F486320
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 940 | 399 | 898 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300048917|Ga0496114_0323707|Ga0496114_0323707_153_1166 |
| Length | 337 |
| Sequence | MPDRKRPAAGPTAAGKTGKTTSGSGQTKMRGGRAADRAAVRADAGGDGPVGGASARVGVRKTYKLFIGGAFPRSESGRSYPAAGPDGAVLAHVAMASRKDARDAVVAARKAVAGWAGATAYNRGQVLYRVAELLQGRAAQFTAESVANEGVSRAEAERAVTEAIDRWVWYAGWPDKVAQVTGSANAVAGPYFNFSVPEPTGVVAVTAPATPGLLXXXSVLAPVIATGNTAVVVASESVPLPAVTLAEVLATSDVPPGVVNILTGRTAELAPVLAAHMDVNAIDLTGADVADRAGLARMAAGNVKRVLVSDDDWAAPPGPERMLAFLEIKTVWHPIGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 3 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 4 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 5 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 6 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 7 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 8 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 9 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 10 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 11 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 12 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 13 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 14 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 15 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 16 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 17 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 18 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 19 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 20 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 21 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 22 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 23 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 24 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 25 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 26 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 27 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 28 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 29 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 30 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 31 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 32 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 33 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 34 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 35 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 36 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 37 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 38 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 39 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 40 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 41 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 42 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 43 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 44 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 45 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 46 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 192 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 193 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 194 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 218 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 242 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 252 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 253 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 254 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 255 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 256 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 257 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 369 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 384 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 385 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 386 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 389 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 390 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 391 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 396 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 397 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 398 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 399 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.21 |
| Metatranscriptomes | 0.32 |
| Isolates | 4.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.6 |
| Nodule | 0 |
| Rhizoplane | 5.43 |
| Rhizosphere | 87.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1005976 | 3300000549 | Bacteria | 1526 |
| 2 | JGI24740J21852_10016753 | 3300001979 | Bacteria | 2639 |
| 3 | JGI24739J22299_10007674 | 3300001989 | Bacteria | 4035 |
| 4 | JGI24737J22298_10016265 | 3300001990 | Bacteria | 2402 |
| 5 | JGI24737J22298_10017067 | 3300001990 | Bacteria | 2340 |
| 6 | rootH2_10000702 | 3300003320 | Bacteria | 98192 |
| 7 | rootL2_10287462 | 3300003322 | Unclassified | 2603 |
| 8 | JGI25407J50210_10002761 | 3300003373 | Bacteria | 4176 |
| 9 | JGI25407J50210_10019322 | 3300003373 | Bacteria | 1771 |
| 10 | JGI25404J52841_10001883 | 3300003659 | Bacteria | 3835 |
| 11 | Ga0070690_100026408 | 3300005330 | Bacteria | 3582 |
| 12 | Ga0068869_100009393 | 3300005334 | Bacteria | 6346 |
| 13 | Ga0070680_100135656 | 3300005336 | Bacteria | 2061 |
| 14 | Ga0070682_100035175 | 3300005337 | Bacteria | 3056 |
| 15 | Ga0068868_100085051 | 3300005338 | Bacteria | 2541 |
| 16 | Ga0070660_100246681 | 3300005339 | Bacteria | 1455 |
| 17 | Ga0070691_10012141 | 3300005341 | Bacteria | 3944 |
| 18 | Ga0070691_10045492 | 3300005341 | Bacteria | 2083 |
| 19 | Ga0070661_100000480 | 3300005344 | Bacteria | 30486 |
| 20 | Ga0070661_100015487 | 3300005344 | Bacteria | 5381 |
| 21 | Ga0070661_100181116 | 3300005344 | Bacteria | 1603 |
| 22 | Ga0070661_100266859 | 3300005344 | Bacteria | 1324 |
| 23 | Ga0070668_100113809 | 3300005347 | Bacteria | 2156 |
| 24 | Ga0070668_100497742 | 3300005347 | Bacteria | 1055 |
| 25 | Ga0070675_100000194 | 3300005354 | Bacteria | 38282 |
| 26 | Ga0070671_100006642 | 3300005355 | Bacteria | 9247 |
| 27 | Ga0070673_100011497 | 3300005364 | Bacteria | 6043 |
| 28 | Ga0070688_100364111 | 3300005365 | Bacteria | 1062 |
| 29 | Ga0070659_100009047 | 3300005366 | Bacteria | 7309 |
| 30 | Ga0070667_100061147 | 3300005367 | Bacteria | 3188 |
| 31 | Ga0070709_10000166 | 3300005434 | Bacteria | 41674 |
| 32 | Ga0070709_10002090 | 3300005434 | Bacteria | 10810 |
| 33 | Ga0070709_10007326 | 3300005434 | Bacteria | 6046 |
| 34 | Ga0070714_100001331 | 3300005435 | Bacteria | 17836 |
| 35 | Ga0070714_100003333 | 3300005435 | Bacteria | 11978 |
| 36 | Ga0070714_100030237 | 3300005435 | Bacteria | 4506 |
| 37 | Ga0070714_100140973 | 3300005435 | Bacteria | 2164 |
| 38 | Ga0070713_100000050 | 3300005436 | Bacteria | 73746 |
| 39 | Ga0070713_100139436 | 3300005436 | Bacteria | 2146 |
| 40 | Ga0070713_100197947 | 3300005436 | Bacteria | 1813 |
| 41 | Ga0070713_100217465 | 3300005436 | Bacteria | 1732 |
| 42 | Ga0070713_100289161 | 3300005436 | Bacteria | 1506 |
| 43 | Ga0070710_10000055 | 3300005437 | Bacteria | 51746 |
| 44 | Ga0070710_10000435 | 3300005437 | Bacteria | 19546 |
| 45 | Ga0070710_10006989 | 3300005437 | Bacteria | 5444 |
| 46 | Ga0070711_100027816 | 3300005439 | Bacteria | 3715 |
| 47 | Ga0070705_100061937 | 3300005440 | Bacteria | 2225 |
| 48 | Ga0070705_100074217 | 3300005440 | Bacteria | 2067 |
| 49 | Ga0070694_100096640 | 3300005444 | Bacteria | 2082 |
| 50 | Ga0070708_100011223 | 3300005445 | Bacteria | 7285 |
| 51 | Ga0070708_100041831 | 3300005445 | Bacteria | 4019 |
| 52 | Ga0070708_100249986 | 3300005445 | Bacteria | 1666 |
| 53 | Ga0070663_100031164 | 3300005455 | Bacteria | 3663 |
| 54 | Ga0070663_100409800 | 3300005455 | Bacteria | 1110 |
| 55 | Ga0070678_100058966 | 3300005456 | Bacteria | 2819 |
| 56 | Ga0070662_100177105 | 3300005457 | Bacteria | 1679 |
| 57 | Ga0070681_10043195 | 3300005458 | Bacteria | 4516 |
| 58 | Ga0070706_100009721 | 3300005467 | Bacteria | 8939 |
| 59 | Ga0070706_100048728 | 3300005467 | Bacteria | 3910 |
| 60 | Ga0070706_100054511 | 3300005467 | Bacteria | 3690 |
| 61 | Ga0070706_100095470 | 3300005467 | Bacteria | 2760 |
| 62 | Ga0070706_100175291 | 3300005467 | Bacteria | 2002 |
| 63 | Ga0070707_100000473 | 3300005468 | Bacteria | 39809 |
| 64 | Ga0070707_100005848 | 3300005468 | Bacteria | 11466 |
| 65 | Ga0070707_100012394 | 3300005468 | Bacteria | 7961 |
| 66 | Ga0070707_100025347 | 3300005468 | Bacteria | 5625 |
| 67 | Ga0070707_100033209 | 3300005468 | Bacteria | 4919 |
| 68 | Ga0070707_100080778 | 3300005468 | Bacteria | 3138 |
| 69 | Ga0070707_100083675 | 3300005468 | Bacteria | 3083 |
| 70 | Ga0070707_100166643 | 3300005468 | Bacteria | 2147 |
| 71 | Ga0070698_100002837 | 3300005471 | Bacteria | 19066 |
| 72 | Ga0070698_100014157 | 3300005471 | Bacteria | 8432 |
| 73 | Ga0070698_100033301 | 3300005471 | Bacteria | 5337 |
| 74 | Ga0070698_100467157 | 3300005471 | Bacteria | 1198 |
| 75 | Ga0070699_100018579 | 3300005518 | Bacteria | 5972 |
| 76 | Ga0070699_100102561 | 3300005518 | Bacteria | 2508 |
| 77 | Ga0070679_100503694 | 3300005530 | Bacteria | 1155 |
| 78 | Ga0070684_100053587 | 3300005535 | Bacteria | 3512 |
| 79 | Ga0070684_100451804 | 3300005535 | Bacteria | 1188 |
| 80 | Ga0070697_100008951 | 3300005536 | Bacteria | 7823 |
| 81 | Ga0070697_100042029 | 3300005536 | Bacteria | 3700 |
| 82 | Ga0070697_100196145 | 3300005536 | Bacteria | 1715 |
| 83 | Ga0070686_100436560 | 3300005544 | Bacteria | 1003 |
| 84 | Ga0070665_100071319 | 3300005548 | Bacteria | 3481 |
| 85 | Ga0070704_100253445 | 3300005549 | Bacteria | 1446 |
| 86 | Ga0068855_100011645 | 3300005563 | Bacteria | 10629 |
| 87 | Ga0068855_100270937 | 3300005563 | Bacteria | 1888 |
| 88 | Ga0070664_100065548 | 3300005564 | Bacteria | 3099 |
| 89 | Ga0070664_100085300 | 3300005564 | Bacteria | 2727 |
| 90 | Ga0068857_100036375 | 3300005577 | Bacteria | 4362 |
| 91 | Ga0068857_100121210 | 3300005577 | Bacteria | 2354 |
| 92 | Ga0068857_100145383 | 3300005577 | Bacteria | 2145 |
| 93 | Ga0068857_100466054 | 3300005577 | Bacteria | 1183 |
| 94 | Ga0068857_100510562 | 3300005577 | Bacteria | 1129 |
| 95 | Ga0068856_100085687 | 3300005614 | Bacteria | 3130 |
| 96 | Ga0068852_100049783 | 3300005616 | Bacteria | 3586 |
| 97 | Ga0068852_100371802 | 3300005616 | Bacteria | 1401 |
| 98 | Ga0068852_100469305 | 3300005616 | Bacteria | 1249 |
| 99 | Ga0068859_100126037 | 3300005617 | Bacteria | 2629 |
| 100 | Ga0068864_100095816 | 3300005618 | Bacteria | 2625 |
| 101 | Ga0068864_100173229 | 3300005618 | Bacteria | 1969 |
| 102 | Ga0068866_10014385 | 3300005718 | Bacteria | 3494 |
| 103 | Ga0068861_100171327 | 3300005719 | Bacteria | 1799 |
| 104 | Ga0068863_100130608 | 3300005841 | Bacteria | 2398 |
| 105 | Ga0068863_100223657 | 3300005841 | Bacteria | 1814 |
| 106 | Ga0068863_100521651 | 3300005841 | Bacteria | 1171 |
| 107 | Ga0068858_100000281 | 3300005842 | Bacteria | 54790 |
| 108 | Ga0068858_100498075 | 3300005842 | Bacteria | 1177 |
| 109 | Ga0068860_100000286 | 3300005843 | Bacteria | 71981 |
| 110 | Ga0068860_100123657 | 3300005843 | Bacteria | 2479 |
| 111 | Ga0068862_100114172 | 3300005844 | Bacteria | 2374 |
| 112 | Ga0081455_10007241 | 3300005937 | Bacteria | 11718 |
| 113 | Ga0081455_10008314 | 3300005937 | Bacteria | 10812 |
| 114 | Ga0081455_10080099 | 3300005937 | Bacteria | 2679 |
| 115 | Ga0081538_10000079 | 3300005981 | Bacteria | 92419 |
| 116 | Ga0081538_10001977 | 3300005981 | Bacteria | 20499 |
| 117 | Ga0081538_10003089 | 3300005981 | Bacteria | 15834 |
| 118 | Ga0081540_1000134 | 3300005983 | Bacteria | 79126 |
| 119 | Ga0081540_1000527 | 3300005983 | Bacteria | 37363 |
| 120 | Ga0081539_10000356 | 3300005985 | Bacteria | 100748 |
| 121 | Ga0070717_10000775 | 3300006028 | Bacteria | 20918 |
| 122 | Ga0070717_10003709 | 3300006028 | Bacteria | 10978 |
| 123 | Ga0070717_10073250 | 3300006028 | Bacteria | 2862 |
| 124 | Ga0070717_10083758 | 3300006028 | Bacteria | 2682 |
| 125 | Ga0070717_10515540 | 3300006028 | Bacteria | 1081 |
| 126 | Ga0075365_10118382 | 3300006038 | Bacteria | 1825 |
| 127 | Ga0075364_10065617 | 3300006051 | Bacteria | 2383 |
| 128 | Ga0070715_10037300 | 3300006163 | Bacteria | 2011 |
| 129 | Ga0070715_10049194 | 3300006163 | Bacteria | 1805 |
| 130 | Ga0070716_100000268 | 3300006173 | Bacteria | 20929 |
| 131 | Ga0070716_100052078 | 3300006173 | Bacteria | 2330 |
| 132 | Ga0070712_100012392 | 3300006175 | Bacteria | 5418 |
| 133 | Ga0070712_100089727 | 3300006175 | Bacteria | 2249 |
| 134 | Ga0075428_100000669 | 3300006844 | Bacteria | 35178 |
| 135 | Ga0075428_100024987 | 3300006844 | Bacteria | 6610 |
| 136 | Ga0075428_100071186 | 3300006844 | Bacteria | 3801 |
| 137 | Ga0075428_100120061 | 3300006844 | Bacteria | 2862 |
| 138 | Ga0075428_100121027 | 3300006844 | Bacteria | 2850 |
| 139 | Ga0075428_100751413 | 3300006844 | Bacteria | 1038 |
| 140 | Ga0075430_100003905 | 3300006846 | Bacteria | 12567 |
| 141 | Ga0075430_100008412 | 3300006846 | Bacteria | 8714 |
| 142 | Ga0075430_100020627 | 3300006846 | Bacteria | 5605 |
| 143 | Ga0075430_100066631 | 3300006846 | Bacteria | 3024 |
| 144 | Ga0075431_100000513 | 3300006847 | Bacteria | 32457 |
| 145 | Ga0075431_100022199 | 3300006847 | Bacteria | 6490 |
| 146 | Ga0075431_100242950 | 3300006847 | Bacteria | 1831 |
| 147 | Ga0075429_100005589 | 3300006880 | Bacteria | 10838 |
| 148 | Ga0075429_100012802 | 3300006880 | Bacteria | 7276 |
| 149 | Ga0075429_100059512 | 3300006880 | Bacteria | 3328 |
| 150 | Ga0075429_100392746 | 3300006880 | Bacteria | 1215 |
| 151 | Ga0097620_100126036 | 3300006931 | Bacteria | 2629 |
| 152 | Ga0099794_10033229 | 3300007265 | Bacteria | 2425 |
| 153 | Ga0105251_10046492 | 3300009011 | Bacteria | 2088 |
| 154 | Ga0105240_10008130 | 3300009093 | Bacteria | 15050 |
| 155 | Ga0105240_10542480 | 3300009093 | Bacteria | 1288 |
| 156 | Ga0111539_10008303 | 3300009094 | Bacteria | 13217 |
| 157 | Ga0111539_10031916 | 3300009094 | Bacteria | 6398 |
| 158 | Ga0111539_10270344 | 3300009094 | Bacteria | 1978 |
| 159 | Ga0114129_10000001 | 3300009147 | Bacteria | 292978 |
| 160 | Ga0114129_10000011 | 3300009147 | Bacteria | 139000 |
| 161 | Ga0114129_10000201 | 3300009147 | Bacteria | 66395 |
| 162 | Ga0114129_10075261 | 3300009147 | Bacteria | 4701 |
| 163 | Ga0114129_10268023 | 3300009147 | Bacteria | 2286 |
| 164 | Ga0114129_10321087 | 3300009147 | Bacteria | 2058 |
| 165 | Ga0114129_10457866 | 3300009147 | Bacteria | 1672 |
| 166 | Ga0105243_10043334 | 3300009148 | Bacteria | 3527 |
| 167 | Ga0105243_10070227 | 3300009148 | Bacteria | 2827 |
| 168 | Ga0105241_10032699 | 3300009174 | Bacteria | 3902 |
| 169 | Ga0105241_10248435 | 3300009174 | Bacteria | 1507 |
| 170 | Ga0105248_10058674 | 3300009177 | Bacteria | 4322 |
| 171 | Ga0105248_10131729 | 3300009177 | Bacteria | 2821 |
| 172 | Ga0105248_10256882 | 3300009177 | Bacteria | 1967 |
| 173 | Ga0105237_10477996 | 3300009545 | Bacteria | 1252 |
| 174 | Ga0105238_10152672 | 3300009551 | Bacteria | 2284 |
| 175 | Ga0105249_10208698 | 3300009553 | Bacteria | 1915 |
| 176 | Ga0105249_10381417 | 3300009553 | Bacteria | 1436 |
| 177 | Ga0105239_10070091 | 3300010375 | Bacteria | 3851 |
| 178 | Ga0105239_10190656 | 3300010375 | Bacteria | 2295 |
| 179 | Ga0105239_10227730 | 3300010375 | Bacteria | 2091 |
| 180 | Ga0105239_10485530 | 3300010375 | Bacteria | 1404 |
| 181 | Ga0157371_10050131 | 3300013102 | Bacteria | 2966 |
| 182 | Ga0157370_10009280 | 3300013104 | Bacteria | 10536 |
| 183 | Ga0157370_10167967 | 3300013104 | Bacteria | 2040 |
| 184 | Ga0157369_10010406 | 3300013105 | Bacteria | 10601 |
| 185 | Ga0157374_10067450 | 3300013296 | Bacteria | 3364 |
| 186 | Ga0157374_10617566 | 3300013296 | Bacteria | 1095 |
| 187 | Ga0157375_10067949 | 3300013308 | Bacteria | 3563 |
| 188 | Ga0157375_10090494 | 3300013308 | Bacteria | 3119 |
| 189 | Ga0157375_10097559 | 3300013308 | Bacteria | 3014 |
| 190 | Ga0157375_10282254 | 3300013308 | Bacteria | 1824 |
| 191 | Ga0157375_10553806 | 3300013308 | Bacteria | 1312 |
| 192 | Ga0163163_10017213 | 3300014325 | Bacteria | 6735 |
| 193 | Ga0163163_10359165 | 3300014325 | Bacteria | 1513 |
| 194 | Ga0157380_10108755 | 3300014326 | Bacteria | 2325 |
| 195 | Ga0157380_10202063 | 3300014326 | Bacteria | 1764 |
| 196 | Ga0157377_10033019 | 3300014745 | Bacteria | 2822 |
| 197 | Ga0157377_10077392 | 3300014745 | Bacteria | 1937 |
| 198 | Ga0157376_10044321 | 3300014969 | Bacteria | 3656 |
| 199 | Ga0157376_10232731 | 3300014969 | Bacteria | 1712 |
| 200 | Ga0206354_11271448 | 3300020081 | Bacteria | 1564 |
| 201 | Ga0206353_10299334 | 3300020082 | Bacteria | 2344 |
| 202 | Ga0213875_10001293 | 3300021388 | Bacteria | 16668 |
| 203 | Ga0213875_10010004 | 3300021388 | Bacteria | 4772 |
| 204 | Ga0207713_1043258 | 3300025735 | Bacteria | 1862 |
| 205 | Ga0207653_10003493 | 3300025885 | Bacteria | 4950 |
| 206 | Ga0207692_10000027 | 3300025898 | Bacteria | 50108 |
| 207 | Ga0207692_10001629 | 3300025898 | Bacteria | 8474 |
| 208 | Ga0207692_10012248 | 3300025898 | Bacteria | 3679 |
| 209 | Ga0207688_10004893 | 3300025901 | Bacteria | 7291 |
| 210 | Ga0207688_10251284 | 3300025901 | Bacteria | 1071 |
| 211 | Ga0207680_10089396 | 3300025903 | Bacteria | 1955 |
| 212 | Ga0207647_10005178 | 3300025904 | Bacteria | 9594 |
| 213 | Ga0207685_10005407 | 3300025905 | Bacteria | 3369 |
| 214 | Ga0207699_10000102 | 3300025906 | Bacteria | 61110 |
| 215 | Ga0207699_10001301 | 3300025906 | Bacteria | 11864 |
| 216 | Ga0207699_10001338 | 3300025906 | Bacteria | 11705 |
| 217 | Ga0207699_10004405 | 3300025906 | Bacteria | 6732 |
| 218 | Ga0207699_10026106 | 3300025906 | Bacteria | 3215 |
| 219 | Ga0207645_10067759 | 3300025907 | Bacteria | 2281 |
| 220 | Ga0207643_10249953 | 3300025908 | Bacteria | 1092 |
| 221 | Ga0207684_10006576 | 3300025910 | Bacteria | 10578 |
| 222 | Ga0207684_10045994 | 3300025910 | Bacteria | 3703 |
| 223 | Ga0207684_10072295 | 3300025910 | Bacteria | 2929 |
| 224 | Ga0207654_10168434 | 3300025911 | Bacteria | 1421 |
| 225 | Ga0207671_10136889 | 3300025914 | Bacteria | 1884 |
| 226 | Ga0207693_10015690 | 3300025915 | Bacteria | 6071 |
| 227 | Ga0207693_10058853 | 3300025915 | Bacteria | 3010 |
| 228 | Ga0207693_10071822 | 3300025915 | Bacteria | 2710 |
| 229 | Ga0207693_10109391 | 3300025915 | Bacteria | 2168 |
| 230 | Ga0207663_10000170 | 3300025916 | Bacteria | 29272 |
| 231 | Ga0207663_10008646 | 3300025916 | Bacteria | 5341 |
| 232 | Ga0207663_10015017 | 3300025916 | Bacteria | 4261 |
| 233 | Ga0207663_10139798 | 3300025916 | Bacteria | 1685 |
| 234 | Ga0207663_10262990 | 3300025916 | Bacteria | 1275 |
| 235 | Ga0207660_10172610 | 3300025917 | Bacteria | 1674 |
| 236 | Ga0207662_10014842 | 3300025918 | Bacteria | 4376 |
| 237 | Ga0207657_10015632 | 3300025919 | Bacteria | 7343 |
| 238 | Ga0207657_10055424 | 3300025919 | Bacteria | 3424 |
| 239 | Ga0207649_10009851 | 3300025920 | Bacteria | 5239 |
| 240 | Ga0207649_10124469 | 3300025920 | Bacteria | 1742 |
| 241 | Ga0207652_10279136 | 3300025921 | Bacteria | 1507 |
| 242 | Ga0207646_10000511 | 3300025922 | Bacteria | 51827 |
| 243 | Ga0207646_10023876 | 3300025922 | Bacteria | 5610 |
| 244 | Ga0207646_10030107 | 3300025922 | Bacteria | 4923 |
| 245 | Ga0207646_10040503 | 3300025922 | Bacteria | 4189 |
| 246 | Ga0207646_10044676 | 3300025922 | Bacteria | 3976 |
| 247 | Ga0207694_10118387 | 3300025924 | Bacteria | 2113 |
| 248 | Ga0207659_10009797 | 3300025926 | Bacteria | 5995 |
| 249 | Ga0207687_10317176 | 3300025927 | Bacteria | 1261 |
| 250 | Ga0207700_10000029 | 3300025928 | Bacteria | 132615 |
| 251 | Ga0207700_10001082 | 3300025928 | Bacteria | 15685 |
| 252 | Ga0207700_10005259 | 3300025928 | Bacteria | 7716 |
| 253 | Ga0207700_10052683 | 3300025928 | Bacteria | 3044 |
| 254 | Ga0207700_10108037 | 3300025928 | Bacteria | 2233 |
| 255 | Ga0207700_10108358 | 3300025928 | Bacteria | 2230 |
| 256 | Ga0207700_10237261 | 3300025928 | Bacteria | 1553 |
| 257 | Ga0207700_10272069 | 3300025928 | Bacteria | 1454 |
| 258 | Ga0207664_10000168 | 3300025929 | Bacteria | 52834 |
| 259 | Ga0207664_10001827 | 3300025929 | Bacteria | 14040 |
| 260 | Ga0207664_10016562 | 3300025929 | Bacteria | 5381 |
| 261 | Ga0207664_10021473 | 3300025929 | Bacteria | 4802 |
| 262 | Ga0207664_10114621 | 3300025929 | Bacteria | 2246 |
| 263 | Ga0207664_10134886 | 3300025929 | Bacteria | 2082 |
| 264 | Ga0207664_10154325 | 3300025929 | Bacteria | 1953 |
| 265 | Ga0207664_10160820 | 3300025929 | Bacteria | 1915 |
| 266 | Ga0207690_10464201 | 3300025932 | Bacteria | 1019 |
| 267 | Ga0207706_10011538 | 3300025933 | Bacteria | 8046 |
| 268 | Ga0207709_10170719 | 3300025935 | Bacteria | 1526 |
| 269 | Ga0207665_10000144 | 3300025939 | Bacteria | 48077 |
| 270 | Ga0207665_10004667 | 3300025939 | Bacteria | 9103 |
| 271 | Ga0207665_10005206 | 3300025939 | Bacteria | 8686 |
| 272 | Ga0207665_10112795 | 3300025939 | Bacteria | 1912 |
| 273 | Ga0207689_10015828 | 3300025942 | Bacteria | 6387 |
| 274 | Ga0207689_10025438 | 3300025942 | Bacteria | 4961 |
| 275 | Ga0207667_10148464 | 3300025949 | Bacteria | 2413 |
| 276 | Ga0207667_10212294 | 3300025949 | Bacteria | 1984 |
| 277 | Ga0207651_10036600 | 3300025960 | Bacteria | 3206 |
| 278 | Ga0207712_10150252 | 3300025961 | Bacteria | 1798 |
| 279 | Ga0207712_10265669 | 3300025961 | Bacteria | 1393 |
| 280 | Ga0207668_10147583 | 3300025972 | Bacteria | 1817 |
| 281 | Ga0207677_10072190 | 3300026023 | Bacteria | 2439 |
| 282 | Ga0207703_10000173 | 3300026035 | Bacteria | 75642 |
| 283 | Ga0207678_10021601 | 3300026067 | Bacteria | 5643 |
| 284 | Ga0207678_10046428 | 3300026067 | Bacteria | 3755 |
| 285 | Ga0207708_10007803 | 3300026075 | Bacteria | 7925 |
| 286 | Ga0207702_10121496 | 3300026078 | Bacteria | 2338 |
| 287 | Ga0207641_10480173 | 3300026088 | Bacteria | 1204 |
| 288 | Ga0207648_10063057 | 3300026089 | Bacteria | 3231 |
| 289 | Ga0207676_10147933 | 3300026095 | Bacteria | 2019 |
| 290 | Ga0207676_10159132 | 3300026095 | Bacteria | 1954 |
| 291 | Ga0207674_10004069 | 3300026116 | Bacteria | 17718 |
| 292 | Ga0207674_10034596 | 3300026116 | Bacteria | 5280 |
| 293 | Ga0207674_10551941 | 3300026116 | Bacteria | 1113 |
| 294 | Ga0207675_100013930 | 3300026118 | Bacteria | 7495 |
| 295 | Ga0207683_10003655 | 3300026121 | Bacteria | 13377 |
| 296 | Ga0207683_10133058 | 3300026121 | Bacteria | 2237 |
| 297 | Ga0207698_10136154 | 3300026142 | Bacteria | 2108 |
| 298 | Ga0207698_10175189 | 3300026142 | Bacteria | 1893 |
| 299 | Ga0207698_10236897 | 3300026142 | Bacteria | 1661 |
| 300 | Ga0207698_10585941 | 3300026142 | Bacteria | 1098 |
| 301 | Ga0207428_10036811 | 3300027907 | Bacteria | 3987 |
| 302 | Ga0268265_10143532 | 3300028380 | Bacteria | 2002 |
| 303 | Ga0268264_10000246 | 3300028381 | Bacteria | 102361 |
| 304 | Ga0268264_10104010 | 3300028381 | Bacteria | 2474 |
| 305 | Ga0268264_10195866 | 3300028381 | Bacteria | 1845 |
| 306 | Ga0265334_10012852 | 3300028573 | Bacteria | 3511 |
| 307 | Ga0265318_10014087 | 3300028577 | Bacteria | 3361 |
| 308 | Ga0307515_10284834 | 3300028794 | Bacteria | 1355 |
| 309 | Ga0265338_10008735 | 3300028800 | Bacteria | 12248 |
| 310 | Ga0265338_10028796 | 3300028800 | Bacteria | 5529 |
| 311 | Ga0265324_10026005 | 3300029957 | Bacteria | 2072 |
| 312 | Ga0307511_10058350 | 3300030521 | Bacteria | 2984 |
| 313 | Ga0307511_10066119 | 3300030521 | Bacteria | 2697 |
| 314 | Ga0307512_10155660 | 3300030522 | Bacteria | 1353 |
| 315 | Ga0316180_1176821 | 3300030736 | Bacteria | 1977 |
| 316 | Ga0265320_10002133 | 3300031240 | Bacteria | 13874 |
| 317 | Ga0265325_10047288 | 3300031241 | Bacteria | 2227 |
| 318 | Ga0265340_10004044 | 3300031247 | Bacteria | 8239 |
| 319 | Ga0265340_10044288 | 3300031247 | Bacteria | 2177 |
| 320 | Ga0265331_10022587 | 3300031250 | Bacteria | 3209 |
| 321 | Ga0307513_10039124 | 3300031456 | Bacteria | 5259 |
| 322 | Ga0307513_10068521 | 3300031456 | Bacteria | 3716 |
| 323 | Ga0307513_10231929 | 3300031456 | Bacteria | 1658 |
| 324 | Ga0307513_10339587 | 3300031456 | Bacteria | 1253 |
| 325 | Ga0307509_10081585 | 3300031507 | Bacteria | 3340 |
| 326 | Ga0265342_10023010 | 3300031712 | Bacteria | 3951 |
| 327 | Ga0265342_10025071 | 3300031712 | Bacteria | 3756 |
| 328 | Ga0316576_10029277 | 3300031727 | Bacteria | 3891 |
| 329 | Ga0316576_10034208 | 3300031727 | Bacteria | 3621 |
| 330 | Ga0316578_10040255 | 3300031728 | Bacteria | 2701 |
| 331 | Ga0307405_10120116 | 3300031731 | Bacteria | 1797 |
| 332 | Ga0307405_10257355 | 3300031731 | Bacteria | 1302 |
| 333 | Ga0307405_10442443 | 3300031731 | Bacteria | 1028 |
| 334 | Ga0307413_10136855 | 3300031824 | Bacteria | 1686 |
| 335 | Ga0307413_10237553 | 3300031824 | Bacteria | 1343 |
| 336 | Ga0307518_10133220 | 3300031838 | Bacteria | 1744 |
| 337 | Ga0307410_10117772 | 3300031852 | Bacteria | 1932 |
| 338 | Ga0307406_10065726 | 3300031901 | Bacteria | 2358 |
| 339 | Ga0307407_10058484 | 3300031903 | Bacteria | 2241 |
| 340 | Ga0307407_10393583 | 3300031903 | Bacteria | 992 |
| 341 | Ga0307409_100043096 | 3300031995 | Bacteria | 3385 |
| 342 | Ga0307409_100062491 | 3300031995 | Bacteria | 2916 |
| 343 | Ga0307416_100007146 | 3300032002 | Bacteria | 7062 |
| 344 | Ga0307416_100068131 | 3300032002 | Bacteria | 2939 |
| 345 | Ga0307416_100355555 | 3300032002 | Bacteria | 1484 |
| 346 | Ga0307414_10333488 | 3300032004 | Bacteria | 1296 |
| 347 | Ga0307411_10011700 | 3300032005 | Bacteria | 4751 |
| 348 | Ga0307415_100006044 | 3300032126 | Bacteria | 6488 |
| 349 | Ga0307415_100060691 | 3300032126 | Bacteria | 2614 |
| 350 | Ga0307415_100162331 | 3300032126 | Bacteria | 1733 |
| 351 | Ga0307507_10159938 | 3300033179 | Bacteria | 1667 |
| 352 | Ga0373926_0000029 | 3300035083 | Bacteria | 23191 |
| 353 | Ga0373926_0006978 | 3300035083 | Bacteria | 3756 |
| 354 | Ga0373928_0015343 | 3300035084 | Bacteria | 1559 |
| 355 | Ga0373929_0002535 | 3300035085 | Bacteria | 3356 |
| 356 | Ga0373929_0033552 | 3300035085 | Bacteria | 1110 |
| 357 | Ga0373934_0000049 | 3300035086 | Bacteria | 40994 |
| 358 | Ga0373934_0005406 | 3300035086 | Bacteria | 4730 |
| 359 | Ga0373934_0011263 | 3300035086 | Bacteria | 3365 |
| 360 | Ga0373934_0017411 | 3300035086 | Bacteria | 2743 |
| 361 | Ga0373940_0003437 | 3300035088 | Bacteria | 3234 |
| 362 | Ga0373944_0000419 | 3300035089 | Bacteria | 9698 |
| 363 | Ga0373944_0000803 | 3300035089 | Bacteria | 7680 |
| 364 | Ga0373949_0013294 | 3300035090 | Bacteria | 1824 |
| 365 | Ga0373923_0001569 | 3300035111 | Bacteria | 6627 |
| 366 | Ga0373923_0007640 | 3300035111 | Bacteria | 3814 |
| 367 | Ga0373923_0015623 | 3300035111 | Bacteria | 2869 |
| 368 | Ga0373923_0029737 | 3300035111 | Bacteria | 2192 |
| 369 | Ga0373936_0000433 | 3300035113 | Bacteria | 13986 |
| 370 | Ga0373936_0024453 | 3300035113 | Bacteria | 2358 |
| 371 | Ga0373936_0028672 | 3300035113 | Bacteria | 2189 |
| 372 | Ga0373945_0000686 | 3300035116 | Bacteria | 9775 |
| 373 | Ga0373953_0000067 | 3300035117 | Bacteria | 25799 |
| 374 | Ga0373953_0004314 | 3300035117 | Bacteria | 4524 |
| 375 | Ga0373953_0006688 | 3300035117 | Bacteria | 3814 |
| 376 | Ga0373954_0049417 | 3300035118 | Bacteria | 1972 |
| 377 | Ga0373956_0000086 | 3300035119 | Bacteria | 31023 |
| 378 | Ga0373956_0002433 | 3300035119 | Bacteria | 7584 |
| 379 | Ga0373956_0018268 | 3300035119 | Bacteria | 2967 |
| 380 | Ga0373956_0029484 | 3300035119 | Bacteria | 2394 |
| 381 | Ga0373956_0048891 | 3300035119 | Bacteria | 1895 |
| 382 | Ga0373957_0000632 | 3300035120 | Bacteria | 9005 |
| 383 | Ga0373957_0012190 | 3300035120 | Bacteria | 2888 |
| 384 | Ga0373957_0017544 | 3300035120 | Bacteria | 2495 |
| 385 | Ga0373943_0000683 | 3300035170 | Bacteria | 14797 |
| 386 | Ga0373946_0000547 | 3300035171 | Bacteria | 12448 |
| 387 | Ga0373946_0001780 | 3300035171 | Bacteria | 7510 |
| 388 | Ga0373946_0034533 | 3300035171 | Bacteria | 2042 |
| 389 | Ga0373955_0000252 | 3300035172 | Bacteria | 22257 |
| 390 | Ga0373955_0013081 | 3300035172 | Bacteria | 4002 |
| 391 | Ga0373955_0030358 | 3300035172 | Bacteria | 2821 |
| 392 | Ga0373955_0030668 | 3300035172 | Bacteria | 2809 |
| 393 | Ga0373942_0002413 | 3300035207 | Bacteria | 4537 |
| 394 | Ga0373942_0009261 | 3300035207 | Bacteria | 2302 |
| 395 | Ga0373962_0015047 | 3300035242 | Bacteria | 1979 |
| 396 | Ga0316574_0038258 | 3300035398 | Bacteria | 2945 |
| 397 | Ga0373924_0001613 | 3300035410 | Bacteria | 7398 |
| 398 | Ga0373924_0002829 | 3300035410 | Bacteria | 5875 |
| 399 | Ga0373935_0001279 | 3300035692 | Bacteria | 13858 |
| 400 | Ga0373935_0004514 | 3300035692 | Bacteria | 8181 |
| 401 | Ga0373935_0075877 | 3300035692 | Bacteria | 2175 |
| 402 | Ga0373935_0317921 | 3300035692 | Bacteria | 1104 |
| 403 | Ga0373935_0372596 | 3300035692 | Bacteria | 1021 |
| 404 | Ga0373927_0005059 | 3300035695 | Bacteria | 9125 |
| 405 | Ga0373927_0008697 | 3300035695 | Bacteria | 6822 |
| 406 | Ga0373933_0000051 | 3300035724 | Bacteria | 71384 |
| 407 | Ga0373933_0002841 | 3300035724 | Bacteria | 9670 |
| 408 | Ga0373933_0050651 | 3300035724 | Bacteria | 2479 |
| 409 | Ga0373933_0072236 | 3300035724 | Bacteria | 2101 |
| 410 | Ga0373947_0001901 | 3300035725 | Bacteria | 12758 |
| 411 | Ga0373947_0006626 | 3300035725 | Bacteria | 6723 |
| 412 | Ga0373947_0104227 | 3300035725 | Bacteria | 1785 |
| 413 | Ga0373937_0000289 | 3300036401 | Bacteria | 47874 |
| 414 | Ga0373937_0009894 | 3300036401 | Bacteria | 8313 |
| 415 | Ga0373937_0058844 | 3300036401 | Bacteria | 3530 |
| 416 | Ga0373937_0132729 | 3300036401 | Bacteria | 2326 |
| 417 | Ga0373937_0150534 | 3300036401 | Bacteria | 2179 |
| 418 | Ga0316582_0218837 | 3300036647 | Bacteria | 1302 |
| 419 | Ga0316584_0175662 | 3300036712 | Bacteria | 1587 |
| 420 | Ga0373925_0004633 | 3300037068 | Bacteria | 10380 |
| 421 | Ga0373925_0006032 | 3300037068 | Bacteria | 8967 |
| 422 | Ga0373925_0013709 | 3300037068 | Bacteria | 5868 |
| 423 | Ga0373925_0098291 | 3300037068 | Bacteria | 2246 |
| 424 | Ga0395900_0007194 | 3300037418 | Bacteria | 11535 |
| 425 | Ga0395900_0040121 | 3300037418 | Bacteria | 4824 |
| 426 | Ga0395898_0154761 | 3300037466 | Bacteria | 2193 |
| 427 | Ga0395898_0213776 | 3300037466 | Bacteria | 1839 |
| 428 | Ga0436364_0087476 | 3300037853 | Bacteria | 47044 |
| 429 | Ga0436364_0687768 | 3300037853 | Bacteria | 4381 |
| 430 | Ga0436364_0883803 | 3300037853 | Bacteria | 2258 |
| 431 | Ga0436364_0997648 | 3300037853 | Bacteria | 2735 |
| 432 | Ga0436364_1326662 | 3300037853 | Bacteria | 39324 |
| 433 | Ga0436364_1333729 | 3300037853 | Bacteria | 3764 |
| 434 | Ga0395901_0018699 | 3300038443 | Bacteria | 7077 |
| 435 | Ga0395901_0147008 | 3300038443 | Bacteria | 2477 |
| 436 | Ga0436363_0342702 | 3300039450 | Bacteria | 1419 |
| 437 | Ga0436363_0362663 | 3300039450 | Bacteria | 1217 |
| 438 | Ga0451802_0807064 | 3300041460 | Bacteria | 2239 |
| 439 | Ga0451853_1399455 | 3300041512 | Bacteria | 9982 |
| 440 | Ga0439448_0001608 | 3300042005 | Bacteria | 5919 |
| 441 | Ga0439449_0068540 | 3300042007 | Bacteria | 1308 |
| 442 | Ga0439450_000461 | 3300042008 | Bacteria | 5286 |
| 443 | Ga0439463_005356 | 3300042016 | Bacteria | 3186 |
| 444 | Ga0439464_0001366 | 3300042439 | Bacteria | 5717 |
| 445 | Ga0439460_0002958 | 3300042461 | Bacteria | 4093 |
| 446 | Ga0439440_0002719 | 3300042993 | Bacteria | 3357 |
| 447 | Ga0466969_0028088 | 3300044656 | Bacteria | 2876 |
| 448 | Ga0466972_0003345 | 3300044658 | Bacteria | 7949 |
| 449 | Ga0466965_0010442 | 3300044683 | Bacteria | 4331 |
| 450 | Ga0466966_0003582 | 3300044684 | Bacteria | 10251 |
| 451 | Ga0466966_0068692 | 3300044684 | Bacteria | 2224 |
| 452 | Ga0466961_0006845 | 3300044693 | Bacteria | 7252 |
| 453 | Ga0466961_0013279 | 3300044693 | Bacteria | 5270 |
| 454 | Ga0466961_0054516 | 3300044693 | Bacteria | 2550 |
| 455 | Ga0466961_0064737 | 3300044693 | Bacteria | 2323 |
| 456 | Ga0466961_0105346 | 3300044693 | Bacteria | 1775 |
| 457 | Ga0466961_0134553 | 3300044693 | Bacteria | 1549 |
| 458 | Ga0466961_0293804 | 3300044693 | Bacteria | 993 |
| 459 | Ga0466963_0063032 | 3300044694 | Bacteria | 2480 |
| 460 | Ga0466963_0099909 | 3300044694 | Bacteria | 1985 |
| 461 | Ga0466963_0227764 | 3300044694 | Bacteria | 1306 |
| 462 | Ga0466964_0069989 | 3300044706 | Bacteria | 1481 |
| 463 | Ga0466971_0001527 | 3300044719 | Bacteria | 9761 |
| 464 | Ga0466971_0112252 | 3300044719 | Bacteria | 1258 |
| 465 | Ga0466970_0020427 | 3300044765 | Bacteria | 3441 |
| 466 | Ga0466970_0088990 | 3300044765 | Bacteria | 1674 |
| 467 | Ga0466957_0020618 | 3300044842 | Bacteria | 3879 |
| 468 | Ga0466957_0078189 | 3300044842 | Bacteria | 2056 |
| 469 | Ga0466957_0124251 | 3300044842 | Bacteria | 1647 |
| 470 | Ga0466960_0021272 | 3300044901 | Bacteria | 2885 |
| 471 | Ga0466960_0054179 | 3300044901 | Bacteria | 1947 |
| 472 | Ga0466960_0085367 | 3300044901 | Bacteria | 1599 |
| 473 | Ga0466959_0001241 | 3300045049 | Bacteria | 15410 |
| 474 | Ga0466959_0006690 | 3300045049 | Bacteria | 8016 |
| 475 | Ga0466958_0009913 | 3300045836 | Bacteria | 5321 |
| 476 | Ga0466958_0029434 | 3300045836 | Bacteria | 3259 |
| 477 | Ga0466958_0126851 | 3300045836 | Bacteria | 1600 |
| 478 | Ga0466967_0005879 | 3300045976 | Bacteria | 8590 |
| 479 | Ga0466967_0084313 | 3300045976 | Bacteria | 2875 |
| 480 | Ga0466967_0174812 | 3300045976 | Bacteria | 2023 |
| 481 | Ga0466967_0470667 | 3300045976 | Bacteria | 1230 |
| 482 | Ga0466967_0501596 | 3300045976 | Bacteria | 1191 |
| 483 | Ga0495592_0000111 | 3300046454 | Bacteria | 71400 |
| 484 | Ga0495592_0023301 | 3300046454 | Bacteria | 4708 |
| 485 | Ga0495592_0037269 | 3300046454 | Bacteria | 3661 |
| 486 | Ga0495592_0071860 | 3300046454 | Bacteria | 2518 |
| 487 | Ga0495592_0072184 | 3300046454 | Bacteria | 2511 |
| 488 | Ga0495629_0009160 | 3300046459 | Bacteria | 7248 |
| 489 | Ga0495629_0147707 | 3300046459 | Bacteria | 1634 |
| 490 | Ga0495641_0003333 | 3300046461 | Bacteria | 12083 |
| 491 | Ga0495641_0003865 | 3300046461 | Bacteria | 10927 |
| 492 | Ga0495641_0005398 | 3300046461 | Bacteria | 8649 |
| 493 | Ga0495651_0000068 | 3300046462 | Bacteria | 76489 |
| 494 | Ga0495651_0001532 | 3300046462 | Bacteria | 17873 |
| 495 | Ga0495651_0002798 | 3300046462 | Bacteria | 13523 |
| 496 | Ga0495651_0009060 | 3300046462 | Bacteria | 7638 |
| 497 | Ga0495651_0086274 | 3300046462 | Bacteria | 2362 |
| 498 | Ga0495651_0102771 | 3300046462 | Bacteria | 2124 |
| 499 | Ga0495653_0002320 | 3300046463 | Bacteria | 15090 |
| 500 | Ga0495653_0004725 | 3300046463 | Bacteria | 11029 |
| 501 | Ga0495653_0005403 | 3300046463 | Bacteria | 10402 |
| 502 | Ga0495653_0011639 | 3300046463 | Bacteria | 7182 |
| 503 | Ga0495653_0037340 | 3300046463 | Bacteria | 3817 |
| 504 | Ga0495653_0042432 | 3300046463 | Bacteria | 3543 |
| 505 | Ga0495653_0102787 | 3300046463 | Bacteria | 2067 |
| 506 | Ga0495653_0251618 | 3300046463 | Bacteria | 1172 |
| 507 | Ga0495653_0279795 | 3300046463 | Bacteria | 1095 |
| 508 | Ga0495580_0016862 | 3300046472 | Bacteria | 5477 |
| 509 | Ga0495580_0089223 | 3300046472 | Bacteria | 2146 |
| 510 | Ga0495580_0116311 | 3300046472 | Bacteria | 1857 |
| 511 | Ga0495582_0001688 | 3300046473 | Bacteria | 12464 |
| 512 | Ga0495582_0023358 | 3300046473 | Bacteria | 3383 |
| 513 | Ga0495582_0035858 | 3300046473 | Bacteria | 2728 |
| 514 | Ga0495639_0034447 | 3300046475 | Bacteria | 2265 |
| 515 | Ga0495639_0045609 | 3300046475 | Bacteria | 1983 |
| 516 | Ga0495639_0078151 | 3300046475 | Bacteria | 1537 |
| 517 | Ga0495662_0000400 | 3300046476 | Bacteria | 19374 |
| 518 | Ga0495662_0011429 | 3300046476 | Bacteria | 4339 |
| 519 | Ga0495662_0063494 | 3300046476 | Bacteria | 1784 |
| 520 | Ga0495662_0064706 | 3300046476 | Bacteria | 1767 |
| 521 | Ga0495664_0003706 | 3300046477 | Bacteria | 8335 |
| 522 | Ga0495664_0086409 | 3300046477 | Bacteria | 1884 |
| 523 | Ga0495664_0122637 | 3300046477 | Bacteria | 1571 |
| 524 | Ga0495664_0147728 | 3300046477 | Bacteria | 1426 |
| 525 | Ga0495606_0001132 | 3300046507 | Bacteria | 37971 |
| 526 | Ga0495608_0000160 | 3300046511 | Bacteria | 48626 |
| 527 | Ga0495608_0001185 | 3300046511 | Bacteria | 18505 |
| 528 | Ga0495608_0017087 | 3300046511 | Bacteria | 5021 |
| 529 | Ga0495608_0019053 | 3300046511 | Bacteria | 4729 |
| 530 | Ga0495618_0014041 | 3300046514 | Bacteria | 4876 |
| 531 | Ga0495618_0025606 | 3300046514 | Bacteria | 3662 |
| 532 | Ga0495618_0028042 | 3300046514 | Bacteria | 3508 |
| 533 | Ga0495628_0000250 | 3300046516 | Bacteria | 47359 |
| 534 | Ga0495628_0009279 | 3300046516 | Bacteria | 8407 |
| 535 | Ga0495628_0011278 | 3300046516 | Bacteria | 7560 |
| 536 | Ga0495628_0017244 | 3300046516 | Bacteria | 6013 |
| 537 | Ga0495628_0025644 | 3300046516 | Bacteria | 4815 |
| 538 | Ga0495628_0076978 | 3300046516 | Bacteria | 2595 |
| 539 | Ga0495628_0214688 | 3300046516 | Bacteria | 1446 |
| 540 | Ga0495630_0028635 | 3300046517 | Bacteria | 4139 |
| 541 | Ga0495630_0071921 | 3300046517 | Bacteria | 2603 |
| 542 | Ga0495630_0289393 | 3300046517 | Bacteria | 1252 |
| 543 | Ga0495666_0005084 | 3300046526 | Bacteria | 6654 |
| 544 | Ga0495666_0164184 | 3300046526 | Bacteria | 1029 |
| 545 | Ga0495652_0000440 | 3300046529 | Bacteria | 48629 |
| 546 | Ga0495652_0000860 | 3300046529 | Bacteria | 35013 |
| 547 | Ga0495652_0016783 | 3300046529 | Bacteria | 6543 |
| 548 | Ga0495652_0058582 | 3300046529 | Bacteria | 3260 |
| 549 | Ga0495652_0095794 | 3300046529 | Bacteria | 2418 |
| 550 | Ga0495652_0158990 | 3300046529 | Bacteria | 1756 |
| 551 | Ga0495652_0229477 | 3300046529 | Bacteria | 1389 |
| 552 | Ga0495665_0001375 | 3300046531 | Bacteria | 13014 |
| 553 | Ga0495665_0035237 | 3300046531 | Bacteria | 2674 |
| 554 | Ga0495665_0073112 | 3300046531 | Bacteria | 1805 |
| 555 | Ga0495665_0140664 | 3300046531 | Bacteria | 1261 |
| 556 | Ga0495640_0012101 | 3300046533 | Bacteria | 6608 |
| 557 | Ga0495640_0016894 | 3300046533 | Bacteria | 5451 |
| 558 | Ga0495640_0020018 | 3300046533 | Bacteria | 4932 |
| 559 | Ga0495586_0014091 | 3300046535 | Bacteria | 4247 |
| 560 | Ga0495586_0019800 | 3300046535 | Bacteria | 3583 |
| 561 | Ga0495586_0083048 | 3300046535 | Bacteria | 1762 |
| 562 | Ga0495587_0000056 | 3300046536 | Bacteria | 96726 |
| 563 | Ga0495587_0004715 | 3300046536 | Bacteria | 8946 |
| 564 | Ga0495587_0008582 | 3300046536 | Bacteria | 6568 |
| 565 | Ga0495587_0015541 | 3300046536 | Bacteria | 4751 |
| 566 | Ga0495587_0026209 | 3300046536 | Bacteria | 3556 |
| 567 | Ga0495587_0077861 | 3300046536 | Bacteria | 1924 |
| 568 | Ga0495645_0017763 | 3300046543 | Bacteria | 5101 |
| 569 | Ga0495645_0040788 | 3300046543 | Bacteria | 3385 |
| 570 | Ga0495645_0117053 | 3300046543 | Bacteria | 1880 |
| 571 | Ga0495667_0000078 | 3300046559 | Bacteria | 71356 |
| 572 | Ga0495667_0000947 | 3300046559 | Bacteria | 18764 |
| 573 | Ga0495667_0004878 | 3300046559 | Bacteria | 9068 |
| 574 | Ga0495667_0013303 | 3300046559 | Bacteria | 5570 |
| 575 | Ga0495667_0019859 | 3300046559 | Bacteria | 4534 |
| 576 | Ga0495667_0024606 | 3300046559 | Bacteria | 4055 |
| 577 | Ga0495667_0025498 | 3300046559 | Bacteria | 3983 |
| 578 | Ga0495667_0031900 | 3300046559 | Bacteria | 3533 |
| 579 | Ga0495656_0026587 | 3300046615 | Bacteria | 2305 |
| 580 | Ga0495668_0000615 | 3300046616 | Bacteria | 43050 |
| 581 | Ga0495634_0004211 | 3300046642 | Bacteria | 11359 |
| 582 | Ga0495634_0011704 | 3300046642 | Bacteria | 6380 |
| 583 | Ga0495634_0034112 | 3300046642 | Bacteria | 3493 |
| 584 | Ga0495634_0052817 | 3300046642 | Bacteria | 2723 |
| 585 | Ga0495634_0141493 | 3300046642 | Bacteria | 1527 |
| 586 | Ga0495634_0189990 | 3300046642 | Bacteria | 1281 |
| 587 | Ga0495625_0023711 | 3300046660 | Bacteria | 4683 |
| 588 | Ga0495635_0000244 | 3300046663 | Bacteria | 34527 |
| 589 | Ga0495635_0001441 | 3300046663 | Bacteria | 15895 |
| 590 | Ga0495635_0002316 | 3300046663 | Bacteria | 12947 |
| 591 | Ga0495635_0018200 | 3300046663 | Bacteria | 4903 |
| 592 | Ga0495635_0093358 | 3300046663 | Bacteria | 2057 |
| 593 | Ga0495657_0000444 | 3300046675 | Bacteria | 38608 |
| 594 | Ga0495657_0006066 | 3300046675 | Bacteria | 9487 |
| 595 | Ga0495657_0006331 | 3300046675 | Bacteria | 9275 |
| 596 | Ga0495657_0047671 | 3300046675 | Bacteria | 2895 |
| 597 | Ga0495657_0090086 | 3300046675 | Bacteria | 1969 |
| 598 | Ga0495599_0001783 | 3300046678 | Bacteria | 12482 |
| 599 | Ga0495599_0006717 | 3300046678 | Bacteria | 6949 |
| 600 | Ga0495599_0047684 | 3300046678 | Bacteria | 2685 |
| 601 | Ga0495599_0055897 | 3300046678 | Bacteria | 2470 |
| 602 | Ga0495623_0000209 | 3300046679 | Bacteria | 37387 |
| 603 | Ga0495623_0034635 | 3300046679 | Bacteria | 3238 |
| 604 | Ga0495623_0035576 | 3300046679 | Bacteria | 3191 |
| 605 | Ga0495623_0080263 | 3300046679 | Bacteria | 2020 |
| 606 | Ga0495623_0153858 | 3300046679 | Bacteria | 1357 |
| 607 | Ga0495646_0004757 | 3300046680 | Bacteria | 8573 |
| 608 | Ga0495646_0007692 | 3300046680 | Bacteria | 6846 |
| 609 | Ga0495646_0008480 | 3300046680 | Bacteria | 6527 |
| 610 | Ga0495646_0015185 | 3300046680 | Bacteria | 4891 |
| 611 | Ga0495646_0020950 | 3300046680 | Bacteria | 4134 |
| 612 | Ga0495646_0022028 | 3300046680 | Bacteria | 4022 |
| 613 | Ga0495646_0022376 | 3300046680 | Bacteria | 3988 |
| 614 | Ga0495658_0007983 | 3300046683 | Bacteria | 5242 |
| 615 | Ga0495658_0012486 | 3300046683 | Bacteria | 4305 |
| 616 | Ga0495613_0013631 | 3300046689 | Bacteria | 6033 |
| 617 | Ga0495600_0004520 | 3300046809 | Bacteria | 8334 |
| 618 | Ga0495600_0018370 | 3300046809 | Bacteria | 4455 |
| 619 | Ga0495600_0050119 | 3300046809 | Bacteria | 2724 |
| 620 | Ga0495600_0050668 | 3300046809 | Bacteria | 2709 |
| 621 | Ga0495600_0100703 | 3300046809 | Bacteria | 1883 |
| 622 | Ga0495581_0000947 | 3300047315 | Bacteria | 15594 |
| 623 | Ga0495581_0012762 | 3300047315 | Bacteria | 4867 |
| 624 | Ga0495581_0190917 | 3300047315 | Bacteria | 1198 |
| 625 | Ga0495604_0000105 | 3300047317 | Bacteria | 71375 |
| 626 | Ga0495604_0008628 | 3300047317 | Bacteria | 8057 |
| 627 | Ga0495604_0009174 | 3300047317 | Bacteria | 7829 |
| 628 | Ga0495604_0013304 | 3300047317 | Bacteria | 6552 |
| 629 | Ga0495604_0030524 | 3300047317 | Bacteria | 4280 |
| 630 | Ga0495674_0001098 | 3300047319 | Bacteria | 25960 |
| 631 | Ga0495674_0016755 | 3300047319 | Bacteria | 6835 |
| 632 | Ga0495674_0017493 | 3300047319 | Bacteria | 6671 |
| 633 | Ga0495674_0023294 | 3300047319 | Bacteria | 5708 |
| 634 | Ga0495674_0042198 | 3300047319 | Bacteria | 4070 |
| 635 | Ga0495674_0076907 | 3300047319 | Bacteria | 2870 |
| 636 | Ga0495674_0360765 | 3300047319 | Bacteria | 1178 |
| 637 | Ga0495674_0376443 | 3300047319 | Bacteria | 1149 |
| 638 | Ga0495676_0004908 | 3300047321 | Bacteria | 12269 |
| 639 | Ga0495680_0000115 | 3300047322 | Bacteria | 76480 |
| 640 | Ga0495680_0003508 | 3300047322 | Bacteria | 15385 |
| 641 | Ga0495680_0005139 | 3300047322 | Bacteria | 12356 |
| 642 | Ga0495680_0006180 | 3300047322 | Bacteria | 11167 |
| 643 | Ga0495680_0036467 | 3300047322 | Bacteria | 3946 |
| 644 | Ga0495680_0039803 | 3300047322 | Bacteria | 3747 |
| 645 | Ga0495680_0100714 | 3300047322 | Bacteria | 2152 |
| 646 | Ga0495683_0157084 | 3300047323 | Bacteria | 1054 |
| 647 | Ga0495675_0001210 | 3300047444 | Bacteria | 15641 |
| 648 | Ga0495675_0027223 | 3300047444 | Bacteria | 3643 |
| 649 | Ga0495675_0036612 | 3300047444 | Bacteria | 3128 |
| 650 | Ga0495684_0010668 | 3300047471 | Bacteria | 7103 |
| 651 | Ga0495684_0038708 | 3300047471 | Bacteria | 3655 |
| 652 | Ga0495684_0101890 | 3300047471 | Bacteria | 2170 |
| 653 | Ga0495684_0175008 | 3300047471 | Bacteria | 1593 |
| 654 | Ga0495593_0002762 | 3300047673 | Bacteria | 10557 |
| 655 | Ga0495593_0042392 | 3300047673 | Bacteria | 2442 |
| 656 | Ga0495602_0000114 | 3300048088 | Bacteria | 76491 |
| 657 | Ga0495602_0031216 | 3300048088 | Bacteria | 5041 |
| 658 | Ga0495602_0071836 | 3300048088 | Bacteria | 2954 |
| 659 | Ga0495602_0088268 | 3300048088 | Bacteria | 2582 |
| 660 | Ga0495614_0032918 | 3300048089 | Bacteria | 2230 |
| 661 | Ga0495614_0058879 | 3300048089 | Bacteria | 1649 |
| 662 | Ga0495626_0000127 | 3300048091 | Bacteria | 97134 |
| 663 | Ga0496100_0006407 | 3300048903 | Bacteria | 6416 |
| 664 | Ga0496100_0065444 | 3300048903 | Bacteria | 2408 |
| 665 | Ga0496101_0035090 | 3300048904 | Bacteria | 3546 |
| 666 | Ga0496101_0042784 | 3300048904 | Bacteria | 3234 |
| 667 | Ga0496102_0092891 | 3300048905 | Bacteria | 2795 |
| 668 | Ga0496102_0288078 | 3300048905 | Bacteria | 1548 |
| 669 | Ga0496103_0021748 | 3300048906 | Bacteria | 3860 |
| 670 | Ga0496104_0015206 | 3300048907 | Bacteria | 6967 |
| 671 | Ga0496104_0030805 | 3300048907 | Bacteria | 4987 |
| 672 | Ga0496104_0035885 | 3300048907 | Bacteria | 4632 |
| 673 | Ga0496104_0065446 | 3300048907 | Bacteria | 3449 |
| 674 | Ga0496104_0110537 | 3300048907 | Bacteria | 2635 |
| 675 | Ga0496104_0161018 | 3300048907 | Bacteria | 2153 |
| 676 | Ga0496104_0242339 | 3300048907 | Bacteria | 1715 |
| 677 | Ga0496104_0284390 | 3300048907 | Bacteria | 1567 |
| 678 | Ga0496104_0285196 | 3300048907 | Bacteria | 1564 |
| 679 | Ga0496104_0393214 | 3300048907 | Bacteria | 1298 |
| 680 | Ga0496105_0023216 | 3300048908 | Bacteria | 5029 |
| 681 | Ga0496105_0059597 | 3300048908 | Bacteria | 3150 |
| 682 | Ga0496105_0318928 | 3300048908 | Unclassified | 1246 |
| 683 | Ga0496106_0166627 | 3300048909 | Bacteria | 1744 |
| 684 | Ga0496106_0235756 | 3300048909 | Bacteria | 1462 |
| 685 | Ga0496106_0443766 | 3300048909 | Bacteria | 1043 |
| 686 | Ga0496107_0030694 | 3300048910 | Bacteria | 3831 |
| 687 | Ga0496108_0003174 | 3300048911 | Bacteria | 13229 |
| 688 | Ga0496108_0047884 | 3300048911 | Bacteria | 3574 |
| 689 | Ga0496108_0084576 | 3300048911 | Bacteria | 2692 |
| 690 | Ga0496108_0243887 | 3300048911 | Bacteria | 1563 |
| 691 | Ga0496109_0024582 | 3300048912 | Bacteria | 5357 |
| 692 | Ga0496109_0097188 | 3300048912 | Bacteria | 2729 |
| 693 | Ga0496110_0005134 | 3300048913 | Bacteria | 10230 |
| 694 | Ga0496110_0005401 | 3300048913 | Bacteria | 10020 |
| 695 | Ga0496110_0470857 | 3300048913 | Bacteria | 1144 |
| 696 | Ga0496111_0021259 | 3300048914 | Bacteria | 4528 |
| 697 | Ga0496111_0259763 | 3300048914 | Bacteria | 1289 |
| 698 | Ga0496112_0092592 | 3300048915 | Bacteria | 2992 |
| 699 | Ga0496113_0025849 | 3300048916 | Bacteria | 4191 |
| 700 | Ga0496113_0042765 | 3300048916 | Bacteria | 3349 |
| 701 | Ga0496113_0156309 | 3300048916 | Bacteria | 1801 |
| 702 | Ga0496114_0013937 | 3300048917 | Bacteria | 6446 |
| 703 | Ga0496114_0020209 | 3300048917 | Bacteria | 5404 |
| 704 | Ga0496114_0044618 | 3300048917 | Bacteria | 3679 |
| 705 | Ga0496114_0047951 | 3300048917 | Bacteria | 3553 |
| 706 | Ga0496114_0088560 | 3300048917 | Bacteria | 2626 |
| 707 | Ga0496114_0206248 | 3300048917 | Bacteria | 1723 |
| 708 | Ga0496114_0323707 | 3300048917 | Bacteria | 1362 |
| 709 | Ga0496114_0441022 | 3300048917 | Bacteria | 1153 |
| 710 | Ga0496114_0452031 | 3300048917 | Bacteria | 1138 |
| 711 | Ga0496115_0014483 | 3300048918 | Bacteria | 5970 |
| 712 | Ga0496115_0053323 | 3300048918 | Bacteria | 3245 |
| 713 | Ga0501311_013289 | 3300049527 | Bacteria | 1037 |
| 714 | Ga0501031_0061819 | 3300049568 | Bacteria | 2440 |
| 715 | Ga0501031_0066182 | 3300049568 | Bacteria | 2354 |
| 716 | Ga0501031_0337244 | 3300049568 | Bacteria | 976 |
| 717 | Ga0501032_0011144 | 3300049569 | Bacteria | 6461 |
| 718 | Ga0501032_0028017 | 3300049569 | Bacteria | 3871 |
| 719 | Ga0501033_0000722 | 3300049570 | Bacteria | 30335 |
| 720 | Ga0501033_0007874 | 3300049570 | Bacteria | 8256 |
| 721 | Ga0501033_0010957 | 3300049570 | Bacteria | 6949 |
| 722 | Ga0501033_0057993 | 3300049570 | Bacteria | 2860 |
| 723 | Ga0501034_0007396 | 3300049571 | Bacteria | 11694 |
| 724 | Ga0501034_0134927 | 3300049571 | Bacteria | 2449 |
| 725 | Ga0501036_0008093 | 3300049572 | Bacteria | 8614 |
| 726 | Ga0501036_0016376 | 3300049572 | Bacteria | 6193 |
| 727 | Ga0501036_0023879 | 3300049572 | Bacteria | 5153 |
| 728 | Ga0501036_0045420 | 3300049572 | Bacteria | 3721 |
| 729 | Ga0501036_0061770 | 3300049572 | Bacteria | 3173 |
| 730 | Ga0501036_0153770 | 3300049572 | Bacteria | 1940 |
| 731 | Ga0501038_0000211 | 3300049574 | Bacteria | 49814 |
| 732 | Ga0501038_0053893 | 3300049574 | Bacteria | 3460 |
| 733 | Ga0501038_0092296 | 3300049574 | Bacteria | 2535 |
| 734 | Ga0501038_0232568 | 3300049574 | Bacteria | 1466 |
| 735 | Ga0501038_0316835 | 3300049574 | Bacteria | 1221 |
| 736 | Ga0501039_0016114 | 3300049575 | Bacteria | 5724 |
| 737 | Ga0501039_0021128 | 3300049575 | Bacteria | 4993 |
| 738 | Ga0501039_0028798 | 3300049575 | Bacteria | 4277 |
| 739 | Ga0501039_0029602 | 3300049575 | Bacteria | 4217 |
| 740 | Ga0501039_0292851 | 3300049575 | Bacteria | 1280 |
| 741 | Ga0501040_0001735 | 3300049576 | Bacteria | 13996 |
| 742 | Ga0501040_0008502 | 3300049576 | Bacteria | 6664 |
| 743 | Ga0501040_0072114 | 3300049576 | Bacteria | 2385 |
| 744 | Ga0501040_0115366 | 3300049576 | Bacteria | 1880 |
| 745 | Ga0501041_0013597 | 3300049577 | Bacteria | 4827 |
| 746 | Ga0501041_0013837 | 3300049577 | Bacteria | 4783 |
| 747 | Ga0501042_0012480 | 3300049578 | Bacteria | 5757 |
| 748 | Ga0501042_0032377 | 3300049578 | Bacteria | 3702 |
| 749 | Ga0501042_0038522 | 3300049578 | Bacteria | 3395 |
| 750 | Ga0501042_0173751 | 3300049578 | Bacteria | 1554 |
| 751 | Ga0501043_0059056 | 3300049579 | Bacteria | 3009 |
| 752 | Ga0501043_0148233 | 3300049579 | Bacteria | 1836 |
| 753 | Ga0501043_0192320 | 3300049579 | Bacteria | 1586 |
| 754 | Ga0501043_0264822 | 3300049579 | Bacteria | 1321 |
| 755 | Ga0501043_0386576 | 3300049579 | Bacteria | 1059 |
| 756 | Ga0501046_0034381 | 3300049580 | Bacteria | 4091 |
| 757 | Ga0501046_0195797 | 3300049580 | Bacteria | 1505 |
| 758 | Ga0501047_0008457 | 3300049581 | Bacteria | 9712 |
| 759 | Ga0501047_0055483 | 3300049581 | Bacteria | 3831 |
| 760 | Ga0501047_0060996 | 3300049581 | Bacteria | 3638 |
| 761 | Ga0501047_0190794 | 3300049581 | Bacteria | 1913 |
| 762 | Ga0501047_0205560 | 3300049581 | Bacteria | 1828 |
| 763 | Ga0501047_0215455 | 3300049581 | Bacteria | 1777 |
| 764 | Ga0501048_0014782 | 3300049582 | Bacteria | 5775 |
| 765 | Ga0501048_0020660 | 3300049582 | Bacteria | 4826 |
| 766 | Ga0501048_0037443 | 3300049582 | Bacteria | 3483 |
| 767 | Ga0501048_0198150 | 3300049582 | Bacteria | 1423 |
| 768 | Ga0501067_0005431 | 3300049583 | Bacteria | 7076 |
| 769 | Ga0501067_0169847 | 3300049583 | Bacteria | 1215 |
| 770 | Ga0501068_0015420 | 3300049584 | Bacteria | 4389 |
| 771 | Ga0501068_0137155 | 3300049584 | Bacteria | 1532 |
| 772 | Ga0501068_0161682 | 3300049584 | Bacteria | 1411 |
| 773 | Ga0501069_0066514 | 3300049585 | Bacteria | 2015 |
| 774 | Ga0501069_0154549 | 3300049585 | Bacteria | 1319 |
| 775 | Ga0501069_0183464 | 3300049585 | Bacteria | 1210 |
| 776 | Ga0501069_0307637 | 3300049585 | Bacteria | 930 |
| 777 | Ga0501070_0000855 | 3300049586 | Bacteria | 27653 |
| 778 | Ga0501070_0006057 | 3300049586 | Bacteria | 10302 |
| 779 | Ga0501070_0026272 | 3300049586 | Bacteria | 4887 |
| 780 | Ga0501070_0424800 | 3300049586 | Bacteria | 1073 |
| 781 | Ga0501071_0000066 | 3300049587 | Bacteria | 37099 |
| 782 | Ga0501071_0021831 | 3300049587 | Bacteria | 4461 |
| 783 | Ga0501071_0053221 | 3300049587 | Bacteria | 2919 |
| 784 | Ga0501071_0180050 | 3300049587 | Bacteria | 1583 |
| 785 | Ga0501072_0022680 | 3300049588 | Bacteria | 4870 |
| 786 | Ga0501072_0034531 | 3300049588 | Bacteria | 3964 |
| 787 | Ga0501072_0047468 | 3300049588 | Bacteria | 3381 |
| 788 | Ga0501072_0257145 | 3300049588 | Bacteria | 1390 |
| 789 | Ga0501072_0285410 | 3300049588 | Bacteria | 1312 |
| 790 | Ga0501072_0373977 | 3300049588 | Bacteria | 1131 |
| 791 | Ga0501073_0016367 | 3300049589 | Bacteria | 5374 |
| 792 | Ga0501073_0119453 | 3300049589 | Bacteria | 1827 |
| 793 | Ga0501074_0004503 | 3300049590 | Bacteria | 9977 |
| 794 | Ga0501074_0048523 | 3300049590 | Bacteria | 3067 |
| 795 | Ga0501074_0160831 | 3300049590 | Bacteria | 1604 |
| 796 | Ga0501074_0208177 | 3300049590 | Bacteria | 1394 |
| 797 | Ga0501075_0002773 | 3300049591 | Bacteria | 11741 |
| 798 | Ga0501075_0025237 | 3300049591 | Bacteria | 4367 |
| 799 | Ga0501075_0104374 | 3300049591 | Bacteria | 2154 |
| 800 | Ga0501076_0078601 | 3300049592 | Bacteria | 2647 |
| 801 | Ga0501076_0140147 | 3300049592 | Bacteria | 1964 |
| 802 | Ga0501076_0150803 | 3300049592 | Bacteria | 1891 |
| 803 | Ga0501076_0236247 | 3300049592 | Bacteria | 1494 |
| 804 | Ga0501076_0364018 | 3300049592 | Bacteria | 1188 |
| 805 | Ga0501076_0478808 | 3300049592 | Bacteria | 1026 |
| 806 | Ga0501077_0058055 | 3300049593 | Bacteria | 2457 |
| 807 | Ga0501077_0076340 | 3300049593 | Bacteria | 2122 |
| 808 | Ga0501077_0157631 | 3300049593 | Bacteria | 1441 |
| 809 | Ga0501077_0207136 | 3300049593 | Bacteria | 1246 |
| 810 | Ga0501079_0014654 | 3300049741 | Bacteria | 5978 |
| 811 | Ga0501079_0019809 | 3300049741 | Bacteria | 5141 |
| 812 | Ga0501079_0024941 | 3300049741 | Bacteria | 4587 |
| 813 | Ga0501079_0106866 | 3300049741 | Bacteria | 2172 |
| 814 | Ga0501080_0041833 | 3300049742 | Bacteria | 4268 |
| 815 | Ga0501080_0051831 | 3300049742 | Bacteria | 3820 |
| 816 | Ga0501080_0132417 | 3300049742 | Bacteria | 2308 |
| 817 | Ga0501080_0154663 | 3300049742 | Bacteria | 2119 |
| 818 | Ga0501080_0256148 | 3300049742 | Bacteria | 1595 |
| 819 | Ga0501080_0301978 | 3300049742 | Bacteria | 1452 |
| 820 | Ga0501081_0006278 | 3300049743 | Bacteria | 7705 |
| 821 | Ga0501081_0016163 | 3300049743 | Bacteria | 4929 |
| 822 | Ga0501081_0027717 | 3300049743 | Bacteria | 3819 |
| 823 | Ga0501081_0203314 | 3300049743 | Bacteria | 1437 |
| 824 | Ga0501083_0112514 | 3300049744 | Bacteria | 1789 |
| 825 | Ga0501035_0018307 | 3300049822 | Bacteria | 6453 |
| 826 | Ga0501035_0050588 | 3300049822 | Bacteria | 3723 |
| 827 | Ga0501035_0211604 | 3300049822 | Bacteria | 1658 |
| 828 | Ga0501035_0332071 | 3300049822 | Bacteria | 1275 |
| 829 | Ga0501044_0016891 | 3300049823 | Bacteria | 7830 |
| 830 | Ga0501044_0051732 | 3300049823 | Bacteria | 4234 |
| 831 | Ga0501044_0316349 | 3300049823 | Bacteria | 1486 |
| 832 | Ga0501045_0005561 | 3300049824 | Bacteria | 8717 |
| 833 | Ga0501045_0019251 | 3300049824 | Bacteria | 4863 |
| 834 | Ga0501045_0032855 | 3300049824 | Bacteria | 3761 |
| 835 | Ga0501045_0070695 | 3300049824 | Bacteria | 2568 |
| 836 | Ga0501045_0252567 | 3300049824 | Bacteria | 1312 |
| 837 | nmdc:mga03n38_49012_c1 | 3300050490 | Bacteria | 1876 |
| 838 | nmdc:mga00v17_40489_c1 | 3300050491 | Bacteria | 2795 |
| 839 | nmdc:mga0yw44_37526_c1 | 3300050492 | Bacteria | 2861 |
| 840 | nmdc:mga0yw44_413143_c1 | 3300050492 | Bacteria | 913 |
| 841 | nmdc:mga05p37_119852_c1 | 3300050507 | Bacteria | 3233 |
| 842 | nmdc:mga05p37_14121_c1 | 3300050507 | Bacteria | 9585 |
| 843 | nmdc:mga05p37_214526_c1 | 3300050507 | Bacteria | 2325 |
| 844 | nmdc:mga05p37_22766_c1 | 3300050507 | Bacteria | 7601 |
| 845 | nmdc:mga05p37_275458_c1 | 3300050507 | Bacteria | 2009 |
| 846 | nmdc:mga05p37_823_c1 | 3300050507 | Bacteria | 34775 |
| 847 | nmdc:mga09592_11227_c1 | 3300050508 | Bacteria | 7289 |
| 848 | nmdc:mga09592_16_c1 | 3300050508 | Bacteria | 97518 |
| 849 | nmdc:mga09592_71095_c1 | 3300050508 | Bacteria | 2954 |
| 850 | nmdc:mga09592_76545_c1 | 3300050508 | Bacteria | 2845 |
| 851 | nmdc:mga0qj67_16_c1 | 3300050509 | Bacteria | 124323 |
| 852 | nmdc:mga06r32_12345_c1 | 3300050510 | Bacteria | 7705 |
| 853 | nmdc:mga06r32_423464_c1 | 3300050510 | Bacteria | 1312 |
| 854 | nmdc:mga06r32_493_c1 | 3300050510 | Bacteria | 34078 |
| 855 | nmdc:mga06r32_55904_c1 | 3300050510 | Bacteria | 3787 |
| 856 | nmdc:mga08y16_138537_c1 | 3300050511 | Bacteria | 2530 |
| 857 | nmdc:mga08y16_47979_c1 | 3300050511 | Bacteria | 4470 |
| 858 | nmdc:mga0n895_536016_c1 | 3300050512 | Bacteria | 1177 |
| 859 | nmdc:mga08x19_394657_c1 | 3300050514 | Bacteria | 970 |
| 860 | nmdc:mga0a205_469272_c1 | 3300050515 | Bacteria | 1117 |
| 861 | Ga0495601_0005278 | 3300053077 | Bacteria | 7515 |
| 862 | Ga0495601_0010567 | 3300053077 | Bacteria | 5498 |
| 863 | Ga0495601_0089601 | 3300053077 | Bacteria | 1978 |
| 864 | Ga0495612_0006871 | 3300053078 | Bacteria | 4655 |
| 865 | Ga0495612_0026438 | 3300053078 | Bacteria | 2332 |
| 866 | Ga0495612_0093969 | 3300053078 | Bacteria | 1272 |
| 867 | Ga0495595_0007397 | 3300053084 | Bacteria | 4496 |
| 868 | Ga0495595_0023177 | 3300053084 | Bacteria | 2731 |
| 869 | Ga0495619_0015865 | 3300053085 | Bacteria | 4768 |
| 870 | Ga0495619_0016123 | 3300053085 | Bacteria | 4729 |
| 871 | Ga0495619_0025527 | 3300053085 | Bacteria | 3795 |
| 872 | Ga0495619_0046606 | 3300053085 | Bacteria | 2851 |
| 873 | Ga0495619_0055057 | 3300053085 | Bacteria | 2634 |
| 874 | Ga0495619_0064338 | 3300053085 | Bacteria | 2445 |
| 875 | Ga0500646_0000070 | 3300053090 | Bacteria | 29109 |
| 876 | Ga0500583_0006147 | 3300053092 | Bacteria | 4102 |
| 877 | Ga0500554_020716 | 3300053102 | Bacteria | 1812 |
| 878 | Ga0500556_0001268 | 3300053104 | Bacteria | 11526 |
| 879 | Ga0500593_000433 | 3300053117 | Bacteria | 16492 |
| 880 | Ga0500623_146194 | 3300053127 | Bacteria | 982 |
| 881 | Ga0500559_0117480 | 3300053136 | Bacteria | 1235 |
| 882 | Ga0500568_0081996 | 3300053139 | Bacteria | 1224 |
| 883 | Ga0500588_0010241 | 3300053146 | Bacteria | 2257 |
| 884 | Ga0501084_0009095 | 3300054114 | Bacteria | 8220 |
| 885 | Ga0501084_0017512 | 3300054114 | Bacteria | 5958 |
| 886 | Ga0501084_0024480 | 3300054114 | Bacteria | 5036 |
| 887 | Ga0501084_0058083 | 3300054114 | Bacteria | 3237 |
| 888 | Ga0501084_0347283 | 3300054114 | Bacteria | 1253 |
| 889 | Ga0501082_0015875 | 3300060353 | Bacteria | 6476 |
| 890 | Ga0501082_0030297 | 3300060353 | Bacteria | 4663 |
| 891 | Ga0466962_0000273 | 3300061719 | Bacteria | 21782 |
| 892 | Ga0466962_0021274 | 3300061719 | Bacteria | 3116 |
| 893 | Ga0466962_0039752 | 3300061719 | Bacteria | 2252 |
| 894 | Ga0466962_0167126 | 3300061719 | Bacteria | 1070 |
| 895 | Ga0530510_0013642 | 3300061734 | Bacteria | 5717 |
| 896 | Ga0530510_0053714 | 3300061734 | Bacteria | 2911 |
| 897 | Ga0530510_0059472 | 3300061734 | Bacteria | 2764 |
| 898 | Ga0530510_0104482 | 3300061734 | Bacteria | 2072 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048911 | Ga0496108_0243887 | Ga0496108_0243887_546_1220 | 223 |
| 2 | 3300049593 | Ga0501077_0207136 | Ga0501077_0207136_19_741 | 237 |
| 3 | 3300049568 | Ga0501031_0337244 | Ga0501031_0337244_16_963 | 250 |
| 4 | 3300035207 | Ga0373942_0002413 | Ga0373942_0002413_3534_4457 | 252 |
| 5 | 3300035086 | Ga0373934_0011263 | Ga0373934_0011263_12_1088 | 255 |
| 6 | 3300035117 | Ga0373953_0006688 | Ga0373953_0006688_2505_3581 | 255 |
| 7 | 3300035724 | Ga0373933_0050651 | Ga0373933_0050651_844_1920 | 255 |
| 8 | 3300044719 | Ga0466971_0112252 | Ga0466971_0112252_393_1163 | 255 |
| 9 | 3300046533 | Ga0495640_0012101 | Ga0495640_0012101_4973_6049 | 255 |
| 10 | 3300046642 | Ga0495634_0034112 | Ga0495634_0034112_58_978 | 255 |
| 11 | 3300046516 | Ga0495628_0025644 | Ga0495628_0025644_2851_3927 | 256 |
| 12 | 3300046543 | Ga0495645_0117053 | Ga0495645_0117053_793_1869 | 256 |
| 13 | 3300053102 | Ga0500554_020716 | Ga0500554_020716_685_1563 | 257 |
| 14 | 3300046461 | Ga0495641_0005398 | Ga0495641_0005398_5586_6644 | 258 |
| 15 | 3300049585 | Ga0501069_0183464 | Ga0501069_0183464_392_1195 | 258 |
| 16 | 3300006844 | Ga0075428_100120061 | Ga0075428_1001200612 | 259 |
| 17 | 3300006880 | Ga0075429_100392746 | Ga0075429_1003927462 | 259 |
| 18 | 3300050508 | nmdc:mga09592_76545_c1 | nmdc:mga09592_76545_c1_1819_2727 | 259 |
| 19 | 3300006028 | Ga0070717_10073250 | Ga0070717_100732502 | 260 |
| 20 | 3300025906 | Ga0207699_10026106 | Ga0207699_100261063 | 260 |
| 21 | 3300025916 | Ga0207663_10015017 | Ga0207663_100150172 | 260 |
| 22 | 3300025928 | Ga0207700_10052683 | Ga0207700_100526832 | 260 |
| 23 | 3300025929 | Ga0207664_10154325 | Ga0207664_101543252 | 260 |
| 24 | 3300025939 | Ga0207665_10005206 | Ga0207665_100052064 | 260 |
| 25 | 3300048907 | Ga0496104_0030805 | Ga0496104_0030805_2129_3223 | 260 |
| 26 | 3300048908 | Ga0496105_0023216 | Ga0496105_0023216_1947_3023 | 260 |
| 27 | 3300048915 | Ga0496112_0092592 | Ga0496112_0092592_91_1185 | 260 |
| 28 | 3300048916 | Ga0496113_0042765 | Ga0496113_0042765_651_1745 | 260 |
| 29 | 3300050510 | nmdc:mga06r32_423464_c1 | nmdc:mga06r32_423464_c1_102_1013 | 260 |
| 30 | 3300028573 | Ga0265334_10012852 | Ga0265334_100128522 | 262 |
| 31 | 3300028577 | Ga0265318_10014087 | Ga0265318_100140874 | 262 |
| 32 | 3300028800 | Ga0265338_10008735 | Ga0265338_100087355 | 262 |
| 33 | 3300029957 | Ga0265324_10026005 | Ga0265324_100260051 | 262 |
| 34 | 3300031240 | Ga0265320_10002133 | Ga0265320_1000213311 | 262 |
| 35 | 3300031250 | Ga0265331_10022587 | Ga0265331_100225873 | 262 |
| 36 | 3300031712 | Ga0265342_10025071 | Ga0265342_100250713 | 262 |
| 37 | 3300035084 | Ga0373928_0015343 | Ga0373928_0015343_249_1265 | 263 |
| 38 | 3300035088 | Ga0373940_0003437 | Ga0373940_0003437_70_1086 | 263 |
| 39 | 3300035207 | Ga0373942_0009261 | Ga0373942_0009261_818_1834 | 263 |
| 40 | 3300048907 | Ga0496104_0065446 | Ga0496104_0065446_611_1627 | 263 |
| 41 | 3300048918 | Ga0496115_0014483 | Ga0496115_0014483_4142_5158 | 263 |
| 42 | 3300049583 | Ga0501067_0169847 | Ga0501067_0169847_175_1065 | 263 |
| 43 | 3300049585 | Ga0501069_0154549 | Ga0501069_0154549_161_1051 | 263 |
| 44 | 3300050507 | nmdc:mga05p37_22766_c1 | nmdc:mga05p37_22766_c1_950_1840 | 263 |
| 45 | 3300009147 | Ga0114129_10000011 | Ga0114129_1000001170 | 264 |
| 46 | 3300036401 | Ga0373937_0150534 | Ga0373937_0150534_1297_2136 | 264 |
| 47 | 3300037853 | Ga0436364_0997648 | Ga0436364_0997648_752_1648 | 264 |
| 48 | 3300049742 | Ga0501080_0301978 | Ga0501080_0301978_489_1406 | 264 |
| 49 | 3300005341 | Ga0070691_10045492 | Ga0070691_100454921 | 265 |
| 50 | 3300005440 | Ga0070705_100074217 | Ga0070705_1000742172 | 265 |
| 51 | 3300005536 | Ga0070697_100196145 | Ga0070697_1001961452 | 265 |
| 52 | 3300005563 | Ga0068855_100270937 | Ga0068855_1002709372 | 265 |
| 53 | 3300005841 | Ga0068863_100130608 | Ga0068863_1001306082 | 265 |
| 54 | 3300009177 | Ga0105248_10058674 | Ga0105248_100586741 | 265 |
| 55 | 3300010375 | Ga0105239_10227730 | Ga0105239_102277302 | 265 |
| 56 | 3300013308 | Ga0157375_10067949 | Ga0157375_100679493 | 265 |
| 57 | 3300014969 | Ga0157376_10044321 | Ga0157376_100443214 | 265 |
| 58 | 3300020081 | Ga0206354_11271448 | Ga0206354_112714481 | 265 |
| 59 | 3300025929 | Ga0207664_10160820 | Ga0207664_101608202 | 265 |
| 60 | 3300025949 | Ga0207667_10212294 | Ga0207667_102122943 | 265 |
| 61 | 3300026095 | Ga0207676_10147933 | Ga0207676_101479332 | 265 |
| 62 | 3300026142 | Ga0207698_10585941 | Ga0207698_105859411 | 265 |
| 63 | 3300033179 | Ga0307507_10159938 | Ga0307507_101599382 | 265 |
| 64 | 3300035085 | Ga0373929_0002535 | Ga0373929_0002535_35_1051 | 265 |
| 65 | 3300035111 | Ga0373923_0029737 | Ga0373923_0029737_373_1257 | 265 |
| 66 | 3300035113 | Ga0373936_0024453 | Ga0373936_0024453_1247_2131 | 265 |
| 67 | 3300035120 | Ga0373957_0017544 | Ga0373957_0017544_435_1319 | 265 |
| 68 | 3300035171 | Ga0373946_0034533 | Ga0373946_0034533_307_1191 | 265 |
| 69 | 3300035692 | Ga0373935_0075877 | Ga0373935_0075877_871_1755 | 265 |
| 70 | 3300035725 | Ga0373947_0104227 | Ga0373947_0104227_89_973 | 265 |
| 71 | 3300046454 | Ga0495592_0037269 | Ga0495592_0037269_1546_2430 | 265 |
| 72 | 3300046462 | Ga0495651_0102771 | Ga0495651_0102771_1066_1950 | 265 |
| 73 | 3300046472 | Ga0495580_0089223 | Ga0495580_0089223_239_1123 | 265 |
| 74 | 3300046475 | Ga0495639_0045609 | Ga0495639_0045609_325_1209 | 265 |
| 75 | 3300046476 | Ga0495662_0064706 | Ga0495662_0064706_796_1680 | 265 |
| 76 | 3300046514 | Ga0495618_0028042 | Ga0495618_0028042_175_1059 | 265 |
| 77 | 3300046516 | Ga0495628_0076978 | Ga0495628_0076978_436_1320 | 265 |
| 78 | 3300046526 | Ga0495666_0164184 | Ga0495666_0164184_121_1005 | 265 |
| 79 | 3300046531 | Ga0495665_0073112 | Ga0495665_0073112_209_1093 | 265 |
| 80 | 3300046533 | Ga0495640_0020018 | Ga0495640_0020018_3384_4268 | 265 |
| 81 | 3300046535 | Ga0495586_0014091 | Ga0495586_0014091_170_1054 | 265 |
| 82 | 3300046663 | Ga0495635_0018200 | Ga0495635_0018200_3355_4239 | 265 |
| 83 | 3300046675 | Ga0495657_0090086 | Ga0495657_0090086_47_931 | 265 |
| 84 | 3300046680 | Ga0495646_0015185 | Ga0495646_0015185_3715_4599 | 265 |
| 85 | 3300046809 | Ga0495600_0050668 | Ga0495600_0050668_1406_2290 | 265 |
| 86 | 3300047315 | Ga0495581_0190917 | Ga0495581_0190917_126_1010 | 265 |
| 87 | 3300047317 | Ga0495604_0009174 | Ga0495604_0009174_2469_3353 | 265 |
| 88 | 3300047322 | Ga0495680_0036467 | Ga0495680_0036467_962_1846 | 265 |
| 89 | 3300047444 | Ga0495675_0027223 | Ga0495675_0027223_1847_2731 | 265 |
| 90 | 3300047471 | Ga0495684_0038708 | Ga0495684_0038708_2597_3481 | 265 |
| 91 | 3300047673 | Ga0495593_0042392 | Ga0495593_0042392_174_1058 | 265 |
| 92 | 3300048088 | Ga0495602_0031216 | Ga0495602_0031216_1819_2703 | 265 |
| 93 | 3300048911 | Ga0496108_0084576 | Ga0496108_0084576_429_1313 | 265 |
| 94 | 3300048913 | Ga0496110_0005134 | Ga0496110_0005134_717_1601 | 265 |
| 95 | 3300048916 | Ga0496113_0025849 | Ga0496113_0025849_675_1559 | 265 |
| 96 | 3300053085 | Ga0495619_0016123 | Ga0495619_0016123_1357_2241 | 265 |
| 97 | 3300046507 | Ga0495606_0001132 | Ga0495606_0001132_26742_27647 | 266 |
| 98 | 3300046616 | Ga0495668_0000615 | Ga0495668_0000615_15277_16182 | 266 |
| 99 | 3300046660 | Ga0495625_0023711 | Ga0495625_0023711_3746_4651 | 266 |
| 100 | 3300047323 | Ga0495683_0157084 | Ga0495683_0157084_126_1031 | 266 |
| 101 | 3300048091 | Ga0495626_0000127 | Ga0495626_0000127_15179_16084 | 266 |
| 102 | 3300048907 | Ga0496104_0242339 | Ga0496104_0242339_188_1051 | 266 |
| 103 | 3300048907 | Ga0496104_0285196 | Ga0496104_0285196_41_916 | 266 |
| 104 | 3300048911 | Ga0496108_0047884 | Ga0496108_0047884_2354_3217 | 266 |
| 105 | 3300048912 | Ga0496109_0097188 | Ga0496109_0097188_417_1280 | 266 |
| 106 | 3300048917 | Ga0496114_0047951 | Ga0496114_0047951_1383_2258 | 266 |
| 107 | 3300006847 | Ga0075431_100242950 | Ga0075431_1002429502 | 267 |
| 108 | 3300049572 | Ga0501036_0016376 | Ga0501036_0016376_4198_5067 | 267 |
| 109 | 3300049582 | Ga0501048_0198150 | Ga0501048_0198150_264_1133 | 267 |
| 110 | 3300050507 | nmdc:mga05p37_119852_c1 | nmdc:mga05p37_119852_c1_1239_2255 | 267 |
| 111 | 3300061734 | Ga0530510_0053714 | Ga0530510_0053714_1659_2528 | 267 |
| 112 | 3300005445 | Ga0070708_100011223 | Ga0070708_1000112235 | 268 |
| 113 | 3300044842 | Ga0466957_0124251 | Ga0466957_0124251_783_1601 | 268 |
| 114 | 3300005536 | Ga0070697_100042029 | Ga0070697_1000420292 | 269 |
| 115 | 3300005983 | Ga0081540_1000527 | Ga0081540_100052718 | 269 |
| 116 | 3300025901 | Ga0207688_10251284 | Ga0207688_102512841 | 269 |
| 117 | 3300037068 | Ga0373925_0098291 | Ga0373925_0098291_268_1308 | 269 |
| 118 | 3300046463 | Ga0495653_0251618 | Ga0495653_0251618_109_1149 | 269 |
| 119 | 3300046476 | Ga0495662_0063494 | Ga0495662_0063494_309_1349 | 269 |
| 120 | 3300046529 | Ga0495652_0095794 | Ga0495652_0095794_317_1357 | 269 |
| 121 | 3300047319 | Ga0495674_0023294 | Ga0495674_0023294_3842_4882 | 269 |
| 122 | 3300053077 | Ga0495601_0010567 | Ga0495601_0010567_1479_2417 | 269 |
| 123 | 3300053077 | Ga0495601_0089601 | Ga0495601_0089601_801_1841 | 269 |
| 124 | 3300053078 | Ga0495612_0026438 | Ga0495612_0026438_1050_1988 | 269 |
| 125 | 3300032126 | Ga0307415_100060691 | Ga0307415_1000606912 | 270 |
| 126 | 3300035086 | Ga0373934_0000049 | Ga0373934_0000049_15450_16319 | 270 |
| 127 | 3300035111 | Ga0373923_0007640 | Ga0373923_0007640_2635_3504 | 270 |
| 128 | 3300035117 | Ga0373953_0000067 | Ga0373953_0000067_22762_23631 | 270 |
| 129 | 3300035119 | Ga0373956_0000086 | Ga0373956_0000086_6490_7359 | 270 |
| 130 | 3300035120 | Ga0373957_0000632 | Ga0373957_0000632_2064_2933 | 270 |
| 131 | 3300035172 | Ga0373955_0000252 | Ga0373955_0000252_6592_7461 | 270 |
| 132 | 3300035172 | Ga0373955_0030358 | Ga0373955_0030358_1002_1964 | 270 |
| 133 | 3300035724 | Ga0373933_0000051 | Ga0373933_0000051_44651_45520 | 270 |
| 134 | 3300036401 | Ga0373937_0000289 | Ga0373937_0000289_25865_26734 | 270 |
| 135 | 3300036401 | Ga0373937_0058844 | Ga0373937_0058844_1304_2266 | 270 |
| 136 | 3300046454 | Ga0495592_0000111 | Ga0495592_0000111_44667_45536 | 270 |
| 137 | 3300046454 | Ga0495592_0023301 | Ga0495592_0023301_216_1178 | 270 |
| 138 | 3300046462 | Ga0495651_0000068 | Ga0495651_0000068_49756_50625 | 270 |
| 139 | 3300046462 | Ga0495651_0002798 | Ga0495651_0002798_6690_7652 | 270 |
| 140 | 3300046463 | Ga0495653_0002320 | Ga0495653_0002320_6643_7605 | 270 |
| 141 | 3300046463 | Ga0495653_0005403 | Ga0495653_0005403_7484_8353 | 270 |
| 142 | 3300046511 | Ga0495608_0000160 | Ga0495608_0000160_25852_26721 | 270 |
| 143 | 3300046511 | Ga0495608_0001185 | Ga0495608_0001185_12066_13028 | 270 |
| 144 | 3300046514 | Ga0495618_0025606 | Ga0495618_0025606_1410_2372 | 270 |
| 145 | 3300046516 | Ga0495628_0000250 | Ga0495628_0000250_8091_8960 | 270 |
| 146 | 3300046516 | Ga0495628_0009279 | Ga0495628_0009279_5116_6078 | 270 |
| 147 | 3300046529 | Ga0495652_0000440 | Ga0495652_0000440_25825_26694 | 270 |
| 148 | 3300046536 | Ga0495587_0000056 | Ga0495587_0000056_25865_26734 | 270 |
| 149 | 3300046536 | Ga0495587_0004715 | Ga0495587_0004715_4755_5717 | 270 |
| 150 | 3300046559 | Ga0495667_0000078 | Ga0495667_0000078_25843_26712 | 270 |
| 151 | 3300046559 | Ga0495667_0000947 | Ga0495667_0000947_5881_6843 | 270 |
| 152 | 3300046675 | Ga0495657_0000444 | Ga0495657_0000444_13128_13997 | 270 |
| 153 | 3300046675 | Ga0495657_0006331 | Ga0495657_0006331_6626_7588 | 270 |
| 154 | 3300046678 | Ga0495599_0001783 | Ga0495599_0001783_10828_11697 | 270 |
| 155 | 3300046679 | Ga0495623_0000209 | Ga0495623_0000209_25861_26730 | 270 |
| 156 | 3300046680 | Ga0495646_0004757 | Ga0495646_0004757_7187_8056 | 270 |
| 157 | 3300046680 | Ga0495646_0020950 | Ga0495646_0020950_1631_2593 | 270 |
| 158 | 3300046809 | Ga0495600_0004520 | Ga0495600_0004520_1601_2563 | 270 |
| 159 | 3300046809 | Ga0495600_0018370 | Ga0495600_0018370_2331_3200 | 270 |
| 160 | 3300047317 | Ga0495604_0000105 | Ga0495604_0000105_44642_45511 | 270 |
| 161 | 3300047317 | Ga0495604_0013304 | Ga0495604_0013304_3371_4333 | 270 |
| 162 | 3300047319 | Ga0495674_0017493 | Ga0495674_0017493_971_1933 | 270 |
| 163 | 3300047322 | Ga0495680_0000115 | Ga0495680_0000115_49756_50625 | 270 |
| 164 | 3300047322 | Ga0495680_0003508 | Ga0495680_0003508_7728_8690 | 270 |
| 165 | 3300047444 | Ga0495675_0001210 | Ga0495675_0001210_8234_9103 | 270 |
| 166 | 3300047471 | Ga0495684_0101890 | Ga0495684_0101890_141_1103 | 270 |
| 167 | 3300048088 | Ga0495602_0000114 | Ga0495602_0000114_49756_50625 | 270 |
| 168 | 3300049568 | Ga0501031_0066182 | Ga0501031_0066182_1177_2037 | 270 |
| 169 | 3300049569 | Ga0501032_0011144 | Ga0501032_0011144_2284_3144 | 270 |
| 170 | 3300049570 | Ga0501033_0057993 | Ga0501033_0057993_161_1021 | 270 |
| 171 | 3300049572 | Ga0501036_0061770 | Ga0501036_0061770_1010_1870 | 270 |
| 172 | 3300049575 | Ga0501039_0016114 | Ga0501039_0016114_1998_2858 | 270 |
| 173 | 3300049578 | Ga0501042_0012480 | Ga0501042_0012480_2066_2926 | 270 |
| 174 | 3300049579 | Ga0501043_0148233 | Ga0501043_0148233_795_1655 | 270 |
| 175 | 3300049581 | Ga0501047_0060996 | Ga0501047_0060996_2305_3165 | 270 |
| 176 | 3300049582 | Ga0501048_0020660 | Ga0501048_0020660_2607_3467 | 270 |
| 177 | 3300049584 | Ga0501068_0137155 | Ga0501068_0137155_180_1040 | 270 |
| 178 | 3300049585 | Ga0501069_0066514 | Ga0501069_0066514_592_1452 | 270 |
| 179 | 3300049586 | Ga0501070_0026272 | Ga0501070_0026272_1832_2692 | 270 |
| 180 | 3300049589 | Ga0501073_0016367 | Ga0501073_0016367_2554_3414 | 270 |
| 181 | 3300049590 | Ga0501074_0004503 | Ga0501074_0004503_6320_7180 | 270 |
| 182 | 3300049742 | Ga0501080_0041833 | Ga0501080_0041833_2105_2965 | 270 |
| 183 | 3300049822 | Ga0501035_0332071 | Ga0501035_0332071_182_1042 | 270 |
| 184 | 3300049823 | Ga0501044_0051732 | Ga0501044_0051732_1070_1930 | 270 |
| 185 | 3300049824 | Ga0501045_0019251 | Ga0501045_0019251_3559_4419 | 270 |
| 186 | 3300050515 | nmdc:mga0a205_469272_c1 | nmdc:mga0a205_469272_c1_148_981 | 270 |
| 187 | 3300053084 | Ga0495595_0007397 | Ga0495595_0007397_721_1590 | 270 |
| 188 | 3300053085 | Ga0495619_0046606 | Ga0495619_0046606_1845_2807 | 270 |
| 189 | 3300054114 | Ga0501084_0058083 | Ga0501084_0058083_690_1550 | 270 |
| 190 | 3300005334 | Ga0068869_100009393 | Ga0068869_1000093934 | 271 |
| 191 | 3300005338 | Ga0068868_100085051 | Ga0068868_1000850512 | 271 |
| 192 | 3300005344 | Ga0070661_100015487 | Ga0070661_1000154874 | 271 |
| 193 | 3300005354 | Ga0070675_100000194 | Ga0070675_10000019421 | 271 |
| 194 | 3300005366 | Ga0070659_100009047 | Ga0070659_1000090476 | 271 |
| 195 | 3300005455 | Ga0070663_100031164 | Ga0070663_1000311643 | 271 |
| 196 | 3300005457 | Ga0070662_100177105 | Ga0070662_1001771052 | 271 |
| 197 | 3300005564 | Ga0070664_100065548 | Ga0070664_1000655482 | 271 |
| 198 | 3300005616 | Ga0068852_100371802 | Ga0068852_1003718021 | 271 |
| 199 | 3300005618 | Ga0068864_100173229 | Ga0068864_1001732292 | 271 |
| 200 | 3300005841 | Ga0068863_100223657 | Ga0068863_1002236572 | 271 |
| 201 | 3300005844 | Ga0068862_100114172 | Ga0068862_1001141721 | 271 |
| 202 | 3300009094 | Ga0111539_10031916 | Ga0111539_100319165 | 271 |
| 203 | 3300010375 | Ga0105239_10070091 | Ga0105239_100700912 | 271 |
| 204 | 3300025920 | Ga0207649_10124469 | Ga0207649_101244692 | 271 |
| 205 | 3300025926 | Ga0207659_10009797 | Ga0207659_100097975 | 271 |
| 206 | 3300025933 | Ga0207706_10011538 | Ga0207706_100115381 | 271 |
| 207 | 3300025942 | Ga0207689_10015828 | Ga0207689_100158284 | 271 |
| 208 | 3300025961 | Ga0207712_10150252 | Ga0207712_101502522 | 271 |
| 209 | 3300026023 | Ga0207677_10072190 | Ga0207677_100721902 | 271 |
| 210 | 3300026067 | Ga0207678_10046428 | Ga0207678_100464282 | 271 |
| 211 | 3300026075 | Ga0207708_10007803 | Ga0207708_100078036 | 271 |
| 212 | 3300026116 | Ga0207674_10004069 | Ga0207674_100040696 | 271 |
| 213 | 3300027907 | Ga0207428_10036811 | Ga0207428_100368111 | 271 |
| 214 | 3300028380 | Ga0268265_10143532 | Ga0268265_101435321 | 271 |
| 215 | 3300046516 | Ga0495628_0011278 | Ga0495628_0011278_3370_4386 | 271 |
| 216 | 3300046529 | Ga0495652_0229477 | Ga0495652_0229477_117_1133 | 271 |
| 217 | 3300046678 | Ga0495599_0006717 | Ga0495599_0006717_2058_3074 | 271 |
| 218 | 3300049570 | Ga0501033_0000722 | Ga0501033_0000722_22110_22970 | 271 |
| 219 | 3300049572 | Ga0501036_0153770 | Ga0501036_0153770_469_1329 | 271 |
| 220 | 3300049574 | Ga0501038_0232568 | Ga0501038_0232568_104_964 | 271 |
| 221 | 3300049580 | Ga0501046_0195797 | Ga0501046_0195797_156_1016 | 271 |
| 222 | 3300050511 | nmdc:mga08y16_47979_c1 | nmdc:mga08y16_47979_c1_548_1387 | 271 |
| 223 | 3300053085 | Ga0495619_0025527 | Ga0495619_0025527_1098_2114 | 271 |
| 224 | 3300005577 | Ga0068857_100036375 | Ga0068857_1000363752 | 272 |
| 225 | 3300009553 | Ga0105249_10381417 | Ga0105249_103814172 | 272 |
| 226 | 3300013296 | Ga0157374_10617566 | Ga0157374_106175662 | 272 |
| 227 | 3300014745 | Ga0157377_10077392 | Ga0157377_100773922 | 272 |
| 228 | 3300044842 | Ga0466957_0020618 | Ga0466957_0020618_1414_2289 | 272 |
| 229 | 3300049571 | Ga0501034_0007396 | Ga0501034_0007396_1125_2009 | 272 |
| 230 | 3300049586 | Ga0501070_0000855 | Ga0501070_0000855_15626_16510 | 272 |
| 231 | 3300049587 | Ga0501071_0000066 | Ga0501071_0000066_24820_25704 | 272 |
| 232 | 3300049589 | Ga0501073_0119453 | Ga0501073_0119453_497_1381 | 272 |
| 233 | 3300053127 | Ga0500623_146194 | Ga0500623_146194_20_838 | 272 |
| 234 | 3300005937 | Ga0081455_10080099 | Ga0081455_100800992 | 273 |
| 235 | 3300025917 | Ga0207660_10172610 | Ga0207660_101726102 | 273 |
| 236 | 3300035117 | Ga0373953_0004314 | Ga0373953_0004314_1739_2755 | 273 |
| 237 | 3300035119 | Ga0373956_0029484 | Ga0373956_0029484_734_1750 | 273 |
| 238 | 3300035172 | Ga0373955_0013081 | Ga0373955_0013081_2371_3387 | 273 |
| 239 | 3300035410 | Ga0373924_0002829 | Ga0373924_0002829_2820_3836 | 273 |
| 240 | 3300035724 | Ga0373933_0002841 | Ga0373933_0002841_6495_7511 | 273 |
| 241 | 3300036401 | Ga0373937_0009894 | Ga0373937_0009894_7074_8090 | 273 |
| 242 | 3300046463 | Ga0495653_0102787 | Ga0495653_0102787_327_1340 | 273 |
| 243 | 3300046473 | Ga0495582_0023358 | Ga0495582_0023358_1814_2830 | 273 |
| 244 | 3300046475 | Ga0495639_0078151 | Ga0495639_0078151_274_1290 | 273 |
| 245 | 3300046476 | Ga0495662_0011429 | Ga0495662_0011429_1818_2831 | 273 |
| 246 | 3300046477 | Ga0495664_0147728 | Ga0495664_0147728_325_1335 | 273 |
| 247 | 3300046511 | Ga0495608_0019053 | Ga0495608_0019053_2387_3403 | 273 |
| 248 | 3300046517 | Ga0495630_0071921 | Ga0495630_0071921_742_1758 | 273 |
| 249 | 3300046536 | Ga0495587_0008582 | Ga0495587_0008582_2232_3248 | 273 |
| 250 | 3300046559 | Ga0495667_0013303 | Ga0495667_0013303_2158_3174 | 273 |
| 251 | 3300046675 | Ga0495657_0006066 | Ga0495657_0006066_3239_4255 | 273 |
| 252 | 3300046679 | Ga0495623_0034635 | Ga0495623_0034635_1832_2848 | 273 |
| 253 | 3300046680 | Ga0495646_0008480 | Ga0495646_0008480_3732_4748 | 273 |
| 254 | 3300047315 | Ga0495581_0012762 | Ga0495581_0012762_2098_3114 | 273 |
| 255 | 3300047319 | Ga0495674_0076907 | Ga0495674_0076907_1175_2191 | 273 |
| 256 | 3300047322 | Ga0495680_0100714 | Ga0495680_0100714_659_1675 | 273 |
| 257 | 3300049575 | Ga0501039_0292851 | Ga0501039_0292851_210_1148 | 273 |
| 258 | 3300049576 | Ga0501040_0072114 | Ga0501040_0072114_291_1229 | 273 |
| 259 | 3300049591 | Ga0501075_0104374 | Ga0501075_0104374_592_1530 | 273 |
| 260 | 3300049592 | Ga0501076_0364018 | Ga0501076_0364018_104_1042 | 273 |
| 261 | 3300049743 | Ga0501081_0027717 | Ga0501081_0027717_2443_3381 | 273 |
| 262 | 3300049824 | Ga0501045_0032855 | Ga0501045_0032855_2080_3018 | 273 |
| 263 | 3300053078 | Ga0495612_0093969 | Ga0495612_0093969_116_1132 | 273 |
| 264 | 3300005467 | Ga0070706_100009721 | Ga0070706_1000097212 | 274 |
| 265 | 3300005468 | Ga0070707_100000473 | Ga0070707_10000047323 | 274 |
| 266 | 3300005471 | Ga0070698_100002837 | Ga0070698_1000028376 | 274 |
| 267 | 3300006163 | Ga0070715_10049194 | Ga0070715_100491942 | 274 |
| 268 | 3300009011 | Ga0105251_10046492 | Ga0105251_100464923 | 274 |
| 269 | 3300009148 | Ga0105243_10043334 | Ga0105243_100433345 | 274 |
| 270 | 3300009174 | Ga0105241_10032699 | Ga0105241_100326995 | 274 |
| 271 | 3300009177 | Ga0105248_10256882 | Ga0105248_102568822 | 274 |
| 272 | 3300013102 | Ga0157371_10050131 | Ga0157371_100501314 | 274 |
| 273 | 3300013296 | Ga0157374_10067450 | Ga0157374_100674505 | 274 |
| 274 | 3300013308 | Ga0157375_10097559 | Ga0157375_100975592 | 274 |
| 275 | 3300014325 | Ga0163163_10017213 | Ga0163163_100172132 | 274 |
| 276 | 3300014326 | Ga0157380_10108755 | Ga0157380_101087552 | 274 |
| 277 | 3300014745 | Ga0157377_10033019 | Ga0157377_100330194 | 274 |
| 278 | 3300014969 | Ga0157376_10232731 | Ga0157376_102327313 | 274 |
| 279 | 3300025906 | Ga0207699_10004405 | Ga0207699_100044052 | 274 |
| 280 | 3300025910 | Ga0207684_10006576 | Ga0207684_100065763 | 274 |
| 281 | 3300025915 | Ga0207693_10109391 | Ga0207693_101093912 | 274 |
| 282 | 3300025916 | Ga0207663_10139798 | Ga0207663_101397982 | 274 |
| 283 | 3300025922 | Ga0207646_10000511 | Ga0207646_1000051116 | 274 |
| 284 | 3300035085 | Ga0373929_0033552 | Ga0373929_0033552_205_1047 | 274 |
| 285 | 3300035090 | Ga0373949_0013294 | Ga0373949_0013294_833_1675 | 274 |
| 286 | 3300035242 | Ga0373962_0015047 | Ga0373962_0015047_822_1664 | 274 |
| 287 | 3300045976 | Ga0466967_0501596 | Ga0466967_0501596_174_1037 | 274 |
| 288 | 3300046559 | Ga0495667_0031900 | Ga0495667_0031900_70_963 | 274 |
| 289 | 3300048904 | Ga0496101_0035090 | Ga0496101_0035090_928_1770 | 274 |
| 290 | 3300048906 | Ga0496103_0021748 | Ga0496103_0021748_1358_2200 | 274 |
| 291 | 3300048907 | Ga0496104_0393214 | Ga0496104_0393214_30_872 | 274 |
| 292 | 3300048909 | Ga0496106_0166627 | Ga0496106_0166627_649_1491 | 274 |
| 293 | 3300048910 | Ga0496107_0030694 | Ga0496107_0030694_1035_1877 | 274 |
| 294 | 3300048913 | Ga0496110_0470857 | Ga0496110_0470857_138_980 | 274 |
| 295 | 3300048914 | Ga0496111_0021259 | Ga0496111_0021259_231_1073 | 274 |
| 296 | 3300050514 | nmdc:mga08x19_394657_c1 | nmdc:mga08x19_394657_c1_76_918 | 274 |
| 297 | iso_pu_bacteria | 2643221575 | 2643888658 | 274 |
| 298 | iso_pu_bacteria | 2643221690 | 2644505150 | 274 |
| 299 | iso_pu_bacteria | 2935409751 | 2935413094 | 274 |
| 300 | 3300046459 | Ga0495629_0147707 | Ga0495629_0147707_237_1250 | 275 |
| 301 | 3300046472 | Ga0495580_0116311 | Ga0495580_0116311_636_1649 | 275 |
| 302 | 3300046473 | Ga0495582_0035858 | Ga0495582_0035858_1073_2086 | 275 |
| 303 | 3300046475 | Ga0495639_0034447 | Ga0495639_0034447_609_1622 | 275 |
| 304 | 3300046531 | Ga0495665_0140664 | Ga0495665_0140664_120_1133 | 275 |
| 305 | 3300046543 | Ga0495645_0040788 | Ga0495645_0040788_187_1212 | 275 |
| 306 | 3300046642 | Ga0495634_0189990 | Ga0495634_0189990_237_1250 | 275 |
| 307 | 3300046683 | Ga0495658_0012486 | Ga0495658_0012486_928_1941 | 275 |
| 308 | 3300047471 | Ga0495684_0175008 | Ga0495684_0175008_405_1418 | 275 |
| 309 | 3300048089 | Ga0495614_0032918 | Ga0495614_0032918_183_1196 | 275 |
| 310 | 3300049742 | Ga0501080_0154663 | Ga0501080_0154663_545_1483 | 275 |
| 311 | iso_pu_bacteria | 2833709550 | 2833710407 | 275 |
| 312 | iso_pu_bacteria | 8045830549 | 8045832563 | 275 |
| 313 | 3300005518 | Ga0070699_100102561 | Ga0070699_1001025612 | 276 |
| 314 | 3300006844 | Ga0075428_100000669 | Ga0075428_1000006698 | 276 |
| 315 | 3300006846 | Ga0075430_100003905 | Ga0075430_1000039058 | 276 |
| 316 | 3300006847 | Ga0075431_100000513 | Ga0075431_10000051328 | 276 |
| 317 | 3300006880 | Ga0075429_100005589 | Ga0075429_1000055897 | 276 |
| 318 | 3300009147 | Ga0114129_10000001 | Ga0114129_10000001206 | 276 |
| 319 | 3300031901 | Ga0307406_10065726 | Ga0307406_100657263 | 276 |
| 320 | 3300046462 | Ga0495651_0086274 | Ga0495651_0086274_1022_1960 | 276 |
| 321 | 3300046514 | Ga0495618_0014041 | Ga0495618_0014041_66_968 | 276 |
| 322 | 3300050507 | nmdc:mga05p37_823_c1 | nmdc:mga05p37_823_c1_4422_5258 | 276 |
| 323 | 3300050508 | nmdc:mga09592_16_c1 | nmdc:mga09592_16_c1_66037_66873 | 276 |
| 324 | 3300050509 | nmdc:mga0qj67_16_c1 | nmdc:mga0qj67_16_c1_30646_31482 | 276 |
| 325 | 3300050510 | nmdc:mga06r32_493_c1 | nmdc:mga06r32_493_c1_4256_5092 | 276 |
| 326 | 3300053085 | Ga0495619_0055057 | Ga0495619_0055057_1591_2529 | 276 |
| 327 | iso_pu_bacteria | 2675903060 | 2676489696 | 276 |
| 328 | iso_pu_bacteria | 2895427314 | 2895433009 | 276 |
| 329 | 3300005339 | Ga0070660_100246681 | Ga0070660_1002466812 | 277 |
| 330 | 3300039450 | Ga0436363_0342702 | Ga0436363_0342702_131_1150 | 277 |
| 331 | 3300044684 | Ga0466966_0068692 | Ga0466966_0068692_836_1669 | 277 |
| 332 | 3300044693 | Ga0466961_0105346 | Ga0466961_0105346_565_1398 | 277 |
| 333 | 3300044765 | Ga0466970_0088990 | Ga0466970_0088990_629_1462 | 277 |
| 334 | 3300046463 | Ga0495653_0279795 | Ga0495653_0279795_98_1021 | 277 |
| 335 | 3300048917 | Ga0496114_0441022 | Ga0496114_0441022_72_995 | 277 |
| 336 | 3300049572 | Ga0501036_0023879 | Ga0501036_0023879_1310_2239 | 277 |
| 337 | 3300049574 | Ga0501038_0092296 | Ga0501038_0092296_510_1439 | 277 |
| 338 | 3300049575 | Ga0501039_0028798 | Ga0501039_0028798_1929_2858 | 277 |
| 339 | 3300049576 | Ga0501040_0008502 | Ga0501040_0008502_2373_3302 | 277 |
| 340 | 3300049577 | Ga0501041_0013837 | Ga0501041_0013837_1800_2729 | 277 |
| 341 | 3300049579 | Ga0501043_0386576 | Ga0501043_0386576_132_974 | 277 |
| 342 | 3300049582 | Ga0501048_0014782 | Ga0501048_0014782_829_1758 | 277 |
| 343 | 3300049587 | Ga0501071_0021831 | Ga0501071_0021831_3205_4134 | 277 |
| 344 | 3300049588 | Ga0501072_0047468 | Ga0501072_0047468_2330_3277 | 277 |
| 345 | 3300049588 | Ga0501072_0285410 | Ga0501072_0285410_371_1300 | 277 |
| 346 | 3300049590 | Ga0501074_0208177 | Ga0501074_0208177_387_1316 | 277 |
| 347 | 3300049592 | Ga0501076_0150803 | Ga0501076_0150803_877_1806 | 277 |
| 348 | 3300049592 | Ga0501076_0478808 | Ga0501076_0478808_55_897 | 277 |
| 349 | 3300049593 | Ga0501077_0157631 | Ga0501077_0157631_228_1157 | 277 |
| 350 | 3300049741 | Ga0501079_0024941 | Ga0501079_0024941_1700_2629 | 277 |
| 351 | 3300049741 | Ga0501079_0106866 | Ga0501079_0106866_275_1117 | 277 |
| 352 | 3300049742 | Ga0501080_0132417 | Ga0501080_0132417_523_1452 | 277 |
| 353 | 3300049743 | Ga0501081_0006278 | Ga0501081_0006278_2565_3494 | 277 |
| 354 | 3300049743 | Ga0501081_0203314 | Ga0501081_0203314_257_1099 | 277 |
| 355 | 3300049824 | Ga0501045_0005561 | Ga0501045_0005561_5591_6520 | 277 |
| 356 | 3300053084 | Ga0495595_0023177 | Ga0495595_0023177_60_983 | 277 |
| 357 | 3300054114 | Ga0501084_0009095 | Ga0501084_0009095_1096_2025 | 277 |
| 358 | 3300054114 | Ga0501084_0347283 | Ga0501084_0347283_385_1227 | 277 |
| 359 | 3300060353 | Ga0501082_0030297 | Ga0501082_0030297_1267_2196 | 277 |
| 360 | 3300003320 | rootH2_10000702 | rootH2_1000070219 | 278 |
| 361 | 3300003322 | rootL2_10287462 | rootL2_102874621 | 278 |
| 362 | 3300005344 | Ga0070661_100000480 | Ga0070661_10000048022 | 278 |
| 363 | 3300005614 | Ga0068856_100085687 | Ga0068856_1000856872 | 278 |
| 364 | 3300005842 | Ga0068858_100000281 | Ga0068858_10000028151 | 278 |
| 365 | 3300009553 | Ga0105249_10208698 | Ga0105249_102086982 | 278 |
| 366 | 3300013104 | Ga0157370_10167967 | Ga0157370_101679672 | 278 |
| 367 | 3300025920 | Ga0207649_10009851 | Ga0207649_100098515 | 278 |
| 368 | 3300025961 | Ga0207712_10265669 | Ga0207712_102656692 | 278 |
| 369 | 3300026035 | Ga0207703_10000173 | Ga0207703_1000017369 | 278 |
| 370 | 3300031731 | Ga0307405_10120116 | Ga0307405_101201162 | 278 |
| 371 | 3300032002 | Ga0307416_100007146 | Ga0307416_1000071465 | 278 |
| 372 | 3300038443 | Ga0395901_0147008 | Ga0395901_0147008_225_1085 | 278 |
| 373 | 3300044694 | Ga0466963_0099909 | Ga0466963_0099909_1118_1954 | 278 |
| 374 | 3300045836 | Ga0466958_0029434 | Ga0466958_0029434_222_1058 | 278 |
| 375 | 3300048917 | Ga0496114_0206248 | Ga0496114_0206248_810_1667 | 278 |
| 376 | 3300049569 | Ga0501032_0028017 | Ga0501032_0028017_1211_2224 | 278 |
| 377 | 3300049570 | Ga0501033_0010957 | Ga0501033_0010957_3413_4273 | 278 |
| 378 | 3300049571 | Ga0501034_0134927 | Ga0501034_0134927_589_1602 | 278 |
| 379 | 3300049572 | Ga0501036_0045420 | Ga0501036_0045420_238_1251 | 278 |
| 380 | 3300049574 | Ga0501038_0000211 | Ga0501038_0000211_26859_27725 | 278 |
| 381 | 3300049574 | Ga0501038_0053893 | Ga0501038_0053893_2305_3318 | 278 |
| 382 | 3300049574 | Ga0501038_0316835 | Ga0501038_0316835_121_981 | 278 |
| 383 | 3300049575 | Ga0501039_0029602 | Ga0501039_0029602_2497_3510 | 278 |
| 384 | 3300049579 | Ga0501043_0059056 | Ga0501043_0059056_1622_2482 | 278 |
| 385 | 3300049579 | Ga0501043_0192320 | Ga0501043_0192320_262_1122 | 278 |
| 386 | 3300049581 | Ga0501047_0008457 | Ga0501047_0008457_2892_3752 | 278 |
| 387 | 3300049581 | Ga0501047_0055483 | Ga0501047_0055483_696_1709 | 278 |
| 388 | 3300049581 | Ga0501047_0205560 | Ga0501047_0205560_480_1340 | 278 |
| 389 | 3300049583 | Ga0501067_0005431 | Ga0501067_0005431_4532_5398 | 278 |
| 390 | 3300049586 | Ga0501070_0006057 | Ga0501070_0006057_6456_7469 | 278 |
| 391 | 3300049742 | Ga0501080_0256148 | Ga0501080_0256148_219_1079 | 278 |
| 392 | 3300049822 | Ga0501035_0018307 | Ga0501035_0018307_2803_3663 | 278 |
| 393 | 3300049822 | Ga0501035_0050588 | Ga0501035_0050588_1042_2055 | 278 |
| 394 | 3300049822 | Ga0501035_0211604 | Ga0501035_0211604_507_1367 | 278 |
| 395 | 3300049823 | Ga0501044_0016891 | Ga0501044_0016891_2006_2866 | 278 |
| 396 | 3300049823 | Ga0501044_0316349 | Ga0501044_0316349_228_1088 | 278 |
| 397 | 3300061719 | Ga0466962_0039752 | Ga0466962_0039752_1225_2061 | 278 |
| 398 | 3300007265 | Ga0099794_10033229 | Ga0099794_100332292 | 279 |
| 399 | 3300025922 | Ga0207646_10023876 | Ga0207646_100238762 | 279 |
| 400 | iso_pu_bacteria | 2887478801 | 2887484630 | 279 |
| 401 | iso_pu_bacteria | 8053945823 | 8053945871 | 279 |
| 402 | 3300010375 | Ga0105239_10190656 | Ga0105239_101906563 | 280 |
| 403 | 3300035692 | Ga0373935_0372596 | Ga0373935_0372596_70_945 | 280 |
| 404 | 3300037853 | Ga0436364_0883803 | Ga0436364_0883803_722_1564 | 280 |
| 405 | 3300046463 | Ga0495653_0042432 | Ga0495653_0042432_709_1584 | 280 |
| 406 | 3300046477 | Ga0495664_0122637 | Ga0495664_0122637_416_1291 | 280 |
| 407 | 3300046529 | Ga0495652_0058582 | Ga0495652_0058582_1567_2442 | 280 |
| 408 | 3300046536 | Ga0495587_0077861 | Ga0495587_0077861_806_1681 | 280 |
| 409 | 3300047322 | Ga0495680_0039803 | Ga0495680_0039803_120_995 | 280 |
| 410 | iso_pu_bacteria | 2883821847 | 2883823271 | 280 |
| 411 | 3300009174 | Ga0105241_10248435 | Ga0105241_102484351 | 281 |
| 412 | 3300048908 | Ga0496105_0318928 | Ga0496105_0318928_330_1205 | 281 |
| 413 | 3300048917 | Ga0496114_0088560 | Ga0496114_0088560_382_1257 | 281 |
| 414 | iso_pu_bacteria | 2884693830 | 2884694540 | 281 |
| 415 | iso_pu_bacteria | 2895442618 | 2895444445 | 281 |
| 416 | 3300005455 | Ga0070663_100409800 | Ga0070663_1004098001 | 282 |
| 417 | 3300009093 | Ga0105240_10542480 | Ga0105240_105424802 | 282 |
| 418 | 3300025972 | Ga0207668_10147583 | Ga0207668_101475832 | 282 |
| 419 | 3300037853 | Ga0436364_1333729 | Ga0436364_1333729_2714_3616 | 282 |
| 420 | 3300044693 | Ga0466961_0293804 | Ga0466961_0293804_60_911 | 282 |
| 421 | iso_pu_bacteria | 2515154155 | 2515856687 | 282 |
| 422 | iso_pu_bacteria | 2558860280 | 2559428947 | 282 |
| 423 | 3300005434 | Ga0070709_10000166 | Ga0070709_1000016626 | 283 |
| 424 | 3300005435 | Ga0070714_100003333 | Ga0070714_1000033337 | 283 |
| 425 | 3300005436 | Ga0070713_100000050 | Ga0070713_10000005032 | 283 |
| 426 | 3300005437 | Ga0070710_10000055 | Ga0070710_1000005512 | 283 |
| 427 | 3300005467 | Ga0070706_100175291 | Ga0070706_1001752912 | 283 |
| 428 | 3300005468 | Ga0070707_100083675 | Ga0070707_1000836754 | 283 |
| 429 | 3300005518 | Ga0070699_100018579 | Ga0070699_1000185794 | 283 |
| 430 | 3300005536 | Ga0070697_100008951 | Ga0070697_1000089513 | 283 |
| 431 | 3300006028 | Ga0070717_10000775 | Ga0070717_100007759 | 283 |
| 432 | 3300006028 | Ga0070717_10003709 | Ga0070717_1000370912 | 283 |
| 433 | 3300006163 | Ga0070715_10037300 | Ga0070715_100373002 | 283 |
| 434 | 3300006173 | Ga0070716_100000268 | Ga0070716_10000026815 | 283 |
| 435 | 3300006844 | Ga0075428_100121027 | Ga0075428_1001210272 | 283 |
| 436 | 3300009094 | Ga0111539_10270344 | Ga0111539_102703442 | 283 |
| 437 | 3300009147 | Ga0114129_10268023 | Ga0114129_102680232 | 283 |
| 438 | 3300025898 | Ga0207692_10000027 | Ga0207692_1000002744 | 283 |
| 439 | 3300025905 | Ga0207685_10005407 | Ga0207685_100054072 | 283 |
| 440 | 3300025906 | Ga0207699_10000102 | Ga0207699_1000010251 | 283 |
| 441 | 3300025910 | Ga0207684_10045994 | Ga0207684_100459942 | 283 |
| 442 | 3300025915 | Ga0207693_10071822 | Ga0207693_100718222 | 283 |
| 443 | 3300025916 | Ga0207663_10000170 | Ga0207663_100001708 | 283 |
| 444 | 3300025922 | Ga0207646_10044676 | Ga0207646_100446764 | 283 |
| 445 | 3300025928 | Ga0207700_10000029 | Ga0207700_1000002991 | 283 |
| 446 | 3300025929 | Ga0207664_10000168 | Ga0207664_1000016833 | 283 |
| 447 | 3300025939 | Ga0207665_10000144 | Ga0207665_100001448 | 283 |
| 448 | 3300048905 | Ga0496102_0092891 | Ga0496102_0092891_1146_2132 | 283 |
| 449 | 3300049581 | Ga0501047_0190794 | Ga0501047_0190794_968_1822 | 283 |
| 450 | 3300049581 | Ga0501047_0215455 | Ga0501047_0215455_417_1271 | 283 |
| 451 | 3300050507 | nmdc:mga05p37_275458_c1 | nmdc:mga05p37_275458_c1_270_1196 | 283 |
| 452 | iso_pu_bacteria | 8055172936 | 8055178707 | 283 |
| 453 | 3300003659 | JGI25404J52841_10001883 | JGI25404J52841_100018833 | 284 |
| 454 | 3300005330 | Ga0070690_100026408 | Ga0070690_1000264082 | 284 |
| 455 | 3300005336 | Ga0070680_100135656 | Ga0070680_1001356562 | 284 |
| 456 | 3300005337 | Ga0070682_100035175 | Ga0070682_1000351752 | 284 |
| 457 | 3300005341 | Ga0070691_10012141 | Ga0070691_100121413 | 284 |
| 458 | 3300005344 | Ga0070661_100266859 | Ga0070661_1002668592 | 284 |
| 459 | 3300005347 | Ga0070668_100113809 | Ga0070668_1001138092 | 284 |
| 460 | 3300005355 | Ga0070671_100006642 | Ga0070671_1000066421 | 284 |
| 461 | 3300005364 | Ga0070673_100011497 | Ga0070673_1000114972 | 284 |
| 462 | 3300005365 | Ga0070688_100364111 | Ga0070688_1003641111 | 284 |
| 463 | 3300005367 | Ga0070667_100061147 | Ga0070667_1000611473 | 284 |
| 464 | 3300005440 | Ga0070705_100061937 | Ga0070705_1000619371 | 284 |
| 465 | 3300005444 | Ga0070694_100096640 | Ga0070694_1000966403 | 284 |
| 466 | 3300005456 | Ga0070678_100058966 | Ga0070678_1000589662 | 284 |
| 467 | 3300005458 | Ga0070681_10043195 | Ga0070681_100431955 | 284 |
| 468 | 3300005468 | Ga0070707_100012394 | Ga0070707_1000123942 | 284 |
| 469 | 3300005471 | Ga0070698_100467157 | Ga0070698_1004671571 | 284 |
| 470 | 3300005535 | Ga0070684_100053587 | Ga0070684_1000535872 | 284 |
| 471 | 3300005544 | Ga0070686_100436560 | Ga0070686_1004365601 | 284 |
| 472 | 3300005549 | Ga0070704_100253445 | Ga0070704_1002534452 | 284 |
| 473 | 3300005564 | Ga0070664_100085300 | Ga0070664_1000853001 | 284 |
| 474 | 3300005577 | Ga0068857_100121210 | Ga0068857_1001212101 | 284 |
| 475 | 3300005616 | Ga0068852_100049783 | Ga0068852_1000497833 | 284 |
| 476 | 3300005617 | Ga0068859_100126037 | Ga0068859_1001260374 | 284 |
| 477 | 3300005618 | Ga0068864_100095816 | Ga0068864_1000958162 | 284 |
| 478 | 3300005718 | Ga0068866_10014385 | Ga0068866_100143852 | 284 |
| 479 | 3300005719 | Ga0068861_100171327 | Ga0068861_1001713272 | 284 |
| 480 | 3300005841 | Ga0068863_100521651 | Ga0068863_1005216512 | 284 |
| 481 | 3300005843 | Ga0068860_100123657 | Ga0068860_1001236574 | 284 |
| 482 | 3300005983 | Ga0081540_1000134 | Ga0081540_100013472 | 284 |
| 483 | 3300006931 | Ga0097620_100126036 | Ga0097620_1001260362 | 284 |
| 484 | 3300009177 | Ga0105248_10131729 | Ga0105248_101317293 | 284 |
| 485 | 3300020082 | Ga0206353_10299334 | Ga0206353_102993342 | 284 |
| 486 | 3300025735 | Ga0207713_1043258 | Ga0207713_10432582 | 284 |
| 487 | 3300025901 | Ga0207688_10004893 | Ga0207688_100048933 | 284 |
| 488 | 3300025903 | Ga0207680_10089396 | Ga0207680_100893962 | 284 |
| 489 | 3300025907 | Ga0207645_10067759 | Ga0207645_100677594 | 284 |
| 490 | 3300025908 | Ga0207643_10249953 | Ga0207643_102499532 | 284 |
| 491 | 3300025911 | Ga0207654_10168434 | Ga0207654_101684342 | 284 |
| 492 | 3300025914 | Ga0207671_10136889 | Ga0207671_101368892 | 284 |
| 493 | 3300025918 | Ga0207662_10014842 | Ga0207662_100148424 | 284 |
| 494 | 3300025919 | Ga0207657_10015632 | Ga0207657_100156327 | 284 |
| 495 | 3300025927 | Ga0207687_10317176 | Ga0207687_103171762 | 284 |
| 496 | 3300025928 | Ga0207700_10005259 | Ga0207700_100052599 | 284 |
| 497 | 3300025929 | Ga0207664_10016562 | Ga0207664_100165623 | 284 |
| 498 | 3300025935 | Ga0207709_10170719 | Ga0207709_101707192 | 284 |
| 499 | 3300025942 | Ga0207689_10025438 | Ga0207689_100254383 | 284 |
| 500 | 3300025949 | Ga0207667_10148464 | Ga0207667_101484642 | 284 |
| 501 | 3300025960 | Ga0207651_10036600 | Ga0207651_100366002 | 284 |
| 502 | 3300026067 | Ga0207678_10021601 | Ga0207678_100216013 | 284 |
| 503 | 3300026078 | Ga0207702_10121496 | Ga0207702_101214961 | 284 |
| 504 | 3300026088 | Ga0207641_10480173 | Ga0207641_104801732 | 284 |
| 505 | 3300026089 | Ga0207648_10063057 | Ga0207648_100630572 | 284 |
| 506 | 3300026095 | Ga0207676_10159132 | Ga0207676_101591321 | 284 |
| 507 | 3300026116 | Ga0207674_10034596 | Ga0207674_100345964 | 284 |
| 508 | 3300026118 | Ga0207675_100013930 | Ga0207675_1000139303 | 284 |
| 509 | 3300026121 | Ga0207683_10003655 | Ga0207683_1000365513 | 284 |
| 510 | 3300026142 | Ga0207698_10175189 | Ga0207698_101751892 | 284 |
| 511 | 3300028381 | Ga0268264_10104010 | Ga0268264_101040102 | 284 |
| 512 | 3300035083 | Ga0373926_0000029 | Ga0373926_0000029_4862_5737 | 284 |
| 513 | 3300035086 | Ga0373934_0005406 | Ga0373934_0005406_2646_3521 | 284 |
| 514 | 3300035089 | Ga0373944_0000803 | Ga0373944_0000803_971_1846 | 284 |
| 515 | 3300035111 | Ga0373923_0001569 | Ga0373923_0001569_4527_5402 | 284 |
| 516 | 3300035116 | Ga0373945_0000686 | Ga0373945_0000686_6196_7071 | 284 |
| 517 | 3300035119 | Ga0373956_0048891 | Ga0373956_0048891_855_1730 | 284 |
| 518 | 3300035120 | Ga0373957_0012190 | Ga0373957_0012190_1222_2097 | 284 |
| 519 | 3300035171 | Ga0373946_0000547 | Ga0373946_0000547_2192_3067 | 284 |
| 520 | 3300035410 | Ga0373924_0001613 | Ga0373924_0001613_3881_4756 | 284 |
| 521 | 3300035692 | Ga0373935_0001279 | Ga0373935_0001279_4862_5737 | 284 |
| 522 | 3300035695 | Ga0373927_0005059 | Ga0373927_0005059_4063_4938 | 284 |
| 523 | 3300035724 | Ga0373933_0072236 | Ga0373933_0072236_805_1680 | 284 |
| 524 | 3300035725 | Ga0373947_0001901 | Ga0373947_0001901_9375_10250 | 284 |
| 525 | 3300037068 | Ga0373925_0006032 | Ga0373925_0006032_4180_5169 | 284 |
| 526 | 3300037068 | Ga0373925_0013709 | Ga0373925_0013709_2546_3421 | 284 |
| 527 | 3300044694 | Ga0466963_0227764 | Ga0466963_0227764_59_934 | 284 |
| 528 | 3300045976 | Ga0466967_0174812 | Ga0466967_0174812_759_1670 | 284 |
| 529 | 3300046454 | Ga0495592_0072184 | Ga0495592_0072184_677_1552 | 284 |
| 530 | 3300046459 | Ga0495629_0009160 | Ga0495629_0009160_4861_5736 | 284 |
| 531 | 3300046461 | Ga0495641_0003865 | Ga0495641_0003865_6354_7229 | 284 |
| 532 | 3300046463 | Ga0495653_0011639 | Ga0495653_0011639_4862_5737 | 284 |
| 533 | 3300046472 | Ga0495580_0016862 | Ga0495580_0016862_961_1836 | 284 |
| 534 | 3300046473 | Ga0495582_0001688 | Ga0495582_0001688_2270_3145 | 284 |
| 535 | 3300046476 | Ga0495662_0000400 | Ga0495662_0000400_16493_17368 | 284 |
| 536 | 3300046517 | Ga0495630_0028635 | Ga0495630_0028635_2361_3236 | 284 |
| 537 | 3300046526 | Ga0495666_0005084 | Ga0495666_0005084_1106_1981 | 284 |
| 538 | 3300046529 | Ga0495652_0158990 | Ga0495652_0158990_677_1552 | 284 |
| 539 | 3300046531 | Ga0495665_0001375 | Ga0495665_0001375_9648_10523 | 284 |
| 540 | 3300046533 | Ga0495640_0016894 | Ga0495640_0016894_3513_4388 | 284 |
| 541 | 3300046535 | Ga0495586_0019800 | Ga0495586_0019800_1460_2335 | 284 |
| 542 | 3300046536 | Ga0495587_0026209 | Ga0495587_0026209_2484_3359 | 284 |
| 543 | 3300046559 | Ga0495667_0004878 | Ga0495667_0004878_1216_2091 | 284 |
| 544 | 3300046642 | Ga0495634_0011704 | Ga0495634_0011704_2219_3094 | 284 |
| 545 | 3300046663 | Ga0495635_0001441 | Ga0495635_0001441_7682_8557 | 284 |
| 546 | 3300046679 | Ga0495623_0035576 | Ga0495623_0035576_1903_2778 | 284 |
| 547 | 3300046680 | Ga0495646_0007692 | Ga0495646_0007692_5142_6017 | 284 |
| 548 | 3300046683 | Ga0495658_0007983 | Ga0495658_0007983_2072_2947 | 284 |
| 549 | 3300046689 | Ga0495613_0013631 | Ga0495613_0013631_2670_3545 | 284 |
| 550 | 3300047315 | Ga0495581_0000947 | Ga0495581_0000947_7250_8125 | 284 |
| 551 | 3300047317 | Ga0495604_0008628 | Ga0495604_0008628_6978_7853 | 284 |
| 552 | 3300047319 | Ga0495674_0016755 | Ga0495674_0016755_2448_3323 | 284 |
| 553 | 3300047321 | Ga0495676_0004908 | Ga0495676_0004908_8003_8878 | 284 |
| 554 | 3300047322 | Ga0495680_0005139 | Ga0495680_0005139_7710_8585 | 284 |
| 555 | 3300047444 | Ga0495675_0036612 | Ga0495675_0036612_1243_2118 | 284 |
| 556 | 3300047673 | Ga0495593_0002762 | Ga0495593_0002762_4142_5017 | 284 |
| 557 | 3300048089 | Ga0495614_0058879 | Ga0495614_0058879_43_918 | 284 |
| 558 | 3300048903 | Ga0496100_0065444 | Ga0496100_0065444_1341_2216 | 284 |
| 559 | 3300048907 | Ga0496104_0015206 | Ga0496104_0015206_3325_4215 | 284 |
| 560 | 3300048909 | Ga0496106_0443766 | Ga0496106_0443766_16_912 | 284 |
| 561 | 3300048912 | Ga0496109_0024582 | Ga0496109_0024582_1766_2656 | 284 |
| 562 | 3300048916 | Ga0496113_0156309 | Ga0496113_0156309_518_1408 | 284 |
| 563 | 3300048917 | Ga0496114_0452031 | Ga0496114_0452031_22_918 | 284 |
| 564 | 3300048918 | Ga0496115_0053323 | Ga0496115_0053323_503_1378 | 284 |
| 565 | 3300053077 | Ga0495601_0005278 | Ga0495601_0005278_972_1847 | 284 |
| 566 | 3300053085 | Ga0495619_0015865 | Ga0495619_0015865_2448_3323 | 284 |
| 567 | iso_pu_bacteria | 2751185734 | 2753074309 | 284 |
| 568 | iso_pu_bacteria | 2791354901 | 2791915875 | 284 |
| 569 | iso_pu_bacteria | 2795385472 | 2795795134 | 284 |
| 570 | iso_pu_bacteria | 2873314349 | 2873314724 | 284 |
| 571 | iso_pu_bacteria | 8055066027 | 8055066390 | 284 |
| 572 | 3300001979 | JGI24740J21852_10016753 | JGI24740J21852_100167532 | 285 |
| 573 | 3300001989 | JGI24739J22299_10007674 | JGI24739J22299_100076741 | 285 |
| 574 | 3300001990 | JGI24737J22298_10016265 | JGI24737J22298_100162652 | 285 |
| 575 | 3300001990 | JGI24737J22298_10017067 | JGI24737J22298_100170671 | 285 |
| 576 | 3300005434 | Ga0070709_10002090 | Ga0070709_100020908 | 285 |
| 577 | 3300005435 | Ga0070714_100030237 | Ga0070714_1000302372 | 285 |
| 578 | 3300005436 | Ga0070713_100217465 | Ga0070713_1002174652 | 285 |
| 579 | 3300005437 | Ga0070710_10006989 | Ga0070710_100069895 | 285 |
| 580 | 3300005577 | Ga0068857_100145383 | Ga0068857_1001453832 | 285 |
| 581 | 3300005577 | Ga0068857_100466054 | Ga0068857_1004660542 | 285 |
| 582 | 3300005616 | Ga0068852_100469305 | Ga0068852_1004693052 | 285 |
| 583 | 3300005842 | Ga0068858_100498075 | Ga0068858_1004980751 | 285 |
| 584 | 3300006173 | Ga0070716_100052078 | Ga0070716_1000520782 | 285 |
| 585 | 3300006175 | Ga0070712_100012392 | Ga0070712_1000123925 | 285 |
| 586 | 3300025885 | Ga0207653_10003493 | Ga0207653_100034932 | 285 |
| 587 | 3300025898 | Ga0207692_10012248 | Ga0207692_100122482 | 285 |
| 588 | 3300025904 | Ga0207647_10005178 | Ga0207647_100051789 | 285 |
| 589 | 3300025906 | Ga0207699_10001301 | Ga0207699_1000130110 | 285 |
| 590 | 3300025915 | Ga0207693_10015690 | Ga0207693_100156902 | 285 |
| 591 | 3300025916 | Ga0207663_10008646 | Ga0207663_100086464 | 285 |
| 592 | 3300025929 | Ga0207664_10134886 | Ga0207664_101348862 | 285 |
| 593 | 3300025939 | Ga0207665_10004667 | Ga0207665_100046679 | 285 |
| 594 | 3300026116 | Ga0207674_10551941 | Ga0207674_105519411 | 285 |
| 595 | 3300026142 | Ga0207698_10236897 | Ga0207698_102368971 | 285 |
| 596 | 3300031456 | Ga0307513_10339587 | Ga0307513_103395872 | 285 |
| 597 | 3300031838 | Ga0307518_10133220 | Ga0307518_101332202 | 285 |
| 598 | 3300037466 | Ga0395898_0154761 | Ga0395898_0154761_718_1605 | 285 |
| 599 | 3300041460 | Ga0451802_0807064 | Ga0451802_0807064_203_1063 | 285 |
| 600 | 3300041512 | Ga0451853_1399455 | Ga0451853_1399455_309_1169 | 285 |
| 601 | 3300044901 | Ga0466960_0085367 | Ga0466960_0085367_241_1098 | 285 |
| 602 | 3300047319 | Ga0495674_0376443 | Ga0495674_0376443_203_1120 | 285 |
| 603 | 3300048907 | Ga0496104_0161018 | Ga0496104_0161018_592_1479 | 285 |
| 604 | 3300048908 | Ga0496105_0059597 | Ga0496105_0059597_1807_2694 | 285 |
| 605 | 3300048917 | Ga0496114_0044618 | Ga0496114_0044618_2201_3088 | 285 |
| 606 | iso_pu_bacteria | 2643221561 | 2643827855 | 285 |
| 607 | iso_pu_bacteria | 2643221576 | 2643892395 | 285 |
| 608 | iso_pu_bacteria | 2643221590 | 2643961447 | 285 |
| 609 | iso_pu_bacteria | 2643221604 | 2644032378 | 285 |
| 610 | iso_pu_bacteria | 2643221617 | 2644099630 | 285 |
| 611 | iso_pu_bacteria | 2643221620 | 2644116175 | 285 |
| 612 | iso_pu_bacteria | 2643221696 | 2644532377 | 285 |
| 613 | iso_pu_bacteria | 2738541305 | 2738870551 | 285 |
| 614 | iso_pu_bacteria | 2811994874 | 2812334175 | 285 |
| 615 | iso_pu_bacteria | 2816332119 | 2816423705 | 285 |
| 616 | iso_pu_bacteria | 2816332139 | 2816505401 | 285 |
| 617 | iso_pu_bacteria | 2856741275 | 2856746088 | 285 |
| 618 | iso_pu_bacteria | 2891395885 | 2891400155 | 285 |
| 619 | iso_pu_bacteria | 2891554331 | 2891559900 | 285 |
| 620 | iso_pu_bacteria | 2891562705 | 2891567298 | 285 |
| 621 | 3300005435 | Ga0070714_100001331 | Ga0070714_1000013319 | 286 |
| 622 | 3300005445 | Ga0070708_100249986 | Ga0070708_1002499861 | 286 |
| 623 | 3300005467 | Ga0070706_100054511 | Ga0070706_1000545112 | 286 |
| 624 | 3300005468 | Ga0070707_100005848 | Ga0070707_10000584812 | 286 |
| 625 | 3300005468 | Ga0070707_100080778 | Ga0070707_1000807782 | 286 |
| 626 | 3300009551 | Ga0105238_10152672 | Ga0105238_101526722 | 286 |
| 627 | 3300014325 | Ga0163163_10359165 | Ga0163163_103591652 | 286 |
| 628 | 3300021388 | Ga0213875_10001293 | Ga0213875_1000129310 | 286 |
| 629 | 3300025924 | Ga0207694_10118387 | Ga0207694_101183872 | 286 |
| 630 | 3300025928 | Ga0207700_10237261 | Ga0207700_102372612 | 286 |
| 631 | 3300025929 | Ga0207664_10001827 | Ga0207664_1000182711 | 286 |
| 632 | 3300037853 | Ga0436364_1326662 | Ga0436364_1326662_25454_26317 | 286 |
| 633 | 3300046679 | Ga0495623_0153858 | Ga0495623_0153858_187_1146 | 286 |
| 634 | iso_pu_bacteria | 2643221615 | 2644090455 | 286 |
| 635 | iso_pu_bacteria | 2643221657 | 2644323417 | 286 |
| 636 | iso_pu_bacteria | 2866552031 | 2866555402 | 286 |
| 637 | 3300005437 | Ga0070710_10000435 | Ga0070710_1000043515 | 287 |
| 638 | 3300005468 | Ga0070707_100166643 | Ga0070707_1001666432 | 287 |
| 639 | 3300009147 | Ga0114129_10457866 | Ga0114129_104578663 | 287 |
| 640 | 3300009545 | Ga0105237_10477996 | Ga0105237_104779961 | 287 |
| 641 | 3300013308 | Ga0157375_10282254 | Ga0157375_102822542 | 287 |
| 642 | 3300025898 | Ga0207692_10001629 | Ga0207692_100016292 | 287 |
| 643 | 3300028381 | Ga0268264_10195866 | Ga0268264_101958662 | 287 |
| 644 | 3300028800 | Ga0265338_10028796 | Ga0265338_100287961 | 287 |
| 645 | 3300030736 | Ga0316180_1176821 | Ga0316180_11768213 | 287 |
| 646 | 3300031241 | Ga0265325_10047288 | Ga0265325_100472882 | 287 |
| 647 | 3300031247 | Ga0265340_10044288 | Ga0265340_100442882 | 287 |
| 648 | 3300031712 | Ga0265342_10023010 | Ga0265342_100230102 | 287 |
| 649 | 3300031727 | Ga0316576_10029277 | Ga0316576_100292771 | 287 |
| 650 | 3300031727 | Ga0316576_10034208 | Ga0316576_100342083 | 287 |
| 651 | 3300031728 | Ga0316578_10040255 | Ga0316578_100402553 | 287 |
| 652 | 3300035118 | Ga0373954_0049417 | Ga0373954_0049417_814_1698 | 287 |
| 653 | 3300035398 | Ga0316574_0038258 | Ga0316574_0038258_1789_2655 | 287 |
| 654 | 3300035692 | Ga0373935_0317921 | Ga0373935_0317921_77_967 | 287 |
| 655 | 3300036647 | Ga0316582_0218837 | Ga0316582_0218837_394_1260 | 287 |
| 656 | 3300036712 | Ga0316584_0175662 | Ga0316584_0175662_564_1430 | 287 |
| 657 | 3300044658 | Ga0466972_0003345 | Ga0466972_0003345_7021_7884 | 287 |
| 658 | 3300044683 | Ga0466965_0010442 | Ga0466965_0010442_1249_2112 | 287 |
| 659 | 3300044684 | Ga0466966_0003582 | Ga0466966_0003582_1624_2493 | 287 |
| 660 | 3300044693 | Ga0466961_0006845 | Ga0466961_0006845_1377_2246 | 287 |
| 661 | 3300044693 | Ga0466961_0054516 | Ga0466961_0054516_103_966 | 287 |
| 662 | 3300044765 | Ga0466970_0020427 | Ga0466970_0020427_651_1514 | 287 |
| 663 | 3300045049 | Ga0466959_0006690 | Ga0466959_0006690_1931_2800 | 287 |
| 664 | 3300045836 | Ga0466958_0009913 | Ga0466958_0009913_3399_4268 | 287 |
| 665 | 3300046516 | Ga0495628_0214688 | Ga0495628_0214688_39_929 | 287 |
| 666 | 3300046517 | Ga0495630_0289393 | Ga0495630_0289393_296_1186 | 287 |
| 667 | 3300046559 | Ga0495667_0025498 | Ga0495667_0025498_59_943 | 287 |
| 668 | 3300046663 | Ga0495635_0093358 | Ga0495635_0093358_857_1741 | 287 |
| 669 | 3300046675 | Ga0495657_0047671 | Ga0495657_0047671_1888_2772 | 287 |
| 670 | 3300047319 | Ga0495674_0360765 | Ga0495674_0360765_151_1041 | 287 |
| 671 | 3300049586 | Ga0501070_0424800 | Ga0501070_0424800_107_985 | 287 |
| 672 | 3300050512 | nmdc:mga0n895_536016_c1 | nmdc:mga0n895_536016_c1_152_1111 | 287 |
| 673 | 3300061719 | Ga0466962_0167126 | Ga0466962_0167126_115_984 | 287 |
| 674 | iso_pu_bacteria | 2675903058 | 2676473548 | 287 |
| 675 | iso_pu_bacteria | 2827628540 | 2827632061 | 287 |
| 676 | iso_pu_bacteria | 3002998708 | 3003005506 | 287 |
| 677 | 3300003373 | JGI25407J50210_10002761 | JGI25407J50210_100027614 | 288 |
| 678 | 3300005435 | Ga0070714_100140973 | Ga0070714_1001409732 | 288 |
| 679 | 3300005530 | Ga0070679_100503694 | Ga0070679_1005036942 | 288 |
| 680 | 3300005563 | Ga0068855_100011645 | Ga0068855_1000116453 | 288 |
| 681 | 3300005981 | Ga0081538_10000079 | Ga0081538_1000007910 | 288 |
| 682 | 3300009093 | Ga0105240_10008130 | Ga0105240_100081302 | 288 |
| 683 | 3300013104 | Ga0157370_10009280 | Ga0157370_100092804 | 288 |
| 684 | 3300013105 | Ga0157369_10010406 | Ga0157369_100104064 | 288 |
| 685 | 3300025921 | Ga0207652_10279136 | Ga0207652_102791361 | 288 |
| 686 | 3300026142 | Ga0207698_10136154 | Ga0207698_101361542 | 288 |
| 687 | 3300028794 | Ga0307515_10284834 | Ga0307515_102848342 | 288 |
| 688 | 3300030521 | Ga0307511_10066119 | Ga0307511_100661192 | 288 |
| 689 | 3300030522 | Ga0307512_10155660 | Ga0307512_101556601 | 288 |
| 690 | 3300031456 | Ga0307513_10039124 | Ga0307513_100391246 | 288 |
| 691 | 3300031456 | Ga0307513_10231929 | Ga0307513_102319292 | 288 |
| 692 | 3300031824 | Ga0307413_10136855 | Ga0307413_101368553 | 288 |
| 693 | 3300032005 | Ga0307411_10011700 | Ga0307411_100117002 | 288 |
| 694 | 3300035083 | Ga0373926_0006978 | Ga0373926_0006978_407_1372 | 288 |
| 695 | 3300035089 | Ga0373944_0000419 | Ga0373944_0000419_3174_4124 | 288 |
| 696 | 3300035111 | Ga0373923_0015623 | Ga0373923_0015623_1702_2667 | 288 |
| 697 | 3300035113 | Ga0373936_0000433 | Ga0373936_0000433_6266_7231 | 288 |
| 698 | 3300035170 | Ga0373943_0000683 | Ga0373943_0000683_10919_11899 | 288 |
| 699 | 3300035171 | Ga0373946_0001780 | Ga0373946_0001780_4234_5199 | 288 |
| 700 | 3300035692 | Ga0373935_0004514 | Ga0373935_0004514_1525_2445 | 288 |
| 701 | 3300035695 | Ga0373927_0008697 | Ga0373927_0008697_1631_2596 | 288 |
| 702 | 3300035725 | Ga0373947_0006626 | Ga0373947_0006626_4441_5436 | 288 |
| 703 | 3300037068 | Ga0373925_0004633 | Ga0373925_0004633_4227_5222 | 288 |
| 704 | 3300037418 | Ga0395900_0040121 | Ga0395900_0040121_644_1516 | 288 |
| 705 | 3300037466 | Ga0395898_0213776 | Ga0395898_0213776_46_918 | 288 |
| 706 | 3300042007 | Ga0439449_0068540 | Ga0439449_0068540_96_989 | 288 |
| 707 | 3300046461 | Ga0495641_0003333 | Ga0495641_0003333_8009_8974 | 288 |
| 708 | 3300046463 | Ga0495653_0004725 | Ga0495653_0004725_7547_8512 | 288 |
| 709 | 3300046477 | Ga0495664_0003706 | Ga0495664_0003706_2724_3719 | 288 |
| 710 | 3300046529 | Ga0495652_0016783 | Ga0495652_0016783_4009_4974 | 288 |
| 711 | 3300046559 | Ga0495667_0019859 | Ga0495667_0019859_1343_2338 | 288 |
| 712 | 3300046642 | Ga0495634_0004211 | Ga0495634_0004211_8817_9812 | 288 |
| 713 | 3300046663 | Ga0495635_0002316 | Ga0495635_0002316_5856_6821 | 288 |
| 714 | 3300046678 | Ga0495599_0055897 | Ga0495599_0055897_1114_2064 | 288 |
| 715 | 3300047319 | Ga0495674_0001098 | Ga0495674_0001098_4626_5591 | 288 |
| 716 | 3300048088 | Ga0495602_0088268 | Ga0495602_0088268_258_1223 | 288 |
| 717 | 3300048903 | Ga0496100_0006407 | Ga0496100_0006407_978_1964 | 288 |
| 718 | 3300048904 | Ga0496101_0042784 | Ga0496101_0042784_1288_2274 | 288 |
| 719 | 3300048907 | Ga0496104_0035885 | Ga0496104_0035885_475_1461 | 288 |
| 720 | 3300048907 | Ga0496104_0110537 | Ga0496104_0110537_284_1159 | 288 |
| 721 | 3300048907 | Ga0496104_0284390 | Ga0496104_0284390_122_1048 | 288 |
| 722 | 3300048911 | Ga0496108_0003174 | Ga0496108_0003174_10988_11974 | 288 |
| 723 | 3300048913 | Ga0496110_0005401 | Ga0496110_0005401_7517_8503 | 288 |
| 724 | 3300048917 | Ga0496114_0020209 | Ga0496114_0020209_2187_3173 | 288 |
| 725 | iso_pu_bacteria | 2870721527 | 2870727367 | 288 |
| 726 | 3300005436 | Ga0070713_100139436 | Ga0070713_1001394362 | 289 |
| 727 | 3300005436 | Ga0070713_100197947 | Ga0070713_1001979472 | 289 |
| 728 | 3300005436 | Ga0070713_100289161 | Ga0070713_1002891612 | 289 |
| 729 | 3300005468 | Ga0070707_100033209 | Ga0070707_1000332096 | 289 |
| 730 | 3300005471 | Ga0070698_100033301 | Ga0070698_1000333015 | 289 |
| 731 | 3300005843 | Ga0068860_100000286 | Ga0068860_10000028657 | 289 |
| 732 | 3300006844 | Ga0075428_100024987 | Ga0075428_1000249875 | 289 |
| 733 | 3300006844 | Ga0075428_100751413 | Ga0075428_1007514132 | 289 |
| 734 | 3300006846 | Ga0075430_100008412 | Ga0075430_10000841210 | 289 |
| 735 | 3300009094 | Ga0111539_10008303 | Ga0111539_100083037 | 289 |
| 736 | 3300009147 | Ga0114129_10075261 | Ga0114129_100752615 | 289 |
| 737 | 3300013308 | Ga0157375_10553806 | Ga0157375_105538062 | 289 |
| 738 | 3300025922 | Ga0207646_10030107 | Ga0207646_100301072 | 289 |
| 739 | 3300025928 | Ga0207700_10001082 | Ga0207700_1000108213 | 289 |
| 740 | 3300025928 | Ga0207700_10108037 | Ga0207700_101080373 | 289 |
| 741 | 3300028381 | Ga0268264_10000246 | Ga0268264_1000024653 | 289 |
| 742 | 3300031456 | Ga0307513_10068521 | Ga0307513_100685213 | 289 |
| 743 | 3300031731 | Ga0307405_10257355 | Ga0307405_102573552 | 289 |
| 744 | 3300031731 | Ga0307405_10442443 | Ga0307405_104424432 | 289 |
| 745 | 3300031824 | Ga0307413_10237553 | Ga0307413_102375531 | 289 |
| 746 | 3300031903 | Ga0307407_10393583 | Ga0307407_103935831 | 289 |
| 747 | 3300032004 | Ga0307414_10333488 | Ga0307414_103334881 | 289 |
| 748 | 3300037418 | Ga0395900_0007194 | Ga0395900_0007194_10151_11020 | 289 |
| 749 | 3300038443 | Ga0395901_0018699 | Ga0395901_0018699_3525_4394 | 289 |
| 750 | 3300045976 | Ga0466967_0470667 | Ga0466967_0470667_160_1029 | 289 |
| 751 | 3300048905 | Ga0496102_0288078 | Ga0496102_0288078_279_1148 | 289 |
| 752 | 3300048914 | Ga0496111_0259763 | Ga0496111_0259763_273_1142 | 289 |
| 753 | 3300048917 | Ga0496114_0013937 | Ga0496114_0013937_4985_5854 | 289 |
| 754 | 3300048917 | Ga0496114_0323707 | Ga0496114_0323707_153_1166 | 289 |
| 755 | 3300049527 | Ga0501311_013289 | Ga0501311_013289_32_901 | 289 |
| 756 | 3300049568 | Ga0501031_0061819 | Ga0501031_0061819_538_1413 | 289 |
| 757 | 3300049575 | Ga0501039_0021128 | Ga0501039_0021128_4065_4940 | 289 |
| 758 | 3300049576 | Ga0501040_0115366 | Ga0501040_0115366_657_1532 | 289 |
| 759 | 3300049578 | Ga0501042_0032377 | Ga0501042_0032377_338_1213 | 289 |
| 760 | 3300049579 | Ga0501043_0264822 | Ga0501043_0264822_53_928 | 289 |
| 761 | 3300049580 | Ga0501046_0034381 | Ga0501046_0034381_2628_3503 | 289 |
| 762 | 3300049582 | Ga0501048_0037443 | Ga0501048_0037443_205_1080 | 289 |
| 763 | 3300049584 | Ga0501068_0015420 | Ga0501068_0015420_697_1572 | 289 |
| 764 | 3300049587 | Ga0501071_0180050 | Ga0501071_0180050_461_1336 | 289 |
| 765 | 3300049588 | Ga0501072_0257145 | Ga0501072_0257145_448_1323 | 289 |
| 766 | 3300049588 | Ga0501072_0373977 | Ga0501072_0373977_84_953 | 289 |
| 767 | 3300049590 | Ga0501074_0048523 | Ga0501074_0048523_1779_2654 | 289 |
| 768 | 3300049592 | Ga0501076_0236247 | Ga0501076_0236247_128_1003 | 289 |
| 769 | 3300049824 | Ga0501045_0252567 | Ga0501045_0252567_187_1062 | 289 |
| 770 | 3300050492 | nmdc:mga0yw44_37526_c1 | nmdc:mga0yw44_37526_c1_328_1197 | 289 |
| 771 | 3300050492 | nmdc:mga0yw44_413143_c1 | nmdc:mga0yw44_413143_c1_26_895 | 289 |
| 772 | 3300050508 | nmdc:mga09592_71095_c1 | nmdc:mga09592_71095_c1_2037_2927 | 289 |
| 773 | 3300050510 | nmdc:mga06r32_55904_c1 | nmdc:mga06r32_55904_c1_2230_3120 | 289 |
| 774 | 3300050511 | nmdc:mga08y16_138537_c1 | nmdc:mga08y16_138537_c1_174_1055 | 289 |
| 775 | 3300053136 | Ga0500559_0117480 | Ga0500559_0117480_163_1032 | 289 |
| 776 | 3300054114 | Ga0501084_0024480 | Ga0501084_0024480_3841_4716 | 289 |
| 777 | 3300061734 | Ga0530510_0104482 | Ga0530510_0104482_803_1678 | 289 |
| 778 | 3300005445 | Ga0070708_100041831 | Ga0070708_1000418312 | 290 |
| 779 | 3300005467 | Ga0070706_100048728 | Ga0070706_1000487282 | 290 |
| 780 | 3300005937 | Ga0081455_10007241 | Ga0081455_1000724112 | 290 |
| 781 | 3300006028 | Ga0070717_10515540 | Ga0070717_105155401 | 290 |
| 782 | 3300006038 | Ga0075365_10118382 | Ga0075365_101183822 | 290 |
| 783 | 3300006846 | Ga0075430_100020627 | Ga0075430_1000206276 | 290 |
| 784 | 3300006847 | Ga0075431_100022199 | Ga0075431_1000221996 | 290 |
| 785 | 3300006880 | Ga0075429_100012802 | Ga0075429_1000128025 | 290 |
| 786 | 3300009147 | Ga0114129_10000201 | Ga0114129_1000020133 | 290 |
| 787 | 3300013308 | Ga0157375_10090494 | Ga0157375_100904942 | 290 |
| 788 | 3300021388 | Ga0213875_10010004 | Ga0213875_100100043 | 290 |
| 789 | 3300025910 | Ga0207684_10072295 | Ga0207684_100722952 | 290 |
| 790 | 3300031247 | Ga0265340_10004044 | Ga0265340_100040448 | 290 |
| 791 | 3300031995 | Ga0307409_100062491 | Ga0307409_1000624912 | 290 |
| 792 | 3300032126 | Ga0307415_100006044 | Ga0307415_1000060443 | 290 |
| 793 | 3300035119 | Ga0373956_0002433 | Ga0373956_0002433_4785_5684 | 290 |
| 794 | 3300037853 | Ga0436364_0087476 | Ga0436364_0087476_29024_29908 | 290 |
| 795 | 3300037853 | Ga0436364_0687768 | Ga0436364_0687768_1415_2302 | 290 |
| 796 | 3300039450 | Ga0436363_0362663 | Ga0436363_0362663_82_957 | 290 |
| 797 | 3300048088 | Ga0495602_0071836 | Ga0495602_0071836_615_1598 | 290 |
| 798 | 3300049570 | Ga0501033_0007874 | Ga0501033_0007874_2650_3537 | 290 |
| 799 | 3300049572 | Ga0501036_0008093 | Ga0501036_0008093_3117_4004 | 290 |
| 800 | 3300049576 | Ga0501040_0001735 | Ga0501040_0001735_5333_6220 | 290 |
| 801 | 3300049577 | Ga0501041_0013597 | Ga0501041_0013597_3226_4113 | 290 |
| 802 | 3300049578 | Ga0501042_0038522 | Ga0501042_0038522_1580_2476 | 290 |
| 803 | 3300049578 | Ga0501042_0173751 | Ga0501042_0173751_348_1235 | 290 |
| 804 | 3300049587 | Ga0501071_0053221 | Ga0501071_0053221_1492_2379 | 290 |
| 805 | 3300049588 | Ga0501072_0022680 | Ga0501072_0022680_3724_4611 | 290 |
| 806 | 3300049588 | Ga0501072_0034531 | Ga0501072_0034531_2725_3621 | 290 |
| 807 | 3300049590 | Ga0501074_0160831 | Ga0501074_0160831_362_1258 | 290 |
| 808 | 3300049591 | Ga0501075_0002773 | Ga0501075_0002773_7466_8353 | 290 |
| 809 | 3300049592 | Ga0501076_0078601 | Ga0501076_0078601_810_1697 | 290 |
| 810 | 3300049593 | Ga0501077_0076340 | Ga0501077_0076340_1016_1903 | 290 |
| 811 | 3300049741 | Ga0501079_0014654 | Ga0501079_0014654_951_1838 | 290 |
| 812 | 3300049742 | Ga0501080_0051831 | Ga0501080_0051831_2900_3787 | 290 |
| 813 | 3300049743 | Ga0501081_0016163 | Ga0501081_0016163_329_1216 | 290 |
| 814 | 3300049744 | Ga0501083_0112514 | Ga0501083_0112514_859_1746 | 290 |
| 815 | 3300049824 | Ga0501045_0070695 | Ga0501045_0070695_755_1651 | 290 |
| 816 | 3300050507 | nmdc:mga05p37_14121_c1 | nmdc:mga05p37_14121_c1_3677_4558 | 290 |
| 817 | 3300050508 | nmdc:mga09592_11227_c1 | nmdc:mga09592_11227_c1_1034_1915 | 290 |
| 818 | 3300050510 | nmdc:mga06r32_12345_c1 | nmdc:mga06r32_12345_c1_3807_4688 | 290 |
| 819 | 3300053090 | Ga0500646_0000070 | Ga0500646_0000070_4492_5382 | 290 |
| 820 | 3300053092 | Ga0500583_0006147 | Ga0500583_0006147_634_1524 | 290 |
| 821 | 3300053104 | Ga0500556_0001268 | Ga0500556_0001268_6885_7757 | 290 |
| 822 | 3300053117 | Ga0500593_000433 | Ga0500593_000433_5452_6324 | 290 |
| 823 | 3300053139 | Ga0500568_0081996 | Ga0500568_0081996_191_1063 | 290 |
| 824 | 3300053146 | Ga0500588_0010241 | Ga0500588_0010241_360_1250 | 290 |
| 825 | 3300054114 | Ga0501084_0017512 | Ga0501084_0017512_4220_5107 | 290 |
| 826 | 3300060353 | Ga0501082_0015875 | Ga0501082_0015875_888_1775 | 290 |
| 827 | 3300061734 | Ga0530510_0013642 | Ga0530510_0013642_3979_4866 | 290 |
| 828 | 3300003373 | JGI25407J50210_10019322 | JGI25407J50210_100193222 | 291 |
| 829 | 3300005344 | Ga0070661_100181116 | Ga0070661_1001811161 | 291 |
| 830 | 3300005434 | Ga0070709_10007326 | Ga0070709_100073263 | 291 |
| 831 | 3300005439 | Ga0070711_100027816 | Ga0070711_1000278162 | 291 |
| 832 | 3300005467 | Ga0070706_100095470 | Ga0070706_1000954701 | 291 |
| 833 | 3300005468 | Ga0070707_100025347 | Ga0070707_1000253474 | 291 |
| 834 | 3300005471 | Ga0070698_100014157 | Ga0070698_1000141577 | 291 |
| 835 | 3300005577 | Ga0068857_100510562 | Ga0068857_1005105621 | 291 |
| 836 | 3300005937 | Ga0081455_10008314 | Ga0081455_1000831411 | 291 |
| 837 | 3300005981 | Ga0081538_10001977 | Ga0081538_1000197711 | 291 |
| 838 | 3300005981 | Ga0081538_10003089 | Ga0081538_100030895 | 291 |
| 839 | 3300006028 | Ga0070717_10083758 | Ga0070717_100837582 | 291 |
| 840 | 3300006844 | Ga0075428_100071186 | Ga0075428_1000711864 | 291 |
| 841 | 3300006846 | Ga0075430_100066631 | Ga0075430_1000666312 | 291 |
| 842 | 3300006880 | Ga0075429_100059512 | Ga0075429_1000595123 | 291 |
| 843 | 3300009147 | Ga0114129_10321087 | Ga0114129_103210872 | 291 |
| 844 | 3300025906 | Ga0207699_10001338 | Ga0207699_100013388 | 291 |
| 845 | 3300025922 | Ga0207646_10040503 | Ga0207646_100405033 | 291 |
| 846 | 3300025928 | Ga0207700_10108358 | Ga0207700_101083582 | 291 |
| 847 | 3300025929 | Ga0207664_10021473 | Ga0207664_100214733 | 291 |
| 848 | 3300035086 | Ga0373934_0017411 | Ga0373934_0017411_1388_2290 | 291 |
| 849 | 3300035113 | Ga0373936_0028672 | Ga0373936_0028672_1101_2003 | 291 |
| 850 | 3300035119 | Ga0373956_0018268 | Ga0373956_0018268_277_1179 | 291 |
| 851 | 3300035172 | Ga0373955_0030668 | Ga0373955_0030668_1703_2605 | 291 |
| 852 | 3300036401 | Ga0373937_0132729 | Ga0373937_0132729_105_1007 | 291 |
| 853 | 3300042005 | Ga0439448_0001608 | Ga0439448_0001608_707_1600 | 291 |
| 854 | 3300042008 | Ga0439450_000461 | Ga0439450_000461_1526_2419 | 291 |
| 855 | 3300042016 | Ga0439463_005356 | Ga0439463_005356_1071_1964 | 291 |
| 856 | 3300042439 | Ga0439464_0001366 | Ga0439464_0001366_2676_3569 | 291 |
| 857 | 3300042461 | Ga0439460_0002958 | Ga0439460_0002958_1992_2885 | 291 |
| 858 | 3300042993 | Ga0439440_0002719 | Ga0439440_0002719_210_1103 | 291 |
| 859 | 3300045976 | Ga0466967_0084313 | Ga0466967_0084313_1129_2019 | 291 |
| 860 | 3300046462 | Ga0495651_0009060 | Ga0495651_0009060_5133_6035 | 291 |
| 861 | 3300046463 | Ga0495653_0037340 | Ga0495653_0037340_1489_2391 | 291 |
| 862 | 3300046511 | Ga0495608_0017087 | Ga0495608_0017087_4013_4915 | 291 |
| 863 | 3300046516 | Ga0495628_0017244 | Ga0495628_0017244_3501_4403 | 291 |
| 864 | 3300046531 | Ga0495665_0035237 | Ga0495665_0035237_757_1659 | 291 |
| 865 | 3300046535 | Ga0495586_0083048 | Ga0495586_0083048_321_1223 | 291 |
| 866 | 3300046536 | Ga0495587_0015541 | Ga0495587_0015541_466_1368 | 291 |
| 867 | 3300046543 | Ga0495645_0017763 | Ga0495645_0017763_1597_2499 | 291 |
| 868 | 3300046559 | Ga0495667_0024606 | Ga0495667_0024606_1425_2327 | 291 |
| 869 | 3300046615 | Ga0495656_0026587 | Ga0495656_0026587_1185_2081 | 291 |
| 870 | 3300046642 | Ga0495634_0052817 | Ga0495634_0052817_60_962 | 291 |
| 871 | 3300046642 | Ga0495634_0141493 | Ga0495634_0141493_247_1188 | 291 |
| 872 | 3300046680 | Ga0495646_0022376 | Ga0495646_0022376_64_966 | 291 |
| 873 | 3300046809 | Ga0495600_0050119 | Ga0495600_0050119_47_949 | 291 |
| 874 | 3300047317 | Ga0495604_0030524 | Ga0495604_0030524_1937_2839 | 291 |
| 875 | 3300047319 | Ga0495674_0042198 | Ga0495674_0042198_3074_3976 | 291 |
| 876 | 3300047322 | Ga0495680_0006180 | Ga0495680_0006180_3439_4341 | 291 |
| 877 | 3300047471 | Ga0495684_0010668 | Ga0495684_0010668_5099_6001 | 291 |
| 878 | 3300049591 | Ga0501075_0025237 | Ga0501075_0025237_1646_2539 | 291 |
| 879 | 3300049592 | Ga0501076_0140147 | Ga0501076_0140147_153_1046 | 291 |
| 880 | 3300049593 | Ga0501077_0058055 | Ga0501077_0058055_1297_2190 | 291 |
| 881 | 3300049741 | Ga0501079_0019809 | Ga0501079_0019809_1353_2246 | 291 |
| 882 | 3300050507 | nmdc:mga05p37_214526_c1 | nmdc:mga05p37_214526_c1_299_1192 | 291 |
| 883 | 3300053078 | Ga0495612_0006871 | Ga0495612_0006871_1933_2874 | 291 |
| 884 | 3300061734 | Ga0530510_0059472 | Ga0530510_0059472_1855_2748 | 291 |
| 885 | 3300006175 | Ga0070712_100089727 | Ga0070712_1000897274 | 292 |
| 886 | 3300010375 | Ga0105239_10485530 | Ga0105239_104855301 | 292 |
| 887 | 3300025915 | Ga0207693_10058853 | Ga0207693_100588534 | 292 |
| 888 | 3300025916 | Ga0207663_10262990 | Ga0207663_102629901 | 292 |
| 889 | 3300025928 | Ga0207700_10272069 | Ga0207700_102720692 | 292 |
| 890 | 3300025929 | Ga0207664_10114621 | Ga0207664_101146212 | 292 |
| 891 | 3300025939 | Ga0207665_10112795 | Ga0207665_101127952 | 292 |
| 892 | 3300046454 | Ga0495592_0071860 | Ga0495592_0071860_560_1504 | 292 |
| 893 | 3300046462 | Ga0495651_0001532 | Ga0495651_0001532_15014_15943 | 292 |
| 894 | 3300046477 | Ga0495664_0086409 | Ga0495664_0086409_628_1572 | 292 |
| 895 | 3300046529 | Ga0495652_0000860 | Ga0495652_0000860_20556_21500 | 292 |
| 896 | 3300046678 | Ga0495599_0047684 | Ga0495599_0047684_55_1044 | 292 |
| 897 | 3300046679 | Ga0495623_0080263 | Ga0495623_0080263_107_1036 | 292 |
| 898 | 3300046680 | Ga0495646_0022028 | Ga0495646_0022028_2160_3104 | 292 |
| 899 | 3300053085 | Ga0495619_0064338 | Ga0495619_0064338_444_1373 | 292 |
| 900 | 3300005347 | Ga0070668_100497742 | Ga0070668_1004977421 | 293 |
| 901 | 3300005535 | Ga0070684_100451804 | Ga0070684_1004518042 | 293 |
| 902 | 3300005548 | Ga0070665_100071319 | Ga0070665_1000713193 | 293 |
| 903 | 3300006051 | Ga0075364_10065617 | Ga0075364_100656174 | 293 |
| 904 | 3300009148 | Ga0105243_10070227 | Ga0105243_100702272 | 293 |
| 905 | 3300014326 | Ga0157380_10202063 | Ga0157380_102020632 | 293 |
| 906 | 3300025919 | Ga0207657_10055424 | Ga0207657_100554242 | 293 |
| 907 | 3300025932 | Ga0207690_10464201 | Ga0207690_104642011 | 293 |
| 908 | 3300026121 | Ga0207683_10133058 | Ga0207683_101330582 | 293 |
| 909 | 3300030521 | Ga0307511_10058350 | Ga0307511_100583502 | 293 |
| 910 | 3300031507 | Ga0307509_10081585 | Ga0307509_100815852 | 293 |
| 911 | 3300032002 | Ga0307416_100355555 | Ga0307416_1003555552 | 293 |
| 912 | 3300044656 | Ga0466969_0028088 | Ga0466969_0028088_111_1100 | 293 |
| 913 | 3300044693 | Ga0466961_0064737 | Ga0466961_0064737_1197_2186 | 293 |
| 914 | 3300044719 | Ga0466971_0001527 | Ga0466971_0001527_6487_7476 | 293 |
| 915 | 3300044901 | Ga0466960_0021272 | Ga0466960_0021272_692_1573 | 293 |
| 916 | 3300045049 | Ga0466959_0001241 | Ga0466959_0001241_149_1138 | 293 |
| 917 | 3300045836 | Ga0466958_0126851 | Ga0466958_0126851_251_1240 | 293 |
| 918 | 3300046663 | Ga0495635_0000244 | Ga0495635_0000244_20401_21342 | 293 |
| 919 | 3300046809 | Ga0495600_0100703 | Ga0495600_0100703_695_1636 | 293 |
| 920 | 3300048909 | Ga0496106_0235756 | Ga0496106_0235756_310_1233 | 293 |
| 921 | 3300049584 | Ga0501068_0161682 | Ga0501068_0161682_341_1222 | 293 |
| 922 | 3300049585 | Ga0501069_0307637 | Ga0501069_0307637_35_916 | 293 |
| 923 | 3300050490 | nmdc:mga03n38_49012_c1 | nmdc:mga03n38_49012_c1_761_1642 | 293 |
| 924 | 3300050491 | nmdc:mga00v17_40489_c1 | nmdc:mga00v17_40489_c1_1386_2267 | 293 |
| 925 | 3300061719 | Ga0466962_0000273 | Ga0466962_0000273_6365_7354 | 293 |
| 926 | 3300000549 | LJQas_1005976 | LJQas_10059762 | 294 |
| 927 | 3300005985 | Ga0081539_10000356 | Ga0081539_1000035676 | 294 |
| 928 | 3300031852 | Ga0307410_10117772 | Ga0307410_101177722 | 294 |
| 929 | 3300031903 | Ga0307407_10058484 | Ga0307407_100584842 | 294 |
| 930 | 3300031995 | Ga0307409_100043096 | Ga0307409_1000430964 | 294 |
| 931 | 3300032002 | Ga0307416_100068131 | Ga0307416_1000681312 | 294 |
| 932 | 3300032126 | Ga0307415_100162331 | Ga0307415_1001623311 | 294 |
| 933 | 3300044693 | Ga0466961_0013279 | Ga0466961_0013279_1129_2028 | 294 |
| 934 | 3300044693 | Ga0466961_0134553 | Ga0466961_0134553_316_1227 | 294 |
| 935 | 3300044694 | Ga0466963_0063032 | Ga0466963_0063032_177_1076 | 294 |
| 936 | 3300044706 | Ga0466964_0069989 | Ga0466964_0069989_376_1275 | 294 |
| 937 | 3300044842 | Ga0466957_0078189 | Ga0466957_0078189_180_1079 | 294 |
| 938 | 3300044901 | Ga0466960_0054179 | Ga0466960_0054179_286_1197 | 294 |
| 939 | 3300045976 | Ga0466967_0005879 | Ga0466967_0005879_4034_4933 | 294 |
| 940 | 3300061719 | Ga0466962_0021274 | Ga0466962_0021274_490_1389 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4o6r-assembly1.cif.gz_D | crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia | 0.9595 | 15 | 260 |
| 6mvs-assembly1.cif.gz_A | structure of a bacterial aldh16 complexed with nad | 0.9564 | 10 | 293 |
| 6mvu-assembly1.cif.gz_A | structure of a bacterial aldh16 active site mutant c295a complexed with p-nitrophenylacetate | 0.9549 | 10 | 294 |
| 4nmk-assembly3.cif.gz_F | thermostable aldehyde dehydrogenase from pyrobaculum sp. crystallized in microgravity (complex with nadp+) | 0.9532 | 15 | 260 |
| 1zum-assembly3.cif.gz_L | human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form | 0.9522 | 15 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1QGP1_508_771_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9693 | 10 | 264 | 3.40.605.10 |
| af_A0A0R0ESV8_56_300_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9538 | 15 | 235 | 3.40.605.10 |
| af_Q9URW9_34_486_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9508 | 30 | 260 | 3.40.605.10 |
| af_O33340_2_231_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9489 | 30 | 264 | 3.40.605.10 |
| af_O33340_2_445_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9454 | 30 | 260 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1N7ABV7-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9746 | 6 | 294 |
GO:0016491
|
| AF-B5GSY3-F1-model_v4 | deleted | 0.9722 | 1 | 293 |
|
| AF-A0A6N3JYY5-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9715 | 8 | 294 |
GO:0016491
|
| AF-A0A3S2A0W8-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9707 | 34 | 221 |
GO:0016491
|
| AF-A0A1N7ABV7-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9676 | 6 | 294 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar