F486320

General Info

Members Datasets Scaffolds Average Seq Length
940 399 898 290

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0323707|Ga0496114_0323707_153_1166
Length 337
Sequence MPDRKRPAAGPTAAGKTGKTTSGSGQTKMRGGRAADRAAVRADAGGDGPVGGASARVGVRKTYKLFIGGAFPRSESGRSYPAAGPDGAVLAHVAMASRKDARDAVVAARKAVAGWAGATAYNRGQVLYRVAELLQGRAAQFTAESVANEGVSRAEAERAVTEAIDRWVWYAGWPDKVAQVTGSANAVAGPYFNFSVPEPTGVVAVTAPATPGLLXXXSVLAPVIATGNTAVVVASESVPLPAVTLAEVLATSDVPPGVVNILTGRTAELAPVLAAHMDVNAIDLTGADVADRAGLARMAAGNVKRVLVSDDDWAAPPGPERMLAFLEIKTVWHPIGI

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2643221561 Nocardioides sp. Root151 Isolate Unclassified
4 2643221575 Microbacterium sp. Root61 Isolate Unclassified
5 2643221576 Nocardioides sp. Root614 Isolate Unclassified
6 2643221590 Nocardioides sp. Root682 Isolate Unclassified
7 2643221604 Nocardioides sp. Root190 Isolate Unclassified
8 2643221615 Nocardioides sp. Root224 Isolate Unclassified
9 2643221617 Nocardioides sp. Root79 Isolate Unclassified
10 2643221620 Nocardioides sp. Root240 Isolate Unclassified
11 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
12 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
13 2643221696 Nocardioides sp. Root140 Isolate Unclassified
14 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
15 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
16 2738541305 Nocardioides sp. CF167 Isolate Unclassified
17 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
18 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
19 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
20 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
21 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
22 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
23 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
24 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
25 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
26 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
27 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
28 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
29 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
30 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
31 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
32 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
33 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
34 2891562705 Microbispora tritici MT50 Isolate Unclassified
35 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
36 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
37 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
38 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
39 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
187 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
194 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
217 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
220 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
221 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
242 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
252 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
253 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
254 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
255 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
256 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
257 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
260 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
281 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
284 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
318 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
369 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
370 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
384 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
385 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
386 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
387 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
388 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
389 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
390 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
391 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
396 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
397 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
398 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
399 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.21
Metatranscriptomes 0.32
Isolates 4.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 5.43
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005976 3300000549 Bacteria 1526
2 JGI24740J21852_10016753 3300001979 Bacteria 2639
3 JGI24739J22299_10007674 3300001989 Bacteria 4035
4 JGI24737J22298_10016265 3300001990 Bacteria 2402
5 JGI24737J22298_10017067 3300001990 Bacteria 2340
6 rootH2_10000702 3300003320 Bacteria 98192
7 rootL2_10287462 3300003322 Unclassified 2603
8 JGI25407J50210_10002761 3300003373 Bacteria 4176
9 JGI25407J50210_10019322 3300003373 Bacteria 1771
10 JGI25404J52841_10001883 3300003659 Bacteria 3835
11 Ga0070690_100026408 3300005330 Bacteria 3582
12 Ga0068869_100009393 3300005334 Bacteria 6346
13 Ga0070680_100135656 3300005336 Bacteria 2061
14 Ga0070682_100035175 3300005337 Bacteria 3056
15 Ga0068868_100085051 3300005338 Bacteria 2541
16 Ga0070660_100246681 3300005339 Bacteria 1455
17 Ga0070691_10012141 3300005341 Bacteria 3944
18 Ga0070691_10045492 3300005341 Bacteria 2083
19 Ga0070661_100000480 3300005344 Bacteria 30486
20 Ga0070661_100015487 3300005344 Bacteria 5381
21 Ga0070661_100181116 3300005344 Bacteria 1603
22 Ga0070661_100266859 3300005344 Bacteria 1324
23 Ga0070668_100113809 3300005347 Bacteria 2156
24 Ga0070668_100497742 3300005347 Bacteria 1055
25 Ga0070675_100000194 3300005354 Bacteria 38282
26 Ga0070671_100006642 3300005355 Bacteria 9247
27 Ga0070673_100011497 3300005364 Bacteria 6043
28 Ga0070688_100364111 3300005365 Bacteria 1062
29 Ga0070659_100009047 3300005366 Bacteria 7309
30 Ga0070667_100061147 3300005367 Bacteria 3188
31 Ga0070709_10000166 3300005434 Bacteria 41674
32 Ga0070709_10002090 3300005434 Bacteria 10810
33 Ga0070709_10007326 3300005434 Bacteria 6046
34 Ga0070714_100001331 3300005435 Bacteria 17836
35 Ga0070714_100003333 3300005435 Bacteria 11978
36 Ga0070714_100030237 3300005435 Bacteria 4506
37 Ga0070714_100140973 3300005435 Bacteria 2164
38 Ga0070713_100000050 3300005436 Bacteria 73746
39 Ga0070713_100139436 3300005436 Bacteria 2146
40 Ga0070713_100197947 3300005436 Bacteria 1813
41 Ga0070713_100217465 3300005436 Bacteria 1732
42 Ga0070713_100289161 3300005436 Bacteria 1506
43 Ga0070710_10000055 3300005437 Bacteria 51746
44 Ga0070710_10000435 3300005437 Bacteria 19546
45 Ga0070710_10006989 3300005437 Bacteria 5444
46 Ga0070711_100027816 3300005439 Bacteria 3715
47 Ga0070705_100061937 3300005440 Bacteria 2225
48 Ga0070705_100074217 3300005440 Bacteria 2067
49 Ga0070694_100096640 3300005444 Bacteria 2082
50 Ga0070708_100011223 3300005445 Bacteria 7285
51 Ga0070708_100041831 3300005445 Bacteria 4019
52 Ga0070708_100249986 3300005445 Bacteria 1666
53 Ga0070663_100031164 3300005455 Bacteria 3663
54 Ga0070663_100409800 3300005455 Bacteria 1110
55 Ga0070678_100058966 3300005456 Bacteria 2819
56 Ga0070662_100177105 3300005457 Bacteria 1679
57 Ga0070681_10043195 3300005458 Bacteria 4516
58 Ga0070706_100009721 3300005467 Bacteria 8939
59 Ga0070706_100048728 3300005467 Bacteria 3910
60 Ga0070706_100054511 3300005467 Bacteria 3690
61 Ga0070706_100095470 3300005467 Bacteria 2760
62 Ga0070706_100175291 3300005467 Bacteria 2002
63 Ga0070707_100000473 3300005468 Bacteria 39809
64 Ga0070707_100005848 3300005468 Bacteria 11466
65 Ga0070707_100012394 3300005468 Bacteria 7961
66 Ga0070707_100025347 3300005468 Bacteria 5625
67 Ga0070707_100033209 3300005468 Bacteria 4919
68 Ga0070707_100080778 3300005468 Bacteria 3138
69 Ga0070707_100083675 3300005468 Bacteria 3083
70 Ga0070707_100166643 3300005468 Bacteria 2147
71 Ga0070698_100002837 3300005471 Bacteria 19066
72 Ga0070698_100014157 3300005471 Bacteria 8432
73 Ga0070698_100033301 3300005471 Bacteria 5337
74 Ga0070698_100467157 3300005471 Bacteria 1198
75 Ga0070699_100018579 3300005518 Bacteria 5972
76 Ga0070699_100102561 3300005518 Bacteria 2508
77 Ga0070679_100503694 3300005530 Bacteria 1155
78 Ga0070684_100053587 3300005535 Bacteria 3512
79 Ga0070684_100451804 3300005535 Bacteria 1188
80 Ga0070697_100008951 3300005536 Bacteria 7823
81 Ga0070697_100042029 3300005536 Bacteria 3700
82 Ga0070697_100196145 3300005536 Bacteria 1715
83 Ga0070686_100436560 3300005544 Bacteria 1003
84 Ga0070665_100071319 3300005548 Bacteria 3481
85 Ga0070704_100253445 3300005549 Bacteria 1446
86 Ga0068855_100011645 3300005563 Bacteria 10629
87 Ga0068855_100270937 3300005563 Bacteria 1888
88 Ga0070664_100065548 3300005564 Bacteria 3099
89 Ga0070664_100085300 3300005564 Bacteria 2727
90 Ga0068857_100036375 3300005577 Bacteria 4362
91 Ga0068857_100121210 3300005577 Bacteria 2354
92 Ga0068857_100145383 3300005577 Bacteria 2145
93 Ga0068857_100466054 3300005577 Bacteria 1183
94 Ga0068857_100510562 3300005577 Bacteria 1129
95 Ga0068856_100085687 3300005614 Bacteria 3130
96 Ga0068852_100049783 3300005616 Bacteria 3586
97 Ga0068852_100371802 3300005616 Bacteria 1401
98 Ga0068852_100469305 3300005616 Bacteria 1249
99 Ga0068859_100126037 3300005617 Bacteria 2629
100 Ga0068864_100095816 3300005618 Bacteria 2625
101 Ga0068864_100173229 3300005618 Bacteria 1969
102 Ga0068866_10014385 3300005718 Bacteria 3494
103 Ga0068861_100171327 3300005719 Bacteria 1799
104 Ga0068863_100130608 3300005841 Bacteria 2398
105 Ga0068863_100223657 3300005841 Bacteria 1814
106 Ga0068863_100521651 3300005841 Bacteria 1171
107 Ga0068858_100000281 3300005842 Bacteria 54790
108 Ga0068858_100498075 3300005842 Bacteria 1177
109 Ga0068860_100000286 3300005843 Bacteria 71981
110 Ga0068860_100123657 3300005843 Bacteria 2479
111 Ga0068862_100114172 3300005844 Bacteria 2374
112 Ga0081455_10007241 3300005937 Bacteria 11718
113 Ga0081455_10008314 3300005937 Bacteria 10812
114 Ga0081455_10080099 3300005937 Bacteria 2679
115 Ga0081538_10000079 3300005981 Bacteria 92419
116 Ga0081538_10001977 3300005981 Bacteria 20499
117 Ga0081538_10003089 3300005981 Bacteria 15834
118 Ga0081540_1000134 3300005983 Bacteria 79126
119 Ga0081540_1000527 3300005983 Bacteria 37363
120 Ga0081539_10000356 3300005985 Bacteria 100748
121 Ga0070717_10000775 3300006028 Bacteria 20918
122 Ga0070717_10003709 3300006028 Bacteria 10978
123 Ga0070717_10073250 3300006028 Bacteria 2862
124 Ga0070717_10083758 3300006028 Bacteria 2682
125 Ga0070717_10515540 3300006028 Bacteria 1081
126 Ga0075365_10118382 3300006038 Bacteria 1825
127 Ga0075364_10065617 3300006051 Bacteria 2383
128 Ga0070715_10037300 3300006163 Bacteria 2011
129 Ga0070715_10049194 3300006163 Bacteria 1805
130 Ga0070716_100000268 3300006173 Bacteria 20929
131 Ga0070716_100052078 3300006173 Bacteria 2330
132 Ga0070712_100012392 3300006175 Bacteria 5418
133 Ga0070712_100089727 3300006175 Bacteria 2249
134 Ga0075428_100000669 3300006844 Bacteria 35178
135 Ga0075428_100024987 3300006844 Bacteria 6610
136 Ga0075428_100071186 3300006844 Bacteria 3801
137 Ga0075428_100120061 3300006844 Bacteria 2862
138 Ga0075428_100121027 3300006844 Bacteria 2850
139 Ga0075428_100751413 3300006844 Bacteria 1038
140 Ga0075430_100003905 3300006846 Bacteria 12567
141 Ga0075430_100008412 3300006846 Bacteria 8714
142 Ga0075430_100020627 3300006846 Bacteria 5605
143 Ga0075430_100066631 3300006846 Bacteria 3024
144 Ga0075431_100000513 3300006847 Bacteria 32457
145 Ga0075431_100022199 3300006847 Bacteria 6490
146 Ga0075431_100242950 3300006847 Bacteria 1831
147 Ga0075429_100005589 3300006880 Bacteria 10838
148 Ga0075429_100012802 3300006880 Bacteria 7276
149 Ga0075429_100059512 3300006880 Bacteria 3328
150 Ga0075429_100392746 3300006880 Bacteria 1215
151 Ga0097620_100126036 3300006931 Bacteria 2629
152 Ga0099794_10033229 3300007265 Bacteria 2425
153 Ga0105251_10046492 3300009011 Bacteria 2088
154 Ga0105240_10008130 3300009093 Bacteria 15050
155 Ga0105240_10542480 3300009093 Bacteria 1288
156 Ga0111539_10008303 3300009094 Bacteria 13217
157 Ga0111539_10031916 3300009094 Bacteria 6398
158 Ga0111539_10270344 3300009094 Bacteria 1978
159 Ga0114129_10000001 3300009147 Bacteria 292978
160 Ga0114129_10000011 3300009147 Bacteria 139000
161 Ga0114129_10000201 3300009147 Bacteria 66395
162 Ga0114129_10075261 3300009147 Bacteria 4701
163 Ga0114129_10268023 3300009147 Bacteria 2286
164 Ga0114129_10321087 3300009147 Bacteria 2058
165 Ga0114129_10457866 3300009147 Bacteria 1672
166 Ga0105243_10043334 3300009148 Bacteria 3527
167 Ga0105243_10070227 3300009148 Bacteria 2827
168 Ga0105241_10032699 3300009174 Bacteria 3902
169 Ga0105241_10248435 3300009174 Bacteria 1507
170 Ga0105248_10058674 3300009177 Bacteria 4322
171 Ga0105248_10131729 3300009177 Bacteria 2821
172 Ga0105248_10256882 3300009177 Bacteria 1967
173 Ga0105237_10477996 3300009545 Bacteria 1252
174 Ga0105238_10152672 3300009551 Bacteria 2284
175 Ga0105249_10208698 3300009553 Bacteria 1915
176 Ga0105249_10381417 3300009553 Bacteria 1436
177 Ga0105239_10070091 3300010375 Bacteria 3851
178 Ga0105239_10190656 3300010375 Bacteria 2295
179 Ga0105239_10227730 3300010375 Bacteria 2091
180 Ga0105239_10485530 3300010375 Bacteria 1404
181 Ga0157371_10050131 3300013102 Bacteria 2966
182 Ga0157370_10009280 3300013104 Bacteria 10536
183 Ga0157370_10167967 3300013104 Bacteria 2040
184 Ga0157369_10010406 3300013105 Bacteria 10601
185 Ga0157374_10067450 3300013296 Bacteria 3364
186 Ga0157374_10617566 3300013296 Bacteria 1095
187 Ga0157375_10067949 3300013308 Bacteria 3563
188 Ga0157375_10090494 3300013308 Bacteria 3119
189 Ga0157375_10097559 3300013308 Bacteria 3014
190 Ga0157375_10282254 3300013308 Bacteria 1824
191 Ga0157375_10553806 3300013308 Bacteria 1312
192 Ga0163163_10017213 3300014325 Bacteria 6735
193 Ga0163163_10359165 3300014325 Bacteria 1513
194 Ga0157380_10108755 3300014326 Bacteria 2325
195 Ga0157380_10202063 3300014326 Bacteria 1764
196 Ga0157377_10033019 3300014745 Bacteria 2822
197 Ga0157377_10077392 3300014745 Bacteria 1937
198 Ga0157376_10044321 3300014969 Bacteria 3656
199 Ga0157376_10232731 3300014969 Bacteria 1712
200 Ga0206354_11271448 3300020081 Bacteria 1564
201 Ga0206353_10299334 3300020082 Bacteria 2344
202 Ga0213875_10001293 3300021388 Bacteria 16668
203 Ga0213875_10010004 3300021388 Bacteria 4772
204 Ga0207713_1043258 3300025735 Bacteria 1862
205 Ga0207653_10003493 3300025885 Bacteria 4950
206 Ga0207692_10000027 3300025898 Bacteria 50108
207 Ga0207692_10001629 3300025898 Bacteria 8474
208 Ga0207692_10012248 3300025898 Bacteria 3679
209 Ga0207688_10004893 3300025901 Bacteria 7291
210 Ga0207688_10251284 3300025901 Bacteria 1071
211 Ga0207680_10089396 3300025903 Bacteria 1955
212 Ga0207647_10005178 3300025904 Bacteria 9594
213 Ga0207685_10005407 3300025905 Bacteria 3369
214 Ga0207699_10000102 3300025906 Bacteria 61110
215 Ga0207699_10001301 3300025906 Bacteria 11864
216 Ga0207699_10001338 3300025906 Bacteria 11705
217 Ga0207699_10004405 3300025906 Bacteria 6732
218 Ga0207699_10026106 3300025906 Bacteria 3215
219 Ga0207645_10067759 3300025907 Bacteria 2281
220 Ga0207643_10249953 3300025908 Bacteria 1092
221 Ga0207684_10006576 3300025910 Bacteria 10578
222 Ga0207684_10045994 3300025910 Bacteria 3703
223 Ga0207684_10072295 3300025910 Bacteria 2929
224 Ga0207654_10168434 3300025911 Bacteria 1421
225 Ga0207671_10136889 3300025914 Bacteria 1884
226 Ga0207693_10015690 3300025915 Bacteria 6071
227 Ga0207693_10058853 3300025915 Bacteria 3010
228 Ga0207693_10071822 3300025915 Bacteria 2710
229 Ga0207693_10109391 3300025915 Bacteria 2168
230 Ga0207663_10000170 3300025916 Bacteria 29272
231 Ga0207663_10008646 3300025916 Bacteria 5341
232 Ga0207663_10015017 3300025916 Bacteria 4261
233 Ga0207663_10139798 3300025916 Bacteria 1685
234 Ga0207663_10262990 3300025916 Bacteria 1275
235 Ga0207660_10172610 3300025917 Bacteria 1674
236 Ga0207662_10014842 3300025918 Bacteria 4376
237 Ga0207657_10015632 3300025919 Bacteria 7343
238 Ga0207657_10055424 3300025919 Bacteria 3424
239 Ga0207649_10009851 3300025920 Bacteria 5239
240 Ga0207649_10124469 3300025920 Bacteria 1742
241 Ga0207652_10279136 3300025921 Bacteria 1507
242 Ga0207646_10000511 3300025922 Bacteria 51827
243 Ga0207646_10023876 3300025922 Bacteria 5610
244 Ga0207646_10030107 3300025922 Bacteria 4923
245 Ga0207646_10040503 3300025922 Bacteria 4189
246 Ga0207646_10044676 3300025922 Bacteria 3976
247 Ga0207694_10118387 3300025924 Bacteria 2113
248 Ga0207659_10009797 3300025926 Bacteria 5995
249 Ga0207687_10317176 3300025927 Bacteria 1261
250 Ga0207700_10000029 3300025928 Bacteria 132615
251 Ga0207700_10001082 3300025928 Bacteria 15685
252 Ga0207700_10005259 3300025928 Bacteria 7716
253 Ga0207700_10052683 3300025928 Bacteria 3044
254 Ga0207700_10108037 3300025928 Bacteria 2233
255 Ga0207700_10108358 3300025928 Bacteria 2230
256 Ga0207700_10237261 3300025928 Bacteria 1553
257 Ga0207700_10272069 3300025928 Bacteria 1454
258 Ga0207664_10000168 3300025929 Bacteria 52834
259 Ga0207664_10001827 3300025929 Bacteria 14040
260 Ga0207664_10016562 3300025929 Bacteria 5381
261 Ga0207664_10021473 3300025929 Bacteria 4802
262 Ga0207664_10114621 3300025929 Bacteria 2246
263 Ga0207664_10134886 3300025929 Bacteria 2082
264 Ga0207664_10154325 3300025929 Bacteria 1953
265 Ga0207664_10160820 3300025929 Bacteria 1915
266 Ga0207690_10464201 3300025932 Bacteria 1019
267 Ga0207706_10011538 3300025933 Bacteria 8046
268 Ga0207709_10170719 3300025935 Bacteria 1526
269 Ga0207665_10000144 3300025939 Bacteria 48077
270 Ga0207665_10004667 3300025939 Bacteria 9103
271 Ga0207665_10005206 3300025939 Bacteria 8686
272 Ga0207665_10112795 3300025939 Bacteria 1912
273 Ga0207689_10015828 3300025942 Bacteria 6387
274 Ga0207689_10025438 3300025942 Bacteria 4961
275 Ga0207667_10148464 3300025949 Bacteria 2413
276 Ga0207667_10212294 3300025949 Bacteria 1984
277 Ga0207651_10036600 3300025960 Bacteria 3206
278 Ga0207712_10150252 3300025961 Bacteria 1798
279 Ga0207712_10265669 3300025961 Bacteria 1393
280 Ga0207668_10147583 3300025972 Bacteria 1817
281 Ga0207677_10072190 3300026023 Bacteria 2439
282 Ga0207703_10000173 3300026035 Bacteria 75642
283 Ga0207678_10021601 3300026067 Bacteria 5643
284 Ga0207678_10046428 3300026067 Bacteria 3755
285 Ga0207708_10007803 3300026075 Bacteria 7925
286 Ga0207702_10121496 3300026078 Bacteria 2338
287 Ga0207641_10480173 3300026088 Bacteria 1204
288 Ga0207648_10063057 3300026089 Bacteria 3231
289 Ga0207676_10147933 3300026095 Bacteria 2019
290 Ga0207676_10159132 3300026095 Bacteria 1954
291 Ga0207674_10004069 3300026116 Bacteria 17718
292 Ga0207674_10034596 3300026116 Bacteria 5280
293 Ga0207674_10551941 3300026116 Bacteria 1113
294 Ga0207675_100013930 3300026118 Bacteria 7495
295 Ga0207683_10003655 3300026121 Bacteria 13377
296 Ga0207683_10133058 3300026121 Bacteria 2237
297 Ga0207698_10136154 3300026142 Bacteria 2108
298 Ga0207698_10175189 3300026142 Bacteria 1893
299 Ga0207698_10236897 3300026142 Bacteria 1661
300 Ga0207698_10585941 3300026142 Bacteria 1098
301 Ga0207428_10036811 3300027907 Bacteria 3987
302 Ga0268265_10143532 3300028380 Bacteria 2002
303 Ga0268264_10000246 3300028381 Bacteria 102361
304 Ga0268264_10104010 3300028381 Bacteria 2474
305 Ga0268264_10195866 3300028381 Bacteria 1845
306 Ga0265334_10012852 3300028573 Bacteria 3511
307 Ga0265318_10014087 3300028577 Bacteria 3361
308 Ga0307515_10284834 3300028794 Bacteria 1355
309 Ga0265338_10008735 3300028800 Bacteria 12248
310 Ga0265338_10028796 3300028800 Bacteria 5529
311 Ga0265324_10026005 3300029957 Bacteria 2072
312 Ga0307511_10058350 3300030521 Bacteria 2984
313 Ga0307511_10066119 3300030521 Bacteria 2697
314 Ga0307512_10155660 3300030522 Bacteria 1353
315 Ga0316180_1176821 3300030736 Bacteria 1977
316 Ga0265320_10002133 3300031240 Bacteria 13874
317 Ga0265325_10047288 3300031241 Bacteria 2227
318 Ga0265340_10004044 3300031247 Bacteria 8239
319 Ga0265340_10044288 3300031247 Bacteria 2177
320 Ga0265331_10022587 3300031250 Bacteria 3209
321 Ga0307513_10039124 3300031456 Bacteria 5259
322 Ga0307513_10068521 3300031456 Bacteria 3716
323 Ga0307513_10231929 3300031456 Bacteria 1658
324 Ga0307513_10339587 3300031456 Bacteria 1253
325 Ga0307509_10081585 3300031507 Bacteria 3340
326 Ga0265342_10023010 3300031712 Bacteria 3951
327 Ga0265342_10025071 3300031712 Bacteria 3756
328 Ga0316576_10029277 3300031727 Bacteria 3891
329 Ga0316576_10034208 3300031727 Bacteria 3621
330 Ga0316578_10040255 3300031728 Bacteria 2701
331 Ga0307405_10120116 3300031731 Bacteria 1797
332 Ga0307405_10257355 3300031731 Bacteria 1302
333 Ga0307405_10442443 3300031731 Bacteria 1028
334 Ga0307413_10136855 3300031824 Bacteria 1686
335 Ga0307413_10237553 3300031824 Bacteria 1343
336 Ga0307518_10133220 3300031838 Bacteria 1744
337 Ga0307410_10117772 3300031852 Bacteria 1932
338 Ga0307406_10065726 3300031901 Bacteria 2358
339 Ga0307407_10058484 3300031903 Bacteria 2241
340 Ga0307407_10393583 3300031903 Bacteria 992
341 Ga0307409_100043096 3300031995 Bacteria 3385
342 Ga0307409_100062491 3300031995 Bacteria 2916
343 Ga0307416_100007146 3300032002 Bacteria 7062
344 Ga0307416_100068131 3300032002 Bacteria 2939
345 Ga0307416_100355555 3300032002 Bacteria 1484
346 Ga0307414_10333488 3300032004 Bacteria 1296
347 Ga0307411_10011700 3300032005 Bacteria 4751
348 Ga0307415_100006044 3300032126 Bacteria 6488
349 Ga0307415_100060691 3300032126 Bacteria 2614
350 Ga0307415_100162331 3300032126 Bacteria 1733
351 Ga0307507_10159938 3300033179 Bacteria 1667
352 Ga0373926_0000029 3300035083 Bacteria 23191
353 Ga0373926_0006978 3300035083 Bacteria 3756
354 Ga0373928_0015343 3300035084 Bacteria 1559
355 Ga0373929_0002535 3300035085 Bacteria 3356
356 Ga0373929_0033552 3300035085 Bacteria 1110
357 Ga0373934_0000049 3300035086 Bacteria 40994
358 Ga0373934_0005406 3300035086 Bacteria 4730
359 Ga0373934_0011263 3300035086 Bacteria 3365
360 Ga0373934_0017411 3300035086 Bacteria 2743
361 Ga0373940_0003437 3300035088 Bacteria 3234
362 Ga0373944_0000419 3300035089 Bacteria 9698
363 Ga0373944_0000803 3300035089 Bacteria 7680
364 Ga0373949_0013294 3300035090 Bacteria 1824
365 Ga0373923_0001569 3300035111 Bacteria 6627
366 Ga0373923_0007640 3300035111 Bacteria 3814
367 Ga0373923_0015623 3300035111 Bacteria 2869
368 Ga0373923_0029737 3300035111 Bacteria 2192
369 Ga0373936_0000433 3300035113 Bacteria 13986
370 Ga0373936_0024453 3300035113 Bacteria 2358
371 Ga0373936_0028672 3300035113 Bacteria 2189
372 Ga0373945_0000686 3300035116 Bacteria 9775
373 Ga0373953_0000067 3300035117 Bacteria 25799
374 Ga0373953_0004314 3300035117 Bacteria 4524
375 Ga0373953_0006688 3300035117 Bacteria 3814
376 Ga0373954_0049417 3300035118 Bacteria 1972
377 Ga0373956_0000086 3300035119 Bacteria 31023
378 Ga0373956_0002433 3300035119 Bacteria 7584
379 Ga0373956_0018268 3300035119 Bacteria 2967
380 Ga0373956_0029484 3300035119 Bacteria 2394
381 Ga0373956_0048891 3300035119 Bacteria 1895
382 Ga0373957_0000632 3300035120 Bacteria 9005
383 Ga0373957_0012190 3300035120 Bacteria 2888
384 Ga0373957_0017544 3300035120 Bacteria 2495
385 Ga0373943_0000683 3300035170 Bacteria 14797
386 Ga0373946_0000547 3300035171 Bacteria 12448
387 Ga0373946_0001780 3300035171 Bacteria 7510
388 Ga0373946_0034533 3300035171 Bacteria 2042
389 Ga0373955_0000252 3300035172 Bacteria 22257
390 Ga0373955_0013081 3300035172 Bacteria 4002
391 Ga0373955_0030358 3300035172 Bacteria 2821
392 Ga0373955_0030668 3300035172 Bacteria 2809
393 Ga0373942_0002413 3300035207 Bacteria 4537
394 Ga0373942_0009261 3300035207 Bacteria 2302
395 Ga0373962_0015047 3300035242 Bacteria 1979
396 Ga0316574_0038258 3300035398 Bacteria 2945
397 Ga0373924_0001613 3300035410 Bacteria 7398
398 Ga0373924_0002829 3300035410 Bacteria 5875
399 Ga0373935_0001279 3300035692 Bacteria 13858
400 Ga0373935_0004514 3300035692 Bacteria 8181
401 Ga0373935_0075877 3300035692 Bacteria 2175
402 Ga0373935_0317921 3300035692 Bacteria 1104
403 Ga0373935_0372596 3300035692 Bacteria 1021
404 Ga0373927_0005059 3300035695 Bacteria 9125
405 Ga0373927_0008697 3300035695 Bacteria 6822
406 Ga0373933_0000051 3300035724 Bacteria 71384
407 Ga0373933_0002841 3300035724 Bacteria 9670
408 Ga0373933_0050651 3300035724 Bacteria 2479
409 Ga0373933_0072236 3300035724 Bacteria 2101
410 Ga0373947_0001901 3300035725 Bacteria 12758
411 Ga0373947_0006626 3300035725 Bacteria 6723
412 Ga0373947_0104227 3300035725 Bacteria 1785
413 Ga0373937_0000289 3300036401 Bacteria 47874
414 Ga0373937_0009894 3300036401 Bacteria 8313
415 Ga0373937_0058844 3300036401 Bacteria 3530
416 Ga0373937_0132729 3300036401 Bacteria 2326
417 Ga0373937_0150534 3300036401 Bacteria 2179
418 Ga0316582_0218837 3300036647 Bacteria 1302
419 Ga0316584_0175662 3300036712 Bacteria 1587
420 Ga0373925_0004633 3300037068 Bacteria 10380
421 Ga0373925_0006032 3300037068 Bacteria 8967
422 Ga0373925_0013709 3300037068 Bacteria 5868
423 Ga0373925_0098291 3300037068 Bacteria 2246
424 Ga0395900_0007194 3300037418 Bacteria 11535
425 Ga0395900_0040121 3300037418 Bacteria 4824
426 Ga0395898_0154761 3300037466 Bacteria 2193
427 Ga0395898_0213776 3300037466 Bacteria 1839
428 Ga0436364_0087476 3300037853 Bacteria 47044
429 Ga0436364_0687768 3300037853 Bacteria 4381
430 Ga0436364_0883803 3300037853 Bacteria 2258
431 Ga0436364_0997648 3300037853 Bacteria 2735
432 Ga0436364_1326662 3300037853 Bacteria 39324
433 Ga0436364_1333729 3300037853 Bacteria 3764
434 Ga0395901_0018699 3300038443 Bacteria 7077
435 Ga0395901_0147008 3300038443 Bacteria 2477
436 Ga0436363_0342702 3300039450 Bacteria 1419
437 Ga0436363_0362663 3300039450 Bacteria 1217
438 Ga0451802_0807064 3300041460 Bacteria 2239
439 Ga0451853_1399455 3300041512 Bacteria 9982
440 Ga0439448_0001608 3300042005 Bacteria 5919
441 Ga0439449_0068540 3300042007 Bacteria 1308
442 Ga0439450_000461 3300042008 Bacteria 5286
443 Ga0439463_005356 3300042016 Bacteria 3186
444 Ga0439464_0001366 3300042439 Bacteria 5717
445 Ga0439460_0002958 3300042461 Bacteria 4093
446 Ga0439440_0002719 3300042993 Bacteria 3357
447 Ga0466969_0028088 3300044656 Bacteria 2876
448 Ga0466972_0003345 3300044658 Bacteria 7949
449 Ga0466965_0010442 3300044683 Bacteria 4331
450 Ga0466966_0003582 3300044684 Bacteria 10251
451 Ga0466966_0068692 3300044684 Bacteria 2224
452 Ga0466961_0006845 3300044693 Bacteria 7252
453 Ga0466961_0013279 3300044693 Bacteria 5270
454 Ga0466961_0054516 3300044693 Bacteria 2550
455 Ga0466961_0064737 3300044693 Bacteria 2323
456 Ga0466961_0105346 3300044693 Bacteria 1775
457 Ga0466961_0134553 3300044693 Bacteria 1549
458 Ga0466961_0293804 3300044693 Bacteria 993
459 Ga0466963_0063032 3300044694 Bacteria 2480
460 Ga0466963_0099909 3300044694 Bacteria 1985
461 Ga0466963_0227764 3300044694 Bacteria 1306
462 Ga0466964_0069989 3300044706 Bacteria 1481
463 Ga0466971_0001527 3300044719 Bacteria 9761
464 Ga0466971_0112252 3300044719 Bacteria 1258
465 Ga0466970_0020427 3300044765 Bacteria 3441
466 Ga0466970_0088990 3300044765 Bacteria 1674
467 Ga0466957_0020618 3300044842 Bacteria 3879
468 Ga0466957_0078189 3300044842 Bacteria 2056
469 Ga0466957_0124251 3300044842 Bacteria 1647
470 Ga0466960_0021272 3300044901 Bacteria 2885
471 Ga0466960_0054179 3300044901 Bacteria 1947
472 Ga0466960_0085367 3300044901 Bacteria 1599
473 Ga0466959_0001241 3300045049 Bacteria 15410
474 Ga0466959_0006690 3300045049 Bacteria 8016
475 Ga0466958_0009913 3300045836 Bacteria 5321
476 Ga0466958_0029434 3300045836 Bacteria 3259
477 Ga0466958_0126851 3300045836 Bacteria 1600
478 Ga0466967_0005879 3300045976 Bacteria 8590
479 Ga0466967_0084313 3300045976 Bacteria 2875
480 Ga0466967_0174812 3300045976 Bacteria 2023
481 Ga0466967_0470667 3300045976 Bacteria 1230
482 Ga0466967_0501596 3300045976 Bacteria 1191
483 Ga0495592_0000111 3300046454 Bacteria 71400
484 Ga0495592_0023301 3300046454 Bacteria 4708
485 Ga0495592_0037269 3300046454 Bacteria 3661
486 Ga0495592_0071860 3300046454 Bacteria 2518
487 Ga0495592_0072184 3300046454 Bacteria 2511
488 Ga0495629_0009160 3300046459 Bacteria 7248
489 Ga0495629_0147707 3300046459 Bacteria 1634
490 Ga0495641_0003333 3300046461 Bacteria 12083
491 Ga0495641_0003865 3300046461 Bacteria 10927
492 Ga0495641_0005398 3300046461 Bacteria 8649
493 Ga0495651_0000068 3300046462 Bacteria 76489
494 Ga0495651_0001532 3300046462 Bacteria 17873
495 Ga0495651_0002798 3300046462 Bacteria 13523
496 Ga0495651_0009060 3300046462 Bacteria 7638
497 Ga0495651_0086274 3300046462 Bacteria 2362
498 Ga0495651_0102771 3300046462 Bacteria 2124
499 Ga0495653_0002320 3300046463 Bacteria 15090
500 Ga0495653_0004725 3300046463 Bacteria 11029
501 Ga0495653_0005403 3300046463 Bacteria 10402
502 Ga0495653_0011639 3300046463 Bacteria 7182
503 Ga0495653_0037340 3300046463 Bacteria 3817
504 Ga0495653_0042432 3300046463 Bacteria 3543
505 Ga0495653_0102787 3300046463 Bacteria 2067
506 Ga0495653_0251618 3300046463 Bacteria 1172
507 Ga0495653_0279795 3300046463 Bacteria 1095
508 Ga0495580_0016862 3300046472 Bacteria 5477
509 Ga0495580_0089223 3300046472 Bacteria 2146
510 Ga0495580_0116311 3300046472 Bacteria 1857
511 Ga0495582_0001688 3300046473 Bacteria 12464
512 Ga0495582_0023358 3300046473 Bacteria 3383
513 Ga0495582_0035858 3300046473 Bacteria 2728
514 Ga0495639_0034447 3300046475 Bacteria 2265
515 Ga0495639_0045609 3300046475 Bacteria 1983
516 Ga0495639_0078151 3300046475 Bacteria 1537
517 Ga0495662_0000400 3300046476 Bacteria 19374
518 Ga0495662_0011429 3300046476 Bacteria 4339
519 Ga0495662_0063494 3300046476 Bacteria 1784
520 Ga0495662_0064706 3300046476 Bacteria 1767
521 Ga0495664_0003706 3300046477 Bacteria 8335
522 Ga0495664_0086409 3300046477 Bacteria 1884
523 Ga0495664_0122637 3300046477 Bacteria 1571
524 Ga0495664_0147728 3300046477 Bacteria 1426
525 Ga0495606_0001132 3300046507 Bacteria 37971
526 Ga0495608_0000160 3300046511 Bacteria 48626
527 Ga0495608_0001185 3300046511 Bacteria 18505
528 Ga0495608_0017087 3300046511 Bacteria 5021
529 Ga0495608_0019053 3300046511 Bacteria 4729
530 Ga0495618_0014041 3300046514 Bacteria 4876
531 Ga0495618_0025606 3300046514 Bacteria 3662
532 Ga0495618_0028042 3300046514 Bacteria 3508
533 Ga0495628_0000250 3300046516 Bacteria 47359
534 Ga0495628_0009279 3300046516 Bacteria 8407
535 Ga0495628_0011278 3300046516 Bacteria 7560
536 Ga0495628_0017244 3300046516 Bacteria 6013
537 Ga0495628_0025644 3300046516 Bacteria 4815
538 Ga0495628_0076978 3300046516 Bacteria 2595
539 Ga0495628_0214688 3300046516 Bacteria 1446
540 Ga0495630_0028635 3300046517 Bacteria 4139
541 Ga0495630_0071921 3300046517 Bacteria 2603
542 Ga0495630_0289393 3300046517 Bacteria 1252
543 Ga0495666_0005084 3300046526 Bacteria 6654
544 Ga0495666_0164184 3300046526 Bacteria 1029
545 Ga0495652_0000440 3300046529 Bacteria 48629
546 Ga0495652_0000860 3300046529 Bacteria 35013
547 Ga0495652_0016783 3300046529 Bacteria 6543
548 Ga0495652_0058582 3300046529 Bacteria 3260
549 Ga0495652_0095794 3300046529 Bacteria 2418
550 Ga0495652_0158990 3300046529 Bacteria 1756
551 Ga0495652_0229477 3300046529 Bacteria 1389
552 Ga0495665_0001375 3300046531 Bacteria 13014
553 Ga0495665_0035237 3300046531 Bacteria 2674
554 Ga0495665_0073112 3300046531 Bacteria 1805
555 Ga0495665_0140664 3300046531 Bacteria 1261
556 Ga0495640_0012101 3300046533 Bacteria 6608
557 Ga0495640_0016894 3300046533 Bacteria 5451
558 Ga0495640_0020018 3300046533 Bacteria 4932
559 Ga0495586_0014091 3300046535 Bacteria 4247
560 Ga0495586_0019800 3300046535 Bacteria 3583
561 Ga0495586_0083048 3300046535 Bacteria 1762
562 Ga0495587_0000056 3300046536 Bacteria 96726
563 Ga0495587_0004715 3300046536 Bacteria 8946
564 Ga0495587_0008582 3300046536 Bacteria 6568
565 Ga0495587_0015541 3300046536 Bacteria 4751
566 Ga0495587_0026209 3300046536 Bacteria 3556
567 Ga0495587_0077861 3300046536 Bacteria 1924
568 Ga0495645_0017763 3300046543 Bacteria 5101
569 Ga0495645_0040788 3300046543 Bacteria 3385
570 Ga0495645_0117053 3300046543 Bacteria 1880
571 Ga0495667_0000078 3300046559 Bacteria 71356
572 Ga0495667_0000947 3300046559 Bacteria 18764
573 Ga0495667_0004878 3300046559 Bacteria 9068
574 Ga0495667_0013303 3300046559 Bacteria 5570
575 Ga0495667_0019859 3300046559 Bacteria 4534
576 Ga0495667_0024606 3300046559 Bacteria 4055
577 Ga0495667_0025498 3300046559 Bacteria 3983
578 Ga0495667_0031900 3300046559 Bacteria 3533
579 Ga0495656_0026587 3300046615 Bacteria 2305
580 Ga0495668_0000615 3300046616 Bacteria 43050
581 Ga0495634_0004211 3300046642 Bacteria 11359
582 Ga0495634_0011704 3300046642 Bacteria 6380
583 Ga0495634_0034112 3300046642 Bacteria 3493
584 Ga0495634_0052817 3300046642 Bacteria 2723
585 Ga0495634_0141493 3300046642 Bacteria 1527
586 Ga0495634_0189990 3300046642 Bacteria 1281
587 Ga0495625_0023711 3300046660 Bacteria 4683
588 Ga0495635_0000244 3300046663 Bacteria 34527
589 Ga0495635_0001441 3300046663 Bacteria 15895
590 Ga0495635_0002316 3300046663 Bacteria 12947
591 Ga0495635_0018200 3300046663 Bacteria 4903
592 Ga0495635_0093358 3300046663 Bacteria 2057
593 Ga0495657_0000444 3300046675 Bacteria 38608
594 Ga0495657_0006066 3300046675 Bacteria 9487
595 Ga0495657_0006331 3300046675 Bacteria 9275
596 Ga0495657_0047671 3300046675 Bacteria 2895
597 Ga0495657_0090086 3300046675 Bacteria 1969
598 Ga0495599_0001783 3300046678 Bacteria 12482
599 Ga0495599_0006717 3300046678 Bacteria 6949
600 Ga0495599_0047684 3300046678 Bacteria 2685
601 Ga0495599_0055897 3300046678 Bacteria 2470
602 Ga0495623_0000209 3300046679 Bacteria 37387
603 Ga0495623_0034635 3300046679 Bacteria 3238
604 Ga0495623_0035576 3300046679 Bacteria 3191
605 Ga0495623_0080263 3300046679 Bacteria 2020
606 Ga0495623_0153858 3300046679 Bacteria 1357
607 Ga0495646_0004757 3300046680 Bacteria 8573
608 Ga0495646_0007692 3300046680 Bacteria 6846
609 Ga0495646_0008480 3300046680 Bacteria 6527
610 Ga0495646_0015185 3300046680 Bacteria 4891
611 Ga0495646_0020950 3300046680 Bacteria 4134
612 Ga0495646_0022028 3300046680 Bacteria 4022
613 Ga0495646_0022376 3300046680 Bacteria 3988
614 Ga0495658_0007983 3300046683 Bacteria 5242
615 Ga0495658_0012486 3300046683 Bacteria 4305
616 Ga0495613_0013631 3300046689 Bacteria 6033
617 Ga0495600_0004520 3300046809 Bacteria 8334
618 Ga0495600_0018370 3300046809 Bacteria 4455
619 Ga0495600_0050119 3300046809 Bacteria 2724
620 Ga0495600_0050668 3300046809 Bacteria 2709
621 Ga0495600_0100703 3300046809 Bacteria 1883
622 Ga0495581_0000947 3300047315 Bacteria 15594
623 Ga0495581_0012762 3300047315 Bacteria 4867
624 Ga0495581_0190917 3300047315 Bacteria 1198
625 Ga0495604_0000105 3300047317 Bacteria 71375
626 Ga0495604_0008628 3300047317 Bacteria 8057
627 Ga0495604_0009174 3300047317 Bacteria 7829
628 Ga0495604_0013304 3300047317 Bacteria 6552
629 Ga0495604_0030524 3300047317 Bacteria 4280
630 Ga0495674_0001098 3300047319 Bacteria 25960
631 Ga0495674_0016755 3300047319 Bacteria 6835
632 Ga0495674_0017493 3300047319 Bacteria 6671
633 Ga0495674_0023294 3300047319 Bacteria 5708
634 Ga0495674_0042198 3300047319 Bacteria 4070
635 Ga0495674_0076907 3300047319 Bacteria 2870
636 Ga0495674_0360765 3300047319 Bacteria 1178
637 Ga0495674_0376443 3300047319 Bacteria 1149
638 Ga0495676_0004908 3300047321 Bacteria 12269
639 Ga0495680_0000115 3300047322 Bacteria 76480
640 Ga0495680_0003508 3300047322 Bacteria 15385
641 Ga0495680_0005139 3300047322 Bacteria 12356
642 Ga0495680_0006180 3300047322 Bacteria 11167
643 Ga0495680_0036467 3300047322 Bacteria 3946
644 Ga0495680_0039803 3300047322 Bacteria 3747
645 Ga0495680_0100714 3300047322 Bacteria 2152
646 Ga0495683_0157084 3300047323 Bacteria 1054
647 Ga0495675_0001210 3300047444 Bacteria 15641
648 Ga0495675_0027223 3300047444 Bacteria 3643
649 Ga0495675_0036612 3300047444 Bacteria 3128
650 Ga0495684_0010668 3300047471 Bacteria 7103
651 Ga0495684_0038708 3300047471 Bacteria 3655
652 Ga0495684_0101890 3300047471 Bacteria 2170
653 Ga0495684_0175008 3300047471 Bacteria 1593
654 Ga0495593_0002762 3300047673 Bacteria 10557
655 Ga0495593_0042392 3300047673 Bacteria 2442
656 Ga0495602_0000114 3300048088 Bacteria 76491
657 Ga0495602_0031216 3300048088 Bacteria 5041
658 Ga0495602_0071836 3300048088 Bacteria 2954
659 Ga0495602_0088268 3300048088 Bacteria 2582
660 Ga0495614_0032918 3300048089 Bacteria 2230
661 Ga0495614_0058879 3300048089 Bacteria 1649
662 Ga0495626_0000127 3300048091 Bacteria 97134
663 Ga0496100_0006407 3300048903 Bacteria 6416
664 Ga0496100_0065444 3300048903 Bacteria 2408
665 Ga0496101_0035090 3300048904 Bacteria 3546
666 Ga0496101_0042784 3300048904 Bacteria 3234
667 Ga0496102_0092891 3300048905 Bacteria 2795
668 Ga0496102_0288078 3300048905 Bacteria 1548
669 Ga0496103_0021748 3300048906 Bacteria 3860
670 Ga0496104_0015206 3300048907 Bacteria 6967
671 Ga0496104_0030805 3300048907 Bacteria 4987
672 Ga0496104_0035885 3300048907 Bacteria 4632
673 Ga0496104_0065446 3300048907 Bacteria 3449
674 Ga0496104_0110537 3300048907 Bacteria 2635
675 Ga0496104_0161018 3300048907 Bacteria 2153
676 Ga0496104_0242339 3300048907 Bacteria 1715
677 Ga0496104_0284390 3300048907 Bacteria 1567
678 Ga0496104_0285196 3300048907 Bacteria 1564
679 Ga0496104_0393214 3300048907 Bacteria 1298
680 Ga0496105_0023216 3300048908 Bacteria 5029
681 Ga0496105_0059597 3300048908 Bacteria 3150
682 Ga0496105_0318928 3300048908 Unclassified 1246
683 Ga0496106_0166627 3300048909 Bacteria 1744
684 Ga0496106_0235756 3300048909 Bacteria 1462
685 Ga0496106_0443766 3300048909 Bacteria 1043
686 Ga0496107_0030694 3300048910 Bacteria 3831
687 Ga0496108_0003174 3300048911 Bacteria 13229
688 Ga0496108_0047884 3300048911 Bacteria 3574
689 Ga0496108_0084576 3300048911 Bacteria 2692
690 Ga0496108_0243887 3300048911 Bacteria 1563
691 Ga0496109_0024582 3300048912 Bacteria 5357
692 Ga0496109_0097188 3300048912 Bacteria 2729
693 Ga0496110_0005134 3300048913 Bacteria 10230
694 Ga0496110_0005401 3300048913 Bacteria 10020
695 Ga0496110_0470857 3300048913 Bacteria 1144
696 Ga0496111_0021259 3300048914 Bacteria 4528
697 Ga0496111_0259763 3300048914 Bacteria 1289
698 Ga0496112_0092592 3300048915 Bacteria 2992
699 Ga0496113_0025849 3300048916 Bacteria 4191
700 Ga0496113_0042765 3300048916 Bacteria 3349
701 Ga0496113_0156309 3300048916 Bacteria 1801
702 Ga0496114_0013937 3300048917 Bacteria 6446
703 Ga0496114_0020209 3300048917 Bacteria 5404
704 Ga0496114_0044618 3300048917 Bacteria 3679
705 Ga0496114_0047951 3300048917 Bacteria 3553
706 Ga0496114_0088560 3300048917 Bacteria 2626
707 Ga0496114_0206248 3300048917 Bacteria 1723
708 Ga0496114_0323707 3300048917 Bacteria 1362
709 Ga0496114_0441022 3300048917 Bacteria 1153
710 Ga0496114_0452031 3300048917 Bacteria 1138
711 Ga0496115_0014483 3300048918 Bacteria 5970
712 Ga0496115_0053323 3300048918 Bacteria 3245
713 Ga0501311_013289 3300049527 Bacteria 1037
714 Ga0501031_0061819 3300049568 Bacteria 2440
715 Ga0501031_0066182 3300049568 Bacteria 2354
716 Ga0501031_0337244 3300049568 Bacteria 976
717 Ga0501032_0011144 3300049569 Bacteria 6461
718 Ga0501032_0028017 3300049569 Bacteria 3871
719 Ga0501033_0000722 3300049570 Bacteria 30335
720 Ga0501033_0007874 3300049570 Bacteria 8256
721 Ga0501033_0010957 3300049570 Bacteria 6949
722 Ga0501033_0057993 3300049570 Bacteria 2860
723 Ga0501034_0007396 3300049571 Bacteria 11694
724 Ga0501034_0134927 3300049571 Bacteria 2449
725 Ga0501036_0008093 3300049572 Bacteria 8614
726 Ga0501036_0016376 3300049572 Bacteria 6193
727 Ga0501036_0023879 3300049572 Bacteria 5153
728 Ga0501036_0045420 3300049572 Bacteria 3721
729 Ga0501036_0061770 3300049572 Bacteria 3173
730 Ga0501036_0153770 3300049572 Bacteria 1940
731 Ga0501038_0000211 3300049574 Bacteria 49814
732 Ga0501038_0053893 3300049574 Bacteria 3460
733 Ga0501038_0092296 3300049574 Bacteria 2535
734 Ga0501038_0232568 3300049574 Bacteria 1466
735 Ga0501038_0316835 3300049574 Bacteria 1221
736 Ga0501039_0016114 3300049575 Bacteria 5724
737 Ga0501039_0021128 3300049575 Bacteria 4993
738 Ga0501039_0028798 3300049575 Bacteria 4277
739 Ga0501039_0029602 3300049575 Bacteria 4217
740 Ga0501039_0292851 3300049575 Bacteria 1280
741 Ga0501040_0001735 3300049576 Bacteria 13996
742 Ga0501040_0008502 3300049576 Bacteria 6664
743 Ga0501040_0072114 3300049576 Bacteria 2385
744 Ga0501040_0115366 3300049576 Bacteria 1880
745 Ga0501041_0013597 3300049577 Bacteria 4827
746 Ga0501041_0013837 3300049577 Bacteria 4783
747 Ga0501042_0012480 3300049578 Bacteria 5757
748 Ga0501042_0032377 3300049578 Bacteria 3702
749 Ga0501042_0038522 3300049578 Bacteria 3395
750 Ga0501042_0173751 3300049578 Bacteria 1554
751 Ga0501043_0059056 3300049579 Bacteria 3009
752 Ga0501043_0148233 3300049579 Bacteria 1836
753 Ga0501043_0192320 3300049579 Bacteria 1586
754 Ga0501043_0264822 3300049579 Bacteria 1321
755 Ga0501043_0386576 3300049579 Bacteria 1059
756 Ga0501046_0034381 3300049580 Bacteria 4091
757 Ga0501046_0195797 3300049580 Bacteria 1505
758 Ga0501047_0008457 3300049581 Bacteria 9712
759 Ga0501047_0055483 3300049581 Bacteria 3831
760 Ga0501047_0060996 3300049581 Bacteria 3638
761 Ga0501047_0190794 3300049581 Bacteria 1913
762 Ga0501047_0205560 3300049581 Bacteria 1828
763 Ga0501047_0215455 3300049581 Bacteria 1777
764 Ga0501048_0014782 3300049582 Bacteria 5775
765 Ga0501048_0020660 3300049582 Bacteria 4826
766 Ga0501048_0037443 3300049582 Bacteria 3483
767 Ga0501048_0198150 3300049582 Bacteria 1423
768 Ga0501067_0005431 3300049583 Bacteria 7076
769 Ga0501067_0169847 3300049583 Bacteria 1215
770 Ga0501068_0015420 3300049584 Bacteria 4389
771 Ga0501068_0137155 3300049584 Bacteria 1532
772 Ga0501068_0161682 3300049584 Bacteria 1411
773 Ga0501069_0066514 3300049585 Bacteria 2015
774 Ga0501069_0154549 3300049585 Bacteria 1319
775 Ga0501069_0183464 3300049585 Bacteria 1210
776 Ga0501069_0307637 3300049585 Bacteria 930
777 Ga0501070_0000855 3300049586 Bacteria 27653
778 Ga0501070_0006057 3300049586 Bacteria 10302
779 Ga0501070_0026272 3300049586 Bacteria 4887
780 Ga0501070_0424800 3300049586 Bacteria 1073
781 Ga0501071_0000066 3300049587 Bacteria 37099
782 Ga0501071_0021831 3300049587 Bacteria 4461
783 Ga0501071_0053221 3300049587 Bacteria 2919
784 Ga0501071_0180050 3300049587 Bacteria 1583
785 Ga0501072_0022680 3300049588 Bacteria 4870
786 Ga0501072_0034531 3300049588 Bacteria 3964
787 Ga0501072_0047468 3300049588 Bacteria 3381
788 Ga0501072_0257145 3300049588 Bacteria 1390
789 Ga0501072_0285410 3300049588 Bacteria 1312
790 Ga0501072_0373977 3300049588 Bacteria 1131
791 Ga0501073_0016367 3300049589 Bacteria 5374
792 Ga0501073_0119453 3300049589 Bacteria 1827
793 Ga0501074_0004503 3300049590 Bacteria 9977
794 Ga0501074_0048523 3300049590 Bacteria 3067
795 Ga0501074_0160831 3300049590 Bacteria 1604
796 Ga0501074_0208177 3300049590 Bacteria 1394
797 Ga0501075_0002773 3300049591 Bacteria 11741
798 Ga0501075_0025237 3300049591 Bacteria 4367
799 Ga0501075_0104374 3300049591 Bacteria 2154
800 Ga0501076_0078601 3300049592 Bacteria 2647
801 Ga0501076_0140147 3300049592 Bacteria 1964
802 Ga0501076_0150803 3300049592 Bacteria 1891
803 Ga0501076_0236247 3300049592 Bacteria 1494
804 Ga0501076_0364018 3300049592 Bacteria 1188
805 Ga0501076_0478808 3300049592 Bacteria 1026
806 Ga0501077_0058055 3300049593 Bacteria 2457
807 Ga0501077_0076340 3300049593 Bacteria 2122
808 Ga0501077_0157631 3300049593 Bacteria 1441
809 Ga0501077_0207136 3300049593 Bacteria 1246
810 Ga0501079_0014654 3300049741 Bacteria 5978
811 Ga0501079_0019809 3300049741 Bacteria 5141
812 Ga0501079_0024941 3300049741 Bacteria 4587
813 Ga0501079_0106866 3300049741 Bacteria 2172
814 Ga0501080_0041833 3300049742 Bacteria 4268
815 Ga0501080_0051831 3300049742 Bacteria 3820
816 Ga0501080_0132417 3300049742 Bacteria 2308
817 Ga0501080_0154663 3300049742 Bacteria 2119
818 Ga0501080_0256148 3300049742 Bacteria 1595
819 Ga0501080_0301978 3300049742 Bacteria 1452
820 Ga0501081_0006278 3300049743 Bacteria 7705
821 Ga0501081_0016163 3300049743 Bacteria 4929
822 Ga0501081_0027717 3300049743 Bacteria 3819
823 Ga0501081_0203314 3300049743 Bacteria 1437
824 Ga0501083_0112514 3300049744 Bacteria 1789
825 Ga0501035_0018307 3300049822 Bacteria 6453
826 Ga0501035_0050588 3300049822 Bacteria 3723
827 Ga0501035_0211604 3300049822 Bacteria 1658
828 Ga0501035_0332071 3300049822 Bacteria 1275
829 Ga0501044_0016891 3300049823 Bacteria 7830
830 Ga0501044_0051732 3300049823 Bacteria 4234
831 Ga0501044_0316349 3300049823 Bacteria 1486
832 Ga0501045_0005561 3300049824 Bacteria 8717
833 Ga0501045_0019251 3300049824 Bacteria 4863
834 Ga0501045_0032855 3300049824 Bacteria 3761
835 Ga0501045_0070695 3300049824 Bacteria 2568
836 Ga0501045_0252567 3300049824 Bacteria 1312
837 nmdc:mga03n38_49012_c1 3300050490 Bacteria 1876
838 nmdc:mga00v17_40489_c1 3300050491 Bacteria 2795
839 nmdc:mga0yw44_37526_c1 3300050492 Bacteria 2861
840 nmdc:mga0yw44_413143_c1 3300050492 Bacteria 913
841 nmdc:mga05p37_119852_c1 3300050507 Bacteria 3233
842 nmdc:mga05p37_14121_c1 3300050507 Bacteria 9585
843 nmdc:mga05p37_214526_c1 3300050507 Bacteria 2325
844 nmdc:mga05p37_22766_c1 3300050507 Bacteria 7601
845 nmdc:mga05p37_275458_c1 3300050507 Bacteria 2009
846 nmdc:mga05p37_823_c1 3300050507 Bacteria 34775
847 nmdc:mga09592_11227_c1 3300050508 Bacteria 7289
848 nmdc:mga09592_16_c1 3300050508 Bacteria 97518
849 nmdc:mga09592_71095_c1 3300050508 Bacteria 2954
850 nmdc:mga09592_76545_c1 3300050508 Bacteria 2845
851 nmdc:mga0qj67_16_c1 3300050509 Bacteria 124323
852 nmdc:mga06r32_12345_c1 3300050510 Bacteria 7705
853 nmdc:mga06r32_423464_c1 3300050510 Bacteria 1312
854 nmdc:mga06r32_493_c1 3300050510 Bacteria 34078
855 nmdc:mga06r32_55904_c1 3300050510 Bacteria 3787
856 nmdc:mga08y16_138537_c1 3300050511 Bacteria 2530
857 nmdc:mga08y16_47979_c1 3300050511 Bacteria 4470
858 nmdc:mga0n895_536016_c1 3300050512 Bacteria 1177
859 nmdc:mga08x19_394657_c1 3300050514 Bacteria 970
860 nmdc:mga0a205_469272_c1 3300050515 Bacteria 1117
861 Ga0495601_0005278 3300053077 Bacteria 7515
862 Ga0495601_0010567 3300053077 Bacteria 5498
863 Ga0495601_0089601 3300053077 Bacteria 1978
864 Ga0495612_0006871 3300053078 Bacteria 4655
865 Ga0495612_0026438 3300053078 Bacteria 2332
866 Ga0495612_0093969 3300053078 Bacteria 1272
867 Ga0495595_0007397 3300053084 Bacteria 4496
868 Ga0495595_0023177 3300053084 Bacteria 2731
869 Ga0495619_0015865 3300053085 Bacteria 4768
870 Ga0495619_0016123 3300053085 Bacteria 4729
871 Ga0495619_0025527 3300053085 Bacteria 3795
872 Ga0495619_0046606 3300053085 Bacteria 2851
873 Ga0495619_0055057 3300053085 Bacteria 2634
874 Ga0495619_0064338 3300053085 Bacteria 2445
875 Ga0500646_0000070 3300053090 Bacteria 29109
876 Ga0500583_0006147 3300053092 Bacteria 4102
877 Ga0500554_020716 3300053102 Bacteria 1812
878 Ga0500556_0001268 3300053104 Bacteria 11526
879 Ga0500593_000433 3300053117 Bacteria 16492
880 Ga0500623_146194 3300053127 Bacteria 982
881 Ga0500559_0117480 3300053136 Bacteria 1235
882 Ga0500568_0081996 3300053139 Bacteria 1224
883 Ga0500588_0010241 3300053146 Bacteria 2257
884 Ga0501084_0009095 3300054114 Bacteria 8220
885 Ga0501084_0017512 3300054114 Bacteria 5958
886 Ga0501084_0024480 3300054114 Bacteria 5036
887 Ga0501084_0058083 3300054114 Bacteria 3237
888 Ga0501084_0347283 3300054114 Bacteria 1253
889 Ga0501082_0015875 3300060353 Bacteria 6476
890 Ga0501082_0030297 3300060353 Bacteria 4663
891 Ga0466962_0000273 3300061719 Bacteria 21782
892 Ga0466962_0021274 3300061719 Bacteria 3116
893 Ga0466962_0039752 3300061719 Bacteria 2252
894 Ga0466962_0167126 3300061719 Bacteria 1070
895 Ga0530510_0013642 3300061734 Bacteria 5717
896 Ga0530510_0053714 3300061734 Bacteria 2911
897 Ga0530510_0059472 3300061734 Bacteria 2764
898 Ga0530510_0104482 3300061734 Bacteria 2072

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0243887 Ga0496108_0243887_546_1220 223
2 3300049593 Ga0501077_0207136 Ga0501077_0207136_19_741 237
3 3300049568 Ga0501031_0337244 Ga0501031_0337244_16_963 250
4 3300035207 Ga0373942_0002413 Ga0373942_0002413_3534_4457 252
5 3300035086 Ga0373934_0011263 Ga0373934_0011263_12_1088 255
6 3300035117 Ga0373953_0006688 Ga0373953_0006688_2505_3581 255
7 3300035724 Ga0373933_0050651 Ga0373933_0050651_844_1920 255
8 3300044719 Ga0466971_0112252 Ga0466971_0112252_393_1163 255
9 3300046533 Ga0495640_0012101 Ga0495640_0012101_4973_6049 255
10 3300046642 Ga0495634_0034112 Ga0495634_0034112_58_978 255
11 3300046516 Ga0495628_0025644 Ga0495628_0025644_2851_3927 256
12 3300046543 Ga0495645_0117053 Ga0495645_0117053_793_1869 256
13 3300053102 Ga0500554_020716 Ga0500554_020716_685_1563 257
14 3300046461 Ga0495641_0005398 Ga0495641_0005398_5586_6644 258
15 3300049585 Ga0501069_0183464 Ga0501069_0183464_392_1195 258
16 3300006844 Ga0075428_100120061 Ga0075428_1001200612 259
17 3300006880 Ga0075429_100392746 Ga0075429_1003927462 259
18 3300050508 nmdc:mga09592_76545_c1 nmdc:mga09592_76545_c1_1819_2727 259
19 3300006028 Ga0070717_10073250 Ga0070717_100732502 260
20 3300025906 Ga0207699_10026106 Ga0207699_100261063 260
21 3300025916 Ga0207663_10015017 Ga0207663_100150172 260
22 3300025928 Ga0207700_10052683 Ga0207700_100526832 260
23 3300025929 Ga0207664_10154325 Ga0207664_101543252 260
24 3300025939 Ga0207665_10005206 Ga0207665_100052064 260
25 3300048907 Ga0496104_0030805 Ga0496104_0030805_2129_3223 260
26 3300048908 Ga0496105_0023216 Ga0496105_0023216_1947_3023 260
27 3300048915 Ga0496112_0092592 Ga0496112_0092592_91_1185 260
28 3300048916 Ga0496113_0042765 Ga0496113_0042765_651_1745 260
29 3300050510 nmdc:mga06r32_423464_c1 nmdc:mga06r32_423464_c1_102_1013 260
30 3300028573 Ga0265334_10012852 Ga0265334_100128522 262
31 3300028577 Ga0265318_10014087 Ga0265318_100140874 262
32 3300028800 Ga0265338_10008735 Ga0265338_100087355 262
33 3300029957 Ga0265324_10026005 Ga0265324_100260051 262
34 3300031240 Ga0265320_10002133 Ga0265320_1000213311 262
35 3300031250 Ga0265331_10022587 Ga0265331_100225873 262
36 3300031712 Ga0265342_10025071 Ga0265342_100250713 262
37 3300035084 Ga0373928_0015343 Ga0373928_0015343_249_1265 263
38 3300035088 Ga0373940_0003437 Ga0373940_0003437_70_1086 263
39 3300035207 Ga0373942_0009261 Ga0373942_0009261_818_1834 263
40 3300048907 Ga0496104_0065446 Ga0496104_0065446_611_1627 263
41 3300048918 Ga0496115_0014483 Ga0496115_0014483_4142_5158 263
42 3300049583 Ga0501067_0169847 Ga0501067_0169847_175_1065 263
43 3300049585 Ga0501069_0154549 Ga0501069_0154549_161_1051 263
44 3300050507 nmdc:mga05p37_22766_c1 nmdc:mga05p37_22766_c1_950_1840 263
45 3300009147 Ga0114129_10000011 Ga0114129_1000001170 264
46 3300036401 Ga0373937_0150534 Ga0373937_0150534_1297_2136 264
47 3300037853 Ga0436364_0997648 Ga0436364_0997648_752_1648 264
48 3300049742 Ga0501080_0301978 Ga0501080_0301978_489_1406 264
49 3300005341 Ga0070691_10045492 Ga0070691_100454921 265
50 3300005440 Ga0070705_100074217 Ga0070705_1000742172 265
51 3300005536 Ga0070697_100196145 Ga0070697_1001961452 265
52 3300005563 Ga0068855_100270937 Ga0068855_1002709372 265
53 3300005841 Ga0068863_100130608 Ga0068863_1001306082 265
54 3300009177 Ga0105248_10058674 Ga0105248_100586741 265
55 3300010375 Ga0105239_10227730 Ga0105239_102277302 265
56 3300013308 Ga0157375_10067949 Ga0157375_100679493 265
57 3300014969 Ga0157376_10044321 Ga0157376_100443214 265
58 3300020081 Ga0206354_11271448 Ga0206354_112714481 265
59 3300025929 Ga0207664_10160820 Ga0207664_101608202 265
60 3300025949 Ga0207667_10212294 Ga0207667_102122943 265
61 3300026095 Ga0207676_10147933 Ga0207676_101479332 265
62 3300026142 Ga0207698_10585941 Ga0207698_105859411 265
63 3300033179 Ga0307507_10159938 Ga0307507_101599382 265
64 3300035085 Ga0373929_0002535 Ga0373929_0002535_35_1051 265
65 3300035111 Ga0373923_0029737 Ga0373923_0029737_373_1257 265
66 3300035113 Ga0373936_0024453 Ga0373936_0024453_1247_2131 265
67 3300035120 Ga0373957_0017544 Ga0373957_0017544_435_1319 265
68 3300035171 Ga0373946_0034533 Ga0373946_0034533_307_1191 265
69 3300035692 Ga0373935_0075877 Ga0373935_0075877_871_1755 265
70 3300035725 Ga0373947_0104227 Ga0373947_0104227_89_973 265
71 3300046454 Ga0495592_0037269 Ga0495592_0037269_1546_2430 265
72 3300046462 Ga0495651_0102771 Ga0495651_0102771_1066_1950 265
73 3300046472 Ga0495580_0089223 Ga0495580_0089223_239_1123 265
74 3300046475 Ga0495639_0045609 Ga0495639_0045609_325_1209 265
75 3300046476 Ga0495662_0064706 Ga0495662_0064706_796_1680 265
76 3300046514 Ga0495618_0028042 Ga0495618_0028042_175_1059 265
77 3300046516 Ga0495628_0076978 Ga0495628_0076978_436_1320 265
78 3300046526 Ga0495666_0164184 Ga0495666_0164184_121_1005 265
79 3300046531 Ga0495665_0073112 Ga0495665_0073112_209_1093 265
80 3300046533 Ga0495640_0020018 Ga0495640_0020018_3384_4268 265
81 3300046535 Ga0495586_0014091 Ga0495586_0014091_170_1054 265
82 3300046663 Ga0495635_0018200 Ga0495635_0018200_3355_4239 265
83 3300046675 Ga0495657_0090086 Ga0495657_0090086_47_931 265
84 3300046680 Ga0495646_0015185 Ga0495646_0015185_3715_4599 265
85 3300046809 Ga0495600_0050668 Ga0495600_0050668_1406_2290 265
86 3300047315 Ga0495581_0190917 Ga0495581_0190917_126_1010 265
87 3300047317 Ga0495604_0009174 Ga0495604_0009174_2469_3353 265
88 3300047322 Ga0495680_0036467 Ga0495680_0036467_962_1846 265
89 3300047444 Ga0495675_0027223 Ga0495675_0027223_1847_2731 265
90 3300047471 Ga0495684_0038708 Ga0495684_0038708_2597_3481 265
91 3300047673 Ga0495593_0042392 Ga0495593_0042392_174_1058 265
92 3300048088 Ga0495602_0031216 Ga0495602_0031216_1819_2703 265
93 3300048911 Ga0496108_0084576 Ga0496108_0084576_429_1313 265
94 3300048913 Ga0496110_0005134 Ga0496110_0005134_717_1601 265
95 3300048916 Ga0496113_0025849 Ga0496113_0025849_675_1559 265
96 3300053085 Ga0495619_0016123 Ga0495619_0016123_1357_2241 265
97 3300046507 Ga0495606_0001132 Ga0495606_0001132_26742_27647 266
98 3300046616 Ga0495668_0000615 Ga0495668_0000615_15277_16182 266
99 3300046660 Ga0495625_0023711 Ga0495625_0023711_3746_4651 266
100 3300047323 Ga0495683_0157084 Ga0495683_0157084_126_1031 266
101 3300048091 Ga0495626_0000127 Ga0495626_0000127_15179_16084 266
102 3300048907 Ga0496104_0242339 Ga0496104_0242339_188_1051 266
103 3300048907 Ga0496104_0285196 Ga0496104_0285196_41_916 266
104 3300048911 Ga0496108_0047884 Ga0496108_0047884_2354_3217 266
105 3300048912 Ga0496109_0097188 Ga0496109_0097188_417_1280 266
106 3300048917 Ga0496114_0047951 Ga0496114_0047951_1383_2258 266
107 3300006847 Ga0075431_100242950 Ga0075431_1002429502 267
108 3300049572 Ga0501036_0016376 Ga0501036_0016376_4198_5067 267
109 3300049582 Ga0501048_0198150 Ga0501048_0198150_264_1133 267
110 3300050507 nmdc:mga05p37_119852_c1 nmdc:mga05p37_119852_c1_1239_2255 267
111 3300061734 Ga0530510_0053714 Ga0530510_0053714_1659_2528 267
112 3300005445 Ga0070708_100011223 Ga0070708_1000112235 268
113 3300044842 Ga0466957_0124251 Ga0466957_0124251_783_1601 268
114 3300005536 Ga0070697_100042029 Ga0070697_1000420292 269
115 3300005983 Ga0081540_1000527 Ga0081540_100052718 269
116 3300025901 Ga0207688_10251284 Ga0207688_102512841 269
117 3300037068 Ga0373925_0098291 Ga0373925_0098291_268_1308 269
118 3300046463 Ga0495653_0251618 Ga0495653_0251618_109_1149 269
119 3300046476 Ga0495662_0063494 Ga0495662_0063494_309_1349 269
120 3300046529 Ga0495652_0095794 Ga0495652_0095794_317_1357 269
121 3300047319 Ga0495674_0023294 Ga0495674_0023294_3842_4882 269
122 3300053077 Ga0495601_0010567 Ga0495601_0010567_1479_2417 269
123 3300053077 Ga0495601_0089601 Ga0495601_0089601_801_1841 269
124 3300053078 Ga0495612_0026438 Ga0495612_0026438_1050_1988 269
125 3300032126 Ga0307415_100060691 Ga0307415_1000606912 270
126 3300035086 Ga0373934_0000049 Ga0373934_0000049_15450_16319 270
127 3300035111 Ga0373923_0007640 Ga0373923_0007640_2635_3504 270
128 3300035117 Ga0373953_0000067 Ga0373953_0000067_22762_23631 270
129 3300035119 Ga0373956_0000086 Ga0373956_0000086_6490_7359 270
130 3300035120 Ga0373957_0000632 Ga0373957_0000632_2064_2933 270
131 3300035172 Ga0373955_0000252 Ga0373955_0000252_6592_7461 270
132 3300035172 Ga0373955_0030358 Ga0373955_0030358_1002_1964 270
133 3300035724 Ga0373933_0000051 Ga0373933_0000051_44651_45520 270
134 3300036401 Ga0373937_0000289 Ga0373937_0000289_25865_26734 270
135 3300036401 Ga0373937_0058844 Ga0373937_0058844_1304_2266 270
136 3300046454 Ga0495592_0000111 Ga0495592_0000111_44667_45536 270
137 3300046454 Ga0495592_0023301 Ga0495592_0023301_216_1178 270
138 3300046462 Ga0495651_0000068 Ga0495651_0000068_49756_50625 270
139 3300046462 Ga0495651_0002798 Ga0495651_0002798_6690_7652 270
140 3300046463 Ga0495653_0002320 Ga0495653_0002320_6643_7605 270
141 3300046463 Ga0495653_0005403 Ga0495653_0005403_7484_8353 270
142 3300046511 Ga0495608_0000160 Ga0495608_0000160_25852_26721 270
143 3300046511 Ga0495608_0001185 Ga0495608_0001185_12066_13028 270
144 3300046514 Ga0495618_0025606 Ga0495618_0025606_1410_2372 270
145 3300046516 Ga0495628_0000250 Ga0495628_0000250_8091_8960 270
146 3300046516 Ga0495628_0009279 Ga0495628_0009279_5116_6078 270
147 3300046529 Ga0495652_0000440 Ga0495652_0000440_25825_26694 270
148 3300046536 Ga0495587_0000056 Ga0495587_0000056_25865_26734 270
149 3300046536 Ga0495587_0004715 Ga0495587_0004715_4755_5717 270
150 3300046559 Ga0495667_0000078 Ga0495667_0000078_25843_26712 270
151 3300046559 Ga0495667_0000947 Ga0495667_0000947_5881_6843 270
152 3300046675 Ga0495657_0000444 Ga0495657_0000444_13128_13997 270
153 3300046675 Ga0495657_0006331 Ga0495657_0006331_6626_7588 270
154 3300046678 Ga0495599_0001783 Ga0495599_0001783_10828_11697 270
155 3300046679 Ga0495623_0000209 Ga0495623_0000209_25861_26730 270
156 3300046680 Ga0495646_0004757 Ga0495646_0004757_7187_8056 270
157 3300046680 Ga0495646_0020950 Ga0495646_0020950_1631_2593 270
158 3300046809 Ga0495600_0004520 Ga0495600_0004520_1601_2563 270
159 3300046809 Ga0495600_0018370 Ga0495600_0018370_2331_3200 270
160 3300047317 Ga0495604_0000105 Ga0495604_0000105_44642_45511 270
161 3300047317 Ga0495604_0013304 Ga0495604_0013304_3371_4333 270
162 3300047319 Ga0495674_0017493 Ga0495674_0017493_971_1933 270
163 3300047322 Ga0495680_0000115 Ga0495680_0000115_49756_50625 270
164 3300047322 Ga0495680_0003508 Ga0495680_0003508_7728_8690 270
165 3300047444 Ga0495675_0001210 Ga0495675_0001210_8234_9103 270
166 3300047471 Ga0495684_0101890 Ga0495684_0101890_141_1103 270
167 3300048088 Ga0495602_0000114 Ga0495602_0000114_49756_50625 270
168 3300049568 Ga0501031_0066182 Ga0501031_0066182_1177_2037 270
169 3300049569 Ga0501032_0011144 Ga0501032_0011144_2284_3144 270
170 3300049570 Ga0501033_0057993 Ga0501033_0057993_161_1021 270
171 3300049572 Ga0501036_0061770 Ga0501036_0061770_1010_1870 270
172 3300049575 Ga0501039_0016114 Ga0501039_0016114_1998_2858 270
173 3300049578 Ga0501042_0012480 Ga0501042_0012480_2066_2926 270
174 3300049579 Ga0501043_0148233 Ga0501043_0148233_795_1655 270
175 3300049581 Ga0501047_0060996 Ga0501047_0060996_2305_3165 270
176 3300049582 Ga0501048_0020660 Ga0501048_0020660_2607_3467 270
177 3300049584 Ga0501068_0137155 Ga0501068_0137155_180_1040 270
178 3300049585 Ga0501069_0066514 Ga0501069_0066514_592_1452 270
179 3300049586 Ga0501070_0026272 Ga0501070_0026272_1832_2692 270
180 3300049589 Ga0501073_0016367 Ga0501073_0016367_2554_3414 270
181 3300049590 Ga0501074_0004503 Ga0501074_0004503_6320_7180 270
182 3300049742 Ga0501080_0041833 Ga0501080_0041833_2105_2965 270
183 3300049822 Ga0501035_0332071 Ga0501035_0332071_182_1042 270
184 3300049823 Ga0501044_0051732 Ga0501044_0051732_1070_1930 270
185 3300049824 Ga0501045_0019251 Ga0501045_0019251_3559_4419 270
186 3300050515 nmdc:mga0a205_469272_c1 nmdc:mga0a205_469272_c1_148_981 270
187 3300053084 Ga0495595_0007397 Ga0495595_0007397_721_1590 270
188 3300053085 Ga0495619_0046606 Ga0495619_0046606_1845_2807 270
189 3300054114 Ga0501084_0058083 Ga0501084_0058083_690_1550 270
190 3300005334 Ga0068869_100009393 Ga0068869_1000093934 271
191 3300005338 Ga0068868_100085051 Ga0068868_1000850512 271
192 3300005344 Ga0070661_100015487 Ga0070661_1000154874 271
193 3300005354 Ga0070675_100000194 Ga0070675_10000019421 271
194 3300005366 Ga0070659_100009047 Ga0070659_1000090476 271
195 3300005455 Ga0070663_100031164 Ga0070663_1000311643 271
196 3300005457 Ga0070662_100177105 Ga0070662_1001771052 271
197 3300005564 Ga0070664_100065548 Ga0070664_1000655482 271
198 3300005616 Ga0068852_100371802 Ga0068852_1003718021 271
199 3300005618 Ga0068864_100173229 Ga0068864_1001732292 271
200 3300005841 Ga0068863_100223657 Ga0068863_1002236572 271
201 3300005844 Ga0068862_100114172 Ga0068862_1001141721 271
202 3300009094 Ga0111539_10031916 Ga0111539_100319165 271
203 3300010375 Ga0105239_10070091 Ga0105239_100700912 271
204 3300025920 Ga0207649_10124469 Ga0207649_101244692 271
205 3300025926 Ga0207659_10009797 Ga0207659_100097975 271
206 3300025933 Ga0207706_10011538 Ga0207706_100115381 271
207 3300025942 Ga0207689_10015828 Ga0207689_100158284 271
208 3300025961 Ga0207712_10150252 Ga0207712_101502522 271
209 3300026023 Ga0207677_10072190 Ga0207677_100721902 271
210 3300026067 Ga0207678_10046428 Ga0207678_100464282 271
211 3300026075 Ga0207708_10007803 Ga0207708_100078036 271
212 3300026116 Ga0207674_10004069 Ga0207674_100040696 271
213 3300027907 Ga0207428_10036811 Ga0207428_100368111 271
214 3300028380 Ga0268265_10143532 Ga0268265_101435321 271
215 3300046516 Ga0495628_0011278 Ga0495628_0011278_3370_4386 271
216 3300046529 Ga0495652_0229477 Ga0495652_0229477_117_1133 271
217 3300046678 Ga0495599_0006717 Ga0495599_0006717_2058_3074 271
218 3300049570 Ga0501033_0000722 Ga0501033_0000722_22110_22970 271
219 3300049572 Ga0501036_0153770 Ga0501036_0153770_469_1329 271
220 3300049574 Ga0501038_0232568 Ga0501038_0232568_104_964 271
221 3300049580 Ga0501046_0195797 Ga0501046_0195797_156_1016 271
222 3300050511 nmdc:mga08y16_47979_c1 nmdc:mga08y16_47979_c1_548_1387 271
223 3300053085 Ga0495619_0025527 Ga0495619_0025527_1098_2114 271
224 3300005577 Ga0068857_100036375 Ga0068857_1000363752 272
225 3300009553 Ga0105249_10381417 Ga0105249_103814172 272
226 3300013296 Ga0157374_10617566 Ga0157374_106175662 272
227 3300014745 Ga0157377_10077392 Ga0157377_100773922 272
228 3300044842 Ga0466957_0020618 Ga0466957_0020618_1414_2289 272
229 3300049571 Ga0501034_0007396 Ga0501034_0007396_1125_2009 272
230 3300049586 Ga0501070_0000855 Ga0501070_0000855_15626_16510 272
231 3300049587 Ga0501071_0000066 Ga0501071_0000066_24820_25704 272
232 3300049589 Ga0501073_0119453 Ga0501073_0119453_497_1381 272
233 3300053127 Ga0500623_146194 Ga0500623_146194_20_838 272
234 3300005937 Ga0081455_10080099 Ga0081455_100800992 273
235 3300025917 Ga0207660_10172610 Ga0207660_101726102 273
236 3300035117 Ga0373953_0004314 Ga0373953_0004314_1739_2755 273
237 3300035119 Ga0373956_0029484 Ga0373956_0029484_734_1750 273
238 3300035172 Ga0373955_0013081 Ga0373955_0013081_2371_3387 273
239 3300035410 Ga0373924_0002829 Ga0373924_0002829_2820_3836 273
240 3300035724 Ga0373933_0002841 Ga0373933_0002841_6495_7511 273
241 3300036401 Ga0373937_0009894 Ga0373937_0009894_7074_8090 273
242 3300046463 Ga0495653_0102787 Ga0495653_0102787_327_1340 273
243 3300046473 Ga0495582_0023358 Ga0495582_0023358_1814_2830 273
244 3300046475 Ga0495639_0078151 Ga0495639_0078151_274_1290 273
245 3300046476 Ga0495662_0011429 Ga0495662_0011429_1818_2831 273
246 3300046477 Ga0495664_0147728 Ga0495664_0147728_325_1335 273
247 3300046511 Ga0495608_0019053 Ga0495608_0019053_2387_3403 273
248 3300046517 Ga0495630_0071921 Ga0495630_0071921_742_1758 273
249 3300046536 Ga0495587_0008582 Ga0495587_0008582_2232_3248 273
250 3300046559 Ga0495667_0013303 Ga0495667_0013303_2158_3174 273
251 3300046675 Ga0495657_0006066 Ga0495657_0006066_3239_4255 273
252 3300046679 Ga0495623_0034635 Ga0495623_0034635_1832_2848 273
253 3300046680 Ga0495646_0008480 Ga0495646_0008480_3732_4748 273
254 3300047315 Ga0495581_0012762 Ga0495581_0012762_2098_3114 273
255 3300047319 Ga0495674_0076907 Ga0495674_0076907_1175_2191 273
256 3300047322 Ga0495680_0100714 Ga0495680_0100714_659_1675 273
257 3300049575 Ga0501039_0292851 Ga0501039_0292851_210_1148 273
258 3300049576 Ga0501040_0072114 Ga0501040_0072114_291_1229 273
259 3300049591 Ga0501075_0104374 Ga0501075_0104374_592_1530 273
260 3300049592 Ga0501076_0364018 Ga0501076_0364018_104_1042 273
261 3300049743 Ga0501081_0027717 Ga0501081_0027717_2443_3381 273
262 3300049824 Ga0501045_0032855 Ga0501045_0032855_2080_3018 273
263 3300053078 Ga0495612_0093969 Ga0495612_0093969_116_1132 273
264 3300005467 Ga0070706_100009721 Ga0070706_1000097212 274
265 3300005468 Ga0070707_100000473 Ga0070707_10000047323 274
266 3300005471 Ga0070698_100002837 Ga0070698_1000028376 274
267 3300006163 Ga0070715_10049194 Ga0070715_100491942 274
268 3300009011 Ga0105251_10046492 Ga0105251_100464923 274
269 3300009148 Ga0105243_10043334 Ga0105243_100433345 274
270 3300009174 Ga0105241_10032699 Ga0105241_100326995 274
271 3300009177 Ga0105248_10256882 Ga0105248_102568822 274
272 3300013102 Ga0157371_10050131 Ga0157371_100501314 274
273 3300013296 Ga0157374_10067450 Ga0157374_100674505 274
274 3300013308 Ga0157375_10097559 Ga0157375_100975592 274
275 3300014325 Ga0163163_10017213 Ga0163163_100172132 274
276 3300014326 Ga0157380_10108755 Ga0157380_101087552 274
277 3300014745 Ga0157377_10033019 Ga0157377_100330194 274
278 3300014969 Ga0157376_10232731 Ga0157376_102327313 274
279 3300025906 Ga0207699_10004405 Ga0207699_100044052 274
280 3300025910 Ga0207684_10006576 Ga0207684_100065763 274
281 3300025915 Ga0207693_10109391 Ga0207693_101093912 274
282 3300025916 Ga0207663_10139798 Ga0207663_101397982 274
283 3300025922 Ga0207646_10000511 Ga0207646_1000051116 274
284 3300035085 Ga0373929_0033552 Ga0373929_0033552_205_1047 274
285 3300035090 Ga0373949_0013294 Ga0373949_0013294_833_1675 274
286 3300035242 Ga0373962_0015047 Ga0373962_0015047_822_1664 274
287 3300045976 Ga0466967_0501596 Ga0466967_0501596_174_1037 274
288 3300046559 Ga0495667_0031900 Ga0495667_0031900_70_963 274
289 3300048904 Ga0496101_0035090 Ga0496101_0035090_928_1770 274
290 3300048906 Ga0496103_0021748 Ga0496103_0021748_1358_2200 274
291 3300048907 Ga0496104_0393214 Ga0496104_0393214_30_872 274
292 3300048909 Ga0496106_0166627 Ga0496106_0166627_649_1491 274
293 3300048910 Ga0496107_0030694 Ga0496107_0030694_1035_1877 274
294 3300048913 Ga0496110_0470857 Ga0496110_0470857_138_980 274
295 3300048914 Ga0496111_0021259 Ga0496111_0021259_231_1073 274
296 3300050514 nmdc:mga08x19_394657_c1 nmdc:mga08x19_394657_c1_76_918 274
297 iso_pu_bacteria 2643221575 2643888658 274
298 iso_pu_bacteria 2643221690 2644505150 274
299 iso_pu_bacteria 2935409751 2935413094 274
300 3300046459 Ga0495629_0147707 Ga0495629_0147707_237_1250 275
301 3300046472 Ga0495580_0116311 Ga0495580_0116311_636_1649 275
302 3300046473 Ga0495582_0035858 Ga0495582_0035858_1073_2086 275
303 3300046475 Ga0495639_0034447 Ga0495639_0034447_609_1622 275
304 3300046531 Ga0495665_0140664 Ga0495665_0140664_120_1133 275
305 3300046543 Ga0495645_0040788 Ga0495645_0040788_187_1212 275
306 3300046642 Ga0495634_0189990 Ga0495634_0189990_237_1250 275
307 3300046683 Ga0495658_0012486 Ga0495658_0012486_928_1941 275
308 3300047471 Ga0495684_0175008 Ga0495684_0175008_405_1418 275
309 3300048089 Ga0495614_0032918 Ga0495614_0032918_183_1196 275
310 3300049742 Ga0501080_0154663 Ga0501080_0154663_545_1483 275
311 iso_pu_bacteria 2833709550 2833710407 275
312 iso_pu_bacteria 8045830549 8045832563 275
313 3300005518 Ga0070699_100102561 Ga0070699_1001025612 276
314 3300006844 Ga0075428_100000669 Ga0075428_1000006698 276
315 3300006846 Ga0075430_100003905 Ga0075430_1000039058 276
316 3300006847 Ga0075431_100000513 Ga0075431_10000051328 276
317 3300006880 Ga0075429_100005589 Ga0075429_1000055897 276
318 3300009147 Ga0114129_10000001 Ga0114129_10000001206 276
319 3300031901 Ga0307406_10065726 Ga0307406_100657263 276
320 3300046462 Ga0495651_0086274 Ga0495651_0086274_1022_1960 276
321 3300046514 Ga0495618_0014041 Ga0495618_0014041_66_968 276
322 3300050507 nmdc:mga05p37_823_c1 nmdc:mga05p37_823_c1_4422_5258 276
323 3300050508 nmdc:mga09592_16_c1 nmdc:mga09592_16_c1_66037_66873 276
324 3300050509 nmdc:mga0qj67_16_c1 nmdc:mga0qj67_16_c1_30646_31482 276
325 3300050510 nmdc:mga06r32_493_c1 nmdc:mga06r32_493_c1_4256_5092 276
326 3300053085 Ga0495619_0055057 Ga0495619_0055057_1591_2529 276
327 iso_pu_bacteria 2675903060 2676489696 276
328 iso_pu_bacteria 2895427314 2895433009 276
329 3300005339 Ga0070660_100246681 Ga0070660_1002466812 277
330 3300039450 Ga0436363_0342702 Ga0436363_0342702_131_1150 277
331 3300044684 Ga0466966_0068692 Ga0466966_0068692_836_1669 277
332 3300044693 Ga0466961_0105346 Ga0466961_0105346_565_1398 277
333 3300044765 Ga0466970_0088990 Ga0466970_0088990_629_1462 277
334 3300046463 Ga0495653_0279795 Ga0495653_0279795_98_1021 277
335 3300048917 Ga0496114_0441022 Ga0496114_0441022_72_995 277
336 3300049572 Ga0501036_0023879 Ga0501036_0023879_1310_2239 277
337 3300049574 Ga0501038_0092296 Ga0501038_0092296_510_1439 277
338 3300049575 Ga0501039_0028798 Ga0501039_0028798_1929_2858 277
339 3300049576 Ga0501040_0008502 Ga0501040_0008502_2373_3302 277
340 3300049577 Ga0501041_0013837 Ga0501041_0013837_1800_2729 277
341 3300049579 Ga0501043_0386576 Ga0501043_0386576_132_974 277
342 3300049582 Ga0501048_0014782 Ga0501048_0014782_829_1758 277
343 3300049587 Ga0501071_0021831 Ga0501071_0021831_3205_4134 277
344 3300049588 Ga0501072_0047468 Ga0501072_0047468_2330_3277 277
345 3300049588 Ga0501072_0285410 Ga0501072_0285410_371_1300 277
346 3300049590 Ga0501074_0208177 Ga0501074_0208177_387_1316 277
347 3300049592 Ga0501076_0150803 Ga0501076_0150803_877_1806 277
348 3300049592 Ga0501076_0478808 Ga0501076_0478808_55_897 277
349 3300049593 Ga0501077_0157631 Ga0501077_0157631_228_1157 277
350 3300049741 Ga0501079_0024941 Ga0501079_0024941_1700_2629 277
351 3300049741 Ga0501079_0106866 Ga0501079_0106866_275_1117 277
352 3300049742 Ga0501080_0132417 Ga0501080_0132417_523_1452 277
353 3300049743 Ga0501081_0006278 Ga0501081_0006278_2565_3494 277
354 3300049743 Ga0501081_0203314 Ga0501081_0203314_257_1099 277
355 3300049824 Ga0501045_0005561 Ga0501045_0005561_5591_6520 277
356 3300053084 Ga0495595_0023177 Ga0495595_0023177_60_983 277
357 3300054114 Ga0501084_0009095 Ga0501084_0009095_1096_2025 277
358 3300054114 Ga0501084_0347283 Ga0501084_0347283_385_1227 277
359 3300060353 Ga0501082_0030297 Ga0501082_0030297_1267_2196 277
360 3300003320 rootH2_10000702 rootH2_1000070219 278
361 3300003322 rootL2_10287462 rootL2_102874621 278
362 3300005344 Ga0070661_100000480 Ga0070661_10000048022 278
363 3300005614 Ga0068856_100085687 Ga0068856_1000856872 278
364 3300005842 Ga0068858_100000281 Ga0068858_10000028151 278
365 3300009553 Ga0105249_10208698 Ga0105249_102086982 278
366 3300013104 Ga0157370_10167967 Ga0157370_101679672 278
367 3300025920 Ga0207649_10009851 Ga0207649_100098515 278
368 3300025961 Ga0207712_10265669 Ga0207712_102656692 278
369 3300026035 Ga0207703_10000173 Ga0207703_1000017369 278
370 3300031731 Ga0307405_10120116 Ga0307405_101201162 278
371 3300032002 Ga0307416_100007146 Ga0307416_1000071465 278
372 3300038443 Ga0395901_0147008 Ga0395901_0147008_225_1085 278
373 3300044694 Ga0466963_0099909 Ga0466963_0099909_1118_1954 278
374 3300045836 Ga0466958_0029434 Ga0466958_0029434_222_1058 278
375 3300048917 Ga0496114_0206248 Ga0496114_0206248_810_1667 278
376 3300049569 Ga0501032_0028017 Ga0501032_0028017_1211_2224 278
377 3300049570 Ga0501033_0010957 Ga0501033_0010957_3413_4273 278
378 3300049571 Ga0501034_0134927 Ga0501034_0134927_589_1602 278
379 3300049572 Ga0501036_0045420 Ga0501036_0045420_238_1251 278
380 3300049574 Ga0501038_0000211 Ga0501038_0000211_26859_27725 278
381 3300049574 Ga0501038_0053893 Ga0501038_0053893_2305_3318 278
382 3300049574 Ga0501038_0316835 Ga0501038_0316835_121_981 278
383 3300049575 Ga0501039_0029602 Ga0501039_0029602_2497_3510 278
384 3300049579 Ga0501043_0059056 Ga0501043_0059056_1622_2482 278
385 3300049579 Ga0501043_0192320 Ga0501043_0192320_262_1122 278
386 3300049581 Ga0501047_0008457 Ga0501047_0008457_2892_3752 278
387 3300049581 Ga0501047_0055483 Ga0501047_0055483_696_1709 278
388 3300049581 Ga0501047_0205560 Ga0501047_0205560_480_1340 278
389 3300049583 Ga0501067_0005431 Ga0501067_0005431_4532_5398 278
390 3300049586 Ga0501070_0006057 Ga0501070_0006057_6456_7469 278
391 3300049742 Ga0501080_0256148 Ga0501080_0256148_219_1079 278
392 3300049822 Ga0501035_0018307 Ga0501035_0018307_2803_3663 278
393 3300049822 Ga0501035_0050588 Ga0501035_0050588_1042_2055 278
394 3300049822 Ga0501035_0211604 Ga0501035_0211604_507_1367 278
395 3300049823 Ga0501044_0016891 Ga0501044_0016891_2006_2866 278
396 3300049823 Ga0501044_0316349 Ga0501044_0316349_228_1088 278
397 3300061719 Ga0466962_0039752 Ga0466962_0039752_1225_2061 278
398 3300007265 Ga0099794_10033229 Ga0099794_100332292 279
399 3300025922 Ga0207646_10023876 Ga0207646_100238762 279
400 iso_pu_bacteria 2887478801 2887484630 279
401 iso_pu_bacteria 8053945823 8053945871 279
402 3300010375 Ga0105239_10190656 Ga0105239_101906563 280
403 3300035692 Ga0373935_0372596 Ga0373935_0372596_70_945 280
404 3300037853 Ga0436364_0883803 Ga0436364_0883803_722_1564 280
405 3300046463 Ga0495653_0042432 Ga0495653_0042432_709_1584 280
406 3300046477 Ga0495664_0122637 Ga0495664_0122637_416_1291 280
407 3300046529 Ga0495652_0058582 Ga0495652_0058582_1567_2442 280
408 3300046536 Ga0495587_0077861 Ga0495587_0077861_806_1681 280
409 3300047322 Ga0495680_0039803 Ga0495680_0039803_120_995 280
410 iso_pu_bacteria 2883821847 2883823271 280
411 3300009174 Ga0105241_10248435 Ga0105241_102484351 281
412 3300048908 Ga0496105_0318928 Ga0496105_0318928_330_1205 281
413 3300048917 Ga0496114_0088560 Ga0496114_0088560_382_1257 281
414 iso_pu_bacteria 2884693830 2884694540 281
415 iso_pu_bacteria 2895442618 2895444445 281
416 3300005455 Ga0070663_100409800 Ga0070663_1004098001 282
417 3300009093 Ga0105240_10542480 Ga0105240_105424802 282
418 3300025972 Ga0207668_10147583 Ga0207668_101475832 282
419 3300037853 Ga0436364_1333729 Ga0436364_1333729_2714_3616 282
420 3300044693 Ga0466961_0293804 Ga0466961_0293804_60_911 282
421 iso_pu_bacteria 2515154155 2515856687 282
422 iso_pu_bacteria 2558860280 2559428947 282
423 3300005434 Ga0070709_10000166 Ga0070709_1000016626 283
424 3300005435 Ga0070714_100003333 Ga0070714_1000033337 283
425 3300005436 Ga0070713_100000050 Ga0070713_10000005032 283
426 3300005437 Ga0070710_10000055 Ga0070710_1000005512 283
427 3300005467 Ga0070706_100175291 Ga0070706_1001752912 283
428 3300005468 Ga0070707_100083675 Ga0070707_1000836754 283
429 3300005518 Ga0070699_100018579 Ga0070699_1000185794 283
430 3300005536 Ga0070697_100008951 Ga0070697_1000089513 283
431 3300006028 Ga0070717_10000775 Ga0070717_100007759 283
432 3300006028 Ga0070717_10003709 Ga0070717_1000370912 283
433 3300006163 Ga0070715_10037300 Ga0070715_100373002 283
434 3300006173 Ga0070716_100000268 Ga0070716_10000026815 283
435 3300006844 Ga0075428_100121027 Ga0075428_1001210272 283
436 3300009094 Ga0111539_10270344 Ga0111539_102703442 283
437 3300009147 Ga0114129_10268023 Ga0114129_102680232 283
438 3300025898 Ga0207692_10000027 Ga0207692_1000002744 283
439 3300025905 Ga0207685_10005407 Ga0207685_100054072 283
440 3300025906 Ga0207699_10000102 Ga0207699_1000010251 283
441 3300025910 Ga0207684_10045994 Ga0207684_100459942 283
442 3300025915 Ga0207693_10071822 Ga0207693_100718222 283
443 3300025916 Ga0207663_10000170 Ga0207663_100001708 283
444 3300025922 Ga0207646_10044676 Ga0207646_100446764 283
445 3300025928 Ga0207700_10000029 Ga0207700_1000002991 283
446 3300025929 Ga0207664_10000168 Ga0207664_1000016833 283
447 3300025939 Ga0207665_10000144 Ga0207665_100001448 283
448 3300048905 Ga0496102_0092891 Ga0496102_0092891_1146_2132 283
449 3300049581 Ga0501047_0190794 Ga0501047_0190794_968_1822 283
450 3300049581 Ga0501047_0215455 Ga0501047_0215455_417_1271 283
451 3300050507 nmdc:mga05p37_275458_c1 nmdc:mga05p37_275458_c1_270_1196 283
452 iso_pu_bacteria 8055172936 8055178707 283
453 3300003659 JGI25404J52841_10001883 JGI25404J52841_100018833 284
454 3300005330 Ga0070690_100026408 Ga0070690_1000264082 284
455 3300005336 Ga0070680_100135656 Ga0070680_1001356562 284
456 3300005337 Ga0070682_100035175 Ga0070682_1000351752 284
457 3300005341 Ga0070691_10012141 Ga0070691_100121413 284
458 3300005344 Ga0070661_100266859 Ga0070661_1002668592 284
459 3300005347 Ga0070668_100113809 Ga0070668_1001138092 284
460 3300005355 Ga0070671_100006642 Ga0070671_1000066421 284
461 3300005364 Ga0070673_100011497 Ga0070673_1000114972 284
462 3300005365 Ga0070688_100364111 Ga0070688_1003641111 284
463 3300005367 Ga0070667_100061147 Ga0070667_1000611473 284
464 3300005440 Ga0070705_100061937 Ga0070705_1000619371 284
465 3300005444 Ga0070694_100096640 Ga0070694_1000966403 284
466 3300005456 Ga0070678_100058966 Ga0070678_1000589662 284
467 3300005458 Ga0070681_10043195 Ga0070681_100431955 284
468 3300005468 Ga0070707_100012394 Ga0070707_1000123942 284
469 3300005471 Ga0070698_100467157 Ga0070698_1004671571 284
470 3300005535 Ga0070684_100053587 Ga0070684_1000535872 284
471 3300005544 Ga0070686_100436560 Ga0070686_1004365601 284
472 3300005549 Ga0070704_100253445 Ga0070704_1002534452 284
473 3300005564 Ga0070664_100085300 Ga0070664_1000853001 284
474 3300005577 Ga0068857_100121210 Ga0068857_1001212101 284
475 3300005616 Ga0068852_100049783 Ga0068852_1000497833 284
476 3300005617 Ga0068859_100126037 Ga0068859_1001260374 284
477 3300005618 Ga0068864_100095816 Ga0068864_1000958162 284
478 3300005718 Ga0068866_10014385 Ga0068866_100143852 284
479 3300005719 Ga0068861_100171327 Ga0068861_1001713272 284
480 3300005841 Ga0068863_100521651 Ga0068863_1005216512 284
481 3300005843 Ga0068860_100123657 Ga0068860_1001236574 284
482 3300005983 Ga0081540_1000134 Ga0081540_100013472 284
483 3300006931 Ga0097620_100126036 Ga0097620_1001260362 284
484 3300009177 Ga0105248_10131729 Ga0105248_101317293 284
485 3300020082 Ga0206353_10299334 Ga0206353_102993342 284
486 3300025735 Ga0207713_1043258 Ga0207713_10432582 284
487 3300025901 Ga0207688_10004893 Ga0207688_100048933 284
488 3300025903 Ga0207680_10089396 Ga0207680_100893962 284
489 3300025907 Ga0207645_10067759 Ga0207645_100677594 284
490 3300025908 Ga0207643_10249953 Ga0207643_102499532 284
491 3300025911 Ga0207654_10168434 Ga0207654_101684342 284
492 3300025914 Ga0207671_10136889 Ga0207671_101368892 284
493 3300025918 Ga0207662_10014842 Ga0207662_100148424 284
494 3300025919 Ga0207657_10015632 Ga0207657_100156327 284
495 3300025927 Ga0207687_10317176 Ga0207687_103171762 284
496 3300025928 Ga0207700_10005259 Ga0207700_100052599 284
497 3300025929 Ga0207664_10016562 Ga0207664_100165623 284
498 3300025935 Ga0207709_10170719 Ga0207709_101707192 284
499 3300025942 Ga0207689_10025438 Ga0207689_100254383 284
500 3300025949 Ga0207667_10148464 Ga0207667_101484642 284
501 3300025960 Ga0207651_10036600 Ga0207651_100366002 284
502 3300026067 Ga0207678_10021601 Ga0207678_100216013 284
503 3300026078 Ga0207702_10121496 Ga0207702_101214961 284
504 3300026088 Ga0207641_10480173 Ga0207641_104801732 284
505 3300026089 Ga0207648_10063057 Ga0207648_100630572 284
506 3300026095 Ga0207676_10159132 Ga0207676_101591321 284
507 3300026116 Ga0207674_10034596 Ga0207674_100345964 284
508 3300026118 Ga0207675_100013930 Ga0207675_1000139303 284
509 3300026121 Ga0207683_10003655 Ga0207683_1000365513 284
510 3300026142 Ga0207698_10175189 Ga0207698_101751892 284
511 3300028381 Ga0268264_10104010 Ga0268264_101040102 284
512 3300035083 Ga0373926_0000029 Ga0373926_0000029_4862_5737 284
513 3300035086 Ga0373934_0005406 Ga0373934_0005406_2646_3521 284
514 3300035089 Ga0373944_0000803 Ga0373944_0000803_971_1846 284
515 3300035111 Ga0373923_0001569 Ga0373923_0001569_4527_5402 284
516 3300035116 Ga0373945_0000686 Ga0373945_0000686_6196_7071 284
517 3300035119 Ga0373956_0048891 Ga0373956_0048891_855_1730 284
518 3300035120 Ga0373957_0012190 Ga0373957_0012190_1222_2097 284
519 3300035171 Ga0373946_0000547 Ga0373946_0000547_2192_3067 284
520 3300035410 Ga0373924_0001613 Ga0373924_0001613_3881_4756 284
521 3300035692 Ga0373935_0001279 Ga0373935_0001279_4862_5737 284
522 3300035695 Ga0373927_0005059 Ga0373927_0005059_4063_4938 284
523 3300035724 Ga0373933_0072236 Ga0373933_0072236_805_1680 284
524 3300035725 Ga0373947_0001901 Ga0373947_0001901_9375_10250 284
525 3300037068 Ga0373925_0006032 Ga0373925_0006032_4180_5169 284
526 3300037068 Ga0373925_0013709 Ga0373925_0013709_2546_3421 284
527 3300044694 Ga0466963_0227764 Ga0466963_0227764_59_934 284
528 3300045976 Ga0466967_0174812 Ga0466967_0174812_759_1670 284
529 3300046454 Ga0495592_0072184 Ga0495592_0072184_677_1552 284
530 3300046459 Ga0495629_0009160 Ga0495629_0009160_4861_5736 284
531 3300046461 Ga0495641_0003865 Ga0495641_0003865_6354_7229 284
532 3300046463 Ga0495653_0011639 Ga0495653_0011639_4862_5737 284
533 3300046472 Ga0495580_0016862 Ga0495580_0016862_961_1836 284
534 3300046473 Ga0495582_0001688 Ga0495582_0001688_2270_3145 284
535 3300046476 Ga0495662_0000400 Ga0495662_0000400_16493_17368 284
536 3300046517 Ga0495630_0028635 Ga0495630_0028635_2361_3236 284
537 3300046526 Ga0495666_0005084 Ga0495666_0005084_1106_1981 284
538 3300046529 Ga0495652_0158990 Ga0495652_0158990_677_1552 284
539 3300046531 Ga0495665_0001375 Ga0495665_0001375_9648_10523 284
540 3300046533 Ga0495640_0016894 Ga0495640_0016894_3513_4388 284
541 3300046535 Ga0495586_0019800 Ga0495586_0019800_1460_2335 284
542 3300046536 Ga0495587_0026209 Ga0495587_0026209_2484_3359 284
543 3300046559 Ga0495667_0004878 Ga0495667_0004878_1216_2091 284
544 3300046642 Ga0495634_0011704 Ga0495634_0011704_2219_3094 284
545 3300046663 Ga0495635_0001441 Ga0495635_0001441_7682_8557 284
546 3300046679 Ga0495623_0035576 Ga0495623_0035576_1903_2778 284
547 3300046680 Ga0495646_0007692 Ga0495646_0007692_5142_6017 284
548 3300046683 Ga0495658_0007983 Ga0495658_0007983_2072_2947 284
549 3300046689 Ga0495613_0013631 Ga0495613_0013631_2670_3545 284
550 3300047315 Ga0495581_0000947 Ga0495581_0000947_7250_8125 284
551 3300047317 Ga0495604_0008628 Ga0495604_0008628_6978_7853 284
552 3300047319 Ga0495674_0016755 Ga0495674_0016755_2448_3323 284
553 3300047321 Ga0495676_0004908 Ga0495676_0004908_8003_8878 284
554 3300047322 Ga0495680_0005139 Ga0495680_0005139_7710_8585 284
555 3300047444 Ga0495675_0036612 Ga0495675_0036612_1243_2118 284
556 3300047673 Ga0495593_0002762 Ga0495593_0002762_4142_5017 284
557 3300048089 Ga0495614_0058879 Ga0495614_0058879_43_918 284
558 3300048903 Ga0496100_0065444 Ga0496100_0065444_1341_2216 284
559 3300048907 Ga0496104_0015206 Ga0496104_0015206_3325_4215 284
560 3300048909 Ga0496106_0443766 Ga0496106_0443766_16_912 284
561 3300048912 Ga0496109_0024582 Ga0496109_0024582_1766_2656 284
562 3300048916 Ga0496113_0156309 Ga0496113_0156309_518_1408 284
563 3300048917 Ga0496114_0452031 Ga0496114_0452031_22_918 284
564 3300048918 Ga0496115_0053323 Ga0496115_0053323_503_1378 284
565 3300053077 Ga0495601_0005278 Ga0495601_0005278_972_1847 284
566 3300053085 Ga0495619_0015865 Ga0495619_0015865_2448_3323 284
567 iso_pu_bacteria 2751185734 2753074309 284
568 iso_pu_bacteria 2791354901 2791915875 284
569 iso_pu_bacteria 2795385472 2795795134 284
570 iso_pu_bacteria 2873314349 2873314724 284
571 iso_pu_bacteria 8055066027 8055066390 284
572 3300001979 JGI24740J21852_10016753 JGI24740J21852_100167532 285
573 3300001989 JGI24739J22299_10007674 JGI24739J22299_100076741 285
574 3300001990 JGI24737J22298_10016265 JGI24737J22298_100162652 285
575 3300001990 JGI24737J22298_10017067 JGI24737J22298_100170671 285
576 3300005434 Ga0070709_10002090 Ga0070709_100020908 285
577 3300005435 Ga0070714_100030237 Ga0070714_1000302372 285
578 3300005436 Ga0070713_100217465 Ga0070713_1002174652 285
579 3300005437 Ga0070710_10006989 Ga0070710_100069895 285
580 3300005577 Ga0068857_100145383 Ga0068857_1001453832 285
581 3300005577 Ga0068857_100466054 Ga0068857_1004660542 285
582 3300005616 Ga0068852_100469305 Ga0068852_1004693052 285
583 3300005842 Ga0068858_100498075 Ga0068858_1004980751 285
584 3300006173 Ga0070716_100052078 Ga0070716_1000520782 285
585 3300006175 Ga0070712_100012392 Ga0070712_1000123925 285
586 3300025885 Ga0207653_10003493 Ga0207653_100034932 285
587 3300025898 Ga0207692_10012248 Ga0207692_100122482 285
588 3300025904 Ga0207647_10005178 Ga0207647_100051789 285
589 3300025906 Ga0207699_10001301 Ga0207699_1000130110 285
590 3300025915 Ga0207693_10015690 Ga0207693_100156902 285
591 3300025916 Ga0207663_10008646 Ga0207663_100086464 285
592 3300025929 Ga0207664_10134886 Ga0207664_101348862 285
593 3300025939 Ga0207665_10004667 Ga0207665_100046679 285
594 3300026116 Ga0207674_10551941 Ga0207674_105519411 285
595 3300026142 Ga0207698_10236897 Ga0207698_102368971 285
596 3300031456 Ga0307513_10339587 Ga0307513_103395872 285
597 3300031838 Ga0307518_10133220 Ga0307518_101332202 285
598 3300037466 Ga0395898_0154761 Ga0395898_0154761_718_1605 285
599 3300041460 Ga0451802_0807064 Ga0451802_0807064_203_1063 285
600 3300041512 Ga0451853_1399455 Ga0451853_1399455_309_1169 285
601 3300044901 Ga0466960_0085367 Ga0466960_0085367_241_1098 285
602 3300047319 Ga0495674_0376443 Ga0495674_0376443_203_1120 285
603 3300048907 Ga0496104_0161018 Ga0496104_0161018_592_1479 285
604 3300048908 Ga0496105_0059597 Ga0496105_0059597_1807_2694 285
605 3300048917 Ga0496114_0044618 Ga0496114_0044618_2201_3088 285
606 iso_pu_bacteria 2643221561 2643827855 285
607 iso_pu_bacteria 2643221576 2643892395 285
608 iso_pu_bacteria 2643221590 2643961447 285
609 iso_pu_bacteria 2643221604 2644032378 285
610 iso_pu_bacteria 2643221617 2644099630 285
611 iso_pu_bacteria 2643221620 2644116175 285
612 iso_pu_bacteria 2643221696 2644532377 285
613 iso_pu_bacteria 2738541305 2738870551 285
614 iso_pu_bacteria 2811994874 2812334175 285
615 iso_pu_bacteria 2816332119 2816423705 285
616 iso_pu_bacteria 2816332139 2816505401 285
617 iso_pu_bacteria 2856741275 2856746088 285
618 iso_pu_bacteria 2891395885 2891400155 285
619 iso_pu_bacteria 2891554331 2891559900 285
620 iso_pu_bacteria 2891562705 2891567298 285
621 3300005435 Ga0070714_100001331 Ga0070714_1000013319 286
622 3300005445 Ga0070708_100249986 Ga0070708_1002499861 286
623 3300005467 Ga0070706_100054511 Ga0070706_1000545112 286
624 3300005468 Ga0070707_100005848 Ga0070707_10000584812 286
625 3300005468 Ga0070707_100080778 Ga0070707_1000807782 286
626 3300009551 Ga0105238_10152672 Ga0105238_101526722 286
627 3300014325 Ga0163163_10359165 Ga0163163_103591652 286
628 3300021388 Ga0213875_10001293 Ga0213875_1000129310 286
629 3300025924 Ga0207694_10118387 Ga0207694_101183872 286
630 3300025928 Ga0207700_10237261 Ga0207700_102372612 286
631 3300025929 Ga0207664_10001827 Ga0207664_1000182711 286
632 3300037853 Ga0436364_1326662 Ga0436364_1326662_25454_26317 286
633 3300046679 Ga0495623_0153858 Ga0495623_0153858_187_1146 286
634 iso_pu_bacteria 2643221615 2644090455 286
635 iso_pu_bacteria 2643221657 2644323417 286
636 iso_pu_bacteria 2866552031 2866555402 286
637 3300005437 Ga0070710_10000435 Ga0070710_1000043515 287
638 3300005468 Ga0070707_100166643 Ga0070707_1001666432 287
639 3300009147 Ga0114129_10457866 Ga0114129_104578663 287
640 3300009545 Ga0105237_10477996 Ga0105237_104779961 287
641 3300013308 Ga0157375_10282254 Ga0157375_102822542 287
642 3300025898 Ga0207692_10001629 Ga0207692_100016292 287
643 3300028381 Ga0268264_10195866 Ga0268264_101958662 287
644 3300028800 Ga0265338_10028796 Ga0265338_100287961 287
645 3300030736 Ga0316180_1176821 Ga0316180_11768213 287
646 3300031241 Ga0265325_10047288 Ga0265325_100472882 287
647 3300031247 Ga0265340_10044288 Ga0265340_100442882 287
648 3300031712 Ga0265342_10023010 Ga0265342_100230102 287
649 3300031727 Ga0316576_10029277 Ga0316576_100292771 287
650 3300031727 Ga0316576_10034208 Ga0316576_100342083 287
651 3300031728 Ga0316578_10040255 Ga0316578_100402553 287
652 3300035118 Ga0373954_0049417 Ga0373954_0049417_814_1698 287
653 3300035398 Ga0316574_0038258 Ga0316574_0038258_1789_2655 287
654 3300035692 Ga0373935_0317921 Ga0373935_0317921_77_967 287
655 3300036647 Ga0316582_0218837 Ga0316582_0218837_394_1260 287
656 3300036712 Ga0316584_0175662 Ga0316584_0175662_564_1430 287
657 3300044658 Ga0466972_0003345 Ga0466972_0003345_7021_7884 287
658 3300044683 Ga0466965_0010442 Ga0466965_0010442_1249_2112 287
659 3300044684 Ga0466966_0003582 Ga0466966_0003582_1624_2493 287
660 3300044693 Ga0466961_0006845 Ga0466961_0006845_1377_2246 287
661 3300044693 Ga0466961_0054516 Ga0466961_0054516_103_966 287
662 3300044765 Ga0466970_0020427 Ga0466970_0020427_651_1514 287
663 3300045049 Ga0466959_0006690 Ga0466959_0006690_1931_2800 287
664 3300045836 Ga0466958_0009913 Ga0466958_0009913_3399_4268 287
665 3300046516 Ga0495628_0214688 Ga0495628_0214688_39_929 287
666 3300046517 Ga0495630_0289393 Ga0495630_0289393_296_1186 287
667 3300046559 Ga0495667_0025498 Ga0495667_0025498_59_943 287
668 3300046663 Ga0495635_0093358 Ga0495635_0093358_857_1741 287
669 3300046675 Ga0495657_0047671 Ga0495657_0047671_1888_2772 287
670 3300047319 Ga0495674_0360765 Ga0495674_0360765_151_1041 287
671 3300049586 Ga0501070_0424800 Ga0501070_0424800_107_985 287
672 3300050512 nmdc:mga0n895_536016_c1 nmdc:mga0n895_536016_c1_152_1111 287
673 3300061719 Ga0466962_0167126 Ga0466962_0167126_115_984 287
674 iso_pu_bacteria 2675903058 2676473548 287
675 iso_pu_bacteria 2827628540 2827632061 287
676 iso_pu_bacteria 3002998708 3003005506 287
677 3300003373 JGI25407J50210_10002761 JGI25407J50210_100027614 288
678 3300005435 Ga0070714_100140973 Ga0070714_1001409732 288
679 3300005530 Ga0070679_100503694 Ga0070679_1005036942 288
680 3300005563 Ga0068855_100011645 Ga0068855_1000116453 288
681 3300005981 Ga0081538_10000079 Ga0081538_1000007910 288
682 3300009093 Ga0105240_10008130 Ga0105240_100081302 288
683 3300013104 Ga0157370_10009280 Ga0157370_100092804 288
684 3300013105 Ga0157369_10010406 Ga0157369_100104064 288
685 3300025921 Ga0207652_10279136 Ga0207652_102791361 288
686 3300026142 Ga0207698_10136154 Ga0207698_101361542 288
687 3300028794 Ga0307515_10284834 Ga0307515_102848342 288
688 3300030521 Ga0307511_10066119 Ga0307511_100661192 288
689 3300030522 Ga0307512_10155660 Ga0307512_101556601 288
690 3300031456 Ga0307513_10039124 Ga0307513_100391246 288
691 3300031456 Ga0307513_10231929 Ga0307513_102319292 288
692 3300031824 Ga0307413_10136855 Ga0307413_101368553 288
693 3300032005 Ga0307411_10011700 Ga0307411_100117002 288
694 3300035083 Ga0373926_0006978 Ga0373926_0006978_407_1372 288
695 3300035089 Ga0373944_0000419 Ga0373944_0000419_3174_4124 288
696 3300035111 Ga0373923_0015623 Ga0373923_0015623_1702_2667 288
697 3300035113 Ga0373936_0000433 Ga0373936_0000433_6266_7231 288
698 3300035170 Ga0373943_0000683 Ga0373943_0000683_10919_11899 288
699 3300035171 Ga0373946_0001780 Ga0373946_0001780_4234_5199 288
700 3300035692 Ga0373935_0004514 Ga0373935_0004514_1525_2445 288
701 3300035695 Ga0373927_0008697 Ga0373927_0008697_1631_2596 288
702 3300035725 Ga0373947_0006626 Ga0373947_0006626_4441_5436 288
703 3300037068 Ga0373925_0004633 Ga0373925_0004633_4227_5222 288
704 3300037418 Ga0395900_0040121 Ga0395900_0040121_644_1516 288
705 3300037466 Ga0395898_0213776 Ga0395898_0213776_46_918 288
706 3300042007 Ga0439449_0068540 Ga0439449_0068540_96_989 288
707 3300046461 Ga0495641_0003333 Ga0495641_0003333_8009_8974 288
708 3300046463 Ga0495653_0004725 Ga0495653_0004725_7547_8512 288
709 3300046477 Ga0495664_0003706 Ga0495664_0003706_2724_3719 288
710 3300046529 Ga0495652_0016783 Ga0495652_0016783_4009_4974 288
711 3300046559 Ga0495667_0019859 Ga0495667_0019859_1343_2338 288
712 3300046642 Ga0495634_0004211 Ga0495634_0004211_8817_9812 288
713 3300046663 Ga0495635_0002316 Ga0495635_0002316_5856_6821 288
714 3300046678 Ga0495599_0055897 Ga0495599_0055897_1114_2064 288
715 3300047319 Ga0495674_0001098 Ga0495674_0001098_4626_5591 288
716 3300048088 Ga0495602_0088268 Ga0495602_0088268_258_1223 288
717 3300048903 Ga0496100_0006407 Ga0496100_0006407_978_1964 288
718 3300048904 Ga0496101_0042784 Ga0496101_0042784_1288_2274 288
719 3300048907 Ga0496104_0035885 Ga0496104_0035885_475_1461 288
720 3300048907 Ga0496104_0110537 Ga0496104_0110537_284_1159 288
721 3300048907 Ga0496104_0284390 Ga0496104_0284390_122_1048 288
722 3300048911 Ga0496108_0003174 Ga0496108_0003174_10988_11974 288
723 3300048913 Ga0496110_0005401 Ga0496110_0005401_7517_8503 288
724 3300048917 Ga0496114_0020209 Ga0496114_0020209_2187_3173 288
725 iso_pu_bacteria 2870721527 2870727367 288
726 3300005436 Ga0070713_100139436 Ga0070713_1001394362 289
727 3300005436 Ga0070713_100197947 Ga0070713_1001979472 289
728 3300005436 Ga0070713_100289161 Ga0070713_1002891612 289
729 3300005468 Ga0070707_100033209 Ga0070707_1000332096 289
730 3300005471 Ga0070698_100033301 Ga0070698_1000333015 289
731 3300005843 Ga0068860_100000286 Ga0068860_10000028657 289
732 3300006844 Ga0075428_100024987 Ga0075428_1000249875 289
733 3300006844 Ga0075428_100751413 Ga0075428_1007514132 289
734 3300006846 Ga0075430_100008412 Ga0075430_10000841210 289
735 3300009094 Ga0111539_10008303 Ga0111539_100083037 289
736 3300009147 Ga0114129_10075261 Ga0114129_100752615 289
737 3300013308 Ga0157375_10553806 Ga0157375_105538062 289
738 3300025922 Ga0207646_10030107 Ga0207646_100301072 289
739 3300025928 Ga0207700_10001082 Ga0207700_1000108213 289
740 3300025928 Ga0207700_10108037 Ga0207700_101080373 289
741 3300028381 Ga0268264_10000246 Ga0268264_1000024653 289
742 3300031456 Ga0307513_10068521 Ga0307513_100685213 289
743 3300031731 Ga0307405_10257355 Ga0307405_102573552 289
744 3300031731 Ga0307405_10442443 Ga0307405_104424432 289
745 3300031824 Ga0307413_10237553 Ga0307413_102375531 289
746 3300031903 Ga0307407_10393583 Ga0307407_103935831 289
747 3300032004 Ga0307414_10333488 Ga0307414_103334881 289
748 3300037418 Ga0395900_0007194 Ga0395900_0007194_10151_11020 289
749 3300038443 Ga0395901_0018699 Ga0395901_0018699_3525_4394 289
750 3300045976 Ga0466967_0470667 Ga0466967_0470667_160_1029 289
751 3300048905 Ga0496102_0288078 Ga0496102_0288078_279_1148 289
752 3300048914 Ga0496111_0259763 Ga0496111_0259763_273_1142 289
753 3300048917 Ga0496114_0013937 Ga0496114_0013937_4985_5854 289
754 3300048917 Ga0496114_0323707 Ga0496114_0323707_153_1166 289
755 3300049527 Ga0501311_013289 Ga0501311_013289_32_901 289
756 3300049568 Ga0501031_0061819 Ga0501031_0061819_538_1413 289
757 3300049575 Ga0501039_0021128 Ga0501039_0021128_4065_4940 289
758 3300049576 Ga0501040_0115366 Ga0501040_0115366_657_1532 289
759 3300049578 Ga0501042_0032377 Ga0501042_0032377_338_1213 289
760 3300049579 Ga0501043_0264822 Ga0501043_0264822_53_928 289
761 3300049580 Ga0501046_0034381 Ga0501046_0034381_2628_3503 289
762 3300049582 Ga0501048_0037443 Ga0501048_0037443_205_1080 289
763 3300049584 Ga0501068_0015420 Ga0501068_0015420_697_1572 289
764 3300049587 Ga0501071_0180050 Ga0501071_0180050_461_1336 289
765 3300049588 Ga0501072_0257145 Ga0501072_0257145_448_1323 289
766 3300049588 Ga0501072_0373977 Ga0501072_0373977_84_953 289
767 3300049590 Ga0501074_0048523 Ga0501074_0048523_1779_2654 289
768 3300049592 Ga0501076_0236247 Ga0501076_0236247_128_1003 289
769 3300049824 Ga0501045_0252567 Ga0501045_0252567_187_1062 289
770 3300050492 nmdc:mga0yw44_37526_c1 nmdc:mga0yw44_37526_c1_328_1197 289
771 3300050492 nmdc:mga0yw44_413143_c1 nmdc:mga0yw44_413143_c1_26_895 289
772 3300050508 nmdc:mga09592_71095_c1 nmdc:mga09592_71095_c1_2037_2927 289
773 3300050510 nmdc:mga06r32_55904_c1 nmdc:mga06r32_55904_c1_2230_3120 289
774 3300050511 nmdc:mga08y16_138537_c1 nmdc:mga08y16_138537_c1_174_1055 289
775 3300053136 Ga0500559_0117480 Ga0500559_0117480_163_1032 289
776 3300054114 Ga0501084_0024480 Ga0501084_0024480_3841_4716 289
777 3300061734 Ga0530510_0104482 Ga0530510_0104482_803_1678 289
778 3300005445 Ga0070708_100041831 Ga0070708_1000418312 290
779 3300005467 Ga0070706_100048728 Ga0070706_1000487282 290
780 3300005937 Ga0081455_10007241 Ga0081455_1000724112 290
781 3300006028 Ga0070717_10515540 Ga0070717_105155401 290
782 3300006038 Ga0075365_10118382 Ga0075365_101183822 290
783 3300006846 Ga0075430_100020627 Ga0075430_1000206276 290
784 3300006847 Ga0075431_100022199 Ga0075431_1000221996 290
785 3300006880 Ga0075429_100012802 Ga0075429_1000128025 290
786 3300009147 Ga0114129_10000201 Ga0114129_1000020133 290
787 3300013308 Ga0157375_10090494 Ga0157375_100904942 290
788 3300021388 Ga0213875_10010004 Ga0213875_100100043 290
789 3300025910 Ga0207684_10072295 Ga0207684_100722952 290
790 3300031247 Ga0265340_10004044 Ga0265340_100040448 290
791 3300031995 Ga0307409_100062491 Ga0307409_1000624912 290
792 3300032126 Ga0307415_100006044 Ga0307415_1000060443 290
793 3300035119 Ga0373956_0002433 Ga0373956_0002433_4785_5684 290
794 3300037853 Ga0436364_0087476 Ga0436364_0087476_29024_29908 290
795 3300037853 Ga0436364_0687768 Ga0436364_0687768_1415_2302 290
796 3300039450 Ga0436363_0362663 Ga0436363_0362663_82_957 290
797 3300048088 Ga0495602_0071836 Ga0495602_0071836_615_1598 290
798 3300049570 Ga0501033_0007874 Ga0501033_0007874_2650_3537 290
799 3300049572 Ga0501036_0008093 Ga0501036_0008093_3117_4004 290
800 3300049576 Ga0501040_0001735 Ga0501040_0001735_5333_6220 290
801 3300049577 Ga0501041_0013597 Ga0501041_0013597_3226_4113 290
802 3300049578 Ga0501042_0038522 Ga0501042_0038522_1580_2476 290
803 3300049578 Ga0501042_0173751 Ga0501042_0173751_348_1235 290
804 3300049587 Ga0501071_0053221 Ga0501071_0053221_1492_2379 290
805 3300049588 Ga0501072_0022680 Ga0501072_0022680_3724_4611 290
806 3300049588 Ga0501072_0034531 Ga0501072_0034531_2725_3621 290
807 3300049590 Ga0501074_0160831 Ga0501074_0160831_362_1258 290
808 3300049591 Ga0501075_0002773 Ga0501075_0002773_7466_8353 290
809 3300049592 Ga0501076_0078601 Ga0501076_0078601_810_1697 290
810 3300049593 Ga0501077_0076340 Ga0501077_0076340_1016_1903 290
811 3300049741 Ga0501079_0014654 Ga0501079_0014654_951_1838 290
812 3300049742 Ga0501080_0051831 Ga0501080_0051831_2900_3787 290
813 3300049743 Ga0501081_0016163 Ga0501081_0016163_329_1216 290
814 3300049744 Ga0501083_0112514 Ga0501083_0112514_859_1746 290
815 3300049824 Ga0501045_0070695 Ga0501045_0070695_755_1651 290
816 3300050507 nmdc:mga05p37_14121_c1 nmdc:mga05p37_14121_c1_3677_4558 290
817 3300050508 nmdc:mga09592_11227_c1 nmdc:mga09592_11227_c1_1034_1915 290
818 3300050510 nmdc:mga06r32_12345_c1 nmdc:mga06r32_12345_c1_3807_4688 290
819 3300053090 Ga0500646_0000070 Ga0500646_0000070_4492_5382 290
820 3300053092 Ga0500583_0006147 Ga0500583_0006147_634_1524 290
821 3300053104 Ga0500556_0001268 Ga0500556_0001268_6885_7757 290
822 3300053117 Ga0500593_000433 Ga0500593_000433_5452_6324 290
823 3300053139 Ga0500568_0081996 Ga0500568_0081996_191_1063 290
824 3300053146 Ga0500588_0010241 Ga0500588_0010241_360_1250 290
825 3300054114 Ga0501084_0017512 Ga0501084_0017512_4220_5107 290
826 3300060353 Ga0501082_0015875 Ga0501082_0015875_888_1775 290
827 3300061734 Ga0530510_0013642 Ga0530510_0013642_3979_4866 290
828 3300003373 JGI25407J50210_10019322 JGI25407J50210_100193222 291
829 3300005344 Ga0070661_100181116 Ga0070661_1001811161 291
830 3300005434 Ga0070709_10007326 Ga0070709_100073263 291
831 3300005439 Ga0070711_100027816 Ga0070711_1000278162 291
832 3300005467 Ga0070706_100095470 Ga0070706_1000954701 291
833 3300005468 Ga0070707_100025347 Ga0070707_1000253474 291
834 3300005471 Ga0070698_100014157 Ga0070698_1000141577 291
835 3300005577 Ga0068857_100510562 Ga0068857_1005105621 291
836 3300005937 Ga0081455_10008314 Ga0081455_1000831411 291
837 3300005981 Ga0081538_10001977 Ga0081538_1000197711 291
838 3300005981 Ga0081538_10003089 Ga0081538_100030895 291
839 3300006028 Ga0070717_10083758 Ga0070717_100837582 291
840 3300006844 Ga0075428_100071186 Ga0075428_1000711864 291
841 3300006846 Ga0075430_100066631 Ga0075430_1000666312 291
842 3300006880 Ga0075429_100059512 Ga0075429_1000595123 291
843 3300009147 Ga0114129_10321087 Ga0114129_103210872 291
844 3300025906 Ga0207699_10001338 Ga0207699_100013388 291
845 3300025922 Ga0207646_10040503 Ga0207646_100405033 291
846 3300025928 Ga0207700_10108358 Ga0207700_101083582 291
847 3300025929 Ga0207664_10021473 Ga0207664_100214733 291
848 3300035086 Ga0373934_0017411 Ga0373934_0017411_1388_2290 291
849 3300035113 Ga0373936_0028672 Ga0373936_0028672_1101_2003 291
850 3300035119 Ga0373956_0018268 Ga0373956_0018268_277_1179 291
851 3300035172 Ga0373955_0030668 Ga0373955_0030668_1703_2605 291
852 3300036401 Ga0373937_0132729 Ga0373937_0132729_105_1007 291
853 3300042005 Ga0439448_0001608 Ga0439448_0001608_707_1600 291
854 3300042008 Ga0439450_000461 Ga0439450_000461_1526_2419 291
855 3300042016 Ga0439463_005356 Ga0439463_005356_1071_1964 291
856 3300042439 Ga0439464_0001366 Ga0439464_0001366_2676_3569 291
857 3300042461 Ga0439460_0002958 Ga0439460_0002958_1992_2885 291
858 3300042993 Ga0439440_0002719 Ga0439440_0002719_210_1103 291
859 3300045976 Ga0466967_0084313 Ga0466967_0084313_1129_2019 291
860 3300046462 Ga0495651_0009060 Ga0495651_0009060_5133_6035 291
861 3300046463 Ga0495653_0037340 Ga0495653_0037340_1489_2391 291
862 3300046511 Ga0495608_0017087 Ga0495608_0017087_4013_4915 291
863 3300046516 Ga0495628_0017244 Ga0495628_0017244_3501_4403 291
864 3300046531 Ga0495665_0035237 Ga0495665_0035237_757_1659 291
865 3300046535 Ga0495586_0083048 Ga0495586_0083048_321_1223 291
866 3300046536 Ga0495587_0015541 Ga0495587_0015541_466_1368 291
867 3300046543 Ga0495645_0017763 Ga0495645_0017763_1597_2499 291
868 3300046559 Ga0495667_0024606 Ga0495667_0024606_1425_2327 291
869 3300046615 Ga0495656_0026587 Ga0495656_0026587_1185_2081 291
870 3300046642 Ga0495634_0052817 Ga0495634_0052817_60_962 291
871 3300046642 Ga0495634_0141493 Ga0495634_0141493_247_1188 291
872 3300046680 Ga0495646_0022376 Ga0495646_0022376_64_966 291
873 3300046809 Ga0495600_0050119 Ga0495600_0050119_47_949 291
874 3300047317 Ga0495604_0030524 Ga0495604_0030524_1937_2839 291
875 3300047319 Ga0495674_0042198 Ga0495674_0042198_3074_3976 291
876 3300047322 Ga0495680_0006180 Ga0495680_0006180_3439_4341 291
877 3300047471 Ga0495684_0010668 Ga0495684_0010668_5099_6001 291
878 3300049591 Ga0501075_0025237 Ga0501075_0025237_1646_2539 291
879 3300049592 Ga0501076_0140147 Ga0501076_0140147_153_1046 291
880 3300049593 Ga0501077_0058055 Ga0501077_0058055_1297_2190 291
881 3300049741 Ga0501079_0019809 Ga0501079_0019809_1353_2246 291
882 3300050507 nmdc:mga05p37_214526_c1 nmdc:mga05p37_214526_c1_299_1192 291
883 3300053078 Ga0495612_0006871 Ga0495612_0006871_1933_2874 291
884 3300061734 Ga0530510_0059472 Ga0530510_0059472_1855_2748 291
885 3300006175 Ga0070712_100089727 Ga0070712_1000897274 292
886 3300010375 Ga0105239_10485530 Ga0105239_104855301 292
887 3300025915 Ga0207693_10058853 Ga0207693_100588534 292
888 3300025916 Ga0207663_10262990 Ga0207663_102629901 292
889 3300025928 Ga0207700_10272069 Ga0207700_102720692 292
890 3300025929 Ga0207664_10114621 Ga0207664_101146212 292
891 3300025939 Ga0207665_10112795 Ga0207665_101127952 292
892 3300046454 Ga0495592_0071860 Ga0495592_0071860_560_1504 292
893 3300046462 Ga0495651_0001532 Ga0495651_0001532_15014_15943 292
894 3300046477 Ga0495664_0086409 Ga0495664_0086409_628_1572 292
895 3300046529 Ga0495652_0000860 Ga0495652_0000860_20556_21500 292
896 3300046678 Ga0495599_0047684 Ga0495599_0047684_55_1044 292
897 3300046679 Ga0495623_0080263 Ga0495623_0080263_107_1036 292
898 3300046680 Ga0495646_0022028 Ga0495646_0022028_2160_3104 292
899 3300053085 Ga0495619_0064338 Ga0495619_0064338_444_1373 292
900 3300005347 Ga0070668_100497742 Ga0070668_1004977421 293
901 3300005535 Ga0070684_100451804 Ga0070684_1004518042 293
902 3300005548 Ga0070665_100071319 Ga0070665_1000713193 293
903 3300006051 Ga0075364_10065617 Ga0075364_100656174 293
904 3300009148 Ga0105243_10070227 Ga0105243_100702272 293
905 3300014326 Ga0157380_10202063 Ga0157380_102020632 293
906 3300025919 Ga0207657_10055424 Ga0207657_100554242 293
907 3300025932 Ga0207690_10464201 Ga0207690_104642011 293
908 3300026121 Ga0207683_10133058 Ga0207683_101330582 293
909 3300030521 Ga0307511_10058350 Ga0307511_100583502 293
910 3300031507 Ga0307509_10081585 Ga0307509_100815852 293
911 3300032002 Ga0307416_100355555 Ga0307416_1003555552 293
912 3300044656 Ga0466969_0028088 Ga0466969_0028088_111_1100 293
913 3300044693 Ga0466961_0064737 Ga0466961_0064737_1197_2186 293
914 3300044719 Ga0466971_0001527 Ga0466971_0001527_6487_7476 293
915 3300044901 Ga0466960_0021272 Ga0466960_0021272_692_1573 293
916 3300045049 Ga0466959_0001241 Ga0466959_0001241_149_1138 293
917 3300045836 Ga0466958_0126851 Ga0466958_0126851_251_1240 293
918 3300046663 Ga0495635_0000244 Ga0495635_0000244_20401_21342 293
919 3300046809 Ga0495600_0100703 Ga0495600_0100703_695_1636 293
920 3300048909 Ga0496106_0235756 Ga0496106_0235756_310_1233 293
921 3300049584 Ga0501068_0161682 Ga0501068_0161682_341_1222 293
922 3300049585 Ga0501069_0307637 Ga0501069_0307637_35_916 293
923 3300050490 nmdc:mga03n38_49012_c1 nmdc:mga03n38_49012_c1_761_1642 293
924 3300050491 nmdc:mga00v17_40489_c1 nmdc:mga00v17_40489_c1_1386_2267 293
925 3300061719 Ga0466962_0000273 Ga0466962_0000273_6365_7354 293
926 3300000549 LJQas_1005976 LJQas_10059762 294
927 3300005985 Ga0081539_10000356 Ga0081539_1000035676 294
928 3300031852 Ga0307410_10117772 Ga0307410_101177722 294
929 3300031903 Ga0307407_10058484 Ga0307407_100584842 294
930 3300031995 Ga0307409_100043096 Ga0307409_1000430964 294
931 3300032002 Ga0307416_100068131 Ga0307416_1000681312 294
932 3300032126 Ga0307415_100162331 Ga0307415_1001623311 294
933 3300044693 Ga0466961_0013279 Ga0466961_0013279_1129_2028 294
934 3300044693 Ga0466961_0134553 Ga0466961_0134553_316_1227 294
935 3300044694 Ga0466963_0063032 Ga0466963_0063032_177_1076 294
936 3300044706 Ga0466964_0069989 Ga0466964_0069989_376_1275 294
937 3300044842 Ga0466957_0078189 Ga0466957_0078189_180_1079 294
938 3300044901 Ga0466960_0054179 Ga0466960_0054179_286_1197 294
939 3300045976 Ga0466967_0005879 Ga0466967_0005879_4034_4933 294
940 3300061719 Ga0466962_0021274 Ga0466962_0021274_490_1389 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

73

309

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o6r-assembly1.cif.gz_D crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia 0.9595 15 260
6mvs-assembly1.cif.gz_A structure of a bacterial aldh16 complexed with nad 0.9564 10 293
6mvu-assembly1.cif.gz_A structure of a bacterial aldh16 active site mutant c295a complexed with p-nitrophenylacetate 0.9549 10 294
4nmk-assembly3.cif.gz_F thermostable aldehyde dehydrogenase from pyrobaculum sp. crystallized in microgravity (complex with nadp+) 0.9532 15 260
1zum-assembly3.cif.gz_L human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, apo form 0.9522 15 237
ID Description Score Start End Superfamily
af_F1QGP1_508_771_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9693 10 264 3.40.605.10
af_A0A0R0ESV8_56_300_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9538 15 235 3.40.605.10
af_Q9URW9_34_486_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9508 30 260 3.40.605.10
af_O33340_2_231_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9489 30 264 3.40.605.10
af_O33340_2_445_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9454 30 260 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1N7ABV7-F1-model_v4 Aldehyde dehydrogenase family protein 0.9746 6 294 GO:0016491
AF-B5GSY3-F1-model_v4 deleted 0.9722 1 293
AF-A0A6N3JYY5-F1-model_v4 Aldehyde dehydrogenase family protein 0.9715 8 294 GO:0016491
AF-A0A3S2A0W8-F1-model_v4 Aldehyde dehydrogenase family protein 0.9707 34 221 GO:0016491
AF-A0A1N7ABV7-F1-model_v4 Aldehyde dehydrogenase family protein 0.9676 6 294 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map