Ga0207691_10173501 3300025940 Bacteria 1887
232 Ga0207711_10135997 3300025941 Bacteria 2207
233 Ga0207689_10071727 3300025942 Bacteria 2845
234 Ga0207689_10095790 3300025942 Bacteria 2438
235 Ga0207689_10108961 3300025942 Bacteria 2276
236 Ga0207667_10145163 3300025949 Bacteria 2443
237 Ga0207712_10063310 3300025961 Bacteria 2633
238 Ga0207668_10143502 3300025972 Bacteria 1839
239 Ga0207658_10283210 3300025986 Bacteria 1422
240 Ga0207703_10032866 3300026035 Bacteria 4109
241 Ga0207678_10062792 3300026067 Bacteria 3192
242 Ga0207678_10121620 3300026067 Bacteria 2228
243 Ga0207678_10255573 3300026067 Bacteria 1501
244 Ga0207678_10362892 3300026067 Bacteria 1250
245 Ga0207708_10144105 3300026075 Bacteria 1871
246 Ga0207641_10095333 3300026088 Bacteria 2612
247 Ga0207648_10043034 3300026089 Bacteria 3966
248 Ga0207648_10165856 3300026089 Bacteria 1952
249 Ga0207648_10187430 3300026089 Bacteria 1833
250 Ga0207676_10027587 3300026095 Bacteria 4231
251 Ga0207674_10129947 3300026116 Bacteria 2483
252 Ga0207675_100052832 3300026118 Bacteria 3791
253 Ga0207675_100298097 3300026118 Bacteria 1570
254 Ga0207683_10120195 3300026121 Bacteria 2358
255 Ga0207683_10143826 3300026121 Bacteria 2150
256 Ga0207683_10431938 3300026121 Bacteria 1213
257 Ga0209389_1000012 3300027296 Bacteria 213243
258 Ga0209389_1000052 3300027296 Bacteria 109624
259 Ga0209589_1000015 3300027357 Bacteria 225913
260 Ga0209589_1000058 3300027357 Bacteria 109624
261 Ga0209489_100015 3300027361 Bacteria 225913
262 Ga0209489_100019 3300027361 Bacteria 213243
263 Ga0209489_100020 3300027361 Bacteria 207541
264 Ga0209700_100018 3300027363 Bacteria 238200
265 Ga0209700_100025 3300027363 Bacteria 225913
266 Ga0209588_1000822 3300027671 Bacteria 7888
267 Ga0209813_10024637 3300027866 Bacteria 1723
268 Ga0209813_10033217 3300027866 Bacteria 1533
269 Ga0268266_10000936 3300028379 Bacteria 37196
270 Ga0268266_10001232 3300028379 Bacteria 31354
271 Ga0268266_10011944 3300028379 Bacteria 7518
272 Ga0268266_10037059 3300028379 Bacteria 4155
273 Ga0268265_10415570 3300028380 Bacteria 1247
274 Ga0268264_10000073 3300028381 Bacteria 260615
275 Ga0265319_1002449 3300028563 Bacteria 10136
276 Ga0265334_10004379 3300028573 Bacteria 6273
277 Ga0265318_10001721 3300028577 Bacteria 12527
278 Ga0265318_10014731 3300028577 Bacteria 3274
279 Ga0265323_10000822 3300028653 Bacteria 16629
280 Ga0265336_10002743 3300028666 Bacteria 7119
281 Ga0307517_10000476 3300028786 Bacteria 68696
282 Ga0307517_10140253 3300028786 Bacteria 1700
283 Ga0307515_10121156 3300028794 Bacteria 2961
284 Ga0265338_10000176 3300028800 Bacteria 118726
285 Ga0265324_10002446 3300029957 Bacteria 9477
286 Ga0265330_10017291 3300031235 Bacteria 3322
287 Ga0265330_10055412 3300031235 Bacteria 1731
288 Ga0265325_10043560 3300031241 Bacteria 2341
289 Ga0265340_10035701 3300031247 Bacteria 2468
290 Ga0265340_10046406 3300031247 Bacteria 2119
291 Ga0265339_10022304 3300031249 Bacteria 3669
292 Ga0265331_10030941 3300031250 Bacteria 2663
293 Ga0307509_10067824 3300031507 Bacteria 3735
294 Ga0307509_10106278 3300031507 Bacteria 2826
295 Ga0307509_10140559 3300031507 Bacteria 2351
296 Ga0265313_10026059 3300031595 Bacteria 3087
297 Ga0307508_10000740 3300031616 Bacteria 38713
298 Ga0307508_10176710 3300031616 Bacteria 1738
299 Ga0307508_10247379 3300031616 Bacteria 1380
300 Ga0265342_10003084 3300031712 Bacteria 13926
301 Ga0265342_10032748 3300031712 Bacteria 3203
302 Ga0265342_10047735 3300031712 Bacteria 2569
303 Ga0316576_10003774 3300031727 Bacteria 8951
304 Ga0307516_10017246 3300031730 Bacteria 7535
305 Ga0307516_10063273 3300031730 Bacteria 3582
306 Ga0307405_10183097 3300031731 Bacteria 1506
307 Ga0307411_10041450 3300032005 Bacteria 2929
308 Ga0307510_10026086 3300033180 Bacteria 6726
309 Ga0307510_10046575 3300033180 Bacteria 4659
310 Ga0307510_10055610 3300033180 Bacteria 4132
311 Ga0373934_0009613 3300035086 Bacteria 3624
312 Ga0373944_0002516 3300035089 Bacteria 4657
313 Ga0373923_0001598 3300035111 Bacteria 6593
314 Ga0373923_0007180 3300035111 Bacteria 3904
315 Ga0373923_0029285 3300035111 Bacteria 2207
316 Ga0373936_0015828 3300035113 Bacteria 2893
317 Ga0373936_0036898 3300035113 Bacteria 1950
318 Ga0373945_0007782 3300035116 Bacteria 3477
319 Ga0373953_0000365 3300035117 Bacteria 12236
320 Ga0373953_0054773 3300035117 Bacteria 1618
321 Ga0373954_0000474 3300035118 Bacteria 15068
322 Ga0373954_0024611 3300035118 Bacteria 2745
323 Ga0373956_0017676 3300035119 Bacteria 3010
324 Ga0373956_0023157 3300035119 Bacteria 2663
325 Ga0373957_0000677 3300035120 Bacteria 8772
326 Ga0373943_0001393 3300035170 Bacteria 10893
327 Ga0373946_0047144 3300035171 Bacteria 1789
328 Ga0373955_0000870 3300035172 Bacteria 12943
329 Ga0373955_0007967 3300035172 Bacteria 4896
330 Ga0373955_0084838 3300035172 Bacteria 1796
331 Ga0373924_0005372 3300035410 Bacteria 4531
332 Ga0373931_0005817 3300035691 Bacteria 5737
333 Ga0373935_0004338 3300035692 Bacteria 8319
334 Ga0373935_0046033 3300035692 Bacteria 2755
335 Ga0373935_0122777 3300035692 Bacteria 1737
336 Ga0373935_0170286 3300035692 Bacteria 1489
337 Ga0373935_0301710 3300035692 Bacteria 1132
338 Ga0373927_0006494 3300035695 Bacteria 7966
339 Ga0373927_0020110 3300035695 Bacteria 4378
340 Ga0373927_0021557 3300035695 Bacteria 4223
341 Ga0373933_0000158 3300035724 Bacteria 44104
342 Ga0373933_0001161 3300035724 Bacteria 15622
343 Ga0373933_0030660 3300035724 Bacteria 3114
344 Ga0373947_0005561 3300035725 Bacteria 7345
345 Ga0373947_0005689 3300035725 Bacteria 7269
346 Ga0373937_0008434 3300036401 Bacteria 8956
347 Ga0373937_0111845 3300036401 Bacteria 2540
348 Ga0316584_0002193 3300036712 Bacteria 12237
349 Ga0373925_0002440 3300037068 Bacteria 14906
350 Ga0373925_0009266 3300037068 Bacteria 7165
351 Ga0373925_0009840 3300037068 Bacteria 6944
352 Ga0373925_0094377 3300037068 Bacteria 2291
353 Ga0373925_0245062 3300037068 Bacteria 1436
354 Ga0395898_0254442 3300037466 Bacteria 1675
355 Ga0395905_0004146 3300037471 Bacteria 15162
356 Ga0436365_0747992 3300039437 Bacteria 1878
357 Ga0436361_0960294 3300039447 Bacteria 4628
358 Ga0436363_0039721 3300039450 Bacteria 1777
359 Ga0436362_0159823 3300039453 Bacteria 3526
360 Ga0451804_0429416 3300041463 Bacteria 1939
361 Ga0451849_0305165 3300041505 Bacteria 2051
362 Ga0450911_000210 3300042115 Bacteria 22859
363 Ga0466972_0000295 3300044658 Bacteria 30276
364 Ga0466972_0015953 3300044658 Bacteria 3756
365 Ga0466966_0002033 3300044684 Bacteria 13135
366 Ga0466961_0000087 3300044693 Bacteria 58547
367 Ga0466963_0052810 3300044694 Bacteria 2697
368 Ga0466968_0061456 3300044735 Bacteria 1621
369 Ga0466957_0257535 3300044842 Bacteria 1162
370 Ga0466959_0002003 3300045049 Bacteria 12853
371 Ga0466967_0083170 3300045976 Bacteria 2894
372 Ga0495592_0003034 3300046454 Bacteria 11957
373 Ga0495592_0004669 3300046454 Bacteria 10039
374 Ga0495592_0019284 3300046454 Bacteria 5188
375 Ga0495592_0068558 3300046454 Bacteria 2589
376 Ga0495603_0000029 3300046455 Bacteria 60872
377 Ga0495603_0005242 3300046455 Bacteria 7732
378 Ga0495603_0036039 3300046455 Bacteria 2970
379 Ga0495603_0044791 3300046455 Bacteria 2640
380 Ga0495629_0000029 3300046459 Bacteria 127000
381 Ga0495629_0002638 3300046459 Bacteria 13739
382 Ga0495629_0028887 3300046459 Bacteria 3937
383 Ga0495629_0061905 3300046459 Bacteria 2615
384 Ga0495638_0003622 3300046460 Bacteria 12071
385 Ga0495638_0015943 3300046460 Bacteria 5036
386 Ga0495638_0016057 3300046460 Bacteria 5018
387 Ga0495638_0016277 3300046460 Bacteria 4982
388 Ga0495641_0005506 3300046461 Bacteria 8521
389 Ga0495651_0001923 3300046462 Bacteria 16068
390 Ga0495651_0002607 3300046462 Bacteria 13945
391 Ga0495651_0088625 3300046462 Bacteria 2325
392 Ga0495651_0090735 3300046462 Bacteria 2292
393 Ga0495653_0000341 3300046463 Bacteria 38030
394 Ga0495580_0005561 3300046472 Bacteria 10391
395 Ga0495580_0010591 3300046472 Bacteria 7176
396 Ga0495582_0000068 3300046473 Bacteria 53389
397 Ga0495582_0016420 3300046473 Bacteria 4057
398 Ga0495605_0083470 3300046474 Bacteria 1491
399 Ga0495639_0000006 3300046475 Bacteria 100361
400 Ga0495639_0014829 3300046475 Bacteria 3377
401 Ga0495662_0003219 3300046476 Bacteria 8248
402 Ga0495664_0004785 3300046477 Bacteria 7406
403 Ga0495664_0020110 3300046477 Bacteria 3846
404 Ga0495664_0039694 3300046477 Bacteria 2782
405 Ga0495664_0101448 3300046477 Bacteria 1734
406 Ga0495594_0000750 3300046499 Bacteria 16637
407 Ga0495596_0038323 3300046500 Bacteria 1895
408 Ga0495583_0050734 3300046506 Bacteria 1895
409 Ga0495606_0086474 3300046507 Bacteria 1937
410 Ga0495608_0000606 3300046511 Bacteria 24639
411 Ga0495608_0010182 3300046511 Bacteria 6561
412 Ga0495608_0063403 3300046511 Bacteria 2425
413 Ga0495608_0172658 3300046511 Bacteria 1370
414 Ga0495610_0095184 3300046512 Bacteria 1343
415 Ga0495618_0077613 3300046514 Bacteria 2116
416 Ga0495618_0239314 3300046514 Bacteria 1141
417 Ga0495628_0011645 3300046516 Bacteria 7430
418 Ga0495628_0027421 3300046516 Bacteria 4635
419 Ga0495630_0005874 3300046517 Bacteria 8682
420 Ga0495631_0055651 3300046518 Bacteria 1724
421 Ga0495631_0075568 3300046518 Bacteria 1454
422 Ga0495643_0054915 3300046522 Bacteria 2130
423 Ga0495644_0033143 3300046523 Bacteria 1952
424 Ga0495648_0002484 3300046524 Bacteria 16925
425 Ga0495648_0011475 3300046524 Bacteria 6668
426 Ga0495648_0036375 3300046524 Bacteria 3178
427 Ga0495648_0101093 3300046524 Bacteria 1591
428 Ga0495666_0024498 3300046526 Bacteria 2981
429 Ga0495652_0007527 3300046529 Bacteria 10035
430 Ga0495652_0012146 3300046529 Bacteria 7779
431 Ga0495652_0048701 3300046529 Bacteria 3629
432 Ga0495652_0066072 3300046529 Bacteria 3037
433 Ga0495652_0130916 3300046529 Bacteria 1986
434 Ga0495652_0285224 3300046529 Bacteria 1207
435 Ga0495654_0034752 3300046530 Bacteria 2542
436 Ga0495665_0000237 3300046531 Bacteria 27649
437 Ga0495665_0020476 3300046531 Bacteria 3553
438 Ga0495640_0005842 3300046533 Bacteria 9774
439 Ga0495640_0006116 3300046533 Bacteria 9540
440 Ga0495640_0007919 3300046533 Bacteria 8356
441 Ga0495587_0001595 3300046536 Bacteria 15102
442 Ga0495587_0002682 3300046536 Bacteria 11890
443 Ga0495645_0040515 3300046543 Bacteria 3398
444 Ga0495645_0061502 3300046543 Bacteria 2720
445 Ga0495622_0009979 3300046557 Bacteria 4392
446 Ga0495622_0021661 3300046557 Bacteria 2992
447 Ga0495667_0003214 3300046559 Bacteria 10955
448 Ga0495667_0011892 3300046559 Bacteria 5896
449 Ga0495667_0101621 3300046559 Bacteria 1860
450 Ga0495656_0044715 3300046615 Bacteria 1866
451 Ga0495668_0006062 3300046616 Bacteria 8006
452 Ga0495668_0065969 3300046616 Bacteria 1992
453 Ga0495634_0001307 3300046642 Bacteria 22759
454 Ga0495634_0010145 3300046642 Bacteria 6911
455 Ga0495634_0040885 3300046642 Bacteria 3150
456 Ga0495634_0075256 3300046642 Bacteria 2218
457 Ga0495625_0029057 3300046660 Bacteria 4139
458 Ga0495625_0218206 3300046660 Bacteria 1251
459 Ga0495635_0000092 3300046663 Bacteria 53315
460 Ga0495635_0019780 3300046663 Bacteria 4690
461 Ga0495635_0028796 3300046663 Bacteria 3860
462 Ga0495635_0047078 3300046663 Bacteria 2975
463 Ga0495661_0036570 3300046665 Bacteria 3073
464 Ga0495588_0011966 3300046674 Bacteria 4087
465 Ga0495657_0003498 3300046675 Bacteria 12806
466 Ga0495657_0006462 3300046675 Bacteria 9169
467 Ga0495657_0037121 3300046675 Bacteria 3361
468 Ga0495657_0128859 3300046675 Bacteria 1587
469 Ga0495599_0005823 3300046678 Bacteria 7403
470 Ga0495599_0007153 3300046678 Bacteria 6757
471 Ga0495623_0004160 3300046679 Bacteria 9532
472 Ga0495623_0004635 3300046679 Bacteria 9030
473 Ga0495646_0004002 3300046680 Bacteria 9229
474 Ga0495646_0052734 3300046680 Bacteria 2455
475 Ga0495646_0100800 3300046680 Bacteria 1656
476 Ga0495647_0003788 3300046681 Bacteria 4865
477 Ga0495647_0060863 3300046681 Bacteria 1489
478 Ga0495658_0002427 3300046683 Bacteria 9388
479 Ga0495613_0000582 3300046689 Bacteria 29501
480 Ga0495613_0019334 3300046689 Bacteria 5078
481 Ga0495613_0111035 3300046689 Bacteria 1975
482 Ga0495613_0188238 3300046689 Bacteria 1460
483 Ga0495624_0151330 3300046690 Bacteria 1419
484 Ga0495670_0030891 3300046691 Bacteria 2661
485 Ga0495649_0141527 3300046694 Bacteria 1266
486 Ga0495649_0164447 3300046694 Bacteria 1163
487 Ga0495600_0001905 3300046809 Bacteria 11719
488 Ga0495600_0002533 3300046809 Bacteria 10514
489 Ga0495600_0014076 3300046809 Bacteria 5039
490 Ga0495600_0038562 3300046809 Bacteria 3109
491 Ga0495600_0128684 3300046809 Bacteria 1646
492 Ga0495581_0000048 3300047315 Bacteria 45311
493 Ga0495581_0139709 3300047315 Bacteria 1413
494 Ga0495581_0190222 3300047315 Bacteria 1200
495 Ga0495581_0198818 3300047315 Bacteria 1172
496 Ga0495604_0001244 3300047317 Bacteria 20881
497 Ga0495604_0003533 3300047317 Bacteria 12462
498 Ga0495604_0058268 3300047317 Bacteria 2966
499 Ga0495604_0081406 3300047317 Bacteria 2424
500 Ga0495674_0009200 3300047319 Bacteria 9387
501 Ga0495674_0011197 3300047319 Bacteria 8470
502 Ga0495674_0016889 3300047319 Bacteria 6806
503 Ga0495674_0173317 3300047319 Bacteria 1799
504 Ga0495672_0007852 3300047320 Bacteria 7968
505 Ga0495672_0012029 3300047320 Bacteria 6060
506 Ga0495676_0053573 3300047321 Bacteria 3214
507 Ga0495680_0000546 3300047322 Bacteria 42342
508 Ga0495680_0006001 3300047322 Bacteria 11360
509 Ga0495687_043565 3300047443 Bacteria 1954
510 Ga0495675_0001333 3300047444 Bacteria 14952
511 Ga0495675_0009372 3300047444 Bacteria 6089
512 Ga0495675_0112280 3300047444 Bacteria 1701
513 Ga0495685_017516 3300047447 Bacteria 2454
514 Ga0495673_0059165 3300047469 Bacteria 1648
515 Ga0495673_0059235 3300047469 Bacteria 1647
516 Ga0495684_0000032 3300047471 Bacteria 113195
517 Ga0495684_0002955 3300047471 Bacteria 13381
518 Ga0495684_0063799 3300047471 Bacteria 2800
519 Ga0495686_0049142 3300047472 Bacteria 2655
520 Ga0495686_0049237 3300047472 Bacteria 2652
521 Ga0495593_0000556 3300047673 Bacteria 21184
522 Ga0495593_0000660 3300047673 Bacteria 19875
523 Ga0495602_0003334 3300048088 Bacteria 16577
524 Ga0495602_0006506 3300048088 Bacteria 12257
525 Ga0495602_0153553 3300048088 Bacteria 1806
526 Ga0495602_0231460 3300048088 Bacteria 1388
527 Ga0496101_0020506 3300048904 Bacteria 4527
528 Ga0496101_0325999 3300048904 Bacteria 1205
529 Ga0496102_0009365 3300048905 Bacteria 8413
530 Ga0496102_0029530 3300048905 Bacteria 4906
531 Ga0496102_0173731 3300048905 Bacteria 2028
532 Ga0496103_0039337 3300048906 Bacteria 2906
533 Ga0496103_0082413 3300048906 Bacteria 2024
534 Ga0496103_0085757 3300048906 Bacteria 1984
535 Ga0496104_0073659 3300048907 Bacteria 3249
536 Ga0496104_0084884 3300048907 Bacteria 3022
537 Ga0496105_0010801 3300048908 Bacteria 7191
538 Ga0496105_0011478 3300048908 Bacteria 7000
539 Ga0496105_0032337 3300048908 Bacteria 4292
540 Ga0496106_0004140 3300048909 Bacteria 10810
541 Ga0496106_0005511 3300048909 Bacteria 9361
542 Ga0496106_0009870 3300048909 Bacteria 7047
543 Ga0496106_0101452 3300048909 Bacteria 2232
544 Ga0496106_0229856 3300048909 Bacteria 1481
545 Ga0496106_0273268 3300048909 Bacteria 1353
546 Ga0496107_0136247 3300048910 Bacteria 1814
547 Ga0496107_0165980 3300048910 Bacteria 1637
548 Ga0496108_0067452 3300048911 Bacteria 3018
549 Ga0496108_0235856 3300048911 Bacteria 1591
550 Ga0496109_0026957 3300048912 Bacteria 5126
551 Ga0496110_0007995 3300048913 Bacteria 8475
552 Ga0496110_0024944 3300048913 Bacteria 5103
553 Ga0496110_0030548 3300048913 Bacteria 4645
554 Ga0496110_0196880 3300048913 Bacteria 1830
555 Ga0496110_0281533 3300048913 Bacteria 1514
556 Ga0496111_0109768 3300048914 Bacteria 2031
557 Ga0496112_0000169 3300048915 Bacteria 41507
558 Ga0496112_0011528 3300048915 Bacteria 8077
559 Ga0496112_0019225 3300048915 Bacteria 6443
560 Ga0496112_0062276 3300048915 Bacteria 3679
561 Ga0496112_0463508 3300048915 Bacteria 1204
562 Ga0496113_0168171 3300048916 Bacteria 1736
563 Ga0496114_0018487 3300048917 Bacteria 5636
564 Ga0496115_0000889 3300048918 Bacteria 21680
565 Ga0496115_0058415 3300048918 Bacteria 3104
566 Ga0496115_0069856 3300048918 Bacteria 2846
567 Ga0496115_0130878 3300048918 Bacteria 2068
568 Ga0496115_0147538 3300048918 Bacteria 1942
569 Ga0496116_0008611 3300048919 Bacteria 8827
570 Ga0496116_0057216 3300048919 Bacteria 2551
571 Ga0496116_0087090 3300048919 Bacteria 1913
572 Ga0496117_0023533 3300048920 Bacteria 4903
573 Ga0496117_0030017 3300048920 Bacteria 4179
574 Ga0496117_0058124 3300048920 Bacteria 2680
575 Ga0496117_0078000 3300048920 Bacteria 2189
576 Ga0496117_0099551 3300048920 Bacteria 1844
577 Ga0496118_0037060 3300048921 Bacteria 3931
578 Ga0496118_0043939 3300048921 Bacteria 3505
579 Ga0496118_0045932 3300048921 Bacteria 3402
580 Ga0496118_0073192 3300048921 Bacteria 2456
581 Ga0496118_0083401 3300048921 Bacteria 2235
582 Ga0496119_0012324 3300048922 Bacteria 6958
583 Ga0496119_0076976 3300048922 Bacteria 1934
584 Ga0496120_0062215 3300048923 Bacteria 2080
585 Ga0496121_0000155 3300048924 Bacteria 149388
586 Ga0496121_0000218 3300048924 Bacteria 126175
587 Ga0496121_0003892 3300048924 Bacteria 20737
588 Ga0496121_0007080 3300048924 Bacteria 13616
589 Ga0496121_0011030 3300048924 Bacteria 10085
590 Ga0496121_0027285 3300048924 Bacteria 5346
591 Ga0496121_0038776 3300048924 Bacteria 4211
592 Ga0496121_0069992 3300048924 Bacteria 2828
593 Ga0496122_0012396 3300048925 Bacteria 8497
594 Ga0496122_0020536 3300048925 Bacteria 5960
595 Ga0496122_0033693 3300048925 Bacteria 4207
596 Ga0496123_0022201 3300048926 Bacteria 4899
597 Ga0496123_0069865 3300048926 Bacteria 2202
598 Ga0496123_0148245 3300048926 Bacteria 1270
599 Ga0496124_0025392 3300048927 Bacteria 5366
600 Ga0496124_0059392 3300048927 Bacteria 3213
601 Ga0496124_0117718 3300048927 Bacteria 2128
602 Ga0496124_0130505 3300048927 Bacteria 1997
603 Ga0496125_0002212 3300048928 Bacteria 25927
604 Ga0496125_0003115 3300048928 Bacteria 20622
605 Ga0496125_0006315 3300048928 Bacteria 12865
606 Ga0496125_0012310 3300048928 Bacteria 8499
607 Ga0496125_0036214 3300048928 Bacteria 4313
608 Ga0496125_0040815 3300048928 Bacteria 3975
609 Ga0496125_0142561 3300048928 Bacteria 1663
610 Ga0496125_0143744 3300048928 Bacteria 1653
611 Ga0496126_0003000 3300048929 Bacteria 21903
612 Ga0496126_0005013 3300048929 Bacteria 15421
613 Ga0496126_0009925 3300048929 Bacteria 10053
614 Ga0496126_0012765 3300048929 Bacteria 8586
615 Ga0496126_0014895 3300048929 Bacteria 7842
616 Ga0496126_0019762 3300048929 Bacteria 6627
617 Ga0496126_0040827 3300048929 Bacteria 4299
618 Ga0496126_0059401 3300048929 Bacteria 3443
619 Ga0496126_0069880 3300048929 Bacteria 3130
620 Ga0496126_0088546 3300048929 Bacteria 2726
621 Ga0496126_0091578 3300048929 Bacteria 2673
622 Ga0496126_0130897 3300048929 Bacteria 2168
623 Ga0496126_0131930 3300048929 Bacteria 2158
624 Ga0496126_0143331 3300048929 Bacteria 2054
625 Ga0496126_0196426 3300048929 Bacteria 1706
626 Ga0496126_0218469 3300048929 Bacteria 1602
627 Ga0496126_0333421 3300048929 Bacteria 1244
628 Ga0501067_0091274 3300049583 Bacteria 1691
629 Ga0501067_0249615 3300049583 Bacteria 988
630 Ga0501080_0116162 3300049742 Bacteria 2481
631 nmdc:mga03n38_351_c1 3300050490 Bacteria 11225
632 nmdc:mga00v17_113578_c1 3300050491 Bacteria 1720
633 nmdc:mga00v17_128029_c1 3300050491 Bacteria 1621
634 nmdc:mga0yw44_10551_c1 3300050492 Bacteria 4726
635 nmdc:mga0yw44_133679_c1 3300050492 Bacteria 1607
636 nmdc:mga0yw44_21457_c1 3300050492 Bacteria 3602
637 nmdc:mga0yw44_41406_c1 3300050492 Bacteria 2742
638 nmdc:mga0yw44_48499_c1 3300050492 Bacteria 2561
639 nmdc:mga0yw44_72656_c1 3300050492 Bacteria 2139
640 nmdc:mga0k408_31663_c1 3300050493 Bacteria 3021
641 nmdc:mga06z11_127502_c1 3300050494 Bacteria 1425
642 nmdc:mga06z11_165679_c1 3300050494 Bacteria 1266
643 nmdc:mga06z11_40480_c1 3300050494 Bacteria 2326
644 nmdc:mga04h51_28926_c1 3300050495 Bacteria 1732
645 nmdc:mga07m45_13635_c1 3300050496 Bacteria 4317
646 nmdc:mga07m45_69152_c1 3300050496 Bacteria 2007
647 nmdc:mga07m45_93184_c1 3300050496 Bacteria 1727
648 nmdc:mga05p37_315897_c1 3300050507 Bacteria 1850
649 nmdc:mga08y16_484243_c1 3300050511 Bacteria 1258
650 nmdc:mga08y16_66493_c1 3300050511 Bacteria 3762
651 nmdc:mga0n895_127425_c1 3300050512 Bacteria 2569
652 nmdc:mga0sz30_24364_c1 3300050516 Bacteria 2469
653 Ga0495601_0001683 3300053077 Bacteria 12202
654 Ga0495601_0142735 3300053077 Bacteria 1562
655 Ga0495595_0003264 3300053084 Bacteria 6440
656 Ga0495619_0000267 3300053085 Bacteria 38050
657 Ga0495619_0065596 3300053085 Bacteria 2422
658 Ga0500643_000048 3300053087 Bacteria 147879
659 Ga0500644_0000703 3300053088 Bacteria 11861
660 Ga0500644_0019536 3300053088 Bacteria 2001
661 Ga0500646_0027563 3300053090 Bacteria 1547
662 Ga0500651_0005923 3300053093 Bacteria 7012
663 Ga0500651_0057151 3300053093 Bacteria 2442
664 Ga0500566_0000110 3300053094 Bacteria 41727
665 Ga0500566_0007240 3300053094 Bacteria 6575
666 Ga0500566_0018033 3300053094 Bacteria 4146
667 Ga0500566_0127246 3300053094 Bacteria 1367
668 Ga0500640_011481 3300053095 Bacteria 3611
669 Ga0500641_0005426 3300053096 Bacteria 4520
670 Ga0500641_0077440 3300053096 Bacteria 1407
671 Ga0500650_0026722 3300053098 Bacteria 2591
672 Ga0500650_0087658 3300053098 Bacteria 1457
673 Ga0500554_010006 3300053102 Bacteria 2292
674 Ga0500556_0000003 3300053104 Bacteria 679379
675 Ga0500556_0003783 3300053104 Bacteria 4391
676 Ga0500557_000124 3300053105 Bacteria 20414
677 Ga0500569_000744 3300053109 Bacteria 5692
678 Ga0500572_002210 3300053111 Bacteria 4761
679 Ga0500572_002958 3300053111 Bacteria 3981
680 Ga0500593_078733 3300053117 Bacteria 1417
681 Ga0500594_0005603 3300053118 Bacteria 2788
682 Ga0500595_000003 3300053119 Bacteria 419332
683 Ga0500595_002302 3300053119 Bacteria 9568
684 Ga0500595_005550 3300053119 Bacteria 5496
685 Ga0500595_011786 3300053119 Bacteria 3405
686 Ga0500595_011873 3300053119 Bacteria 3390
687 Ga0500595_013114 3300053119 Bacteria 3181
688 Ga0500608_024592 3300053122 Bacteria 2813
689 Ga0500608_031117 3300053122 Bacteria 2531
690 Ga0500614_000900 3300053123 Bacteria 7487
691 Ga0500642_0000100 3300053130 Bacteria 41454
692 Ga0500642_0000104 3300053130 Bacteria 40747
693 Ga0500652_008493 3300053131 Bacteria 3425
694 Ga0500658_0015470 3300053134 Bacteria 2833
695 Ga0500559_0000117 3300053136 Bacteria 62940
696 Ga0500559_0005440 3300053136 Bacteria 5856
697 Ga0500559_0010513 3300053136 Bacteria 3971
698 Ga0500559_0085304 3300053136 Bacteria 1440
699 Ga0500568_0007163 3300053139 Bacteria 5503
700 Ga0500568_0007686 3300053139 Bacteria 5263
701 Ga0500568_0038564 3300053139 Bacteria 1933
702 Ga0500586_000338 3300053145 Bacteria 9253
703 Ga0500590_089316 3300053148 Bacteria 1499
704 Ga0500603_000515 3300053150 Bacteria 9823
705 Ga0500603_001374 3300053150 Bacteria 5553
706 Ga0500604_0000898 3300053151 Bacteria 8222
707 Ga0500616_0000002 3300053153 Bacteria 1611257
708 Ga0500616_0000033 3300053153 Bacteria 398830
709 Ga0500622_0001002 3300053156 Bacteria 23819
710 Ga0500622_0017813 3300053156 Bacteria 3778
711 Ga0500630_004083 3300053159 Bacteria 7099
712 Ga0500633_0024503 3300053160 Bacteria 1876
713 Ga0500638_047139 3300053162 Bacteria 2087
714 Ga0500638_056257 3300053162 Bacteria 1895
715 Ga0500638_076593 3300053162 Bacteria 1593
716 Ga0500639_000598 3300053163 Bacteria 18139
717 Ga0500639_031207 3300053163 Bacteria 2817
718 Ga0500636_0000016 3300053177 Bacteria 123469
719 Ga0500636_0078196 3300053177 Bacteria 1909
720 Ga0500636_0110815 3300053177 Bacteria 1551
721 Ga0500637_0000347 3300053178 Bacteria 17551
722 Ga0500637_0003619 3300053178 Bacteria 7180
723 Ga0500625_045065 3300053729 Bacteria 2059
724 Ga0500645_000087 3300053730 Bacteria 74431
725 Ga0500645_002736 3300053730 Bacteria 7648
726 Ga0500552_004018 3300053733 Bacteria 1527
727 Ga0500596_007853 3300053735 Bacteria 1726
728 Ga0500599_002849 3300053736 Bacteria 2094
729 Ga0500601_000591 3300053737 Bacteria 5186
730 Ga0500661_000111 3300055283 Bacteria 13269
731 Ga0500661_005787 3300055283 Bacteria 2304

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0249615 Ga0501067_0249615_23_925 291
2 3300053093 Ga0500651_0057151 Ga0500651_0057151_1500_2429 298
3 3300005434 Ga0070709_10031036 Ga0070709_100310364 323
4 3300005435 Ga0070714_100207818 Ga0070714_1002078182 323
5 3300025929 Ga0207664_10139733 Ga0207664_101397332 323
6 iso_pu_bacteria 8016530956 8016531940 327
7 3300048925 Ga0496122_0033693 Ga0496122_0033693_2292_3311 328
8 3300048926 Ga0496123_0148245 Ga0496123_0148245_164_1183 328
9 3300048928 Ga0496125_0003115 Ga0496125_0003115_5741_6760 328
10 3300048929 Ga0496126_0005013 Ga0496126_0005013_8705_9724 328
11 iso_pu_bacteria 2545555834 2545676751 329
12 iso_pu_bacteria 3003665799 3003670117 329
13 iso_pu_bacteria 641522639 641642918 329
14 iso_pu_bacteria 643348564 643600951 329
15 iso_pu_bacteria 8055225921 8055227015 329
16 3300005331 Ga0070670_100210685 Ga0070670_1002106852 330
17 3300005466 Ga0070685_10261494 Ga0070685_102614941 330
18 3300050492 nmdc:mga0yw44_133679_c1 nmdc:mga0yw44_133679_c1_27_1064 330
19 iso_pu_bacteria 2547132374 2548500555 330
20 iso_pu_bacteria 2643221717 2644646897 330
21 3300003187 JGI25151J46595_10002288 JGI25151J46595_100022883 331
22 iso_pu_bacteria 2585427608 2585899901 331
23 iso_pu_bacteria 2974320154 2974321543 331
24 iso_pu_bacteria 2513237144 2513913357 332
25 iso_pu_bacteria 2834641062 2834644462 332
26 iso_pu_bacteria 8003400568 8003404130 332
27 3300003784 Ga0055534_1011189 Ga0055534_10111892 333
28 3300007788 Ga0099795_10003024 Ga0099795_100030242 333
29 3300010159 Ga0099796_10010340 Ga0099796_100103401 333
30 3300025291 Ga0209675_1001296 Ga0209675_10012964 333
31 3300042115 Ga0450911_000210 Ga0450911_000210_19740_20798 333
32 3300048924 Ga0496121_0038776 Ga0496121_0038776_1908_3077 333
33 3300048924 Ga0496121_0069992 Ga0496121_0069992_299_1357 333
34 3300048928 Ga0496125_0012310 Ga0496125_0012310_226_1284 333
35 3300014325 Ga0163163_10024312 Ga0163163_100243122 334
36 3300028577 Ga0265318_10014731 Ga0265318_100147313 334
37 3300031241 Ga0265325_10043560 Ga0265325_100435602 334
38 3300031247 Ga0265340_10035701 Ga0265340_100357013 334
39 3300031249 Ga0265339_10022304 Ga0265339_100223044 334
40 3300031595 Ga0265313_10026059 Ga0265313_100260593 334
41 3300031712 Ga0265342_10032748 Ga0265342_100327482 334
42 3300046522 Ga0495643_0054915 Ga0495643_0054915_200_1234 334
43 3300047443 Ga0495687_043565 Ga0495687_043565_789_1823 334
44 3300048905 Ga0496102_0173731 Ga0496102_0173731_975_2009 334
45 3300048915 Ga0496112_0463508 Ga0496112_0463508_158_1192 334
46 3300048921 Ga0496118_0073192 Ga0496118_0073192_437_1471 334
47 3300048929 Ga0496126_0088546 Ga0496126_0088546_997_2025 334
48 3300050491 nmdc:mga00v17_113578_c1 nmdc:mga00v17_113578_c1_649_1683 334
49 3300050496 nmdc:mga07m45_13635_c1 nmdc:mga07m45_13635_c1_2716_3750 334
50 3300053096 Ga0500641_0005426 Ga0500641_0005426_1012_2082 334
51 3300053162 Ga0500638_076593 Ga0500638_076593_377_1411 334
52 3300053177 Ga0500636_0000016 Ga0500636_0000016_39662_40696 334
53 3300053088 Ga0500644_0000703 Ga0500644_0000703_1144_2217 335
54 3300053094 Ga0500566_0127246 Ga0500566_0127246_154_1227 335
55 3300053119 Ga0500595_000003 Ga0500595_000003_15881_16954 335
56 3300053153 Ga0500616_0000002 Ga0500616_0000002_1216504_1217577 335
57 3300053730 Ga0500645_000087 Ga0500645_000087_3599_4672 335
58 iso_pu_bacteria 8019648815 8019651803 335
59 3300025253 Ga0209677_100902 Ga0209677_1009023 336
60 3300050511 nmdc:mga08y16_484243_c1 nmdc:mga08y16_484243_c1_123_1184 336
61 iso_pu_bacteria 2842718218 2842720739 336
62 iso_pu_bacteria 2932794094 2932794928 336
63 iso_pu_bacteria 2932801729 2932805281 336
64 iso_pu_bacteria 2935883170 2935887636 336
65 3300003775 Ga0055524_1008182 Ga0055524_10081822 337
66 3300009545 Ga0105237_10027033 Ga0105237_100270334 337
67 3300025299 Ga0209256_1000272 Ga0209256_100027223 337
68 3300035692 Ga0373935_0170286 Ga0373935_0170286_235_1320 337
69 3300048928 Ga0496125_0143744 Ga0496125_0143744_130_1167 337
70 3300010159 Ga0099796_10022278 Ga0099796_100222782 338
71 3300035692 Ga0373935_0046033 Ga0373935_0046033_1370_2410 338
72 3300035695 Ga0373927_0020110 Ga0373927_0020110_1781_2821 338
73 3300035725 Ga0373947_0005561 Ga0373947_0005561_5227_6267 338
74 3300037068 Ga0373925_0094377 Ga0373925_0094377_211_1251 338
75 3300046455 Ga0495603_0005242 Ga0495603_0005242_6527_7567 338
76 3300048914 Ga0496111_0109768 Ga0496111_0109768_938_1978 338
77 3300048918 Ga0496115_0130878 Ga0496115_0130878_622_1662 338
78 3300005937 Ga0081455_10002667 Ga0081455_1000266712 339
79 3300026121 Ga0207683_10143826 Ga0207683_101438262 339
80 3300047315 Ga0495581_0198818 Ga0495581_0198818_114_1157 339
81 3300048913 Ga0496110_0196880 Ga0496110_0196880_165_1214 339
82 iso_pu_bacteria 8016583857 8016585533 339
83 3300039437 Ga0436365_0747992 Ga0436365_0747992_815_1864 340
84 iso_pu_bacteria 2513237092 2513626485 340
85 iso_pu_bacteria 2513237094 2513638874 340
86 iso_pu_bacteria 2513237098 2513678178 340
87 iso_pu_bacteria 2513237102 2513702980 340
88 iso_pu_bacteria 2857509624 2857513248 340
89 iso_pu_bacteria 2874612657 2874620152 340
90 iso_pu_bacteria 2876761206 2876761750 340
91 iso_pu_bacteria 2881364244 2881369694 340
92 iso_pu_bacteria 2903768456 2903771242 340
93 iso_pu_bacteria 3005710791 3005717669 340
94 iso_pu_bacteria 8056967851 8056975451 340
95 3300005937 Ga0081455_10012598 Ga0081455_1001259810 341
96 3300005981 Ga0081538_10002323 Ga0081538_1000232313 341
97 3300005983 Ga0081540_1010842 Ga0081540_10108421 341
98 3300006871 Ga0075434_100131833 Ga0075434_1001318333 341
99 3300025261 Ga0209233_1000561 Ga0209233_10005617 341
100 3300028563 Ga0265319_1002449 Ga0265319_10024493 341
101 3300028573 Ga0265334_10004379 Ga0265334_100043795 341
102 3300028577 Ga0265318_10001721 Ga0265318_100017218 341
103 3300028653 Ga0265323_10000822 Ga0265323_100008223 341
104 3300028666 Ga0265336_10002743 Ga0265336_100027433 341
105 3300028800 Ga0265338_10000176 Ga0265338_1000017697 341
106 3300029957 Ga0265324_10002446 Ga0265324_100024467 341
107 3300031250 Ga0265331_10030941 Ga0265331_100309413 341
108 3300031712 Ga0265342_10003084 Ga0265342_100030843 341
109 3300041463 Ga0451804_0429416 Ga0451804_0429416_674_1723 341
110 3300044842 Ga0466957_0257535 Ga0466957_0257535_21_1076 341
111 3300046454 Ga0495592_0004669 Ga0495592_0004669_8947_10008 341
112 3300046462 Ga0495651_0001923 Ga0495651_0001923_8750_9811 341
113 3300046477 Ga0495664_0004785 Ga0495664_0004785_5902_6963 341
114 3300046511 Ga0495608_0010182 Ga0495608_0010182_1964_3025 341
115 3300046511 Ga0495608_0172658 Ga0495608_0172658_11_1060 341
116 3300046514 Ga0495618_0239314 Ga0495618_0239314_34_1095 341
117 3300046516 Ga0495628_0027421 Ga0495628_0027421_409_1470 341
118 3300046529 Ga0495652_0012146 Ga0495652_0012146_4869_5930 341
119 3300046533 Ga0495640_0005842 Ga0495640_0005842_2342_3403 341
120 3300046536 Ga0495587_0002682 Ga0495587_0002682_8317_9378 341
121 3300046559 Ga0495667_0011892 Ga0495667_0011892_2300_3361 341
122 3300046663 Ga0495635_0028796 Ga0495635_0028796_924_1985 341
123 3300046675 Ga0495657_0003498 Ga0495657_0003498_4549_5610 341
124 3300046678 Ga0495599_0005823 Ga0495599_0005823_184_1245 341
125 3300046679 Ga0495623_0004160 Ga0495623_0004160_554_1615 341
126 3300046680 Ga0495646_0052734 Ga0495646_0052734_455_1516 341
127 3300046689 Ga0495613_0111035 Ga0495613_0111035_446_1507 341
128 3300046809 Ga0495600_0002533 Ga0495600_0002533_5859_6920 341
129 3300047317 Ga0495604_0003533 Ga0495604_0003533_6264_7325 341
130 3300047319 Ga0495674_0016889 Ga0495674_0016889_5670_6731 341
131 3300047320 Ga0495672_0007852 Ga0495672_0007852_4586_5635 341
132 3300047322 Ga0495680_0000546 Ga0495680_0000546_34320_35381 341
133 3300047444 Ga0495675_0001333 Ga0495675_0001333_6391_7452 341
134 3300047469 Ga0495673_0059235 Ga0495673_0059235_469_1530 341
135 3300048088 Ga0495602_0003334 Ga0495602_0003334_6460_7521 341
136 3300048907 Ga0496104_0084884 Ga0496104_0084884_951_2015 341
137 3300048918 Ga0496115_0147538 Ga0496115_0147538_595_1659 341
138 3300048929 Ga0496126_0218469 Ga0496126_0218469_77_1126 341
139 3300050512 nmdc:mga0n895_127425_c1 nmdc:mga0n895_127425_c1_1116_2165 341
140 iso_pu_bacteria 2507262055 2507505825 341
141 iso_pu_bacteria 2508501009 2508540018 341
142 iso_pu_bacteria 2508501042 2508696093 341
143 iso_pu_bacteria 2511231028 2511394514 341
144 iso_pu_bacteria 2513237095 2513649791 341
145 iso_pu_bacteria 2513237104 2513715466 341
146 iso_pu_bacteria 2513237139 2513875457 341
147 iso_pu_bacteria 2513237161 2514011167 341
148 iso_pu_bacteria 2515154112 2515630825 341
149 iso_pu_bacteria 2517093001 2517105765 341
150 iso_pu_bacteria 2524023205 2524435495 341
151 iso_pu_bacteria 2528768022 2528851060 341
152 iso_pu_bacteria 2602042107 2603860414 341
153 iso_pu_bacteria 2617270735 2617347707 341
154 iso_pu_bacteria 2617270741 2617374436 341
155 iso_pu_bacteria 2744054633 2745081339 341
156 iso_pu_bacteria 2791355196 2793063687 341
157 iso_pu_bacteria 2802429603 2805921187 341
158 iso_pu_bacteria 2816332527 2818240791 341
159 iso_pu_bacteria 2824600985 2824603511 341
160 iso_pu_bacteria 2824609381 2824610902 341
161 iso_pu_bacteria 2824617872 2824619426 341
162 iso_pu_bacteria 2824626560 2824627881 341
163 iso_pu_bacteria 2824635225 2824636075 341
164 iso_pu_bacteria 2824644064 2824647041 341
165 iso_pu_bacteria 2824653114 2824653955 341
166 iso_pu_bacteria 2824661429 2824666429 341
167 iso_pu_bacteria 2824671348 2824677321 341
168 iso_pu_bacteria 2824679649 2824680295 341
169 iso_pu_bacteria 2824687955 2824693998 341
170 iso_pu_bacteria 2824696289 2824702825 341
171 iso_pu_bacteria 2824704595 2824710675 341
172 iso_pu_bacteria 2824714736 2824717305 341
173 iso_pu_bacteria 2824723954 2824726505 341
174 iso_pu_bacteria 2824732956 2824734952 341
175 iso_pu_bacteria 2824746037 2824748099 341
176 iso_pu_bacteria 2824753945 2824754954 341
177 iso_pu_bacteria 2824763712 2824765192 341
178 iso_pu_bacteria 2824773399 2824775819 341
179 iso_pu_bacteria 2838122688 2838125190 341
180 iso_pu_bacteria 2841941048 2841945931 341
181 iso_pu_bacteria 2841949485 2841956745 341
182 iso_pu_bacteria 2841957949 2841963340 341
183 iso_pu_bacteria 2841966195 2841973260 341
184 iso_pu_bacteria 2841974524 2841979578 341
185 iso_pu_bacteria 2841983080 2841989300 341
186 iso_pu_bacteria 2842038055 2842044292 341
187 iso_pu_bacteria 2842045827 2842051719 341
188 iso_pu_bacteria 2844315083 2844321578 341
189 iso_pu_bacteria 2847930680 2847939550 341
190 iso_pu_bacteria 2847939898 2847941356 341
191 iso_pu_bacteria 2849076700 2849082280 341
192 iso_pu_bacteria 2857524615 2857525361 341
193 iso_pu_bacteria 2874590934 2874592092 341
194 iso_pu_bacteria 2874620515 2874622363 341
195 iso_pu_bacteria 2874628541 2874633008 341
196 iso_pu_bacteria 2874645413 2874647229 341
197 iso_pu_bacteria 2876771140 2876772304 341
198 iso_pu_bacteria 2876818435 2876819528 341
199 iso_pu_bacteria 2879074833 2879075980 341
200 iso_pu_bacteria 2879083081 2879091454 341
201 iso_pu_bacteria 2879099564 2879106509 341
202 iso_pu_bacteria 2879127579 2879130383 341
203 iso_pu_bacteria 2879142872 2879147243 341
204 iso_pu_bacteria 2881665667 2881670247 341
205 iso_pu_bacteria 2885366525 2885367652 341
206 iso_pu_bacteria 2885409591 2885417552 341
207 iso_pu_bacteria 2888378607 2888378721 341
208 iso_pu_bacteria 2888419890 2888421012 341
209 iso_pu_bacteria 2893066018 2893066309 341
210 iso_pu_bacteria 2903727486 2903727848 341
211 iso_pu_bacteria 2904666416 2904671630 341
212 iso_pu_bacteria 2904711408 2904714380 341
213 iso_pu_bacteria 2906602504 2906602668 341
214 iso_pu_bacteria 2906626472 2906630976 341
215 iso_pu_bacteria 2906643746 2906650603 341
216 iso_pu_bacteria 2908775508 2908776917 341
217 iso_pu_bacteria 2919073203 2919074948 341
218 iso_pu_bacteria 2922368715 2922377595 341
219 iso_pu_bacteria 2922393267 2922393307 341
220 iso_pu_bacteria 2929615660 2929622373 341
221 iso_pu_bacteria 2929624759 2929629981 341
222 iso_pu_bacteria 2932784394 2932788094 341
223 iso_pu_bacteria 2932809354 2932813469 341
224 iso_pu_bacteria 2932818245 2932820166 341
225 iso_pu_bacteria 2932828146 2932832770 341
226 iso_pu_bacteria 2933577622 2933584013 341
227 iso_pu_bacteria 2935608549 2935613000 341
228 iso_pu_bacteria 2935616580 2935620258 341
229 iso_pu_bacteria 2935638405 2935640580 341
230 iso_pu_bacteria 2935648319 2935649281 341
231 iso_pu_bacteria 2935656913 2935657947 341
232 iso_pu_bacteria 2935665750 2935668772 341
233 iso_pu_bacteria 2935675223 2935681500 341
234 iso_pu_bacteria 2935684952 2935687079 341
235 iso_pu_bacteria 2935694250 2935696950 341
236 iso_pu_bacteria 2935703347 2935709718 341
237 iso_pu_bacteria 2935713505 2935716767 341
238 iso_pu_bacteria 2935722832 2935723108 341
239 iso_pu_bacteria 2935732158 2935734665 341
240 iso_pu_bacteria 2935741537 2935744544 341
241 iso_pu_bacteria 2935750917 2935753045 341
242 iso_pu_bacteria 2935760218 2935766941 341
243 iso_pu_bacteria 2935769743 2935775683 341
244 iso_pu_bacteria 2935777560 2935777865 341
245 iso_pu_bacteria 2935785616 2935791264 341
246 iso_pu_bacteria 2935793552 2935799576 341
247 iso_pu_bacteria 2935801545 2935804690 341
248 iso_pu_bacteria 2935810662 2935815842 341
249 iso_pu_bacteria 2935819856 2935825148 341
250 iso_pu_bacteria 2935827899 2935832086 341
251 iso_pu_bacteria 2935837841 2935841084 341
252 iso_pu_bacteria 2935847175 2935852367 341
253 iso_pu_bacteria 2935855204 2935859144 341
254 iso_pu_bacteria 2935864058 2935864328 341
255 iso_pu_bacteria 2935873716 2935875320 341
256 iso_pu_bacteria 2935908558 2935910801 341
257 iso_pu_bacteria 2935916978 2935921983 341
258 iso_pu_bacteria 2935926038 2935929880 341
259 iso_pu_bacteria 2935934488 2935937548 341
260 iso_pu_bacteria 2935942939 2935948053 341
261 iso_pu_bacteria 2935951376 2935956748 341
262 iso_pu_bacteria 2935959822 2935963987 341
263 iso_pu_bacteria 2935967501 2935970995 341
264 iso_pu_bacteria 2935975950 2935978318 341
265 iso_pu_bacteria 2935984226 2935985559 341
266 iso_pu_bacteria 2935992306 2935995702 341
267 iso_pu_bacteria 2936002035 2936008119 341
268 iso_pu_bacteria 2936011229 2936012166 341
269 iso_pu_bacteria 2936019824 2936020753 341
270 iso_pu_bacteria 2936028420 2936029459 341
271 iso_pu_bacteria 2936046547 2936048217 341
272 iso_pu_bacteria 2936055302 2936056671 341
273 iso_pu_bacteria 2940556831 2940558958 341
274 iso_pu_bacteria 2941538514 2941541654 341
275 iso_pu_bacteria 3005483717 3005485762 341
276 iso_pu_bacteria 3005506211 3005510814 341
277 iso_pu_bacteria 3005587118 3005588754 341
278 iso_pu_bacteria 3005594810 3005601941 341
279 iso_pu_bacteria 8006984368 8006992812 341
280 iso_pu_bacteria 8016511872 8016517452 341
281 iso_pu_bacteria 8016522445 8016526847 341
282 iso_pu_bacteria 8016539877 8016545140 341
283 iso_pu_bacteria 8016548790 8016556936 341
284 iso_pu_bacteria 8016557553 8016565287 341
285 iso_pu_bacteria 8016566248 8016570223 341
286 iso_pu_bacteria 8016575299 8016582778 341
287 iso_pu_bacteria 8016595262 8016602930 341
288 iso_pu_bacteria 8016603502 8016605809 341
289 iso_pu_bacteria 8016613128 8016617712 341
290 iso_pu_bacteria 8016630954 8016634995 341
291 iso_pu_bacteria 8017057580 8017059160 341
292 iso_pu_bacteria 8019530166 8019531758 341
293 iso_pu_bacteria 8019538911 8019539776 341
294 iso_pu_bacteria 8019547302 8019550878 341
295 iso_pu_bacteria 8019576017 8019576472 341
296 iso_pu_bacteria 8019608314 8019611300 341
297 iso_pu_bacteria 8019629233 8019631249 341
298 iso_pu_bacteria 8019638758 8019639374 341
299 iso_pu_bacteria 8019659431 8019668057 341
300 iso_pu_bacteria 8019687851 8019695574 341
301 iso_pu_bacteria 8055742211 8055743377 341
302 3300005548 Ga0070665_100277326 Ga0070665_1002773263 342
303 3300005983 Ga0081540_1010416 Ga0081540_10104164 342
304 3300005983 Ga0081540_1020381 Ga0081540_10203815 342
305 3300005985 Ga0081539_10031929 Ga0081539_100319294 342
306 3300005985 Ga0081539_10066952 Ga0081539_100669522 342
307 3300006038 Ga0075365_10044304 Ga0075365_100443042 342
308 3300009551 Ga0105238_10256670 Ga0105238_102566703 342
309 3300025924 Ga0207694_10240496 Ga0207694_102404963 342
310 3300026067 Ga0207678_10121620 Ga0207678_101216202 342
311 3300033180 Ga0307510_10055610 Ga0307510_100556103 342
312 3300035691 Ga0373931_0005817 Ga0373931_0005817_1197_2249 342
313 3300045976 Ga0466967_0083170 Ga0466967_0083170_149_1201 342
314 3300046460 Ga0495638_0015943 Ga0495638_0015943_880_1941 342
315 3300046460 Ga0495638_0016277 Ga0495638_0016277_3042_4103 342
316 3300046462 Ga0495651_0090735 Ga0495651_0090735_22_1086 342
317 3300046557 Ga0495622_0021661 Ga0495622_0021661_635_1696 342
318 3300046665 Ga0495661_0036570 Ga0495661_0036570_1673_2734 342
319 3300046691 Ga0495670_0030891 Ga0495670_0030891_1357_2418 342
320 3300048905 Ga0496102_0029530 Ga0496102_0029530_2658_3710 342
321 3300048908 Ga0496105_0032337 Ga0496105_0032337_910_1962 342
322 3300048911 Ga0496108_0235856 Ga0496108_0235856_102_1154 342
323 3300048913 Ga0496110_0030548 Ga0496110_0030548_1377_2429 342
324 3300048915 Ga0496112_0011528 Ga0496112_0011528_5956_7008 342
325 3300048916 Ga0496113_0168171 Ga0496113_0168171_141_1193 342
326 3300048920 Ga0496117_0058124 Ga0496117_0058124_1042_2103 342
327 3300048920 Ga0496117_0099551 Ga0496117_0099551_438_1496 342
328 3300048921 Ga0496118_0037060 Ga0496118_0037060_2012_3070 342
329 3300048921 Ga0496118_0045932 Ga0496118_0045932_106_1167 342
330 3300048923 Ga0496120_0062215 Ga0496120_0062215_461_1522 342
331 3300048924 Ga0496121_0003892 Ga0496121_0003892_8001_9062 342
332 3300048925 Ga0496122_0012396 Ga0496122_0012396_1962_3023 342
333 3300048926 Ga0496123_0022201 Ga0496123_0022201_3141_4202 342
334 3300048928 Ga0496125_0006315 Ga0496125_0006315_8596_9657 342
335 3300048929 Ga0496126_0333421 Ga0496126_0333421_28_1083 342
336 3300050492 nmdc:mga0yw44_48499_c1 nmdc:mga0yw44_48499_c1_260_1321 342
337 3300053088 Ga0500644_0019536 Ga0500644_0019536_681_1742 342
338 3300053094 Ga0500566_0007240 Ga0500566_0007240_2521_3582 342
339 3300053096 Ga0500641_0077440 Ga0500641_0077440_158_1219 342
340 3300053098 Ga0500650_0026722 Ga0500650_0026722_871_1932 342
341 3300053098 Ga0500650_0087658 Ga0500650_0087658_380_1441 342
342 3300053104 Ga0500556_0000003 Ga0500556_0000003_30812_31873 342
343 3300053109 Ga0500569_000744 Ga0500569_000744_793_1854 342
344 3300053111 Ga0500572_002210 Ga0500572_002210_1752_2813 342
345 3300053117 Ga0500593_078733 Ga0500593_078733_155_1216 342
346 3300053118 Ga0500594_0005603 Ga0500594_0005603_675_1736 342
347 3300053122 Ga0500608_024592 Ga0500608_024592_1399_2460 342
348 3300053130 Ga0500642_0000104 Ga0500642_0000104_22999_24060 342
349 3300053131 Ga0500652_008493 Ga0500652_008493_279_1340 342
350 3300053134 Ga0500658_0015470 Ga0500658_0015470_936_1997 342
351 3300053136 Ga0500559_0000117 Ga0500559_0000117_25542_26603 342
352 3300053136 Ga0500559_0010513 Ga0500559_0010513_1798_2853 342
353 3300053139 Ga0500568_0007686 Ga0500568_0007686_2035_3096 342
354 3300053145 Ga0500586_000338 Ga0500586_000338_2685_3746 342
355 3300053148 Ga0500590_089316 Ga0500590_089316_347_1408 342
356 3300053151 Ga0500604_0000898 Ga0500604_0000898_2352_3413 342
357 3300053153 Ga0500616_0000033 Ga0500616_0000033_397394_398455 342
358 3300053156 Ga0500622_0001002 Ga0500622_0001002_18985_20046 342
359 3300053163 Ga0500639_031207 Ga0500639_031207_141_1196 342
360 3300053177 Ga0500636_0078196 Ga0500636_0078196_122_1183 342
361 iso_pu_bacteria 2508501128 2509153663 342
362 iso_pu_bacteria 2513237141 2513891706 342
363 iso_pu_bacteria 2842333319 2842333513 342
364 3300003215 JGI25153J46596_10001792 JGI25153J46596_100017925 343
365 3300003215 JGI25153J46596_10003136 JGI25153J46596_100031364 343
366 3300003794 Ga0055531_10002428 Ga0055531_100024286 343
367 3300005335 Ga0070666_10234444 Ga0070666_102344442 343
368 3300005353 Ga0070669_100317280 Ga0070669_1003172801 343
369 3300005366 Ga0070659_100321938 Ga0070659_1003219381 343
370 3300005367 Ga0070667_100222752 Ga0070667_1002227523 343
371 3300005455 Ga0070663_100085005 Ga0070663_1000850052 343
372 3300005577 Ga0068857_100066434 Ga0068857_1000664343 343
373 3300005983 Ga0081540_1030298 Ga0081540_10302983 343
374 3300006038 Ga0075365_10013935 Ga0075365_100139354 343
375 3300006038 Ga0075365_10064888 Ga0075365_100648882 343
376 3300006038 Ga0075365_10165135 Ga0075365_101651352 343
377 3300006048 Ga0075363_100012251 Ga0075363_1000122513 343
378 3300006178 Ga0075367_10209436 Ga0075367_102094362 343
379 3300006186 Ga0075369_10043865 Ga0075369_100438652 343
380 3300006353 Ga0075370_10068260 Ga0075370_100682603 343
381 3300006942 Ga0099824_1006403 Ga0099824_10064036 343
382 3300006944 Ga0099823_1037610 Ga0099823_10376102 343
383 3300007788 Ga0099795_10009882 Ga0099795_100098822 343
384 3300009093 Ga0105240_10285015 Ga0105240_102850152 343
385 3300009177 Ga0105248_10163693 Ga0105248_101636932 343
386 3300009545 Ga0105237_10235116 Ga0105237_102351162 343
387 3300011119 Ga0105246_10097168 Ga0105246_100971682 343
388 3300013297 Ga0157378_10139081 Ga0157378_101390812 343
389 3300021324 Ga0214545_1031015 Ga0214545_10310151 343
390 3300025254 Ga0209148_1000784 Ga0209148_10007848 343
391 3300025272 Ga0209455_1001661 Ga0209455_10016616 343
392 3300025295 Ga0209564_1002283 Ga0209564_10022834 343
393 3300025295 Ga0209564_1008629 Ga0209564_10086294 343
394 3300025297 Ga0209758_1000015 Ga0209758_1000015728 343
395 3300025297 Ga0209758_1000306 Ga0209758_100030656 343
396 3300025297 Ga0209758_1000701 Ga0209758_10007017 343
397 3300025299 Ga0209256_1021845 Ga0209256_10218451 343
398 3300025302 Ga0207426_1001117 Ga0207426_100111724 343
399 3300025304 Ga0209257_1001260 Ga0209257_100126015 343
400 3300025304 Ga0209257_1007750 Ga0209257_10077506 343
401 3300025901 Ga0207688_10057283 Ga0207688_100572831 343
402 3300025904 Ga0207647_10012036 Ga0207647_100120366 343
403 3300025911 Ga0207654_10056358 Ga0207654_100563583 343
404 3300025914 Ga0207671_10149214 Ga0207671_101492142 343
405 3300025914 Ga0207671_10298843 Ga0207671_102988432 343
406 3300025924 Ga0207694_10143116 Ga0207694_101431162 343
407 3300025932 Ga0207690_10350574 Ga0207690_103505741 343
408 3300025933 Ga0207706_10412083 Ga0207706_104120831 343
409 3300025941 Ga0207711_10135997 Ga0207711_101359973 343
410 3300025972 Ga0207668_10143502 Ga0207668_101435022 343
411 3300026067 Ga0207678_10362892 Ga0207678_103628922 343
412 3300026116 Ga0207674_10129947 Ga0207674_101299473 343
413 3300027296 Ga0209389_1000012 Ga0209389_100001281 343
414 3300027296 Ga0209389_1000052 Ga0209389_100005234 343
415 3300027357 Ga0209589_1000058 Ga0209589_100005834 343
416 3300027361 Ga0209489_100019 Ga0209489_10001981 343
417 3300027361 Ga0209489_100020 Ga0209489_100020111 343
418 3300027363 Ga0209700_100018 Ga0209700_100018101 343
419 3300027866 Ga0209813_10033217 Ga0209813_100332172 343
420 3300031616 Ga0307508_10247379 Ga0307508_102473793 343
421 3300031727 Ga0316576_10003774 Ga0316576_100037747 343
422 3300031730 Ga0307516_10017246 Ga0307516_100172463 343
423 3300031730 Ga0307516_10063273 Ga0307516_100632733 343
424 3300031731 Ga0307405_10183097 Ga0307405_101830972 343
425 3300036712 Ga0316584_0002193 Ga0316584_0002193_8254_9342 343
426 3300037466 Ga0395898_0254442 Ga0395898_0254442_128_1189 343
427 3300037471 Ga0395905_0004146 Ga0395905_0004146_5229_6290 343
428 3300039450 Ga0436363_0039721 Ga0436363_0039721_246_1301 343
429 3300041505 Ga0451849_0305165 Ga0451849_0305165_370_1431 343
430 3300046455 Ga0495603_0036039 Ga0495603_0036039_330_1385 343
431 3300046459 Ga0495629_0028887 Ga0495629_0028887_1190_2251 343
432 3300046511 Ga0495608_0063403 Ga0495608_0063403_93_1154 343
433 3300046512 Ga0495610_0095184 Ga0495610_0095184_90_1151 343
434 3300046529 Ga0495652_0007527 Ga0495652_0007527_7442_8503 343
435 3300046530 Ga0495654_0034752 Ga0495654_0034752_844_1905 343
436 3300046642 Ga0495634_0075256 Ga0495634_0075256_315_1376 343
437 3300046663 Ga0495635_0019780 Ga0495635_0019780_1275_2336 343
438 3300046675 Ga0495657_0037121 Ga0495657_0037121_2200_3261 343
439 3300046690 Ga0495624_0151330 Ga0495624_0151330_335_1396 343
440 3300046694 Ga0495649_0164447 Ga0495649_0164447_65_1144 343
441 3300046809 Ga0495600_0014076 Ga0495600_0014076_2198_3259 343
442 3300047317 Ga0495604_0058268 Ga0495604_0058268_369_1430 343
443 3300047320 Ga0495672_0012029 Ga0495672_0012029_3062_4120 343
444 3300047444 Ga0495675_0112280 Ga0495675_0112280_345_1406 343
445 3300048088 Ga0495602_0153553 Ga0495602_0153553_306_1367 343
446 3300048904 Ga0496101_0325999 Ga0496101_0325999_23_1084 343
447 3300048906 Ga0496103_0039337 Ga0496103_0039337_1676_2731 343
448 3300048906 Ga0496103_0082413 Ga0496103_0082413_857_1918 343
449 3300048911 Ga0496108_0067452 Ga0496108_0067452_580_1641 343
450 3300048918 Ga0496115_0069856 Ga0496115_0069856_885_1946 343
451 3300048919 Ga0496116_0008611 Ga0496116_0008611_3109_4170 343
452 3300048919 Ga0496116_0087090 Ga0496116_0087090_53_1114 343
453 3300048920 Ga0496117_0023533 Ga0496117_0023533_1860_2921 343
454 3300048921 Ga0496118_0043939 Ga0496118_0043939_298_1359 343
455 3300048922 Ga0496119_0012324 Ga0496119_0012324_307_1368 343
456 3300048927 Ga0496124_0059392 Ga0496124_0059392_549_1610 343
457 3300048928 Ga0496125_0040815 Ga0496125_0040815_983_2044 343
458 3300048928 Ga0496125_0142561 Ga0496125_0142561_41_1102 343
459 3300050492 nmdc:mga0yw44_10551_c1 nmdc:mga0yw44_10551_c1_2250_3311 343
460 3300050492 nmdc:mga0yw44_21457_c1 nmdc:mga0yw44_21457_c1_1204_2262 343
461 3300050492 nmdc:mga0yw44_72656_c1 nmdc:mga0yw44_72656_c1_901_1962 343
462 3300050494 nmdc:mga06z11_127502_c1 nmdc:mga06z11_127502_c1_210_1271 343
463 3300050494 nmdc:mga06z11_165679_c1 nmdc:mga06z11_165679_c1_89_1162 343
464 3300050516 nmdc:mga0sz30_24364_c1 nmdc:mga0sz30_24364_c1_363_1424 343
465 3300053090 Ga0500646_0027563 Ga0500646_0027563_52_1131 343
466 3300053094 Ga0500566_0000110 Ga0500566_0000110_20186_21241 343
467 3300053095 Ga0500640_011481 Ga0500640_011481_180_1235 343
468 3300053105 Ga0500557_000124 Ga0500557_000124_6333_7394 343
469 3300053111 Ga0500572_002958 Ga0500572_002958_156_1211 343
470 3300053122 Ga0500608_031117 Ga0500608_031117_1145_2203 343
471 3300053123 Ga0500614_000900 Ga0500614_000900_1482_2537 343
472 3300053130 Ga0500642_0000100 Ga0500642_0000100_5577_6638 343
473 3300053136 Ga0500559_0005440 Ga0500559_0005440_1359_2414 343
474 3300053136 Ga0500559_0085304 Ga0500559_0085304_238_1293 343
475 3300053150 Ga0500603_001374 Ga0500603_001374_44_1099 343
476 3300053159 Ga0500630_004083 Ga0500630_004083_1204_2259 343
477 3300053162 Ga0500638_047139 Ga0500638_047139_810_1865 343
478 3300053163 Ga0500639_000598 Ga0500639_000598_7989_9044 343
479 3300053729 Ga0500625_045065 Ga0500625_045065_296_1357 343
480 3300053735 Ga0500596_007853 Ga0500596_007853_539_1594 343
481 3300053737 Ga0500601_000591 Ga0500601_000591_2032_3093 343
482 iso_pu_bacteria 2524023210 2524466256 343
483 iso_pu_bacteria 2885383462 2885385348 343
484 iso_pu_bacteria 8056681323 8056683499 343
485 3300003203 JGI25406J46586_10000885 JGI25406J46586_100008857 344
486 3300005262 Ga0065165_1027223 Ga0065165_10272231 344
487 3300005985 Ga0081539_10000729 Ga0081539_1000072925 344
488 3300013308 Ga0157375_10314033 Ga0157375_103140332 344
489 3300014325 Ga0163163_10067992 Ga0163163_100679924 344
490 3300025302 Ga0207426_1008688 Ga0207426_10086883 344
491 3300026067 Ga0207678_10255573 Ga0207678_102555732 344
492 3300046529 Ga0495652_0130916 Ga0495652_0130916_705_1766 344
493 3300046660 Ga0495625_0218206 Ga0495625_0218206_133_1191 344
494 3300046675 Ga0495657_0128859 Ga0495657_0128859_56_1117 344
495 3300048907 Ga0496104_0073659 Ga0496104_0073659_557_1618 344
496 3300048909 Ga0496106_0009870 Ga0496106_0009870_725_1786 344
497 3300048912 Ga0496109_0026957 Ga0496109_0026957_2428_3489 344
498 3300048913 Ga0496110_0007995 Ga0496110_0007995_850_1911 344
499 3300048915 Ga0496112_0019225 Ga0496112_0019225_3683_4744 344
500 3300048918 Ga0496115_0058415 Ga0496115_0058415_1094_2155 344
501 3300048925 Ga0496122_0020536 Ga0496122_0020536_3125_4189 344
502 3300003354 JGI25160J50197_1003913 JGI25160J50197_10039134 345
503 3300004625 Ga0055543_1001518 Ga0055543_10015182 345
504 3300005262 Ga0065165_1000415 Ga0065165_100041554 345
505 3300005434 Ga0070709_10012512 Ga0070709_100125123 345
506 3300005435 Ga0070714_100037004 Ga0070714_1000370043 345
507 3300005437 Ga0070710_10011173 Ga0070710_100111733 345
508 3300005439 Ga0070711_100007005 Ga0070711_1000070056 345
509 3300005548 Ga0070665_100067568 Ga0070665_1000675682 345
510 3300005616 Ga0068852_100335321 Ga0068852_1003353212 345
511 3300005843 Ga0068860_100003866 Ga0068860_1000038669 345
512 3300006028 Ga0070717_10032483 Ga0070717_100324832 345
513 3300006038 Ga0075365_10022911 Ga0075365_100229114 345
514 3300006048 Ga0075363_100074714 Ga0075363_1000747142 345
515 3300006173 Ga0070716_100001412 Ga0070716_1000014124 345
516 3300006175 Ga0070712_100196056 Ga0070712_1001960561 345
517 3300009174 Ga0105241_10040522 Ga0105241_100405223 345
518 3300009176 Ga0105242_10325543 Ga0105242_103255432 345
519 3300010375 Ga0105239_10115267 Ga0105239_101152673 345
520 3300021320 Ga0214544_1000003 Ga0214544_1000003440 345
521 3300021321 Ga0214542_1000022 Ga0214542_100002210 345
522 3300021324 Ga0214545_1000010 Ga0214545_1000010173 345
523 3300021327 Ga0214543_1000035 Ga0214543_100003510 345
524 3300025261 Ga0209233_1000543 Ga0209233_100054314 345
525 3300025261 Ga0209233_1008323 Ga0209233_10083231 345
526 3300025297 Ga0209758_1001694 Ga0209758_100169411 345
527 3300025297 Ga0209758_1004530 Ga0209758_10045304 345
528 3300025302 Ga0207426_1000217 Ga0207426_100021772 345
529 3300025302 Ga0207426_1012705 Ga0207426_10127052 345
530 3300025304 Ga0209257_1015800 Ga0209257_10158003 345
531 3300025898 Ga0207692_10010351 Ga0207692_100103513 345
532 3300025905 Ga0207685_10013754 Ga0207685_100137543 345
533 3300025906 Ga0207699_10001724 Ga0207699_100017243 345
534 3300025911 Ga0207654_10016718 Ga0207654_100167183 345
535 3300025915 Ga0207693_10002818 Ga0207693_100028185 345
536 3300025916 Ga0207663_10011381 Ga0207663_100113815 345
537 3300025919 Ga0207657_10183138 Ga0207657_101831382 345
538 3300025924 Ga0207694_10153665 Ga0207694_101536652 345
539 3300025928 Ga0207700_10015399 Ga0207700_100153993 345
540 3300025929 Ga0207664_10060839 Ga0207664_100608393 345
541 3300025939 Ga0207665_10002759 Ga0207665_100027594 345
542 3300026088 Ga0207641_10095333 Ga0207641_100953333 345
543 3300028379 Ga0268266_10037059 Ga0268266_100370594 345
544 3300028381 Ga0268264_10000073 Ga0268264_1000007323 345
545 3300028786 Ga0307517_10000476 Ga0307517_1000047661 345
546 3300028794 Ga0307515_10121156 Ga0307515_101211563 345
547 3300031235 Ga0265330_10017291 Ga0265330_100172913 345
548 3300033180 Ga0307510_10046575 Ga0307510_100465753 345
549 3300044658 Ga0466972_0000295 Ga0466972_0000295_26392_27453 345
550 3300044658 Ga0466972_0015953 Ga0466972_0015953_73_1134 345
551 3300044684 Ga0466966_0002033 Ga0466966_0002033_4574_5635 345
552 3300044693 Ga0466961_0000087 Ga0466961_0000087_20091_21152 345
553 3300044694 Ga0466963_0052810 Ga0466963_0052810_1107_2351 345
554 3300045049 Ga0466959_0002003 Ga0466959_0002003_4169_5230 345
555 3300046460 Ga0495638_0003622 Ga0495638_0003622_4348_5409 345
556 3300046462 Ga0495651_0088625 Ga0495651_0088625_794_1855 345
557 3300046474 Ga0495605_0083470 Ga0495605_0083470_127_1188 345
558 3300046506 Ga0495583_0050734 Ga0495583_0050734_761_1822 345
559 3300046507 Ga0495606_0086474 Ga0495606_0086474_863_1924 345
560 3300046518 Ga0495631_0055651 Ga0495631_0055651_11_1072 345
561 3300046524 Ga0495648_0036375 Ga0495648_0036375_47_1108 345
562 3300046524 Ga0495648_0101093 Ga0495648_0101093_246_1307 345
563 3300046660 Ga0495625_0029057 Ga0495625_0029057_2016_3077 345
564 3300046674 Ga0495588_0011966 Ga0495588_0011966_1660_2721 345
565 3300047321 Ga0495676_0053573 Ga0495676_0053573_1379_2440 345
566 3300047472 Ga0495686_0049142 Ga0495686_0049142_1322_2383 345
567 3300047472 Ga0495686_0049237 Ga0495686_0049237_169_1230 345
568 3300048908 Ga0496105_0011478 Ga0496105_0011478_221_1282 345
569 3300048909 Ga0496106_0101452 Ga0496106_0101452_1067_2128 345
570 3300048915 Ga0496112_0000169 Ga0496112_0000169_12410_13477 345
571 3300048920 Ga0496117_0078000 Ga0496117_0078000_500_1561 345
572 3300048921 Ga0496118_0083401 Ga0496118_0083401_59_1120 345
573 3300048924 Ga0496121_0027285 Ga0496121_0027285_2731_3792 345
574 3300048928 Ga0496125_0002212 Ga0496125_0002212_1997_3064 345
575 3300048928 Ga0496125_0036214 Ga0496125_0036214_1946_3007 345
576 3300048929 Ga0496126_0012765 Ga0496126_0012765_5843_6904 345
577 3300048929 Ga0496126_0059401 Ga0496126_0059401_354_1421 345
578 3300048929 Ga0496126_0069880 Ga0496126_0069880_367_1428 345
579 3300048929 Ga0496126_0091578 Ga0496126_0091578_18_1079 345
580 3300050492 nmdc:mga0yw44_41406_c1 nmdc:mga0yw44_41406_c1_1348_2409 345
581 3300053087 Ga0500643_000048 Ga0500643_000048_26760_27821 345
582 3300053104 Ga0500556_0003783 Ga0500556_0003783_826_1887 345
583 3300053139 Ga0500568_0038564 Ga0500568_0038564_340_1401 345
584 3300053156 Ga0500622_0017813 Ga0500622_0017813_1692_2753 345
585 3300053160 Ga0500633_0024503 Ga0500633_0024503_297_1358 345
586 3300053736 Ga0500599_002849 Ga0500599_002849_980_2041 345
587 3300055283 Ga0500661_005787 Ga0500661_005787_218_1279 345
588 iso_pu_bacteria 8056673599 8056678267 345
589 iso_pu_bacteria 8056689827 8056690888 345
590 3300005344 Ga0070661_100041101 Ga0070661_1000411014 346
591 3300021361 Ga0213872_10043969 Ga0213872_100439691 346
592 3300025914 Ga0207671_10198784 Ga0207671_101987841 346
593 3300031507 Ga0307509_10106278 Ga0307509_101062782 346
594 3300031616 Ga0307508_10000740 Ga0307508_1000074011 346
595 3300031616 Ga0307508_10176710 Ga0307508_101767103 346
596 3300032005 Ga0307411_10041450 Ga0307411_100414503 346
597 3300035695 Ga0373927_0021557 Ga0373927_0021557_1276_2349 346
598 3300037068 Ga0373925_0245062 Ga0373925_0245062_62_1135 346
599 3300039447 Ga0436361_0960294 Ga0436361_0960294_1573_2640 346
600 3300039453 Ga0436362_0159823 Ga0436362_0159823_1275_2342 346
601 3300048088 Ga0495602_0231460 Ga0495602_0231460_180_1244 346
602 3300048909 Ga0496106_0005511 Ga0496106_0005511_303_1373 346
603 3300048909 Ga0496106_0229856 Ga0496106_0229856_163_1230 346
604 3300048919 Ga0496116_0057216 Ga0496116_0057216_322_1392 346
605 3300048920 Ga0496117_0030017 Ga0496117_0030017_2985_4055 346
606 3300048922 Ga0496119_0076976 Ga0496119_0076976_800_1867 346
607 3300048924 Ga0496121_0000218 Ga0496121_0000218_22421_23491 346
608 3300048924 Ga0496121_0007080 Ga0496121_0007080_4732_5799 346
609 3300048927 Ga0496124_0025392 Ga0496124_0025392_4056_5126 346
610 3300048929 Ga0496126_0131930 Ga0496126_0131930_97_1164 346
611 3300050496 nmdc:mga07m45_69152_c1 nmdc:mga07m45_69152_c1_58_1128 346
612 3300053093 Ga0500651_0005923 Ga0500651_0005923_1185_2252 346
613 3300053119 Ga0500595_002302 Ga0500595_002302_6808_7875 346
614 3300053119 Ga0500595_011786 Ga0500595_011786_148_1215 346
615 3300053177 Ga0500636_0110815 Ga0500636_0110815_388_1452 346
616 3300053733 Ga0500552_004018 Ga0500552_004018_153_1226 346
617 iso_pu_bacteria 2791355199 2793078041 346
618 3300003203 JGI25406J46586_10000089 JGI25406J46586_1000008937 347
619 3300005329 Ga0070683_100203991 Ga0070683_1002039911 347
620 3300005334 Ga0068869_100060160 Ga0068869_1000601603 347
621 3300005338 Ga0068868_100042187 Ga0068868_1000421873 347
622 3300005436 Ga0070713_100029100 Ga0070713_1000291002 347
623 3300005439 Ga0070711_100009020 Ga0070711_1000090202 347
624 3300005445 Ga0070708_100272628 Ga0070708_1002726283 347
625 3300005455 Ga0070663_100009181 Ga0070663_1000091815 347
626 3300005518 Ga0070699_100144977 Ga0070699_1001449772 347
627 3300005536 Ga0070697_100131997 Ga0070697_1001319973 347
628 3300005543 Ga0070672_100288666 Ga0070672_1002886662 347
629 3300005548 Ga0070665_100130352 Ga0070665_1001303522 347
630 3300005564 Ga0070664_100046714 Ga0070664_1000467143 347
631 3300005618 Ga0068864_100038317 Ga0068864_1000383173 347
632 3300005844 Ga0068862_100462748 Ga0068862_1004627482 347
633 3300005983 Ga0081540_1021353 Ga0081540_10213532 347
634 3300005983 Ga0081540_1032237 Ga0081540_10322373 347
635 3300005983 Ga0081540_1032288 Ga0081540_10322882 347
636 3300005985 Ga0081539_10000461 Ga0081539_1000046180 347
637 3300007265 Ga0099794_10002308 Ga0099794_100023085 347
638 3300009093 Ga0105240_10023702 Ga0105240_100237028 347
639 3300009177 Ga0105248_10169254 Ga0105248_101692543 347
640 3300010375 Ga0105239_10078922 Ga0105239_100789223 347
641 3300011119 Ga0105246_10072422 Ga0105246_100724223 347
642 3300013306 Ga0163162_10087204 Ga0163162_100872044 347
643 3300025906 Ga0207699_10047208 Ga0207699_100472082 347
644 3300025913 Ga0207695_10057666 Ga0207695_100576662 347
645 3300025920 Ga0207649_10040585 Ga0207649_100405852 347
646 3300025928 Ga0207700_10012595 Ga0207700_100125953 347
647 3300025929 Ga0207664_10009218 Ga0207664_100092183 347
648 3300025939 Ga0207665_10061168 Ga0207665_100611683 347
649 3300025942 Ga0207689_10095790 Ga0207689_100957902 347
650 3300027671 Ga0209588_1000822 Ga0209588_10008223 347
651 3300031235 Ga0265330_10055412 Ga0265330_100554122 347
652 3300031247 Ga0265340_10046406 Ga0265340_100464062 347
653 3300031507 Ga0307509_10140559 Ga0307509_101405592 347
654 3300031712 Ga0265342_10047735 Ga0265342_100477352 347
655 3300035086 Ga0373934_0009613 Ga0373934_0009613_184_1251 347
656 3300035089 Ga0373944_0002516 Ga0373944_0002516_2202_3269 347
657 3300035111 Ga0373923_0001598 Ga0373923_0001598_3644_4711 347
658 3300035111 Ga0373923_0007180 Ga0373923_0007180_1288_2355 347
659 3300035111 Ga0373923_0029285 Ga0373923_0029285_73_1140 347
660 3300035113 Ga0373936_0015828 Ga0373936_0015828_773_1840 347
661 3300035116 Ga0373945_0007782 Ga0373945_0007782_1563_2630 347
662 3300035117 Ga0373953_0000365 Ga0373953_0000365_1955_3022 347
663 3300035117 Ga0373953_0054773 Ga0373953_0054773_283_1350 347
664 3300035118 Ga0373954_0000474 Ga0373954_0000474_11727_12794 347
665 3300035118 Ga0373954_0024611 Ga0373954_0024611_434_1501 347
666 3300035119 Ga0373956_0017676 Ga0373956_0017676_271_1338 347
667 3300035119 Ga0373956_0023157 Ga0373956_0023157_761_1828 347
668 3300035120 Ga0373957_0000677 Ga0373957_0000677_2705_3772 347
669 3300035170 Ga0373943_0001393 Ga0373943_0001393_4698_5765 347
670 3300035171 Ga0373946_0047144 Ga0373946_0047144_479_1546 347
671 3300035172 Ga0373955_0000870 Ga0373955_0000870_4543_5610 347
672 3300035172 Ga0373955_0007967 Ga0373955_0007967_1178_2245 347
673 3300035172 Ga0373955_0084838 Ga0373955_0084838_13_1080 347
674 3300035410 Ga0373924_0005372 Ga0373924_0005372_657_1724 347
675 3300035692 Ga0373935_0004338 Ga0373935_0004338_1460_2527 347
676 3300035692 Ga0373935_0122777 Ga0373935_0122777_292_1359 347
677 3300035692 Ga0373935_0301710 Ga0373935_0301710_14_1081 347
678 3300035695 Ga0373927_0006494 Ga0373927_0006494_2022_3089 347
679 3300035724 Ga0373933_0000158 Ga0373933_0000158_21455_22522 347
680 3300035724 Ga0373933_0001161 Ga0373933_0001161_12025_13092 347
681 3300035724 Ga0373933_0030660 Ga0373933_0030660_1319_2386 347
682 3300035725 Ga0373947_0005689 Ga0373947_0005689_2754_3821 347
683 3300036401 Ga0373937_0008434 Ga0373937_0008434_5397_6464 347
684 3300036401 Ga0373937_0111845 Ga0373937_0111845_39_1106 347
685 3300037068 Ga0373925_0002440 Ga0373925_0002440_8652_9719 347
686 3300037068 Ga0373925_0009266 Ga0373925_0009266_4073_5140 347
687 3300037068 Ga0373925_0009840 Ga0373925_0009840_4351_5418 347
688 3300044735 Ga0466968_0061456 Ga0466968_0061456_450_1517 347
689 3300046454 Ga0495592_0003034 Ga0495592_0003034_2492_3559 347
690 3300046454 Ga0495592_0019284 Ga0495592_0019284_3929_4996 347
691 3300046454 Ga0495592_0068558 Ga0495592_0068558_1126_2193 347
692 3300046455 Ga0495603_0000029 Ga0495603_0000029_3522_4589 347
693 3300046459 Ga0495629_0000029 Ga0495629_0000029_92208_93275 347
694 3300046459 Ga0495629_0002638 Ga0495629_0002638_1934_3001 347
695 3300046461 Ga0495641_0005506 Ga0495641_0005506_4061_5128 347
696 3300046462 Ga0495651_0002607 Ga0495651_0002607_4261_5328 347
697 3300046463 Ga0495653_0000341 Ga0495653_0000341_28693_29760 347
698 3300046472 Ga0495580_0005561 Ga0495580_0005561_4553_5620 347
699 3300046472 Ga0495580_0010591 Ga0495580_0010591_2166_3233 347
700 3300046473 Ga0495582_0000068 Ga0495582_0000068_9635_10702 347
701 3300046473 Ga0495582_0016420 Ga0495582_0016420_1130_2197 347
702 3300046475 Ga0495639_0000006 Ga0495639_0000006_70947_72014 347
703 3300046475 Ga0495639_0014829 Ga0495639_0014829_1575_2642 347
704 3300046476 Ga0495662_0003219 Ga0495662_0003219_2378_3445 347
705 3300046477 Ga0495664_0020110 Ga0495664_0020110_118_1185 347
706 3300046477 Ga0495664_0039694 Ga0495664_0039694_620_1687 347
707 3300046477 Ga0495664_0101448 Ga0495664_0101448_90_1157 347
708 3300046499 Ga0495594_0000750 Ga0495594_0000750_13338_14405 347
709 3300046511 Ga0495608_0000606 Ga0495608_0000606_14519_15586 347
710 3300046514 Ga0495618_0077613 Ga0495618_0077613_457_1524 347
711 3300046516 Ga0495628_0011645 Ga0495628_0011645_4450_5517 347
712 3300046517 Ga0495630_0005874 Ga0495630_0005874_2719_3786 347
713 3300046524 Ga0495648_0002484 Ga0495648_0002484_9703_10770 347
714 3300046524 Ga0495648_0011475 Ga0495648_0011475_1391_2458 347
715 3300046526 Ga0495666_0024498 Ga0495666_0024498_1671_2738 347
716 3300046529 Ga0495652_0048701 Ga0495652_0048701_2122_3189 347
717 3300046529 Ga0495652_0066072 Ga0495652_0066072_537_1604 347
718 3300046529 Ga0495652_0285224 Ga0495652_0285224_118_1185 347
719 3300046531 Ga0495665_0000237 Ga0495665_0000237_23408_24475 347
720 3300046531 Ga0495665_0020476 Ga0495665_0020476_1563_2630 347
721 3300046533 Ga0495640_0006116 Ga0495640_0006116_3453_4520 347
722 3300046533 Ga0495640_0007919 Ga0495640_0007919_6245_7312 347
723 3300046536 Ga0495587_0001595 Ga0495587_0001595_9150_10217 347
724 3300046543 Ga0495645_0040515 Ga0495645_0040515_2201_3268 347
725 3300046543 Ga0495645_0061502 Ga0495645_0061502_1296_2363 347
726 3300046557 Ga0495622_0009979 Ga0495622_0009979_3315_4382 347
727 3300046559 Ga0495667_0003214 Ga0495667_0003214_7206_8273 347
728 3300046559 Ga0495667_0101621 Ga0495667_0101621_174_1241 347
729 3300046616 Ga0495668_0065969 Ga0495668_0065969_763_1836 347
730 3300046642 Ga0495634_0001307 Ga0495634_0001307_9297_10364 347
731 3300046642 Ga0495634_0010145 Ga0495634_0010145_329_1396 347
732 3300046642 Ga0495634_0040885 Ga0495634_0040885_954_2021 347
733 3300046663 Ga0495635_0000092 Ga0495635_0000092_49285_50352 347
734 3300046663 Ga0495635_0047078 Ga0495635_0047078_195_1262 347
735 3300046675 Ga0495657_0006462 Ga0495657_0006462_4893_5960 347
736 3300046678 Ga0495599_0007153 Ga0495599_0007153_4676_5743 347
737 3300046679 Ga0495623_0004635 Ga0495623_0004635_2846_3913 347
738 3300046680 Ga0495646_0004002 Ga0495646_0004002_1991_3058 347
739 3300046680 Ga0495646_0100800 Ga0495646_0100800_68_1135 347
740 3300046681 Ga0495647_0003788 Ga0495647_0003788_2974_4041 347
741 3300046681 Ga0495647_0060863 Ga0495647_0060863_58_1125 347
742 3300046683 Ga0495658_0002427 Ga0495658_0002427_8229_9296 347
743 3300046689 Ga0495613_0000582 Ga0495613_0000582_13875_14942 347
744 3300046689 Ga0495613_0019334 Ga0495613_0019334_1475_2542 347
745 3300046689 Ga0495613_0188238 Ga0495613_0188238_336_1403 347
746 3300046809 Ga0495600_0001905 Ga0495600_0001905_6392_7459 347
747 3300046809 Ga0495600_0038562 Ga0495600_0038562_724_1791 347
748 3300046809 Ga0495600_0128684 Ga0495600_0128684_481_1548 347
749 3300047315 Ga0495581_0000048 Ga0495581_0000048_42701_43768 347
750 3300047315 Ga0495581_0139709 Ga0495581_0139709_320_1390 347
751 3300047315 Ga0495581_0190222 Ga0495581_0190222_36_1103 347
752 3300047317 Ga0495604_0001244 Ga0495604_0001244_15199_16266 347
753 3300047317 Ga0495604_0081406 Ga0495604_0081406_182_1249 347
754 3300047319 Ga0495674_0009200 Ga0495674_0009200_7998_9065 347
755 3300047319 Ga0495674_0011197 Ga0495674_0011197_134_1201 347
756 3300047319 Ga0495674_0173317 Ga0495674_0173317_311_1378 347
757 3300047322 Ga0495680_0006001 Ga0495680_0006001_5246_6313 347
758 3300047444 Ga0495675_0009372 Ga0495675_0009372_1893_2960 347
759 3300047469 Ga0495673_0059165 Ga0495673_0059165_362_1429 347
760 3300047471 Ga0495684_0000032 Ga0495684_0000032_56234_57301 347
761 3300047471 Ga0495684_0002955 Ga0495684_0002955_7520_8587 347
762 3300047471 Ga0495684_0063799 Ga0495684_0063799_179_1246 347
763 3300047673 Ga0495593_0000556 Ga0495593_0000556_4553_5620 347
764 3300047673 Ga0495593_0000660 Ga0495593_0000660_16368_17435 347
765 3300048088 Ga0495602_0006506 Ga0495602_0006506_2041_3108 347
766 3300048904 Ga0496101_0020506 Ga0496101_0020506_2523_3590 347
767 3300048905 Ga0496102_0009365 Ga0496102_0009365_5446_6513 347
768 3300048906 Ga0496103_0085757 Ga0496103_0085757_763_1830 347
769 3300048908 Ga0496105_0010801 Ga0496105_0010801_2865_3932 347
770 3300048909 Ga0496106_0004140 Ga0496106_0004140_7724_8791 347
771 3300048909 Ga0496106_0273268 Ga0496106_0273268_262_1329 347
772 3300048913 Ga0496110_0024944 Ga0496110_0024944_2263_3330 347
773 3300048915 Ga0496112_0062276 Ga0496112_0062276_2471_3538 347
774 3300048917 Ga0496114_0018487 Ga0496114_0018487_173_1240 347
775 3300048918 Ga0496115_0000889 Ga0496115_0000889_5858_6925 347
776 3300048924 Ga0496121_0000155 Ga0496121_0000155_137911_138978 347
777 3300048924 Ga0496121_0011030 Ga0496121_0011030_8551_9618 347
778 3300048926 Ga0496123_0069865 Ga0496123_0069865_581_1648 347
779 3300048927 Ga0496124_0117718 Ga0496124_0117718_394_1461 347
780 3300048929 Ga0496126_0009925 Ga0496126_0009925_2355_3422 347
781 3300048929 Ga0496126_0014895 Ga0496126_0014895_3279_4346 347
782 3300048929 Ga0496126_0019762 Ga0496126_0019762_3656_4723 347
783 3300048929 Ga0496126_0130897 Ga0496126_0130897_1072_2139 347
784 3300048929 Ga0496126_0196426 Ga0496126_0196426_248_1315 347
785 3300050496 nmdc:mga07m45_93184_c1 nmdc:mga07m45_93184_c1_463_1536 347
786 3300053077 Ga0495601_0001683 Ga0495601_0001683_7600_8667 347
787 3300053077 Ga0495601_0142735 Ga0495601_0142735_481_1548 347
788 3300053084 Ga0495595_0003264 Ga0495595_0003264_2144_3211 347
789 3300053085 Ga0495619_0000267 Ga0495619_0000267_2492_3559 347
790 3300053119 Ga0500595_005550 Ga0500595_005550_1424_2491 347
791 3300053139 Ga0500568_0007163 Ga0500568_0007163_3944_5011 347
792 3300053150 Ga0500603_000515 Ga0500603_000515_2645_3712 347
793 3300053178 Ga0500637_0003619 Ga0500637_0003619_5923_6990 347
794 iso_pu_bacteria 2513237101 2513694769 347
795 iso_pu_bacteria 2721755755 2723842198 347
796 iso_pu_bacteria 2874604998 2874610216 347
797 iso_pu_bacteria 2876808645 2876809240 347
798 iso_pu_bacteria 2879110137 2879112486 347
799 iso_pu_bacteria 2889033259 2889036299 347
800 iso_pu_bacteria 2922386360 2922389290 347
801 iso_pu_bacteria 8006964411 8006966409 347
802 iso_pu_bacteria 8006994254 8006997072 347
803 3300005434 Ga0070709_10031633 Ga0070709_100316332 348
804 3300013296 Ga0157374_10295269 Ga0157374_102952692 348
805 3300025906 Ga0207699_10028905 Ga0207699_100289052 348
806 3300025916 Ga0207663_10004235 Ga0207663_100042356 348
807 3300025939 Ga0207665_10050012 Ga0207665_100500122 348
808 3300046455 Ga0495603_0044791 Ga0495603_0044791_296_1366 348
809 3300048929 Ga0496126_0040827 Ga0496126_0040827_1094_2164 348
810 3300003215 JGI25153J46596_10003025 JGI25153J46596_100030255 349
811 3300006051 Ga0075364_10058583 Ga0075364_100585833 349
812 3300006942 Ga0099824_1018082 Ga0099824_10180823 349
813 3300006943 Ga0099822_1007370 Ga0099822_100737015 349
814 3300009147 Ga0114129_10131915 Ga0114129_101319153 349
815 3300025919 Ga0207657_10165202 Ga0207657_101652023 349
816 3300025936 Ga0207670_10145871 Ga0207670_101458712 349
817 3300025942 Ga0207689_10071727 Ga0207689_100717273 349
818 3300025986 Ga0207658_10283210 Ga0207658_102832101 349
819 3300026089 Ga0207648_10187430 Ga0207648_101874303 349
820 3300026121 Ga0207683_10431938 Ga0207683_104319381 349
821 3300027357 Ga0209589_1000015 Ga0209589_100001576 349
822 3300027361 Ga0209489_100015 Ga0209489_10001576 349
823 3300027363 Ga0209700_100025 Ga0209700_10002576 349
824 3300028379 Ga0268266_10001232 Ga0268266_100012327 349
825 3300028380 Ga0268265_10415570 Ga0268265_104155702 349
826 3300028786 Ga0307517_10140253 Ga0307517_101402531 349
827 3300031507 Ga0307509_10067824 Ga0307509_100678243 349
828 3300033180 Ga0307510_10026086 Ga0307510_100260861 349
829 3300046459 Ga0495629_0061905 Ga0495629_0061905_679_1758 349
830 3300046460 Ga0495638_0016057 Ga0495638_0016057_2581_3660 349
831 3300046500 Ga0495596_0038323 Ga0495596_0038323_655_1734 349
832 3300046523 Ga0495644_0033143 Ga0495644_0033143_332_1411 349
833 3300046616 Ga0495668_0006062 Ga0495668_0006062_1448_2527 349
834 3300046694 Ga0495649_0141527 Ga0495649_0141527_80_1159 349
835 3300047447 Ga0495685_017516 Ga0495685_017516_470_1549 349
836 3300048913 Ga0496110_0281533 Ga0496110_0281533_14_1090 349
837 3300048927 Ga0496124_0130505 Ga0496124_0130505_392_1471 349
838 3300048929 Ga0496126_0003000 Ga0496126_0003000_7575_8654 349
839 3300048929 Ga0496126_0143331 Ga0496126_0143331_277_1356 349
840 3300049583 Ga0501067_0091274 Ga0501067_0091274_485_1564 349
841 3300049742 Ga0501080_0116162 Ga0501080_0116162_1050_2129 349
842 3300050507 nmdc:mga05p37_315897_c1 nmdc:mga05p37_315897_c1_481_1560 349
843 3300053085 Ga0495619_0065596 Ga0495619_0065596_169_1242 349
844 3300053119 Ga0500595_011873 Ga0500595_011873_783_1862 349
845 3300053730 Ga0500645_002736 Ga0500645_002736_5867_6958 349
846 3300005327 Ga0070658_10161160 Ga0070658_101611602 350
847 3300005336 Ga0070680_100042682 Ga0070680_1000426823 350
848 3300005530 Ga0070679_100003707 Ga0070679_1000037073 350
849 3300005563 Ga0068855_100005214 Ga0068855_1000052147 350
850 3300006195 Ga0075366_10208068 Ga0075366_102080682 350
851 3300009093 Ga0105240_10332893 Ga0105240_103328932 350
852 3300013104 Ga0157370_10031488 Ga0157370_100314884 350
853 3300025913 Ga0207695_10338728 Ga0207695_103387282 350
854 3300025917 Ga0207660_10202889 Ga0207660_102028893 350
855 3300025921 Ga0207652_10264786 Ga0207652_102647862 350
856 3300053094 Ga0500566_0018033 Ga0500566_0018033_2319_3398 350
857 3300053102 Ga0500554_010006 Ga0500554_010006_494_1573 350
858 3300053119 Ga0500595_013114 Ga0500595_013114_1219_2298 350
859 3300053162 Ga0500638_056257 Ga0500638_056257_684_1763 350
860 3300053178 Ga0500637_0000347 Ga0500637_0000347_16082_17161 350
861 3300055283 Ga0500661_000111 Ga0500661_000111_131_1210 350
862 3300005334 Ga0068869_100021516 Ga0068869_1000215164 351
863 3300005347 Ga0070668_100052513 Ga0070668_1000525133 351
864 3300005355 Ga0070671_100062733 Ga0070671_1000627333 351
865 3300005457 Ga0070662_100023244 Ga0070662_1000232443 351
866 3300005548 Ga0070665_100006118 Ga0070665_10000611810 351
867 3300005548 Ga0070665_100034010 Ga0070665_1000340103 351
868 3300005563 Ga0068855_100292750 Ga0068855_1002927503 351
869 3300005616 Ga0068852_100295347 Ga0068852_1002953472 351
870 3300005617 Ga0068859_100150655 Ga0068859_1001506552 351
871 3300005618 Ga0068864_100016160 Ga0068864_1000161603 351
872 3300005841 Ga0068863_100130928 Ga0068863_1001309282 351
873 3300005937 Ga0081455_10034832 Ga0081455_100348323 351
874 3300005983 Ga0081540_1001266 Ga0081540_10012665 351
875 3300005983 Ga0081540_1004882 Ga0081540_10048823 351
876 3300005983 Ga0081540_1012305 Ga0081540_10123053 351
877 3300005985 Ga0081539_10034529 Ga0081539_100345293 351
878 3300006028 Ga0070717_10019858 Ga0070717_100198586 351
879 3300006042 Ga0075368_10046201 Ga0075368_100462011 351
880 3300006048 Ga0075363_100003826 Ga0075363_1000038263 351
881 3300006051 Ga0075364_10132637 Ga0075364_101326371 351
882 3300006051 Ga0075364_10225373 Ga0075364_102253731 351
883 3300006173 Ga0070716_100107414 Ga0070716_1001074142 351
884 3300006178 Ga0075367_10042045 Ga0075367_100420452 351
885 3300006186 Ga0075369_10040322 Ga0075369_100403222 351
886 3300006195 Ga0075366_10136676 Ga0075366_101366761 351
887 3300006237 Ga0097621_100078810 Ga0097621_1000788103 351
888 3300006881 Ga0068865_100015327 Ga0068865_1000153274 351
889 3300006931 Ga0097620_100150655 Ga0097620_1001506553 351
890 3300009094 Ga0111539_10038338 Ga0111539_100383385 351
891 3300009174 Ga0105241_10142573 Ga0105241_101425731 351
892 3300009176 Ga0105242_10274808 Ga0105242_102748082 351
893 3300009553 Ga0105249_10458408 Ga0105249_104584082 351
894 3300010375 Ga0105239_10186334 Ga0105239_101863343 351
895 3300014325 Ga0163163_10275411 Ga0163163_102754113 351
896 3300014968 Ga0157379_10062470 Ga0157379_100624704 351
897 3300025908 Ga0207643_10034912 Ga0207643_100349122 351
898 3300025911 Ga0207654_10019788 Ga0207654_100197883 351
899 3300025914 Ga0207671_10025812 Ga0207671_100258124 351
900 3300025918 Ga0207662_10086259 Ga0207662_100862593 351
901 3300025924 Ga0207694_10281173 Ga0207694_102811731 351
902 3300025927 Ga0207687_10069486 Ga0207687_100694862 351
903 3300025931 Ga0207644_10086400 Ga0207644_100864003 351
904 3300025933 Ga0207706_10097345 Ga0207706_100973453 351
905 3300025942 Ga0207689_10108961 Ga0207689_101089612 351
906 3300025949 Ga0207667_10145163 Ga0207667_101451632 351
907 3300025961 Ga0207712_10063310 Ga0207712_100633103 351
908 3300026035 Ga0207703_10032866 Ga0207703_100328663 351
909 3300026067 Ga0207678_10062792 Ga0207678_100627923 351
910 3300026089 Ga0207648_10043034 Ga0207648_100430343 351
911 3300026089 Ga0207648_10165856 Ga0207648_101658561 351
912 3300026095 Ga0207676_10027587 Ga0207676_100275873 351
913 3300026118 Ga0207675_100298097 Ga0207675_1002980971 351
914 3300026121 Ga0207683_10120195 Ga0207683_101201952 351
915 3300027866 Ga0209813_10024637 Ga0209813_100246373 351
916 3300028379 Ga0268266_10000936 Ga0268266_1000093637 351
917 3300028379 Ga0268266_10011944 Ga0268266_100119442 351
918 3300035113 Ga0373936_0036898 Ga0373936_0036898_69_1148 351
919 3300046518 Ga0495631_0075568 Ga0495631_0075568_200_1279 351
920 3300048910 Ga0496107_0136247 Ga0496107_0136247_309_1388 351
921 3300050490 nmdc:mga03n38_351_c1 nmdc:mga03n38_351_c1_7557_8636 351
922 3300050491 nmdc:mga00v17_128029_c1 nmdc:mga00v17_128029_c1_483_1562 351
923 3300050493 nmdc:mga0k408_31663_c1 nmdc:mga0k408_31663_c1_1195_2274 351
924 3300050494 nmdc:mga06z11_40480_c1 nmdc:mga06z11_40480_c1_1215_2294 351
925 3300050495 nmdc:mga04h51_28926_c1 nmdc:mga04h51_28926_c1_589_1668 351
926 3300050511 nmdc:mga08y16_66493_c1 nmdc:mga08y16_66493_c1_656_1735 351
927 3300002077 JGI24744J21845_10013094 JGI24744J21845_100130942 354
928 3300002244 JGI24742J22300_10010775 JGI24742J22300_100107751 354
929 3300005347 Ga0070668_100177828 Ga0070668_1001778283 354
930 3300005441 Ga0070700_100045927 Ga0070700_1000459273 354
931 3300005543 Ga0070672_100214609 Ga0070672_1002146093 354
932 3300005719 Ga0068861_100035761 Ga0068861_1000357613 354
933 3300009553 Ga0105249_10108707 Ga0105249_101087073 354
934 3300010375 Ga0105239_10223417 Ga0105239_102234173 354
935 3300025935 Ga0207709_10013681 Ga0207709_100136813 354
936 3300025937 Ga0207669_10031041 Ga0207669_100310413 354
937 3300025940 Ga0207691_10173501 Ga0207691_101735012 354
938 3300026075 Ga0207708_10144105 Ga0207708_101441052 354
939 3300026118 Ga0207675_100052832 Ga0207675_1000528322 354
940 3300046615 Ga0495656_0044715 Ga0495656_0044715_497_1600 354
941 3300048910 Ga0496107_0165980 Ga0496107_0165980_90_1193 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

311

376

0.99

PF00005

ABC_tran

ABC transporter

110

260

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9417 22 264
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9347 24 279
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9267 22 273
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9262 25 272
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9261 23 250
ID Description Score Start End Superfamily
af_P75796_311_605_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9566 22 283 3.40.50.300
af_P0AAH8_2_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.948 22 273 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9457 25 271 3.40.50.300
af_I6Y482_280_547_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9438 24 285 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.943 25 272 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7K3DSM3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9666 66 281 GO:0005524
GO:0016887
GO:0055085
AF-A0A212DUA4-F1-model_v4 deleted 0.9649 109 248
AF-A0A5C6AC51-F1-model_v4 Glutathione import ATP-binding protein GsiA (EC 3.6.3.-) 0.9599 22 279 GO:0005524
GO:0015833
GO:0016887
GO:0055085
AF-A0A841PNC6-F1-model_v4 Nickel transport system ATP-binding protein 0.9538 24 255 GO:0005524
GO:0016887
GO:0055085
AF-Q3BNZ3-F1-model_v4 Methionine import ATP-binding protein MetN (EC 7.4.2.11) 0.9494 25 273 GO:0005524
GO:0005886
GO:0016887
GO:0033232

Feature Viewer

pLDDT pTM Quality
86.15 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map