F486292

General Info

Members Datasets Scaffolds Average Seq Length
939 416 938 295

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0045152|Ga0495629_0045152_1992_2867
Length 291
Sequence MIRVSKIAHAAYETPDLNQQTEYYTEIIGLTLAAQEKDTVYLASTVDHHAVVLRKGSQAQCTRIGFQIPPSADLDEFQKQVASHGVVTERRKNAEPSISDMLVFKDPKGTVFKRDDFSHQKFQSKGIVPYKLGHVAFHVADVKHVTKFYCDVLGFRESDWMGDFFSFLRCGPDHHTINLMETGANRHFHTAFELRDWAHMQQACDFLSLHGYKLLWGPGRHGIGHNLFAYHRAPNGLITETFAELDRMNEELGYFEPRPWHRDHPQRPKVWVKDPSAANLWGILPSDEMMK

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
152 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
229 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
240 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
241 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
242 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
243 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
244 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
245 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
246 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
247 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
265 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
266 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
267 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
279 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
280 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
313 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
379 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
380 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
381 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
392 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
393 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
394 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
395 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
396 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
397 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
398 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
401 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
402 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
403 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
404 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
405 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
406 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
407 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
408 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
409 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
410 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
411 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
414 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
415 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
416 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 0
Rhizoplane 8.31
Rhizosphere 87.86
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745235 2209111006 Bacteria 3605
2 ARSoilYngRDRAFT_c00289 3300000042 Bacteria 7363
3 ARcpr5yngRDRAFT_c000271 3300000043 Bacteria 7411
4 ARSoilOldRDRAFT_c000295 3300000044 Bacteria 6988
5 ARCol0yngRDRAFT_1000053 3300000652 Bacteria 20284
6 JGI24740J21852_10014159 3300001979 Bacteria 2953
7 JGI24737J22298_10002175 3300001990 Bacteria 6980
8 JGI24750J21931_1000807 3300002070 Bacteria 4345
9 JGI24750J21931_1002444 3300002070 Bacteria 2238
10 JGI24748J21848_1001444 3300002074 Bacteria 2616
11 JGI24738J21930_10003423 3300002075 Bacteria 4004
12 JGI24749J21850_1005224 3300002076 Bacteria 1822
13 JGI24744J21845_10001325 3300002077 Bacteria 4886
14 JGI24033J26618_1002454 3300002155 Unclassified 1900
15 JGI24034J26672_10000436 3300002239 Bacteria 5413
16 JGI24742J22300_10000131 3300002244 Bacteria 10972
17 JGI24742J22300_10007537 3300002244 Bacteria 1796
18 JGI25406J46586_10010069 3300003203 Bacteria 4211
19 JGI25405J52794_10017289 3300003911 Bacteria 1431
20 Ga0065716_1002255 3300005277 Bacteria 2031
21 Ga0065704_10101333 3300005289 Bacteria 2241
22 Ga0065712_10006389 3300005290 Unclassified 4475
23 Ga0065712_10020432 3300005290 Bacteria 1802
24 Ga0065715_10000953 3300005293 Bacteria 11199
25 Ga0065715_10006553 3300005293 Bacteria 4537
26 Ga0065707_10113298 3300005295 Bacteria 2332
27 Ga0070676_10008398 3300005328 Bacteria 5565
28 Ga0070676_10027396 3300005328 Bacteria 3232
29 Ga0070683_100001740 3300005329 Bacteria 16946
30 Ga0070690_100005830 3300005330 Bacteria 6942
31 Ga0070690_100071996 3300005330 Bacteria 2247
32 Ga0070670_100023972 3300005331 Bacteria 5249
33 Ga0070670_100026485 3300005331 Bacteria 4988
34 Ga0070677_10000553 3300005333 Bacteria 12761
35 Ga0068869_100004139 3300005334 Bacteria 8994
36 Ga0068869_100028847 3300005334 Bacteria 3881
37 Ga0068869_100059369 3300005334 Bacteria 2800
38 Ga0068869_100224315 3300005334 Bacteria 1491
39 Ga0070666_10021676 3300005335 Bacteria 4163
40 Ga0070666_10073203 3300005335 Bacteria 2334
41 Ga0070680_100002899 3300005336 Bacteria 12742
42 Ga0070680_100013552 3300005336 Bacteria 6353
43 Ga0070682_100044407 3300005337 Bacteria 2751
44 Ga0070682_100196384 3300005337 Bacteria 1420
45 Ga0068868_100005781 3300005338 Bacteria 8712
46 Ga0068868_100073271 3300005338 Bacteria 2734
47 Ga0070660_100001515 3300005339 Bacteria 15924
48 Ga0070660_100198358 3300005339 Unclassified 1627
49 Ga0070689_100001241 3300005340 Bacteria 16240
50 Ga0070691_10064595 3300005341 Unclassified 1766
51 Ga0070687_100002230 3300005343 Bacteria 7186
52 Ga0070687_100093250 3300005343 Bacteria 1670
53 Ga0070661_100012739 3300005344 Bacteria 5886
54 Ga0070661_100056802 3300005344 Bacteria 2868
55 Ga0070692_10006992 3300005345 Bacteria 4944
56 Ga0070692_10008859 3300005345 Bacteria 4507
57 Ga0070692_10156883 3300005345 Bacteria 1301
58 Ga0070668_100002506 3300005347 Bacteria 13524
59 Ga0070668_100066945 3300005347 Bacteria 2789
60 Ga0070668_100344455 3300005347 Bacteria 1260
61 Ga0070668_100352522 3300005347 Unclassified 1246
62 Ga0070669_100000743 3300005353 Bacteria 23727
63 Ga0070675_100001086 3300005354 Bacteria 19628
64 Ga0070675_100162845 3300005354 Bacteria 1919
65 Ga0070675_100196384 3300005354 Bacteria 1750
66 Ga0070671_100004095 3300005355 Bacteria 11513
67 Ga0070671_100006476 3300005355 Bacteria 9362
68 Ga0070671_100052468 3300005355 Bacteria 3390
69 Ga0070671_100176242 3300005355 Bacteria 1809
70 Ga0070674_100063066 3300005356 Bacteria 2592
71 Ga0070674_100541386 3300005356 Bacteria 975
72 Ga0070673_100000419 3300005364 Bacteria 22441
73 Ga0070688_100003465 3300005365 Bacteria 8123
74 Ga0070659_100007008 3300005366 Bacteria 8163
75 Ga0070659_100022088 3300005366 Bacteria 4855
76 Ga0070659_100055244 3300005366 Bacteria 3128
77 Ga0070667_100279960 3300005367 Bacteria 1497
78 Ga0070703_10001244 3300005406 Bacteria 7745
79 Ga0070703_10004556 3300005406 Bacteria 3895
80 Ga0070709_10011868 3300005434 Bacteria 4864
81 Ga0070709_10021857 3300005434 Plasmid 3734
82 Ga0070709_10042462 3300005434 Bacteria 2808
83 Ga0070709_10073099 3300005434 Unclassified 2219
84 Ga0070714_100004331 3300005435 Bacteria 10704
85 Ga0070714_100087894 3300005435 Bacteria 2718
86 Ga0070714_100203326 3300005435 Unclassified 1812
87 Ga0070713_100005705 3300005436 Bacteria 8548
88 Ga0070713_100016797 3300005436 Bacteria 5512
89 Ga0070713_100023528 3300005436 Bacteria 4782
90 Ga0070713_100031744 3300005436 Bacteria 4210
91 Ga0070713_100121641 3300005436 Bacteria 2290
92 Ga0070713_100167706 3300005436 Bacteria 1965
93 Ga0070713_100364987 3300005436 Bacteria 1342
94 Ga0070710_10000528 3300005437 Bacteria 18021
95 Ga0070710_10004305 3300005437 Bacteria 6747
96 Ga0070710_10008141 3300005437 Bacteria 5096
97 Ga0070710_10068466 3300005437 Bacteria 2040
98 Ga0070710_10075948 3300005437 Bacteria 1948
99 Ga0070701_10000365 3300005438 Bacteria 15115
100 Ga0070701_10007962 3300005438 Bacteria 4560
101 Ga0070701_10059982 3300005438 Bacteria 2002
102 Ga0070711_100003401 3300005439 Bacteria 9271
103 Ga0070711_100021147 3300005439 Bacteria 4204
104 Ga0070711_100039114 3300005439 Bacteria 3192
105 Ga0070711_100073866 3300005439 Bacteria 2411
106 Ga0070711_100363821 3300005439 Bacteria 1166
107 Ga0070705_100001329 3300005440 Bacteria 13221
108 Ga0070705_100001964 3300005440 Bacteria 10518
109 Ga0070700_100008089 3300005441 Bacteria 5715
110 Ga0070700_100008776 3300005441 Bacteria 5520
111 Ga0070700_100065982 3300005441 Bacteria 2296
112 Ga0070694_100002737 3300005444 Bacteria 10459
113 Ga0070694_100021203 3300005444 Bacteria 4148
114 Ga0070694_100180133 3300005444 Bacteria 1562
115 Ga0070708_100041374 3300005445 Bacteria 4040
116 Ga0070663_100019174 3300005455 Bacteria 4502
117 Ga0070663_100217857 3300005455 Bacteria 1497
118 Ga0070678_100005723 3300005456 Bacteria 7220
119 Ga0070678_100083622 3300005456 Bacteria 2427
120 Ga0070678_100202717 3300005456 Bacteria 1638
121 Ga0070662_100025249 3300005457 Bacteria 4101
122 Ga0070662_100180533 3300005457 Bacteria 1663
123 Ga0070681_10010311 3300005458 Bacteria 9223
124 Ga0070681_10019665 3300005458 Bacteria 6763
125 Ga0070681_10189278 3300005458 Bacteria 1978
126 Ga0068867_100000980 3300005459 Bacteria 19509
127 Ga0070685_10014838 3300005466 Bacteria 4132
128 Ga0070685_10015980 3300005466 Bacteria 3993
129 Ga0070706_100361152 3300005467 Bacteria 1353
130 Ga0070706_100563484 3300005467 Bacteria 1059
131 Ga0070699_100000444 3300005518 Bacteria 39757
132 Ga0070699_100001276 3300005518 Bacteria 23203
133 Ga0070679_100004363 3300005530 Bacteria 13070
134 Ga0070684_100013266 3300005535 Bacteria 6639
135 Ga0070684_100053185 3300005535 Bacteria 3524
136 Ga0070684_100233276 3300005535 Bacteria 1680
137 Ga0070697_100017942 3300005536 Bacteria 5575
138 Ga0070697_100066086 3300005536 Bacteria 2957
139 Ga0070697_100273340 3300005536 Unclassified 1449
140 Ga0068853_100006929 3300005539 Bacteria 9049
141 Ga0070672_100002302 3300005543 Bacteria 12059
142 Ga0070672_100055215 3300005543 Bacteria 3111
143 Ga0070686_100012378 3300005544 Bacteria 4856
144 Ga0070686_100014304 3300005544 Bacteria 4572
145 Ga0070686_100017776 3300005544 Bacteria 4161
146 Ga0070695_100000918 3300005545 Bacteria 15891
147 Ga0070695_100012338 3300005545 Bacteria 5123
148 Ga0070696_100000123 3300005546 Bacteria 40797
149 Ga0070696_100002724 3300005546 Bacteria 11729
150 Ga0070696_100221935 3300005546 Unclassified 1418
151 Ga0070693_100001476 3300005547 Bacteria 10590
152 Ga0070704_100000095 3300005549 Bacteria 30467
153 Ga0070704_100037262 3300005549 Bacteria 3321
154 Ga0068855_100066013 3300005563 Bacteria 4219
155 Ga0068855_100279563 3300005563 Bacteria 1854
156 Ga0070664_100105237 3300005564 Bacteria 2457
157 Ga0070664_100353332 3300005564 Bacteria 1337
158 Ga0068857_100002177 3300005577 Bacteria 15935
159 Ga0068857_100011660 3300005577 Bacteria 7645
160 Ga0068857_100087240 3300005577 Bacteria 2791
161 Ga0068856_100003552 3300005614 Bacteria 15701
162 Ga0068856_100058287 3300005614 Bacteria 3813
163 Ga0068856_100227952 3300005614 Bacteria 1879
164 Ga0070702_100016382 3300005615 Bacteria 3801
165 Ga0070702_100018984 3300005615 Bacteria 3576
166 Ga0070702_100087978 3300005615 Bacteria 1877
167 Ga0068852_100051926 3300005616 Bacteria 3522
168 Ga0068859_100001820 3300005617 Bacteria 21717
169 Ga0068859_100005818 3300005617 Bacteria 12522
170 Ga0068859_100063245 3300005617 Bacteria 3731
171 Ga0068864_100000140 3300005618 Bacteria 69827
172 Ga0068864_100230813 3300005618 Bacteria 1711
173 Ga0068866_10001684 3300005718 Bacteria 9307
174 Ga0068866_10204219 3300005718 Bacteria 1182
175 Ga0068861_100013494 3300005719 Bacteria 5719
176 Ga0068861_100095034 3300005719 Bacteria 2360
177 Ga0068851_10033291 3300005834 Bacteria 2569
178 Ga0068870_10000654 3300005840 Bacteria 13203
179 Ga0068863_100000425 3300005841 Bacteria 42737
180 Ga0068863_100027701 3300005841 Bacteria 5406
181 Ga0068858_100095071 3300005842 Bacteria 2776
182 Ga0068858_100167557 3300005842 Bacteria 2070
183 Ga0068860_100002696 3300005843 Bacteria 18484
184 Ga0068860_100064786 3300005843 Bacteria 3470
185 Ga0068862_100020271 3300005844 Bacteria 5554
186 Ga0068862_100089132 3300005844 Bacteria 2684
187 Ga0081455_10001118 3300005937 Bacteria 33528
188 Ga0081455_10011426 3300005937 Bacteria 8924
189 Ga0081455_10088394 3300005937 Bacteria 2518
190 Ga0081538_10002263 3300005981 Bacteria 19045
191 Ga0081538_10060249 3300005981 Bacteria 2185
192 Ga0081540_1000192 3300005983 Bacteria 63477
193 Ga0081540_1006947 3300005983 Bacteria 8157
194 Ga0081540_1024775 3300005983 Bacteria 3473
195 Ga0081540_1039437 3300005983 Bacteria 2476
196 Ga0081540_1058554 3300005983 Bacteria 1855
197 Ga0081539_10001465 3300005985 Bacteria 40018
198 Ga0070717_10001340 3300006028 Bacteria 16925
199 Ga0070717_10011028 3300006028 Bacteria 6845
200 Ga0070717_10044248 3300006028 Bacteria 3635
201 Ga0075365_10025752 3300006038 Bacteria 3727
202 Ga0075365_10032144 3300006038 Bacteria 3371
203 Ga0075365_10261035 3300006038 Bacteria 1218
204 Ga0075363_100071859 3300006048 Bacteria 1881
205 Ga0075363_100243829 3300006048 Bacteria 1033
206 Ga0075364_10209762 3300006051 Bacteria 1321
207 Ga0075432_10094301 3300006058 Bacteria 1099
208 Ga0070715_10000357 3300006163 Bacteria 11390
209 Ga0070715_10012668 3300006163 Unclassified 3076
210 Ga0070715_10024931 3300006163 Bacteria 2363
211 Ga0070716_100044490 3300006173 Bacteria 2488
212 Ga0070712_100001277 3300006175 Bacteria 15195
213 Ga0070712_100008584 3300006175 Bacteria 6429
214 Ga0070712_100115819 3300006175 Bacteria 2009
215 Ga0070712_100195653 3300006175 Bacteria 1585
216 Ga0070712_100206962 3300006175 Bacteria 1545
217 Ga0070712_100207459 3300006175 Bacteria 1543
218 Ga0070712_100263486 3300006175 Bacteria 1382
219 Ga0070712_100477325 3300006175 Bacteria 1042
220 Ga0075362_10050487 3300006177 Bacteria 1860
221 Ga0075367_10039252 3300006178 Bacteria 2760
222 Ga0075367_10082303 3300006178 Bacteria 1949
223 Ga0097621_100002131 3300006237 Bacteria 13540
224 Ga0075370_10071803 3300006353 Bacteria 1981
225 Ga0068871_100008325 3300006358 Bacteria 7455
226 Ga0075428_100019702 3300006844 Bacteria 7465
227 Ga0075428_100028244 3300006844 Bacteria 6204
228 Ga0075428_100610295 3300006844 Bacteria 1165
229 Ga0075430_100014084 3300006846 Bacteria 6818
230 Ga0075430_100037162 3300006846 Bacteria 4129
231 Ga0075430_100041065 3300006846 Bacteria 3914
232 Ga0075430_100060072 3300006846 Bacteria 3195
233 Ga0075430_100077840 3300006846 Bacteria 2780
234 Ga0075431_100004314 3300006847 Bacteria 13935
235 Ga0075431_100017715 3300006847 Bacteria 7242
236 Ga0075431_100021672 3300006847 Bacteria 6571
237 Ga0075431_100246339 3300006847 Bacteria 1817
238 Ga0075433_10140634 3300006852 Bacteria 2145
239 Ga0075433_10148169 3300006852 Bacteria 2087
240 Ga0075434_100021735 3300006871 Bacteria 6239
241 Ga0075434_100034873 3300006871 Bacteria 4973
242 Ga0075434_100058688 3300006871 Bacteria 3824
243 Ga0075434_100183079 3300006871 Bacteria 2116
244 Ga0075434_100358577 3300006871 Bacteria 1479
245 Ga0075429_100155580 3300006880 Bacteria 2002
246 Ga0075429_100218808 3300006880 Bacteria 1668
247 Ga0075429_100431945 3300006880 Bacteria 1154
248 Ga0068865_100001142 3300006881 Bacteria 15394
249 Ga0068865_100036778 3300006881 Bacteria 3303
250 Ga0068865_100093528 3300006881 Bacteria 2186
251 Ga0068865_100112799 3300006881 Bacteria 2009
252 Ga0068865_100126065 3300006881 Bacteria 1911
253 Ga0075436_100093284 3300006914 Unclassified 2093
254 Ga0075436_100102002 3300006914 Bacteria 1998
255 Ga0097620_100001820 3300006931 Bacteria 21717
256 Ga0097620_100005818 3300006931 Bacteria 12522
257 Ga0097620_100063246 3300006931 Bacteria 3731
258 Ga0097620_100316806 3300006931 Bacteria 1653
259 Ga0075435_100022544 3300007076 Bacteria 4859
260 Ga0075435_100125934 3300007076 Bacteria 2141
261 Ga0099794_10036502 3300007265 Bacteria 2324
262 Ga0105250_10032989 3300009092 Bacteria 2078
263 Ga0105240_10109955 3300009093 Bacteria 3336
264 Ga0105240_10175329 3300009093 Bacteria 2535
265 Ga0111539_10006796 3300009094 Bacteria 14718
266 Ga0111539_10014173 3300009094 Bacteria 9954
267 Ga0111539_10081343 3300009094 Bacteria 3810
268 Ga0111539_10188463 3300009094 Bacteria 2407
269 Ga0111539_10479910 3300009094 Bacteria 1448
270 Ga0111539_10499868 3300009094 Bacteria 1416
271 Ga0111539_10568213 3300009094 Bacteria 1321
272 Ga0111539_10803476 3300009094 Bacteria 1095
273 Ga0105245_10000867 3300009098 Bacteria 27426
274 Ga0105245_10023386 3300009098 Bacteria 5424
275 Ga0105247_10116603 3300009101 Bacteria 1725
276 Ga0114129_10017149 3300009147 Bacteria 10313
277 Ga0114129_10041031 3300009147 Bacteria 6523
278 Ga0114129_10045872 3300009147 Bacteria 6143
279 Ga0114129_10080861 3300009147 Bacteria 4517
280 Ga0114129_10172654 3300009147 Bacteria 2946
281 Ga0114129_10233581 3300009147 Bacteria 2476
282 Ga0114129_10329811 3300009147 Bacteria 2026
283 Ga0114129_10504452 3300009147 Bacteria 1580
284 Ga0105243_10002939 3300009148 Bacteria 14095
285 Ga0105243_10018773 3300009148 Bacteria 5238
286 Ga0105243_10143444 3300009148 Bacteria 2040
287 Ga0105241_10007866 3300009174 Bacteria 7838
288 Ga0105241_10036622 3300009174 Bacteria 3693
289 Ga0105241_10172341 3300009174 Bacteria 1788
290 Ga0105242_10001899 3300009176 Bacteria 16415
291 Ga0105242_10014951 3300009176 Bacteria 6016
292 Ga0105242_10064165 3300009176 Bacteria 3026
293 Ga0105248_10003521 3300009177 Bacteria 17366
294 Ga0105248_10029630 3300009177 Bacteria 6106
295 Ga0105237_10102889 3300009545 Bacteria 2848
296 Ga0105237_10135063 3300009545 Bacteria 2461
297 Ga0105237_10139250 3300009545 Unclassified 2421
298 Ga0105238_10037311 3300009551 Bacteria 4940
299 Ga0105238_10119701 3300009551 Bacteria 2613
300 Ga0105238_10146147 3300009551 Bacteria 2341
301 Ga0105249_10002047 3300009553 Bacteria 17494
302 Ga0105249_10002541 3300009553 Bacteria 15787
303 Ga0105249_10553691 3300009553 Bacteria 1201
304 Ga0105239_10021557 3300010375 Bacteria 7104
305 Ga0105239_10037616 3300010375 Bacteria 5303
306 Ga0105246_10001875 3300011119 Bacteria 12676
307 Ga0157342_1006643 3300012507 Unclassified 1101
308 Ga0157373_10100959 3300013100 Bacteria 2030
309 Ga0157373_10248718 3300013100 Bacteria 1257
310 Ga0157374_10001408 3300013296 Bacteria 20396
311 Ga0157374_10110998 3300013296 Bacteria 2637
312 Ga0157374_10214333 3300013296 Unclassified 1889
313 Ga0157378_10004977 3300013297 Bacteria 11652
314 Ga0157378_10246279 3300013297 Unclassified 1709
315 Ga0163162_10011093 3300013306 Bacteria 8778
316 Ga0163162_10012257 3300013306 Bacteria 8366
317 Ga0163162_10130425 3300013306 Bacteria 2622
318 Ga0163162_10295032 3300013306 Bacteria 1753
319 Ga0157372_10017879 3300013307 Bacteria 7617
320 Ga0157372_10770034 3300013307 Unclassified 1119
321 Ga0157375_10001932 3300013308 Bacteria 17830
322 Ga0157375_10113004 3300013308 Bacteria 2817
323 Ga0163163_10034835 3300014325 Bacteria 4880
324 Ga0163163_10301099 3300014325 Bacteria 1656
325 Ga0163163_10352355 3300014325 Bacteria 1528
326 Ga0157380_10014641 3300014326 Bacteria 5744
327 Ga0157380_10018915 3300014326 Bacteria 5124
328 Ga0157380_10157568 3300014326 Bacteria 1969
329 Ga0157380_10202861 3300014326 Bacteria 1761
330 Ga0157377_10000486 3300014745 Bacteria 17037
331 Ga0157377_10039708 3300014745 Bacteria 2605
332 Ga0157379_10006828 3300014968 Bacteria 9862
333 Ga0157379_10057193 3300014968 Bacteria 3485
334 Ga0157379_10133136 3300014968 Unclassified 2238
335 Ga0157376_10068143 3300014969 Bacteria 3012
336 Ga0157376_10709013 3300014969 Bacteria 1012
337 Ga0213872_10028413 3300021361 Bacteria 2565
338 Ga0213876_10033035 3300021384 Bacteria 2728
339 Ga0213875_10000003 3300021388 Bacteria 719367
340 Ga0207666_1000089 3300025271 Bacteria 14639
341 Ga0207673_1002235 3300025290 Bacteria 2187
342 Ga0207697_10000993 3300025315 Bacteria 15866
343 Ga0207656_10049715 3300025321 Bacteria 1809
344 Ga0207653_10008690 3300025885 Bacteria 3167
345 Ga0207682_10000104 3300025893 Bacteria 38531
346 Ga0207692_10000076 3300025898 Bacteria 28507
347 Ga0207692_10026416 3300025898 Bacteria 2724
348 Ga0207642_10001116 3300025899 Bacteria 8305
349 Ga0207710_10088660 3300025900 Bacteria 1445
350 Ga0207688_10001265 3300025901 Bacteria 13115
351 Ga0207688_10002264 3300025901 Bacteria 10360
352 Ga0207688_10029868 3300025901 Bacteria 3004
353 Ga0207680_10006968 3300025903 Bacteria 5482
354 Ga0207680_10018072 3300025903 Bacteria 3739
355 Ga0207647_10001528 3300025904 Bacteria 17815
356 Ga0207647_10060693 3300025904 Bacteria 2311
357 Ga0207647_10258746 3300025904 Bacteria 997
358 Ga0207685_10020579 3300025905 Bacteria 2196
359 Ga0207685_10028679 3300025905 Unclassified 1963
360 Ga0207699_10008588 3300025906 Bacteria 5049
361 Ga0207699_10111324 3300025906 Bacteria 1755
362 Ga0207699_10164078 3300025906 Bacteria 1481
363 Ga0207699_10270969 3300025906 Bacteria 1176
364 Ga0207645_10002130 3300025907 Bacteria 15831
365 Ga0207645_10070174 3300025907 Bacteria 2241
366 Ga0207643_10000035 3300025908 Bacteria 90905
367 Ga0207643_10002863 3300025908 Bacteria 9308
368 Ga0207684_10152225 3300025910 Bacteria 1990
369 Ga0207654_10026417 3300025911 Bacteria 3144
370 Ga0207707_10001935 3300025912 Bacteria 18839
371 Ga0207707_10046635 3300025912 Bacteria 3775
372 Ga0207707_10092137 3300025912 Bacteria 2648
373 Ga0207695_10038532 3300025913 Bacteria 5144
374 Ga0207693_10001480 3300025915 Bacteria 20759
375 Ga0207693_10001843 3300025915 Bacteria 18573
376 Ga0207693_10004775 3300025915 Bacteria 11395
377 Ga0207693_10008913 3300025915 Bacteria 8193
378 Ga0207693_10026826 3300025915 Plasmid 4557
379 Ga0207693_10057698 3300025915 Bacteria 3042
380 Ga0207693_10184433 3300025915 Bacteria 1643
381 Ga0207693_10200058 3300025915 Bacteria 1571
382 Ga0207693_10207692 3300025915 Bacteria 1539
383 Ga0207693_10229672 3300025915 Bacteria 1457
384 Ga0207663_10008697 3300025916 Bacteria 5328
385 Ga0207663_10090454 3300025916 Bacteria 2029
386 Ga0207663_10110263 3300025916 Bacteria 1866
387 Ga0207663_10172413 3300025916 Unclassified 1538
388 Ga0207663_10254950 3300025916 Bacteria 1293
389 Ga0207660_10000451 3300025917 Bacteria 27028
390 Ga0207660_10001146 3300025917 Bacteria 17678
391 Ga0207660_10032704 3300025917 Bacteria 3592
392 Ga0207662_10002323 3300025918 Bacteria 9527
393 Ga0207662_10060397 3300025918 Bacteria 2274
394 Ga0207657_10002025 3300025919 Bacteria 21900
395 Ga0207657_10024447 3300025919 Bacteria 5591
396 Ga0207649_10000309 3300025920 Bacteria 37243
397 Ga0207649_10308122 3300025920 Unclassified 1160
398 Ga0207652_10010263 3300025921 Bacteria 7538
399 Ga0207652_10058859 3300025921 Bacteria 3311
400 Ga0207646_10304826 3300025922 Bacteria 1439
401 Ga0207681_10001488 3300025923 Bacteria 15114
402 Ga0207694_10068334 3300025924 Bacteria 2775
403 Ga0207694_10144188 3300025924 Bacteria 1916
404 Ga0207694_10227863 3300025924 Bacteria 1521
405 Ga0207650_10006726 3300025925 Bacteria 7838
406 Ga0207650_10061427 3300025925 Bacteria 2806
407 Ga0207659_10000091 3300025926 Bacteria 53079
408 Ga0207659_10116261 3300025926 Bacteria 2042
409 Ga0207687_10000161 3300025927 Bacteria 45255
410 Ga0207687_10085640 3300025927 Bacteria 2287
411 Ga0207700_10002812 3300025928 Bacteria 10019
412 Ga0207700_10009232 3300025928 Bacteria 6151
413 Ga0207700_10096860 3300025928 Bacteria 2344
414 Ga0207700_10264668 3300025928 Bacteria 1473
415 Ga0207700_10393120 3300025928 Bacteria 1214
416 Ga0207700_10400254 3300025928 Bacteria 1203
417 Ga0207700_10527315 3300025928 Bacteria 1047
418 Ga0207664_10006249 3300025929 Bacteria 8182
419 Ga0207664_10011444 3300025929 Bacteria 6308
420 Ga0207664_10210631 3300025929 Bacteria 1681
421 Ga0207664_10236410 3300025929 Bacteria 1590
422 Ga0207644_10000245 3300025931 Bacteria 37122
423 Ga0207644_10052208 3300025931 Bacteria 2937
424 Ga0207644_10074056 3300025931 Bacteria 2498
425 Ga0207644_10105600 3300025931 Bacteria 2122
426 Ga0207690_10000771 3300025932 Bacteria 20713
427 Ga0207690_10088403 3300025932 Bacteria 2182
428 Ga0207706_10005499 3300025933 Bacteria 11813
429 Ga0207706_10012450 3300025933 Bacteria 7751
430 Ga0207706_10110642 3300025933 Bacteria 2416
431 Ga0207686_10001194 3300025934 Bacteria 15062
432 Ga0207686_10008989 3300025934 Bacteria 5408
433 Ga0207686_10040051 3300025934 Bacteria 2847
434 Ga0207709_10001001 3300025935 Bacteria 20987
435 Ga0207709_10075536 3300025935 Bacteria 2154
436 Ga0207709_10084032 3300025935 Bacteria 2060
437 Ga0207670_10000526 3300025936 Bacteria 21144
438 Ga0207670_10018175 3300025936 Bacteria 4267
439 Ga0207670_10090762 3300025936 Bacteria 2159
440 Ga0207670_10262025 3300025936 Bacteria 1340
441 Ga0207669_10011592 3300025937 Bacteria 4297
442 Ga0207704_10031210 3300025938 Bacteria 2999
443 Ga0207704_10092693 3300025938 Bacteria 1989
444 Ga0207665_10001028 3300025939 Bacteria 18828
445 Ga0207665_10007368 3300025939 Bacteria 7271
446 Ga0207665_10025516 3300025939 Bacteria 3900
447 Ga0207665_10127780 3300025939 Bacteria 1801
448 Ga0207665_10185695 3300025939 Bacteria 1508
449 Ga0207691_10000336 3300025940 Bacteria 47166
450 Ga0207691_10015407 3300025940 Bacteria 7273
451 Ga0207711_10035966 3300025941 Bacteria 4200
452 Ga0207711_10061529 3300025941 Bacteria 3237
453 Ga0207711_10295596 3300025941 Bacteria 1493
454 Ga0207689_10000168 3300025942 Bacteria 57089
455 Ga0207689_10028925 3300025942 Bacteria 4633
456 Ga0207689_10098550 3300025942 Bacteria 2401
457 Ga0207689_10145944 3300025942 Bacteria 1949
458 Ga0207661_10000575 3300025944 Bacteria 23433
459 Ga0207661_10258176 3300025944 Bacteria 1551
460 Ga0207679_10000035 3300025945 Bacteria 144173
461 Ga0207679_10019432 3300025945 Bacteria 4563
462 Ga0207679_10205302 3300025945 Bacteria 1649
463 Ga0207667_10098793 3300025949 Bacteria 3012
464 Ga0207651_10000233 3300025960 Bacteria 24032
465 Ga0207651_10075434 3300025960 Bacteria 2406
466 Ga0207712_10000768 3300025961 Bacteria 24025
467 Ga0207712_10009092 3300025961 Bacteria 6285
468 Ga0207668_10001470 3300025972 Bacteria 13811
469 Ga0207668_10159635 3300025972 Bacteria 1755
470 Ga0207668_10270678 3300025972 Bacteria 1388
471 Ga0207640_10001231 3300025981 Bacteria 13954
472 Ga0207658_10073032 3300025986 Bacteria 2603
473 Ga0207677_10000997 3300026023 Bacteria 15626
474 Ga0207677_10061228 3300026023 Bacteria 2605
475 Ga0207703_10001880 3300026035 Bacteria 18666
476 Ga0207703_10091454 3300026035 Bacteria 2559
477 Ga0207639_10000421 3300026041 Bacteria 29387
478 Ga0207678_10001561 3300026067 Bacteria 21040
479 Ga0207678_10016361 3300026067 Bacteria 6513
480 Ga0207678_10186746 3300026067 Bacteria 1771
481 Ga0207708_10001793 3300026075 Bacteria 15836
482 Ga0207708_10004956 3300026075 Bacteria 9812
483 Ga0207708_10013704 3300026075 Bacteria 6058
484 Ga0207702_10045251 3300026078 Bacteria 3703
485 Ga0207641_10003563 3300026088 Bacteria 13757
486 Ga0207641_10484983 3300026088 Bacteria 1198
487 Ga0207648_10004259 3300026089 Bacteria 14771
488 Ga0207648_10060537 3300026089 Bacteria 3302
489 Ga0207648_10205886 3300026089 Bacteria 1746
490 Ga0207674_10000535 3300026116 Bacteria 49820
491 Ga0207674_10002113 3300026116 Bacteria 25122
492 Ga0207674_10112624 3300026116 Bacteria 2694
493 Ga0207675_100000365 3300026118 Bacteria 43342
494 Ga0207683_10000667 3300026121 Bacteria 31542
495 Ga0207683_10010556 3300026121 Bacteria 7880
496 Ga0207698_10006961 3300026142 Bacteria 7075
497 Ga0207698_10026318 3300026142 Bacteria 4114
498 Ga0207698_10326536 3300026142 Unclassified 1439
499 Ga0210002_1000583 3300027617 Bacteria 4951
500 Ga0209983_1008797 3300027665 Bacteria 2060
501 Ga0209998_10001636 3300027717 Bacteria 5367
502 Ga0209974_10006220 3300027876 Bacteria 4179
503 Ga0207428_10000636 3300027907 Bacteria 41316
504 Ga0207428_10001024 3300027907 Bacteria 30931
505 Ga0268266_10005119 3300028379 Bacteria 12356
506 Ga0268265_10003727 3300028380 Bacteria 10834
507 Ga0268265_10007391 3300028380 Bacteria 7418
508 Ga0268264_10001508 3300028381 Bacteria 21696
509 Ga0268264_10002415 3300028381 Bacteria 16442
510 Ga0268264_10101929 3300028381 Bacteria 2497
511 Ga0265338_10004828 3300028800 Bacteria 18005
512 Ga0265338_10031592 3300028800 Bacteria 5188
513 Ga0265330_10098784 3300031235 Bacteria 1250
514 Ga0265332_10000319 3300031238 Bacteria 36874
515 Ga0265325_10000019 3300031241 Bacteria 125265
516 Ga0265325_10003344 3300031241 Bacteria 10523
517 Ga0265325_10003410 3300031241 Bacteria 10388
518 Ga0265325_10115243 3300031241 Bacteria 1301
519 Ga0265329_10094961 3300031242 Bacteria 947
520 Ga0265340_10058370 3300031247 Bacteria 1853
521 Ga0265339_10000269 3300031249 Bacteria 41988
522 Ga0265339_10019476 3300031249 Bacteria 3984
523 Ga0265331_10013951 3300031250 Bacteria 4297
524 Ga0265316_10064110 3300031344 Bacteria 2847
525 Ga0265313_10001274 3300031595 Bacteria 23880
526 Ga0265313_10001604 3300031595 Bacteria 21002
527 Ga0265314_10000577 3300031711 Bacteria 46408
528 Ga0265314_10093502 3300031711 Bacteria 1952
529 Ga0265342_10000050 3300031712 Bacteria 124639
530 Ga0265342_10000085 3300031712 Bacteria 100652
531 Ga0373930_0000585 3300034816 Bacteria 5052
532 Ga0373948_0000258 3300034817 Bacteria 6385
533 Ga0373950_0003921 3300034818 Bacteria 2159
534 Ga0373958_0000124 3300034819 Bacteria 8521
535 Ga0373958_0005327 3300034819 Bacteria 1949
536 Ga0373938_0000585 3300034957 Bacteria 5882
537 Ga0373926_0006655 3300035083 Bacteria 3837
538 Ga0373928_0000615 3300035084 Bacteria 6991
539 Ga0373929_0000271 3300035085 Bacteria 9580
540 Ga0373929_0003779 3300035085 Bacteria 2713
541 Ga0373934_0006337 3300035086 Bacteria 4387
542 Ga0373934_0111791 3300035086 Unclassified 1108
543 Ga0373940_0003638 3300035088 Bacteria 3168
544 Ga0373940_0025596 3300035088 Bacteria 1538
545 Ga0373944_0038946 3300035089 Bacteria 1461
546 Ga0373949_0002356 3300035090 Bacteria 4898
547 Ga0373949_0002759 3300035090 Bacteria 4384
548 Ga0373951_0003109 3300035091 Bacteria 4095
549 Ga0373951_0004829 3300035091 Bacteria 3173
550 Ga0373952_0016434 3300035092 Bacteria 1505
551 Ga0373923_0024434 3300035111 Bacteria 2385
552 Ga0373932_0004854 3300035112 Bacteria 3169
553 Ga0373932_0010920 3300035112 Bacteria 2208
554 Ga0373932_0019069 3300035112 Bacteria 1783
555 Ga0373939_0001233 3300035114 Bacteria 6258
556 Ga0373941_0021850 3300035115 Unclassified 1810
557 Ga0373941_0109674 3300035115 Bacteria 971
558 Ga0373945_0076492 3300035116 Bacteria 1276
559 Ga0373953_0003874 3300035117 Bacteria 4712
560 Ga0373953_0005397 3300035117 Bacteria 4147
561 Ga0373953_0016741 3300035117 Bacteria 2682
562 Ga0373953_0025943 3300035117 Bacteria 2243
563 Ga0373954_0001845 3300035118 Bacteria 8744
564 Ga0373954_0026156 3300035118 Bacteria 2673
565 Ga0373957_0001073 3300035120 Bacteria 7213
566 Ga0373960_0000880 3300035121 Bacteria 6379
567 Ga0373960_0003195 3300035121 Bacteria 3706
568 Ga0373943_0016099 3300035170 Bacteria 3406
569 Ga0373943_0016942 3300035170 Bacteria 3331
570 Ga0373943_0025782 3300035170 Bacteria 2749
571 Ga0373955_0000732 3300035172 Bacteria 14065
572 Ga0373955_0001003 3300035172 Bacteria 11993
573 Ga0373955_0003829 3300035172 Bacteria 6631
574 Ga0373955_0005598 3300035172 Bacteria 5649
575 Ga0373942_0008727 3300035207 Bacteria 2368
576 Ga0373961_0001257 3300035241 Bacteria 7751
577 Ga0373962_0016674 3300035242 Bacteria 1897
578 Ga0373924_0016437 3300035410 Bacteria 2824
579 Ga0373931_0002231 3300035691 Bacteria 8563
580 Ga0373931_0008138 3300035691 Bacteria 4968
581 Ga0373935_0008410 3300035692 Bacteria 6176
582 Ga0373933_0000562 3300035724 Bacteria 23168
583 Ga0373933_0001283 3300035724 Bacteria 14787
584 Ga0373933_0003500 3300035724 Bacteria 8743
585 Ga0373947_0017002 3300035725 Bacteria 4180
586 Ga0373947_0047748 3300035725 Bacteria 2566
587 Ga0373937_0000935 3300036401 Bacteria 24779
588 Ga0373937_0001648 3300036401 Bacteria 18759
589 Ga0373937_0003782 3300036401 Bacteria 12800
590 Ga0373937_0004562 3300036401 Bacteria 11760
591 Ga0373925_0070415 3300037068 Bacteria 2644
592 Ga0373925_0072197 3300037068 Bacteria 2611
593 Ga0373925_0143037 3300037068 Bacteria 1873
594 Ga0373925_0144080 3300037068 Bacteria 1866
595 Ga0395899_0303483 3300037312 Bacteria 1080
596 Ga0395898_0315859 3300037466 Bacteria 1491
597 Ga0395898_0382342 3300037466 Bacteria 1343
598 Ga0436365_0069514 3300039437 Bacteria 5139
599 Ga0436365_0518063 3300039437 Bacteria 2880
600 Ga0436365_1724574 3300039437 Bacteria 4597
601 Ga0436361_0174868 3300039447 Bacteria 1230
602 Ga0436361_0667785 3300039447 Bacteria 5283
603 Ga0451800_0612411 3300041459 Bacteria 1106
604 Ga0439463_038340 3300042016 Bacteria 1216
605 Ga0450923_036232 3300042125 Bacteria 1023
606 Ga0466966_0001275 3300044684 Bacteria 16132
607 Ga0466961_0002805 3300044693 Bacteria 10838
608 Ga0466963_0056152 3300044694 Bacteria 2619
609 Ga0466957_0015701 3300044842 Bacteria 4424
610 Ga0466957_0401730 3300044842 Bacteria 937
611 Ga0466959_0010634 3300045049 Bacteria 6589
612 Ga0466958_0011534 3300045836 Bacteria 4978
613 Ga0495592_0000755 3300046454 Bacteria 22515
614 Ga0495592_0008302 3300046454 Bacteria 7792
615 Ga0495592_0024816 3300046454 Bacteria 4556
616 Ga0495603_0018845 3300046455 Bacteria 4177
617 Ga0495629_0045152 3300046459 Bacteria 3092
618 Ga0495629_0107571 3300046459 Bacteria 1945
619 Ga0495638_0009619 3300046460 Bacteria 6764
620 Ga0495638_0028565 3300046460 Bacteria 3600
621 Ga0495638_0111672 3300046460 Bacteria 1623
622 Ga0495651_0008054 3300046462 Bacteria 8080
623 Ga0495651_0039432 3300046462 Bacteria 3677
624 Ga0495653_0003235 3300046463 Bacteria 13062
625 Ga0495653_0020057 3300046463 Bacteria 5418
626 Ga0495653_0033321 3300046463 Bacteria 4083
627 Ga0495653_0309200 3300046463 Bacteria 1028
628 Ga0495580_0217640 3300046472 Bacteria 1313
629 Ga0495580_0314163 3300046472 Unclassified 1065
630 Ga0495582_0074166 3300046473 Bacteria 1883
631 Ga0495639_0119113 3300046475 Unclassified 1258
632 Ga0495662_0036623 3300046476 Bacteria 2367
633 Ga0495664_0004237 3300046477 Bacteria 7831
634 Ga0495664_0207902 3300046477 Bacteria 1185
635 Ga0495664_0216571 3300046477 Unclassified 1159
636 Ga0495594_0049367 3300046499 Bacteria 2313
637 Ga0495594_0111271 3300046499 Bacteria 1544
638 Ga0495607_0178115 3300046501 Bacteria 1068
639 Ga0495608_0000413 3300046511 Bacteria 29892
640 Ga0495608_0000909 3300046511 Bacteria 20756
641 Ga0495608_0037441 3300046511 Bacteria 3262
642 Ga0495618_0000259 3300046514 Bacteria 38359
643 Ga0495618_0003490 3300046514 Bacteria 9760
644 Ga0495628_0005724 3300046516 Bacteria 10887
645 Ga0495628_0026118 3300046516 Bacteria 4767
646 Ga0495628_0352550 3300046516 Bacteria 1081
647 Ga0495630_0037619 3300046517 Bacteria 3618
648 Ga0495630_0091143 3300046517 Bacteria 2303
649 Ga0495630_0139869 3300046517 Bacteria 1840
650 Ga0495631_0069164 3300046518 Bacteria 1527
651 Ga0495637_0111348 3300046520 Bacteria 1061
652 Ga0495644_0008358 3300046523 Bacteria 3988
653 Ga0495666_0103014 3300046526 Bacteria 1344
654 Ga0495666_0142013 3300046526 Bacteria 1119
655 Ga0495642_0032781 3300046528 Bacteria 2086
656 Ga0495652_0003415 3300046529 Bacteria 15698
657 Ga0495652_0004853 3300046529 Bacteria 12771
658 Ga0495652_0007759 3300046529 Bacteria 9866
659 Ga0495665_0020138 3300046531 Bacteria 3585
660 Ga0495665_0106929 3300046531 Bacteria 1468
661 Ga0495640_0001238 3300046533 Bacteria 20002
662 Ga0495640_0002101 3300046533 Bacteria 15880
663 Ga0495640_0052041 3300046533 Bacteria 2813
664 Ga0495640_0072503 3300046533 Bacteria 2307
665 Ga0495587_0000335 3300046536 Bacteria 33563
666 Ga0495587_0004881 3300046536 Bacteria 8798
667 Ga0495587_0049250 3300046536 Bacteria 2494
668 Ga0495645_0006430 3300046543 Bacteria 8152
669 Ga0495645_0020316 3300046543 Bacteria 4789
670 Ga0495633_0014285 3300046558 Bacteria 4158
671 Ga0495667_0000333 3300046559 Bacteria 29860
672 Ga0495667_0000565 3300046559 Bacteria 23582
673 Ga0495667_0001149 3300046559 Bacteria 17261
674 Ga0495667_0049025 3300046559 Plasmid 2788
675 Ga0495656_0006175 3300046615 Bacteria 4190
676 Ga0495656_0047306 3300046615 Bacteria 1824
677 Ga0495668_0099572 3300046616 Bacteria 1590
678 Ga0495634_0031880 3300046642 Bacteria 3628
679 Ga0495625_0120176 3300046660 Bacteria 1789
680 Ga0495635_0003525 3300046663 Bacteria 10825
681 Ga0495635_0008973 3300046663 Bacteria 6980
682 Ga0495635_0015934 3300046663 Bacteria 5251
683 Ga0495588_0031463 3300046674 Bacteria 2671
684 Ga0495657_0006050 3300046675 Bacteria 9502
685 Ga0495657_0008927 3300046675 Bacteria 7629
686 Ga0495657_0030475 3300046675 Bacteria 3778
687 Ga0495599_0002084 3300046678 Bacteria 11593
688 Ga0495599_0002227 3300046678 Bacteria 11288
689 Ga0495623_0006023 3300046679 Bacteria 7888
690 Ga0495623_0071727 3300046679 Bacteria 2154
691 Ga0495646_0000174 3300046680 Bacteria 32272
692 Ga0495646_0001804 3300046680 Bacteria 12852
693 Ga0495646_0113783 3300046680 Bacteria 1538
694 Ga0495647_0005601 3300046681 Bacteria 4123
695 Ga0495658_0009010 3300046683 Bacteria 4960
696 Ga0495658_0038554 3300046683 Plasmid 2647
697 Ga0495658_0122096 3300046683 Unclassified 1576
698 Ga0495669_0046308 3300046684 Bacteria 1941
699 Ga0495669_0120306 3300046684 Bacteria 1230
700 Ga0495613_0026270 3300046689 Bacteria 4339
701 Ga0495624_0054432 3300046690 Bacteria 2523
702 Ga0495624_0129236 3300046690 Bacteria 1549
703 Ga0495670_0059889 3300046691 Bacteria 1912
704 Ga0495671_0125412 3300046692 Bacteria 1252
705 Ga0495649_0111603 3300046694 Bacteria 1450
706 Ga0495600_0009519 3300046809 Bacteria 6005
707 Ga0495600_0010622 3300046809 Bacteria 5720
708 Ga0495600_0027331 3300046809 Bacteria 3686
709 Ga0495581_0075122 3300047315 Bacteria 1956
710 Ga0495604_0000394 3300047317 Bacteria 39525
711 Ga0495604_0002160 3300047317 Bacteria 15794
712 Ga0495604_0014145 3300047317 Bacteria 6364
713 Ga0495604_0020405 3300047317 Bacteria 5292
714 Ga0495674_0003197 3300047319 Bacteria 15909
715 Ga0495674_0007775 3300047319 Bacteria 10233
716 Ga0495674_0019628 3300047319 Bacteria 6272
717 Ga0495674_0066618 3300047319 Bacteria 3123
718 Ga0495676_0097596 3300047321 Bacteria 2182
719 Ga0495680_0000539 3300047322 Bacteria 42513
720 Ga0495680_0011470 3300047322 Bacteria 7843
721 Ga0495680_0024811 3300047322 Bacteria 4967
722 Ga0495675_0000139 3300047444 Bacteria 50643
723 Ga0495675_0020530 3300047444 Bacteria 4203
724 Ga0495675_0032480 3300047444 Bacteria 3331
725 Ga0495675_0053415 3300047444 Bacteria 2565
726 Ga0495684_0019982 3300047471 Bacteria 5161
727 Ga0495684_0023374 3300047471 Bacteria 4751
728 Ga0495684_0046187 3300047471 Bacteria 3332
729 Ga0495684_0133792 3300047471 Bacteria 1861
730 Ga0495593_0025441 3300047673 Bacteria 3276
731 Ga0495593_0164274 3300047673 Bacteria 1120
732 Ga0495602_0000310 3300048088 Bacteria 45025
733 Ga0495602_0003234 3300048088 Bacteria 16819
734 Ga0495602_0035932 3300048088 Bacteria 4616
735 Ga0495614_0034702 3300048089 Bacteria 2168
736 Ga0496100_0006174 3300048903 Bacteria 6515
737 Ga0496100_0020290 3300048903 Plasmid 3981
738 Ga0496100_0040028 3300048903 Bacteria 2979
739 Ga0496100_0106691 3300048903 Bacteria 1939
740 Ga0496101_0000924 3300048904 Bacteria 17321
741 Ga0496101_0012035 3300048904 Bacteria 5763
742 Ga0496101_0079274 3300048904 Bacteria 2424
743 Ga0496101_0104882 3300048904 Bacteria 2120
744 Ga0496101_0176283 3300048904 Bacteria 1644
745 Ga0496101_0178918 3300048904 Bacteria 1632
746 Ga0496101_0385529 3300048904 Bacteria 1103
747 Ga0496102_0021645 3300048905 Bacteria 5688
748 Ga0496102_0025763 3300048905 Bacteria 5237
749 Ga0496102_0029868 3300048905 Bacteria 4877
750 Ga0496102_0224379 3300048905 Bacteria 1771
751 Ga0496102_0511989 3300048905 Unclassified 1122
752 Ga0496103_0005671 3300048906 Bacteria 7459
753 Ga0496103_0037828 3300048906 Bacteria 2958
754 Ga0496104_0000217 3300048907 Bacteria 50667
755 Ga0496104_0000764 3300048907 Bacteria 27548
756 Ga0496104_0034046 3300048907 Bacteria 4748
757 Ga0496104_0037139 3300048907 Bacteria 4555
758 Ga0496104_0047679 3300048907 Bacteria 4038
759 Ga0496104_0100794 3300048907 Bacteria 2764
760 Ga0496104_0114561 3300048907 Bacteria 2586
761 Ga0496104_0126748 3300048907 Bacteria 2451
762 Ga0496104_0142607 3300048907 Bacteria 2301
763 Ga0496104_0216602 3300048907 Bacteria 1826
764 Ga0496105_0012626 3300048908 Bacteria 6689
765 Ga0496105_0058838 3300048908 Bacteria 3171
766 Ga0496105_0191786 3300048908 Bacteria 1670
767 Ga0496105_0212726 3300048908 Bacteria 1575
768 Ga0496105_0268758 3300048908 Bacteria 1377
769 Ga0496106_0000894 3300048909 Bacteria 21797
770 Ga0496106_0003651 3300048909 Bacteria 11476
771 Ga0496106_0005971 3300048909 Bacteria 8997
772 Ga0496106_0069234 3300048909 Bacteria 2693
773 Ga0496106_0096396 3300048909 Bacteria 2289
774 Ga0496106_0280695 3300048909 Bacteria 1334
775 Ga0496107_0005058 3300048910 Bacteria 8989
776 Ga0496107_0053858 3300048910 Bacteria 2902
777 Ga0496107_0101421 3300048910 Bacteria 2110
778 Ga0496107_0118485 3300048910 Bacteria 1949
779 Ga0496108_0000868 3300048911 Bacteria 23566
780 Ga0496108_0043186 3300048911 Bacteria 3765
781 Ga0496108_0087135 3300048911 Bacteria 2652
782 Ga0496108_0239741 3300048911 Bacteria 1577
783 Ga0496109_0000506 3300048912 Bacteria 33302
784 Ga0496109_0039228 3300048912 Bacteria 4286
785 Ga0496109_0053061 3300048912 Bacteria 3696
786 Ga0496109_0059559 3300048912 Bacteria 3488
787 Ga0496109_0120218 3300048912 Bacteria 2447
788 Ga0496109_0173069 3300048912 Bacteria 2026
789 Ga0496110_0063024 3300048913 Bacteria 3276
790 Ga0496110_0098004 3300048913 Bacteria 2627
791 Ga0496110_0111637 3300048913 Bacteria 2458
792 Ga0496110_0124238 3300048913 Bacteria 2327
793 Ga0496110_0220688 3300048913 Bacteria 1724
794 Ga0496110_0281415 3300048913 Bacteria 1514
795 Ga0496111_0072512 3300048914 Bacteria 2507
796 Ga0496111_0142936 3300048914 Bacteria 1773
797 Ga0496111_0306300 3300048914 Bacteria 1177
798 Ga0496112_0049492 3300048915 Bacteria 4120
799 Ga0496112_0294019 3300048915 Bacteria 1570
800 Ga0496112_0412965 3300048915 Bacteria 1289
801 Ga0496113_0046247 3300048916 Bacteria 3231
802 Ga0496113_0171844 3300048916 Bacteria 1716
803 Ga0496114_0013618 3300048917 Bacteria 6520
804 Ga0496114_0019154 3300048917 Bacteria 5546
805 Ga0496114_0042614 3300048917 Bacteria 3762
806 Ga0496114_0043119 3300048917 Bacteria 3741
807 Ga0496115_0004158 3300048918 Bacteria 10449
808 Ga0496115_0018366 3300048918 Bacteria 5367
809 Ga0496115_0033213 3300048918 Bacteria 4072
810 Ga0496115_0111789 3300048918 Bacteria 2244
811 Ga0496115_0121924 3300048918 Bacteria 2145
812 Ga0496115_0175374 3300048918 Unclassified 1773
813 Ga0501031_0002931 3300049568 Bacteria 10914
814 Ga0501031_0006819 3300049568 Bacteria 7454
815 Ga0501032_0030089 3300049569 Bacteria 3724
816 Ga0501032_0065765 3300049569 Bacteria 2424
817 Ga0501033_0011756 3300049570 Bacteria 6692
818 Ga0501033_0012886 3300049570 Bacteria 6377
819 Ga0501034_0018046 3300049571 Bacteria 7239
820 Ga0501034_0095115 3300049571 Bacteria 2976
821 Ga0501034_0169098 3300049571 Bacteria 2154
822 Ga0501036_0004687 3300049572 Bacteria 11040
823 Ga0501036_0011648 3300049572 Bacteria 7289
824 Ga0501037_0005982 3300049573 Bacteria 8887
825 Ga0501037_0019553 3300049573 Bacteria 4996
826 Ga0501038_0030646 3300049574 Bacteria 4756
827 Ga0501039_0001438 3300049575 Bacteria 17522
828 Ga0501041_0104610 3300049577 Bacteria 1754
829 Ga0501043_0017921 3300049579 Bacteria 5553
830 Ga0501043_0203226 3300049579 Bacteria 1537
831 Ga0501046_0010334 3300049580 Bacteria 8025
832 Ga0501047_0010921 3300049581 Bacteria 8590
833 Ga0501047_0010998 3300049581 Bacteria 8564
834 Ga0501047_0031535 3300049581 Bacteria 5111
835 Ga0501048_0004490 3300049582 Bacteria 10621
836 Ga0501048_0413198 3300049582 Bacteria 965
837 Ga0501067_0005740 3300049583 Bacteria 6886
838 Ga0501068_0011311 3300049584 Bacteria 5035
839 Ga0501069_0006487 3300049585 Bacteria 6116
840 Ga0501070_0014059 3300049586 Bacteria 6738
841 Ga0501070_0025502 3300049586 Bacteria 4958
842 Ga0501070_0159730 3300049586 Bacteria 1858
843 Ga0501070_0188395 3300049586 Bacteria 1696
844 Ga0501071_0077893 3300049587 Bacteria 2422
845 Ga0501072_0413864 3300049588 Bacteria 1069
846 Ga0501073_0006774 3300049589 Bacteria 8529
847 Ga0501074_0012936 3300049590 Bacteria 6067
848 Ga0501076_0408016 3300049592 Bacteria 1117
849 Ga0501077_0166512 3300049593 Bacteria 1400
850 Ga0501079_0026795 3300049741 Bacteria 4419
851 Ga0501080_0028534 3300049742 Bacteria 5193
852 Ga0501081_0071525 3300049743 Bacteria 2418
853 Ga0501083_0015045 3300049744 Bacteria 5415
854 Ga0501035_0014526 3300049822 Bacteria 7268
855 Ga0501035_0018612 3300049822 Bacteria 6396
856 Ga0501044_0000193 3300049823 Bacteria 76794
857 Ga0501044_0026928 3300049823 Bacteria 6083
858 Ga0501044_0050174 3300049823 Bacteria 4307
859 Ga0501044_0276295 3300049823 Bacteria 1615
860 nmdc:mga03683_126932_c1 3300050489 Bacteria 1139
861 nmdc:mga03683_59371_c1 3300050489 Bacteria 1613
862 nmdc:mga0yw44_1168_c1 3300050492 Bacteria 10216
863 nmdc:mga0yw44_393333_c1 3300050492 Bacteria 937
864 nmdc:mga0yw44_86374_c1 3300050492 Bacteria 1976
865 nmdc:mga0yw44_92657_c1 3300050492 Bacteria 1912
866 nmdc:mga0k408_24007_c1 3300050493 Bacteria 3443
867 nmdc:mga0k408_79482_c1 3300050493 Bacteria 1919
868 nmdc:mga0k408_99043_c1 3300050493 Bacteria 1718
869 nmdc:mga06z11_12529_c1 3300050494 Bacteria 3690
870 nmdc:mga06z11_49678_c1 3300050494 Bacteria 2141
871 nmdc:mga06z11_65020_c1 3300050494 Bacteria 1913
872 nmdc:mga07m45_69470_c1 3300050496 Bacteria 2002
873 nmdc:mga05p37_129066_c1 3300050507 Bacteria 3103
874 nmdc:mga05p37_200042_c1 3300050507 Bacteria 2421
875 nmdc:mga05p37_265489_c1 3300050507 Unclassified 2053
876 nmdc:mga05p37_35469_c1 3300050507 Bacteria 6116
877 nmdc:mga05p37_373263_c1 3300050507 Bacteria 1673
878 nmdc:mga05p37_391044_c1 3300050507 Bacteria 1626
879 nmdc:mga05p37_43990_c1 3300050507 Bacteria 5494
880 nmdc:mga05p37_5345_c1 3300050507 Bacteria 15087
881 nmdc:mga09592_148468_c1 3300050508 Bacteria 2022
882 nmdc:mga09592_155548_c1 3300050508 Bacteria 1973
883 nmdc:mga09592_183790_c1 3300050508 Unclassified 1809
884 nmdc:mga0qj67_157449_c1 3300050509 Bacteria 1844
885 nmdc:mga0qj67_61098_c1 3300050509 Bacteria 2991
886 nmdc:mga0qj67_70762_c1 3300050509 Unclassified 2783
887 nmdc:mga0qj67_86566_c1 3300050509 Bacteria 2514
888 nmdc:mga06r32_128479_c1 3300050510 Bacteria 2504
889 nmdc:mga06r32_92744_c1 3300050510 Bacteria 2953
890 nmdc:mga08y16_105572_c1 3300050511 Bacteria 2932
891 nmdc:mga08y16_2968_c1 3300050511 Bacteria 17488
892 nmdc:mga08y16_391273_c1 3300050511 Bacteria 1424
893 nmdc:mga08y16_8363_c1 3300050511 Bacteria 10827
894 nmdc:mga0n895_101152_c1 3300050512 Bacteria 2892
895 nmdc:mga0n895_12603_c1 3300050512 Bacteria 7589
896 nmdc:mga0n895_142142_c1 3300050512 Bacteria 2429
897 nmdc:mga0n895_602258_c1 3300050512 Bacteria 1101
898 nmdc:mga0n895_91583_c1 3300050512 Bacteria 3043
899 nmdc:mga0rr50_175655_c1 3300050513 Bacteria 1748
900 nmdc:mga0rr50_402115_c1 3300050513 Bacteria 1157
901 nmdc:mga08x19_217847_c1 3300050514 Bacteria 1311
902 nmdc:mga0a205_152828_c1 3300050515 Bacteria 2207
903 nmdc:mga0a205_40346_c1 3300050515 Bacteria 4493
904 nmdc:mga0a205_75013_c1 3300050515 Bacteria 3268
905 Ga0495601_0003097 3300053077 Bacteria 9495
906 Ga0495601_0004245 3300053077 Bacteria 8274
907 Ga0495601_0004639 3300053077 Bacteria 7956
908 Ga0495601_0005848 3300053077 Bacteria 7172
909 Ga0495601_0102456 3300053077 Bacteria 1850
910 Ga0495612_0000183 3300053078 Bacteria 26502
911 Ga0495612_0000857 3300053078 Bacteria 12364
912 Ga0495612_0001353 3300053078 Bacteria 10099
913 Ga0495612_0007748 3300053078 Bacteria 4382
914 Ga0495612_0025192 3300053078 Bacteria 2389
915 Ga0495595_0000207 3300053084 Bacteria 23763
916 Ga0495595_0001895 3300053084 Bacteria 8123
917 Ga0495595_0002395 3300053084 Bacteria 7321
918 Ga0495595_0015608 3300053084 Bacteria 3239
919 Ga0495619_0000108 3300053085 Bacteria 62197
920 Ga0495619_0000225 3300053085 Bacteria 40938
921 Ga0495619_0000650 3300053085 Bacteria 22811
922 Ga0495619_0001982 3300053085 Bacteria 13624
923 Ga0495619_0002633 3300053085 Bacteria 11726
924 Ga0495619_0008701 3300053085 Bacteria 6419
925 Ga0495619_0035311 3300053085 Bacteria 3251
926 Ga0500644_0000428 3300053088 Bacteria 19683
927 Ga0500651_0070006 3300053093 Bacteria 2184
928 Ga0500641_0025612 3300053096 Bacteria 2283
929 Ga0500641_0060086 3300053096 Bacteria 1581
930 Ga0500650_0071339 3300053098 Bacteria 1623
931 Ga0500616_0000006 3300053153 Bacteria 944738
932 Ga0500616_0011892 3300053153 Bacteria 5116
933 Ga0500645_000033 3300053730 Bacteria 119279
934 Ga0501084_0019048 3300054114 Bacteria 5716
935 Ga0501084_0230516 3300054114 Bacteria 1563
936 Ga0501082_0006937 3300060353 Bacteria 9790
937 Ga0501082_0215839 3300060353 Bacteria 1669
938 Ga0530510_0058419 3300061734 Bacteria 2789

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0076492 Ga0373945_0076492_166_1041 291
2 3300046459 Ga0495629_0045152 Ga0495629_0045152_1992_2867 291
3 3300046463 Ga0495653_0033321 Ga0495653_0033321_527_1402 291
4 3300046477 Ga0495664_0004237 Ga0495664_0004237_1147_2022 291
5 3300046514 Ga0495618_0000259 Ga0495618_0000259_3939_4814 291
6 3300046517 Ga0495630_0037619 Ga0495630_0037619_2545_3420 291
7 3300046533 Ga0495640_0001238 Ga0495640_0001238_6993_7868 291
8 3300046663 Ga0495635_0003525 Ga0495635_0003525_6054_6929 291
9 3300047319 Ga0495674_0003197 Ga0495674_0003197_10791_11666 291
10 3300047471 Ga0495684_0023374 Ga0495684_0023374_1396_2271 291
11 3300053077 Ga0495601_0004245 Ga0495601_0004245_1346_2221 291
12 3300053078 Ga0495612_0001353 Ga0495612_0001353_7038_7913 291
13 3300053085 Ga0495619_0002633 Ga0495619_0002633_6987_7862 291
14 iso_pu_bacteria 2510917022 2511131504 291
15 3300002070 JGI24750J21931_1002444 JGI24750J21931_10024442 294
16 3300002076 JGI24749J21850_1005224 JGI24749J21850_10052242 294
17 3300002244 JGI24742J22300_10007537 JGI24742J22300_100075372 294
18 3300003911 JGI25405J52794_10017289 JGI25405J52794_100172892 294
19 3300005328 Ga0070676_10027396 Ga0070676_100273962 294
20 3300005331 Ga0070670_100026485 Ga0070670_1000264854 294
21 3300005334 Ga0068869_100059369 Ga0068869_1000593692 294
22 3300005337 Ga0070682_100044407 Ga0070682_1000444073 294
23 3300005338 Ga0068868_100073271 Ga0068868_1000732712 294
24 3300005355 Ga0070671_100006476 Ga0070671_10000647610 294
25 3300005356 Ga0070674_100541386 Ga0070674_1005413861 294
26 3300005366 Ga0070659_100055244 Ga0070659_1000552443 294
27 3300005436 Ga0070713_100023528 Ga0070713_1000235284 294
28 3300005436 Ga0070713_100031744 Ga0070713_1000317442 294
29 3300005436 Ga0070713_100167706 Ga0070713_1001677062 294
30 3300005437 Ga0070710_10000528 Ga0070710_1000052810 294
31 3300005438 Ga0070701_10007962 Ga0070701_100079624 294
32 3300005439 Ga0070711_100003401 Ga0070711_1000034019 294
33 3300005441 Ga0070700_100065982 Ga0070700_1000659822 294
34 3300005456 Ga0070678_100202717 Ga0070678_1002027171 294
35 3300005457 Ga0070662_100180533 Ga0070662_1001805332 294
36 3300005467 Ga0070706_100563484 Ga0070706_1005634841 294
37 3300005518 Ga0070699_100001276 Ga0070699_1000012765 294
38 3300005535 Ga0070684_100053185 Ga0070684_1000531851 294
39 3300005543 Ga0070672_100055215 Ga0070672_1000552152 294
40 3300005544 Ga0070686_100012378 Ga0070686_1000123782 294
41 3300005564 Ga0070664_100353332 Ga0070664_1003533321 294
42 3300005577 Ga0068857_100087240 Ga0068857_1000872402 294
43 3300005614 Ga0068856_100227952 Ga0068856_1002279522 294
44 3300005615 Ga0070702_100087978 Ga0070702_1000879781 294
45 3300005617 Ga0068859_100063245 Ga0068859_1000632453 294
46 3300005618 Ga0068864_100230813 Ga0068864_1002308132 294
47 3300005718 Ga0068866_10204219 Ga0068866_102042191 294
48 3300005834 Ga0068851_10033291 Ga0068851_100332912 294
49 3300005841 Ga0068863_100027701 Ga0068863_1000277015 294
50 3300005842 Ga0068858_100167557 Ga0068858_1001675572 294
51 3300005937 Ga0081455_10001118 Ga0081455_1000111827 294
52 3300005937 Ga0081455_10011426 Ga0081455_100114265 294
53 3300005981 Ga0081538_10002263 Ga0081538_100022639 294
54 3300005981 Ga0081538_10060249 Ga0081538_100602492 294
55 3300005983 Ga0081540_1006947 Ga0081540_10069475 294
56 3300005983 Ga0081540_1024775 Ga0081540_10247752 294
57 3300005983 Ga0081540_1058554 Ga0081540_10585542 294
58 3300006028 Ga0070717_10001340 Ga0070717_100013403 294
59 3300006038 Ga0075365_10025752 Ga0075365_100257524 294
60 3300006038 Ga0075365_10032144 Ga0075365_100321442 294
61 3300006048 Ga0075363_100071859 Ga0075363_1000718592 294
62 3300006048 Ga0075363_100243829 Ga0075363_1002438291 294
63 3300006051 Ga0075364_10209762 Ga0075364_102097622 294
64 3300006058 Ga0075432_10094301 Ga0075432_100943012 294
65 3300006163 Ga0070715_10000357 Ga0070715_100003572 294
66 3300006175 Ga0070712_100008584 Ga0070712_1000085845 294
67 3300006175 Ga0070712_100477325 Ga0070712_1004773251 294
68 3300006177 Ga0075362_10050487 Ga0075362_100504872 294
69 3300006844 Ga0075428_100028244 Ga0075428_1000282443 294
70 3300006844 Ga0075428_100610295 Ga0075428_1006102951 294
71 3300006846 Ga0075430_100014084 Ga0075430_1000140844 294
72 3300006846 Ga0075430_100041065 Ga0075430_1000410653 294
73 3300006846 Ga0075430_100060072 Ga0075430_1000600722 294
74 3300006846 Ga0075430_100077840 Ga0075430_1000778402 294
75 3300006847 Ga0075431_100004314 Ga0075431_10000431410 294
76 3300006847 Ga0075431_100021672 Ga0075431_1000216723 294
77 3300006847 Ga0075431_100246339 Ga0075431_1002463392 294
78 3300006852 Ga0075433_10148169 Ga0075433_101481692 294
79 3300006871 Ga0075434_100021735 Ga0075434_1000217354 294
80 3300006871 Ga0075434_100183079 Ga0075434_1001830792 294
81 3300006880 Ga0075429_100155580 Ga0075429_1001555802 294
82 3300006880 Ga0075429_100218808 Ga0075429_1002188082 294
83 3300006880 Ga0075429_100431945 Ga0075429_1004319452 294
84 3300006881 Ga0068865_100112799 Ga0068865_1001127992 294
85 3300006881 Ga0068865_100126065 Ga0068865_1001260652 294
86 3300006931 Ga0097620_100063246 Ga0097620_1000632463 294
87 3300007265 Ga0099794_10036502 Ga0099794_100365022 294
88 3300009094 Ga0111539_10081343 Ga0111539_100813432 294
89 3300009094 Ga0111539_10188463 Ga0111539_101884632 294
90 3300009094 Ga0111539_10479910 Ga0111539_104799102 294
91 3300009094 Ga0111539_10568213 Ga0111539_105682132 294
92 3300009094 Ga0111539_10803476 Ga0111539_108034761 294
93 3300009147 Ga0114129_10041031 Ga0114129_100410313 294
94 3300009147 Ga0114129_10080861 Ga0114129_100808614 294
95 3300009147 Ga0114129_10172654 Ga0114129_101726543 294
96 3300009147 Ga0114129_10233581 Ga0114129_102335812 294
97 3300009147 Ga0114129_10329811 Ga0114129_103298112 294
98 3300009147 Ga0114129_10504452 Ga0114129_105044522 294
99 3300009174 Ga0105241_10172341 Ga0105241_101723412 294
100 3300009545 Ga0105237_10102889 Ga0105237_101028892 294
101 3300013100 Ga0157373_10248718 Ga0157373_102487181 294
102 3300013296 Ga0157374_10110998 Ga0157374_101109982 294
103 3300013306 Ga0163162_10295032 Ga0163162_102950321 294
104 3300014325 Ga0163163_10301099 Ga0163163_103010992 294
105 3300014325 Ga0163163_10352355 Ga0163163_103523552 294
106 3300014968 Ga0157379_10057193 Ga0157379_100571933 294
107 3300014969 Ga0157376_10709013 Ga0157376_107090131 294
108 3300021361 Ga0213872_10028413 Ga0213872_100284132 294
109 3300025321 Ga0207656_10049715 Ga0207656_100497151 294
110 3300025898 Ga0207692_10000076 Ga0207692_100000765 294
111 3300025900 Ga0207710_10088660 Ga0207710_100886602 294
112 3300025901 Ga0207688_10001265 Ga0207688_1000126511 294
113 3300025904 Ga0207647_10060693 Ga0207647_100606932 294
114 3300025906 Ga0207699_10111324 Ga0207699_101113242 294
115 3300025908 Ga0207643_10002863 Ga0207643_100028633 294
116 3300025910 Ga0207684_10152225 Ga0207684_101522253 294
117 3300025915 Ga0207693_10001843 Ga0207693_1000184313 294
118 3300025915 Ga0207693_10008913 Ga0207693_100089132 294
119 3300025915 Ga0207693_10200058 Ga0207693_102000582 294
120 3300025916 Ga0207663_10110263 Ga0207663_101102632 294
121 3300025918 Ga0207662_10060397 Ga0207662_100603972 294
122 3300025925 Ga0207650_10006726 Ga0207650_100067269 294
123 3300025926 Ga0207659_10116261 Ga0207659_101162612 294
124 3300025927 Ga0207687_10085640 Ga0207687_100856403 294
125 3300025928 Ga0207700_10009232 Ga0207700_100092322 294
126 3300025928 Ga0207700_10096860 Ga0207700_100968602 294
127 3300025928 Ga0207700_10264668 Ga0207700_102646682 294
128 3300025928 Ga0207700_10400254 Ga0207700_104002541 294
129 3300025929 Ga0207664_10006249 Ga0207664_100062497 294
130 3300025929 Ga0207664_10236410 Ga0207664_102364102 294
131 3300025931 Ga0207644_10074056 Ga0207644_100740562 294
132 3300025932 Ga0207690_10088403 Ga0207690_100884032 294
133 3300025933 Ga0207706_10110642 Ga0207706_101106423 294
134 3300025936 Ga0207670_10090762 Ga0207670_100907622 294
135 3300025937 Ga0207669_10011592 Ga0207669_100115925 294
136 3300025938 Ga0207704_10092693 Ga0207704_100926932 294
137 3300025939 Ga0207665_10001028 Ga0207665_100010283 294
138 3300025939 Ga0207665_10127780 Ga0207665_101277802 294
139 3300025940 Ga0207691_10015407 Ga0207691_100154073 294
140 3300025941 Ga0207711_10295596 Ga0207711_102955962 294
141 3300025942 Ga0207689_10028925 Ga0207689_100289254 294
142 3300025944 Ga0207661_10258176 Ga0207661_102581762 294
143 3300025945 Ga0207679_10019432 Ga0207679_100194325 294
144 3300025960 Ga0207651_10075434 Ga0207651_100754342 294
145 3300025972 Ga0207668_10270678 Ga0207668_102706781 294
146 3300026035 Ga0207703_10091454 Ga0207703_100914542 294
147 3300026067 Ga0207678_10001561 Ga0207678_1000156122 294
148 3300026075 Ga0207708_10004956 Ga0207708_100049569 294
149 3300026078 Ga0207702_10045251 Ga0207702_100452514 294
150 3300026089 Ga0207648_10205886 Ga0207648_102058862 294
151 3300026116 Ga0207674_10112624 Ga0207674_101126242 294
152 3300026142 Ga0207698_10026318 Ga0207698_100263184 294
153 3300028381 Ga0268264_10101929 Ga0268264_101019293 294
154 3300028800 Ga0265338_10004828 Ga0265338_1000482813 294
155 3300031238 Ga0265332_10000319 Ga0265332_1000031931 294
156 3300031241 Ga0265325_10003410 Ga0265325_100034102 294
157 3300031249 Ga0265339_10000269 Ga0265339_1000026925 294
158 3300031250 Ga0265331_10013951 Ga0265331_100139514 294
159 3300031595 Ga0265313_10001274 Ga0265313_100012749 294
160 3300031712 Ga0265342_10000050 Ga0265342_1000005074 294
161 3300035083 Ga0373926_0006655 Ga0373926_0006655_2592_3476 294
162 3300035089 Ga0373944_0038946 Ga0373944_0038946_232_1116 294
163 3300035117 Ga0373953_0025943 Ga0373953_0025943_1276_2160 294
164 3300035118 Ga0373954_0026156 Ga0373954_0026156_1456_2340 294
165 3300035170 Ga0373943_0016942 Ga0373943_0016942_1483_2367 294
166 3300035170 Ga0373943_0025782 Ga0373943_0025782_1274_2158 294
167 3300035172 Ga0373955_0000732 Ga0373955_0000732_1931_2815 294
168 3300035692 Ga0373935_0008410 Ga0373935_0008410_3222_4106 294
169 3300035724 Ga0373933_0001283 Ga0373933_0001283_3251_4135 294
170 3300035725 Ga0373947_0017002 Ga0373947_0017002_2770_3654 294
171 3300036401 Ga0373937_0001648 Ga0373937_0001648_16011_16895 294
172 3300037068 Ga0373925_0143037 Ga0373925_0143037_175_1059 294
173 3300037068 Ga0373925_0144080 Ga0373925_0144080_527_1411 294
174 3300037312 Ga0395899_0303483 Ga0395899_0303483_153_1037 294
175 3300037466 Ga0395898_0315859 Ga0395898_0315859_100_984 294
176 3300039447 Ga0436361_0667785 Ga0436361_0667785_1301_2185 294
177 3300041459 Ga0451800_0612411 Ga0451800_0612411_148_1032 294
178 3300042125 Ga0450923_036232 Ga0450923_036232_63_971 294
179 3300046454 Ga0495592_0008302 Ga0495592_0008302_1971_2855 294
180 3300046455 Ga0495603_0018845 Ga0495603_0018845_3033_3917 294
181 3300046459 Ga0495629_0107571 Ga0495629_0107571_498_1382 294
182 3300046462 Ga0495651_0008054 Ga0495651_0008054_2309_3193 294
183 3300046463 Ga0495653_0020057 Ga0495653_0020057_4433_5317 294
184 3300046472 Ga0495580_0217640 Ga0495580_0217640_255_1139 294
185 3300046477 Ga0495664_0207902 Ga0495664_0207902_56_940 294
186 3300046499 Ga0495594_0049367 Ga0495594_0049367_1088_1972 294
187 3300046501 Ga0495607_0178115 Ga0495607_0178115_55_939 294
188 3300046511 Ga0495608_0000413 Ga0495608_0000413_2346_3230 294
189 3300046514 Ga0495618_0003490 Ga0495618_0003490_1837_2721 294
190 3300046516 Ga0495628_0352550 Ga0495628_0352550_105_989 294
191 3300046517 Ga0495630_0091143 Ga0495630_0091143_1353_2237 294
192 3300046518 Ga0495631_0069164 Ga0495631_0069164_325_1209 294
193 3300046520 Ga0495637_0111348 Ga0495637_0111348_137_1021 294
194 3300046523 Ga0495644_0008358 Ga0495644_0008358_2636_3520 294
195 3300046526 Ga0495666_0142013 Ga0495666_0142013_53_937 294
196 3300046528 Ga0495642_0032781 Ga0495642_0032781_591_1475 294
197 3300046529 Ga0495652_0007759 Ga0495652_0007759_7231_8115 294
198 3300046531 Ga0495665_0020138 Ga0495665_0020138_1067_1951 294
199 3300046531 Ga0495665_0106929 Ga0495665_0106929_10_894 294
200 3300046533 Ga0495640_0002101 Ga0495640_0002101_9655_10539 294
201 3300046536 Ga0495587_0004881 Ga0495587_0004881_6399_7283 294
202 3300046543 Ga0495645_0020316 Ga0495645_0020316_1477_2361 294
203 3300046558 Ga0495633_0014285 Ga0495633_0014285_899_1783 294
204 3300046559 Ga0495667_0000565 Ga0495667_0000565_77_961 294
205 3300046615 Ga0495656_0006175 Ga0495656_0006175_2466_3350 294
206 3300046615 Ga0495656_0047306 Ga0495656_0047306_836_1720 294
207 3300046616 Ga0495668_0099572 Ga0495668_0099572_305_1189 294
208 3300046642 Ga0495634_0031880 Ga0495634_0031880_51_935 294
209 3300046660 Ga0495625_0120176 Ga0495625_0120176_473_1357 294
210 3300046663 Ga0495635_0008973 Ga0495635_0008973_1408_2292 294
211 3300046675 Ga0495657_0006050 Ga0495657_0006050_2038_2922 294
212 3300046678 Ga0495599_0002227 Ga0495599_0002227_2305_3189 294
213 3300046679 Ga0495623_0071727 Ga0495623_0071727_147_1031 294
214 3300046680 Ga0495646_0001804 Ga0495646_0001804_10941_11825 294
215 3300046681 Ga0495647_0005601 Ga0495647_0005601_2815_3699 294
216 3300046683 Ga0495658_0009010 Ga0495658_0009010_3331_4215 294
217 3300046684 Ga0495669_0120306 Ga0495669_0120306_327_1211 294
218 3300046689 Ga0495613_0026270 Ga0495613_0026270_2628_3512 294
219 3300046690 Ga0495624_0129236 Ga0495624_0129236_408_1292 294
220 3300046691 Ga0495670_0059889 Ga0495670_0059889_903_1787 294
221 3300046692 Ga0495671_0125412 Ga0495671_0125412_220_1104 294
222 3300046694 Ga0495649_0111603 Ga0495649_0111603_409_1293 294
223 3300047315 Ga0495581_0075122 Ga0495581_0075122_365_1249 294
224 3300047317 Ga0495604_0000394 Ga0495604_0000394_16016_16900 294
225 3300047319 Ga0495674_0066618 Ga0495674_0066618_1465_2349 294
226 3300047321 Ga0495676_0097596 Ga0495676_0097596_475_1359 294
227 3300047322 Ga0495680_0000539 Ga0495680_0000539_32007_32891 294
228 3300047444 Ga0495675_0053415 Ga0495675_0053415_248_1132 294
229 3300047471 Ga0495684_0019982 Ga0495684_0019982_3245_4129 294
230 3300047471 Ga0495684_0046187 Ga0495684_0046187_495_1379 294
231 3300047673 Ga0495593_0164274 Ga0495593_0164274_178_1062 294
232 3300048903 Ga0496100_0040028 Ga0496100_0040028_1350_2234 294
233 3300048903 Ga0496100_0106691 Ga0496100_0106691_980_1864 294
234 3300048904 Ga0496101_0012035 Ga0496101_0012035_1101_1985 294
235 3300048904 Ga0496101_0079274 Ga0496101_0079274_1397_2281 294
236 3300048905 Ga0496102_0029868 Ga0496102_0029868_659_1543 294
237 3300048905 Ga0496102_0224379 Ga0496102_0224379_410_1294 294
238 3300048906 Ga0496103_0005671 Ga0496103_0005671_1468_2352 294
239 3300048907 Ga0496104_0000764 Ga0496104_0000764_1519_2403 294
240 3300048907 Ga0496104_0037139 Ga0496104_0037139_2783_3667 294
241 3300048907 Ga0496104_0100794 Ga0496104_0100794_859_1743 294
242 3300048907 Ga0496104_0216602 Ga0496104_0216602_504_1388 294
243 3300048908 Ga0496105_0012626 Ga0496105_0012626_2084_2968 294
244 3300048908 Ga0496105_0212726 Ga0496105_0212726_189_1073 294
245 3300048908 Ga0496105_0268758 Ga0496105_0268758_304_1188 294
246 3300048909 Ga0496106_0005971 Ga0496106_0005971_118_1002 294
247 3300048909 Ga0496106_0280695 Ga0496106_0280695_229_1113 294
248 3300048910 Ga0496107_0053858 Ga0496107_0053858_429_1313 294
249 3300048910 Ga0496107_0118485 Ga0496107_0118485_837_1721 294
250 3300048911 Ga0496108_0000868 Ga0496108_0000868_21385_22269 294
251 3300048911 Ga0496108_0239741 Ga0496108_0239741_65_949 294
252 3300048912 Ga0496109_0000506 Ga0496109_0000506_18939_19823 294
253 3300048913 Ga0496110_0098004 Ga0496110_0098004_1013_1897 294
254 3300048913 Ga0496110_0124238 Ga0496110_0124238_1272_2156 294
255 3300048913 Ga0496110_0220688 Ga0496110_0220688_49_933 294
256 3300048913 Ga0496110_0281415 Ga0496110_0281415_448_1332 294
257 3300048914 Ga0496111_0072512 Ga0496111_0072512_223_1107 294
258 3300048914 Ga0496111_0306300 Ga0496111_0306300_237_1121 294
259 3300048916 Ga0496113_0171844 Ga0496113_0171844_692_1576 294
260 3300048917 Ga0496114_0042614 Ga0496114_0042614_2105_2989 294
261 3300048918 Ga0496115_0018366 Ga0496115_0018366_470_1354 294
262 3300048918 Ga0496115_0121924 Ga0496115_0121924_1160_2044 294
263 3300048918 Ga0496115_0175374 Ga0496115_0175374_795_1679 294
264 3300049568 Ga0501031_0002931 Ga0501031_0002931_8513_9397 294
265 3300049569 Ga0501032_0030089 Ga0501032_0030089_2147_3031 294
266 3300049570 Ga0501033_0012886 Ga0501033_0012886_1074_1958 294
267 3300049571 Ga0501034_0018046 Ga0501034_0018046_5763_6647 294
268 3300049571 Ga0501034_0169098 Ga0501034_0169098_1012_1902 294
269 3300049572 Ga0501036_0004687 Ga0501036_0004687_6086_6970 294
270 3300049573 Ga0501037_0005982 Ga0501037_0005982_4500_5384 294
271 3300049574 Ga0501038_0030646 Ga0501038_0030646_3414_4298 294
272 3300049575 Ga0501039_0001438 Ga0501039_0001438_6751_7635 294
273 3300049579 Ga0501043_0017921 Ga0501043_0017921_2316_3200 294
274 3300049580 Ga0501046_0010334 Ga0501046_0010334_6101_6985 294
275 3300049581 Ga0501047_0031535 Ga0501047_0031535_3534_4418 294
276 3300049582 Ga0501048_0004490 Ga0501048_0004490_2321_3205 294
277 3300049582 Ga0501048_0413198 Ga0501048_0413198_43_927 294
278 3300049583 Ga0501067_0005740 Ga0501067_0005740_1354_2238 294
279 3300049584 Ga0501068_0011311 Ga0501068_0011311_1052_1936 294
280 3300049585 Ga0501069_0006487 Ga0501069_0006487_4196_5080 294
281 3300049586 Ga0501070_0025502 Ga0501070_0025502_1259_2143 294
282 3300049589 Ga0501073_0006774 Ga0501073_0006774_5499_6383 294
283 3300049590 Ga0501074_0012936 Ga0501074_0012936_1770_2654 294
284 3300049592 Ga0501076_0408016 Ga0501076_0408016_143_1027 294
285 3300049593 Ga0501077_0166512 Ga0501077_0166512_246_1130 294
286 3300049741 Ga0501079_0026795 Ga0501079_0026795_1287_2171 294
287 3300049742 Ga0501080_0028534 Ga0501080_0028534_1093_1977 294
288 3300049744 Ga0501083_0015045 Ga0501083_0015045_2992_3876 294
289 3300049822 Ga0501035_0014526 Ga0501035_0014526_2354_3238 294
290 3300049823 Ga0501044_0000193 Ga0501044_0000193_21312_22202 294
291 3300049823 Ga0501044_0026928 Ga0501044_0026928_4506_5390 294
292 3300050489 nmdc:mga03683_126932_c1 nmdc:mga03683_126932_c1_114_1028 294
293 3300050489 nmdc:mga03683_59371_c1 nmdc:mga03683_59371_c1_478_1362 294
294 3300050492 nmdc:mga0yw44_1168_c1 nmdc:mga0yw44_1168_c1_2256_3140 294
295 3300050492 nmdc:mga0yw44_393333_c1 nmdc:mga0yw44_393333_c1_38_922 294
296 3300050492 nmdc:mga0yw44_86374_c1 nmdc:mga0yw44_86374_c1_146_1030 294
297 3300050492 nmdc:mga0yw44_92657_c1 nmdc:mga0yw44_92657_c1_135_1019 294
298 3300050493 nmdc:mga0k408_79482_c1 nmdc:mga0k408_79482_c1_909_1823 294
299 3300050493 nmdc:mga0k408_99043_c1 nmdc:mga0k408_99043_c1_753_1661 294
300 3300050494 nmdc:mga06z11_49678_c1 nmdc:mga06z11_49678_c1_204_1088 294
301 3300050507 nmdc:mga05p37_129066_c1 nmdc:mga05p37_129066_c1_1249_2133 294
302 3300050507 nmdc:mga05p37_35469_c1 nmdc:mga05p37_35469_c1_4966_5850 294
303 3300050507 nmdc:mga05p37_373263_c1 nmdc:mga05p37_373263_c1_191_1075 294
304 3300050507 nmdc:mga05p37_391044_c1 nmdc:mga05p37_391044_c1_171_1055 294
305 3300050508 nmdc:mga09592_148468_c1 nmdc:mga09592_148468_c1_557_1441 294
306 3300050508 nmdc:mga09592_155548_c1 nmdc:mga09592_155548_c1_623_1507 294
307 3300050509 nmdc:mga0qj67_157449_c1 nmdc:mga0qj67_157449_c1_870_1754 294
308 3300050509 nmdc:mga0qj67_61098_c1 nmdc:mga0qj67_61098_c1_846_1730 294
309 3300050510 nmdc:mga06r32_128479_c1 nmdc:mga06r32_128479_c1_1368_2252 294
310 3300050510 nmdc:mga06r32_92744_c1 nmdc:mga06r32_92744_c1_1413_2297 294
311 3300050511 nmdc:mga08y16_105572_c1 nmdc:mga08y16_105572_c1_716_1600 294
312 3300050511 nmdc:mga08y16_391273_c1 nmdc:mga08y16_391273_c1_131_1015 294
313 3300050512 nmdc:mga0n895_602258_c1 nmdc:mga0n895_602258_c1_196_1080 294
314 3300050512 nmdc:mga0n895_91583_c1 nmdc:mga0n895_91583_c1_783_1667 294
315 3300050513 nmdc:mga0rr50_402115_c1 nmdc:mga0rr50_402115_c1_253_1137 294
316 3300050514 nmdc:mga08x19_217847_c1 nmdc:mga08x19_217847_c1_129_1013 294
317 3300050515 nmdc:mga0a205_152828_c1 nmdc:mga0a205_152828_c1_758_1642 294
318 3300053077 Ga0495601_0102456 Ga0495601_0102456_483_1367 294
319 3300053078 Ga0495612_0000183 Ga0495612_0000183_13115_13999 294
320 3300053084 Ga0495595_0002395 Ga0495595_0002395_3223_4107 294
321 3300053085 Ga0495619_0000650 Ga0495619_0000650_20219_21103 294
322 3300053085 Ga0495619_0035311 Ga0495619_0035311_939_1823 294
323 3300053096 Ga0500641_0060086 Ga0500641_0060086_608_1522 294
324 3300054114 Ga0501084_0019048 Ga0501084_0019048_2872_3756 294
325 3300060353 Ga0501082_0006937 Ga0501082_0006937_6289_7173 294
326 2209111006 2214745235 2213755023 295
327 3300000042 ARSoilYngRDRAFT_c00289 ARSoilYngRDRAFT_002893 295
328 3300000043 ARcpr5yngRDRAFT_c000271 ARcpr5yngRDRAFT_0002716 295
329 3300000044 ARSoilOldRDRAFT_c000295 ARSoilOldRDRAFT_0002956 295
330 3300000652 ARCol0yngRDRAFT_1000053 ARCol0yngRDRAFT_100005315 295
331 3300001979 JGI24740J21852_10014159 JGI24740J21852_100141594 295
332 3300001990 JGI24737J22298_10002175 JGI24737J22298_100021755 295
333 3300002070 JGI24750J21931_1000807 JGI24750J21931_10008072 295
334 3300002074 JGI24748J21848_1001444 JGI24748J21848_10014443 295
335 3300002075 JGI24738J21930_10003423 JGI24738J21930_100034232 295
336 3300002077 JGI24744J21845_10001325 JGI24744J21845_100013254 295
337 3300002155 JGI24033J26618_1002454 JGI24033J26618_10024541 295
338 3300002239 JGI24034J26672_10000436 JGI24034J26672_100004365 295
339 3300002244 JGI24742J22300_10000131 JGI24742J22300_100001315 295
340 3300003203 JGI25406J46586_10010069 JGI25406J46586_100100695 295
341 3300005277 Ga0065716_1002255 Ga0065716_10022551 295
342 3300005289 Ga0065704_10101333 Ga0065704_101013332 295
343 3300005290 Ga0065712_10006389 Ga0065712_100063892 295
344 3300005290 Ga0065712_10020432 Ga0065712_100204322 295
345 3300005293 Ga0065715_10000953 Ga0065715_100009537 295
346 3300005293 Ga0065715_10006553 Ga0065715_100065534 295
347 3300005295 Ga0065707_10113298 Ga0065707_101132982 295
348 3300005328 Ga0070676_10008398 Ga0070676_100083982 295
349 3300005329 Ga0070683_100001740 Ga0070683_10000174018 295
350 3300005330 Ga0070690_100005830 Ga0070690_1000058305 295
351 3300005330 Ga0070690_100071996 Ga0070690_1000719962 295
352 3300005331 Ga0070670_100023972 Ga0070670_1000239722 295
353 3300005333 Ga0070677_10000553 Ga0070677_100005539 295
354 3300005334 Ga0068869_100004139 Ga0068869_1000041393 295
355 3300005334 Ga0068869_100028847 Ga0068869_1000288471 295
356 3300005334 Ga0068869_100224315 Ga0068869_1002243152 295
357 3300005335 Ga0070666_10021676 Ga0070666_100216762 295
358 3300005335 Ga0070666_10073203 Ga0070666_100732032 295
359 3300005336 Ga0070680_100002899 Ga0070680_1000028996 295
360 3300005336 Ga0070680_100013552 Ga0070680_1000135526 295
361 3300005337 Ga0070682_100196384 Ga0070682_1001963842 295
362 3300005338 Ga0068868_100005781 Ga0068868_1000057816 295
363 3300005339 Ga0070660_100001515 Ga0070660_10000151518 295
364 3300005339 Ga0070660_100198358 Ga0070660_1001983581 295
365 3300005340 Ga0070689_100001241 Ga0070689_10000124114 295
366 3300005341 Ga0070691_10064595 Ga0070691_100645952 295
367 3300005343 Ga0070687_100002230 Ga0070687_1000022306 295
368 3300005343 Ga0070687_100093250 Ga0070687_1000932502 295
369 3300005344 Ga0070661_100012739 Ga0070661_1000127394 295
370 3300005344 Ga0070661_100056802 Ga0070661_1000568023 295
371 3300005345 Ga0070692_10006992 Ga0070692_100069924 295
372 3300005345 Ga0070692_10008859 Ga0070692_100088592 295
373 3300005345 Ga0070692_10156883 Ga0070692_101568832 295
374 3300005347 Ga0070668_100002506 Ga0070668_10000250618 295
375 3300005347 Ga0070668_100066945 Ga0070668_1000669452 295
376 3300005347 Ga0070668_100344455 Ga0070668_1003444551 295
377 3300005347 Ga0070668_100352522 Ga0070668_1003525222 295
378 3300005353 Ga0070669_100000743 Ga0070669_10000074314 295
379 3300005354 Ga0070675_100001086 Ga0070675_10000108619 295
380 3300005354 Ga0070675_100162845 Ga0070675_1001628452 295
381 3300005354 Ga0070675_100196384 Ga0070675_1001963842 295
382 3300005355 Ga0070671_100004095 Ga0070671_10000409510 295
383 3300005355 Ga0070671_100052468 Ga0070671_1000524683 295
384 3300005355 Ga0070671_100176242 Ga0070671_1001762422 295
385 3300005356 Ga0070674_100063066 Ga0070674_1000630662 295
386 3300005364 Ga0070673_100000419 Ga0070673_1000004195 295
387 3300005365 Ga0070688_100003465 Ga0070688_1000034652 295
388 3300005366 Ga0070659_100007008 Ga0070659_1000070086 295
389 3300005366 Ga0070659_100022088 Ga0070659_1000220885 295
390 3300005367 Ga0070667_100279960 Ga0070667_1002799602 295
391 3300005406 Ga0070703_10001244 Ga0070703_100012446 295
392 3300005406 Ga0070703_10004556 Ga0070703_100045563 295
393 3300005434 Ga0070709_10011868 Ga0070709_100118686 295
394 3300005434 Ga0070709_10021857 Ga0070709_100218572 295
395 3300005434 Ga0070709_10042462 Ga0070709_100424622 295
396 3300005434 Ga0070709_10073099 Ga0070709_100730992 295
397 3300005435 Ga0070714_100004331 Ga0070714_10000433111 295
398 3300005435 Ga0070714_100087894 Ga0070714_1000878942 295
399 3300005435 Ga0070714_100203326 Ga0070714_1002033263 295
400 3300005436 Ga0070713_100005705 Ga0070713_1000057054 295
401 3300005436 Ga0070713_100016797 Ga0070713_1000167976 295
402 3300005436 Ga0070713_100121641 Ga0070713_1001216412 295
403 3300005436 Ga0070713_100364987 Ga0070713_1003649872 295
404 3300005437 Ga0070710_10004305 Ga0070710_100043053 295
405 3300005437 Ga0070710_10008141 Ga0070710_100081413 295
406 3300005437 Ga0070710_10068466 Ga0070710_100684662 295
407 3300005437 Ga0070710_10075948 Ga0070710_100759482 295
408 3300005438 Ga0070701_10000365 Ga0070701_100003655 295
409 3300005438 Ga0070701_10059982 Ga0070701_100599822 295
410 3300005439 Ga0070711_100021147 Ga0070711_1000211473 295
411 3300005439 Ga0070711_100039114 Ga0070711_1000391143 295
412 3300005439 Ga0070711_100073866 Ga0070711_1000738661 295
413 3300005439 Ga0070711_100363821 Ga0070711_1003638211 295
414 3300005440 Ga0070705_100001329 Ga0070705_1000013297 295
415 3300005440 Ga0070705_100001964 Ga0070705_1000019642 295
416 3300005441 Ga0070700_100008089 Ga0070700_1000080895 295
417 3300005441 Ga0070700_100008776 Ga0070700_1000087763 295
418 3300005444 Ga0070694_100002737 Ga0070694_1000027373 295
419 3300005444 Ga0070694_100021203 Ga0070694_1000212033 295
420 3300005444 Ga0070694_100180133 Ga0070694_1001801332 295
421 3300005445 Ga0070708_100041374 Ga0070708_1000413742 295
422 3300005455 Ga0070663_100019174 Ga0070663_1000191743 295
423 3300005455 Ga0070663_100217857 Ga0070663_1002178572 295
424 3300005456 Ga0070678_100005723 Ga0070678_1000057233 295
425 3300005456 Ga0070678_100083622 Ga0070678_1000836222 295
426 3300005457 Ga0070662_100025249 Ga0070662_1000252492 295
427 3300005458 Ga0070681_10010311 Ga0070681_100103112 295
428 3300005458 Ga0070681_10019665 Ga0070681_100196654 295
429 3300005458 Ga0070681_10189278 Ga0070681_101892782 295
430 3300005459 Ga0068867_100000980 Ga0068867_10000098010 295
431 3300005466 Ga0070685_10014838 Ga0070685_100148382 295
432 3300005466 Ga0070685_10015980 Ga0070685_100159804 295
433 3300005467 Ga0070706_100361152 Ga0070706_1003611522 295
434 3300005518 Ga0070699_100000444 Ga0070699_1000004448 295
435 3300005530 Ga0070679_100004363 Ga0070679_10000436312 295
436 3300005535 Ga0070684_100013266 Ga0070684_1000132666 295
437 3300005535 Ga0070684_100233276 Ga0070684_1002332762 295
438 3300005536 Ga0070697_100017942 Ga0070697_1000179424 295
439 3300005536 Ga0070697_100066086 Ga0070697_1000660861 295
440 3300005536 Ga0070697_100273340 Ga0070697_1002733402 295
441 3300005539 Ga0068853_100006929 Ga0068853_1000069292 295
442 3300005543 Ga0070672_100002302 Ga0070672_1000023023 295
443 3300005544 Ga0070686_100014304 Ga0070686_1000143043 295
444 3300005544 Ga0070686_100017776 Ga0070686_1000177764 295
445 3300005545 Ga0070695_100000918 Ga0070695_1000009186 295
446 3300005545 Ga0070695_100012338 Ga0070695_1000123383 295
447 3300005546 Ga0070696_100000123 Ga0070696_1000001232 295
448 3300005546 Ga0070696_100002724 Ga0070696_1000027245 295
449 3300005546 Ga0070696_100221935 Ga0070696_1002219352 295
450 3300005547 Ga0070693_100001476 Ga0070693_1000014763 295
451 3300005549 Ga0070704_100000095 Ga0070704_10000009513 295
452 3300005549 Ga0070704_100037262 Ga0070704_1000372622 295
453 3300005563 Ga0068855_100066013 Ga0068855_1000660135 295
454 3300005563 Ga0068855_100279563 Ga0068855_1002795632 295
455 3300005564 Ga0070664_100105237 Ga0070664_1001052372 295
456 3300005577 Ga0068857_100002177 Ga0068857_10000217713 295
457 3300005577 Ga0068857_100011660 Ga0068857_1000116607 295
458 3300005614 Ga0068856_100003552 Ga0068856_1000035523 295
459 3300005614 Ga0068856_100058287 Ga0068856_1000582872 295
460 3300005615 Ga0070702_100016382 Ga0070702_1000163822 295
461 3300005615 Ga0070702_100018984 Ga0070702_1000189843 295
462 3300005616 Ga0068852_100051926 Ga0068852_1000519262 295
463 3300005617 Ga0068859_100001820 Ga0068859_1000018203 295
464 3300005617 Ga0068859_100005818 Ga0068859_10000581811 295
465 3300005618 Ga0068864_100000140 Ga0068864_10000014031 295
466 3300005718 Ga0068866_10001684 Ga0068866_100016843 295
467 3300005719 Ga0068861_100013494 Ga0068861_1000134943 295
468 3300005719 Ga0068861_100095034 Ga0068861_1000950342 295
469 3300005840 Ga0068870_10000654 Ga0068870_100006546 295
470 3300005841 Ga0068863_100000425 Ga0068863_10000042541 295
471 3300005842 Ga0068858_100095071 Ga0068858_1000950713 295
472 3300005843 Ga0068860_100002696 Ga0068860_1000026962 295
473 3300005843 Ga0068860_100064786 Ga0068860_1000647864 295
474 3300005844 Ga0068862_100020271 Ga0068862_1000202711 295
475 3300005844 Ga0068862_100089132 Ga0068862_1000891322 295
476 3300005937 Ga0081455_10088394 Ga0081455_100883942 295
477 3300005983 Ga0081540_1000192 Ga0081540_100019237 295
478 3300005983 Ga0081540_1039437 Ga0081540_10394372 295
479 3300005985 Ga0081539_10001465 Ga0081539_100014659 295
480 3300006028 Ga0070717_10011028 Ga0070717_100110285 295
481 3300006028 Ga0070717_10044248 Ga0070717_100442484 295
482 3300006038 Ga0075365_10261035 Ga0075365_102610352 295
483 3300006163 Ga0070715_10012668 Ga0070715_100126682 295
484 3300006163 Ga0070715_10024931 Ga0070715_100249313 295
485 3300006173 Ga0070716_100044490 Ga0070716_1000444901 295
486 3300006175 Ga0070712_100001277 Ga0070712_10000127715 295
487 3300006175 Ga0070712_100115819 Ga0070712_1001158192 295
488 3300006175 Ga0070712_100195653 Ga0070712_1001956532 295
489 3300006175 Ga0070712_100206962 Ga0070712_1002069622 295
490 3300006175 Ga0070712_100207459 Ga0070712_1002074592 295
491 3300006175 Ga0070712_100263486 Ga0070712_1002634862 295
492 3300006178 Ga0075367_10039252 Ga0075367_100392523 295
493 3300006178 Ga0075367_10082303 Ga0075367_100823032 295
494 3300006237 Ga0097621_100002131 Ga0097621_10000213113 295
495 3300006353 Ga0075370_10071803 Ga0075370_100718031 295
496 3300006358 Ga0068871_100008325 Ga0068871_1000083255 295
497 3300006844 Ga0075428_100019702 Ga0075428_1000197024 295
498 3300006846 Ga0075430_100037162 Ga0075430_1000371623 295
499 3300006847 Ga0075431_100017715 Ga0075431_1000177152 295
500 3300006852 Ga0075433_10140634 Ga0075433_101406342 295
501 3300006871 Ga0075434_100034873 Ga0075434_1000348734 295
502 3300006871 Ga0075434_100058688 Ga0075434_1000586885 295
503 3300006871 Ga0075434_100358577 Ga0075434_1003585772 295
504 3300006881 Ga0068865_100001142 Ga0068865_1000011422 295
505 3300006881 Ga0068865_100036778 Ga0068865_1000367784 295
506 3300006881 Ga0068865_100093528 Ga0068865_1000935282 295
507 3300006914 Ga0075436_100093284 Ga0075436_1000932841 295
508 3300006914 Ga0075436_100102002 Ga0075436_1001020022 295
509 3300006931 Ga0097620_100001820 Ga0097620_1000018203 295
510 3300006931 Ga0097620_100005818 Ga0097620_1000058183 295
511 3300006931 Ga0097620_100316806 Ga0097620_1003168062 295
512 3300007076 Ga0075435_100022544 Ga0075435_1000225444 295
513 3300007076 Ga0075435_100125934 Ga0075435_1001259342 295
514 3300009092 Ga0105250_10032989 Ga0105250_100329892 295
515 3300009093 Ga0105240_10109955 Ga0105240_101099553 295
516 3300009093 Ga0105240_10175329 Ga0105240_101753292 295
517 3300009094 Ga0111539_10006796 Ga0111539_100067962 295
518 3300009094 Ga0111539_10014173 Ga0111539_100141739 295
519 3300009094 Ga0111539_10499868 Ga0111539_104998682 295
520 3300009098 Ga0105245_10000867 Ga0105245_1000086714 295
521 3300009098 Ga0105245_10023386 Ga0105245_100233861 295
522 3300009101 Ga0105247_10116603 Ga0105247_101166032 295
523 3300009147 Ga0114129_10017149 Ga0114129_100171495 295
524 3300009147 Ga0114129_10045872 Ga0114129_100458724 295
525 3300009148 Ga0105243_10002939 Ga0105243_100029399 295
526 3300009148 Ga0105243_10018773 Ga0105243_100187734 295
527 3300009148 Ga0105243_10143444 Ga0105243_101434442 295
528 3300009174 Ga0105241_10007866 Ga0105241_100078665 295
529 3300009174 Ga0105241_10036622 Ga0105241_100366223 295
530 3300009176 Ga0105242_10001899 Ga0105242_100018996 295
531 3300009176 Ga0105242_10014951 Ga0105242_100149514 295
532 3300009176 Ga0105242_10064165 Ga0105242_100641651 295
533 3300009177 Ga0105248_10003521 Ga0105248_1000352114 295
534 3300009177 Ga0105248_10029630 Ga0105248_100296303 295
535 3300009545 Ga0105237_10135063 Ga0105237_101350632 295
536 3300009545 Ga0105237_10139250 Ga0105237_101392502 295
537 3300009551 Ga0105238_10037311 Ga0105238_100373114 295
538 3300009551 Ga0105238_10119701 Ga0105238_101197012 295
539 3300009551 Ga0105238_10146147 Ga0105238_101461473 295
540 3300009553 Ga0105249_10002047 Ga0105249_100020472 295
541 3300009553 Ga0105249_10002541 Ga0105249_100025412 295
542 3300009553 Ga0105249_10553691 Ga0105249_105536912 295
543 3300010375 Ga0105239_10021557 Ga0105239_100215574 295
544 3300010375 Ga0105239_10037616 Ga0105239_100376164 295
545 3300011119 Ga0105246_10001875 Ga0105246_1000187510 295
546 3300012507 Ga0157342_1006643 Ga0157342_10066432 295
547 3300013100 Ga0157373_10100959 Ga0157373_101009592 295
548 3300013296 Ga0157374_10001408 Ga0157374_1000140814 295
549 3300013296 Ga0157374_10214333 Ga0157374_102143332 295
550 3300013297 Ga0157378_10004977 Ga0157378_100049775 295
551 3300013297 Ga0157378_10246279 Ga0157378_102462792 295
552 3300013306 Ga0163162_10011093 Ga0163162_100110937 295
553 3300013306 Ga0163162_10012257 Ga0163162_100122578 295
554 3300013306 Ga0163162_10130425 Ga0163162_101304252 295
555 3300013307 Ga0157372_10017879 Ga0157372_100178792 295
556 3300013307 Ga0157372_10770034 Ga0157372_107700341 295
557 3300013308 Ga0157375_10001932 Ga0157375_100019325 295
558 3300013308 Ga0157375_10113004 Ga0157375_101130043 295
559 3300014325 Ga0163163_10034835 Ga0163163_100348354 295
560 3300014326 Ga0157380_10014641 Ga0157380_100146415 295
561 3300014326 Ga0157380_10018915 Ga0157380_100189156 295
562 3300014326 Ga0157380_10157568 Ga0157380_101575682 295
563 3300014326 Ga0157380_10202861 Ga0157380_102028612 295
564 3300014745 Ga0157377_10000486 Ga0157377_1000048616 295
565 3300014745 Ga0157377_10039708 Ga0157377_100397082 295
566 3300014968 Ga0157379_10006828 Ga0157379_100068289 295
567 3300014968 Ga0157379_10133136 Ga0157379_101331362 295
568 3300014969 Ga0157376_10068143 Ga0157376_100681433 295
569 3300021384 Ga0213876_10033035 Ga0213876_100330352 295
570 3300021388 Ga0213875_10000003 Ga0213875_10000003317 295
571 3300025271 Ga0207666_1000089 Ga0207666_10000897 295
572 3300025290 Ga0207673_1002235 Ga0207673_10022352 295
573 3300025315 Ga0207697_10000993 Ga0207697_1000099310 295
574 3300025885 Ga0207653_10008690 Ga0207653_100086902 295
575 3300025893 Ga0207682_10000104 Ga0207682_1000010432 295
576 3300025898 Ga0207692_10026416 Ga0207692_100264163 295
577 3300025899 Ga0207642_10001116 Ga0207642_100011163 295
578 3300025901 Ga0207688_10002264 Ga0207688_1000226410 295
579 3300025901 Ga0207688_10029868 Ga0207688_100298683 295
580 3300025903 Ga0207680_10006968 Ga0207680_100069686 295
581 3300025903 Ga0207680_10018072 Ga0207680_100180723 295
582 3300025904 Ga0207647_10001528 Ga0207647_1000152811 295
583 3300025904 Ga0207647_10258746 Ga0207647_102587461 295
584 3300025905 Ga0207685_10020579 Ga0207685_100205792 295
585 3300025905 Ga0207685_10028679 Ga0207685_100286793 295
586 3300025906 Ga0207699_10008588 Ga0207699_100085883 295
587 3300025906 Ga0207699_10164078 Ga0207699_101640782 295
588 3300025906 Ga0207699_10270969 Ga0207699_102709691 295
589 3300025907 Ga0207645_10002130 Ga0207645_1000213010 295
590 3300025907 Ga0207645_10070174 Ga0207645_100701742 295
591 3300025908 Ga0207643_10000035 Ga0207643_1000003533 295
592 3300025911 Ga0207654_10026417 Ga0207654_100264173 295
593 3300025912 Ga0207707_10001935 Ga0207707_1000193512 295
594 3300025912 Ga0207707_10046635 Ga0207707_100466351 295
595 3300025912 Ga0207707_10092137 Ga0207707_100921373 295
596 3300025913 Ga0207695_10038532 Ga0207695_100385322 295
597 3300025915 Ga0207693_10001480 Ga0207693_100014805 295
598 3300025915 Ga0207693_10004775 Ga0207693_1000477511 295
599 3300025915 Ga0207693_10026826 Ga0207693_100268263 295
600 3300025915 Ga0207693_10057698 Ga0207693_100576982 295
601 3300025915 Ga0207693_10184433 Ga0207693_101844332 295
602 3300025915 Ga0207693_10207692 Ga0207693_102076922 295
603 3300025915 Ga0207693_10229672 Ga0207693_102296722 295
604 3300025916 Ga0207663_10008697 Ga0207663_100086972 295
605 3300025916 Ga0207663_10090454 Ga0207663_100904542 295
606 3300025916 Ga0207663_10172413 Ga0207663_101724131 295
607 3300025916 Ga0207663_10254950 Ga0207663_102549502 295
608 3300025917 Ga0207660_10000451 Ga0207660_100004518 295
609 3300025917 Ga0207660_10001146 Ga0207660_1000114617 295
610 3300025917 Ga0207660_10032704 Ga0207660_100327043 295
611 3300025918 Ga0207662_10002323 Ga0207662_100023238 295
612 3300025919 Ga0207657_10002025 Ga0207657_100020259 295
613 3300025919 Ga0207657_10024447 Ga0207657_100244475 295
614 3300025920 Ga0207649_10000309 Ga0207649_1000030930 295
615 3300025920 Ga0207649_10308122 Ga0207649_103081221 295
616 3300025921 Ga0207652_10010263 Ga0207652_100102635 295
617 3300025921 Ga0207652_10058859 Ga0207652_100588592 295
618 3300025922 Ga0207646_10304826 Ga0207646_103048262 295
619 3300025923 Ga0207681_10001488 Ga0207681_1000148813 295
620 3300025924 Ga0207694_10068334 Ga0207694_100683342 295
621 3300025924 Ga0207694_10144188 Ga0207694_101441882 295
622 3300025924 Ga0207694_10227863 Ga0207694_102278631 295
623 3300025925 Ga0207650_10061427 Ga0207650_100614272 295
624 3300025926 Ga0207659_10000091 Ga0207659_1000009137 295
625 3300025927 Ga0207687_10000161 Ga0207687_1000016137 295
626 3300025928 Ga0207700_10002812 Ga0207700_100028126 295
627 3300025928 Ga0207700_10393120 Ga0207700_103931201 295
628 3300025928 Ga0207700_10527315 Ga0207700_105273151 295
629 3300025929 Ga0207664_10011444 Ga0207664_100114443 295
630 3300025929 Ga0207664_10210631 Ga0207664_102106311 295
631 3300025931 Ga0207644_10000245 Ga0207644_1000024511 295
632 3300025931 Ga0207644_10052208 Ga0207644_100522082 295
633 3300025931 Ga0207644_10105600 Ga0207644_101056003 295
634 3300025932 Ga0207690_10000771 Ga0207690_100007712 295
635 3300025933 Ga0207706_10005499 Ga0207706_1000549910 295
636 3300025933 Ga0207706_10012450 Ga0207706_100124509 295
637 3300025934 Ga0207686_10001194 Ga0207686_100011942 295
638 3300025934 Ga0207686_10008989 Ga0207686_100089893 295
639 3300025934 Ga0207686_10040051 Ga0207686_100400511 295
640 3300025935 Ga0207709_10001001 Ga0207709_1000100113 295
641 3300025935 Ga0207709_10075536 Ga0207709_100755363 295
642 3300025935 Ga0207709_10084032 Ga0207709_100840322 295
643 3300025936 Ga0207670_10000526 Ga0207670_100005267 295
644 3300025936 Ga0207670_10018175 Ga0207670_100181754 295
645 3300025936 Ga0207670_10262025 Ga0207670_102620251 295
646 3300025938 Ga0207704_10031210 Ga0207704_100312102 295
647 3300025939 Ga0207665_10007368 Ga0207665_100073685 295
648 3300025939 Ga0207665_10025516 Ga0207665_100255162 295
649 3300025939 Ga0207665_10185695 Ga0207665_101856952 295
650 3300025940 Ga0207691_10000336 Ga0207691_1000033637 295
651 3300025941 Ga0207711_10035966 Ga0207711_100359663 295
652 3300025941 Ga0207711_10061529 Ga0207711_100615293 295
653 3300025942 Ga0207689_10000168 Ga0207689_100001687 295
654 3300025942 Ga0207689_10098550 Ga0207689_100985502 295
655 3300025942 Ga0207689_10145944 Ga0207689_101459442 295
656 3300025944 Ga0207661_10000575 Ga0207661_100005755 295
657 3300025945 Ga0207679_10000035 Ga0207679_10000035102 295
658 3300025945 Ga0207679_10205302 Ga0207679_102053021 295
659 3300025949 Ga0207667_10098793 Ga0207667_100987932 295
660 3300025960 Ga0207651_10000233 Ga0207651_1000023321 295
661 3300025961 Ga0207712_10000768 Ga0207712_1000076813 295
662 3300025961 Ga0207712_10009092 Ga0207712_100090923 295
663 3300025972 Ga0207668_10001470 Ga0207668_1000147012 295
664 3300025972 Ga0207668_10159635 Ga0207668_101596352 295
665 3300025981 Ga0207640_10001231 Ga0207640_100012318 295
666 3300025986 Ga0207658_10073032 Ga0207658_100730322 295
667 3300026023 Ga0207677_10000997 Ga0207677_1000099710 295
668 3300026023 Ga0207677_10061228 Ga0207677_100612281 295
669 3300026035 Ga0207703_10001880 Ga0207703_1000188012 295
670 3300026041 Ga0207639_10000421 Ga0207639_1000042114 295
671 3300026067 Ga0207678_10016361 Ga0207678_100163612 295
672 3300026067 Ga0207678_10186746 Ga0207678_101867462 295
673 3300026075 Ga0207708_10001793 Ga0207708_100017937 295
674 3300026075 Ga0207708_10013704 Ga0207708_100137043 295
675 3300026088 Ga0207641_10003563 Ga0207641_100035637 295
676 3300026088 Ga0207641_10484983 Ga0207641_104849831 295
677 3300026089 Ga0207648_10004259 Ga0207648_100042597 295
678 3300026089 Ga0207648_10060537 Ga0207648_100605373 295
679 3300026116 Ga0207674_10000535 Ga0207674_1000053535 295
680 3300026116 Ga0207674_10002113 Ga0207674_100021132 295
681 3300026118 Ga0207675_100000365 Ga0207675_10000036535 295
682 3300026121 Ga0207683_10000667 Ga0207683_1000066727 295
683 3300026121 Ga0207683_10010556 Ga0207683_100105567 295
684 3300026142 Ga0207698_10006961 Ga0207698_100069617 295
685 3300026142 Ga0207698_10326536 Ga0207698_103265362 295
686 3300027617 Ga0210002_1000583 Ga0210002_10005834 295
687 3300027665 Ga0209983_1008797 Ga0209983_10087972 295
688 3300027717 Ga0209998_10001636 Ga0209998_100016366 295
689 3300027876 Ga0209974_10006220 Ga0209974_100062202 295
690 3300027907 Ga0207428_10000636 Ga0207428_1000063625 295
691 3300027907 Ga0207428_10001024 Ga0207428_1000102430 295
692 3300028379 Ga0268266_10005119 Ga0268266_100051194 295
693 3300028380 Ga0268265_10003727 Ga0268265_1000372711 295
694 3300028380 Ga0268265_10007391 Ga0268265_100073912 295
695 3300028381 Ga0268264_10001508 Ga0268264_1000150812 295
696 3300028381 Ga0268264_10002415 Ga0268264_100024156 295
697 3300028800 Ga0265338_10031592 Ga0265338_100315924 295
698 3300031235 Ga0265330_10098784 Ga0265330_100987841 295
699 3300031241 Ga0265325_10000019 Ga0265325_1000001920 295
700 3300031241 Ga0265325_10003344 Ga0265325_100033444 295
701 3300031241 Ga0265325_10115243 Ga0265325_101152432 295
702 3300031242 Ga0265329_10094961 Ga0265329_100949611 295
703 3300031247 Ga0265340_10058370 Ga0265340_100583702 295
704 3300031249 Ga0265339_10019476 Ga0265339_100194762 295
705 3300031344 Ga0265316_10064110 Ga0265316_100641102 295
706 3300031595 Ga0265313_10001604 Ga0265313_100016042 295
707 3300031711 Ga0265314_10000577 Ga0265314_1000057710 295
708 3300031711 Ga0265314_10093502 Ga0265314_100935021 295
709 3300031712 Ga0265342_10000085 Ga0265342_100000856 295
710 3300034816 Ga0373930_0000585 Ga0373930_0000585_3414_4301 295
711 3300034817 Ga0373948_0000258 Ga0373948_0000258_4242_5129 295
712 3300034818 Ga0373950_0003921 Ga0373950_0003921_982_1869 295
713 3300034819 Ga0373958_0000124 Ga0373958_0000124_5046_5933 295
714 3300034819 Ga0373958_0005327 Ga0373958_0005327_566_1453 295
715 3300034957 Ga0373938_0000585 Ga0373938_0000585_1834_2721 295
716 3300035084 Ga0373928_0000615 Ga0373928_0000615_152_1039 295
717 3300035085 Ga0373929_0000271 Ga0373929_0000271_4186_5073 295
718 3300035085 Ga0373929_0003779 Ga0373929_0003779_1600_2487 295
719 3300035086 Ga0373934_0006337 Ga0373934_0006337_2765_3655 295
720 3300035086 Ga0373934_0111791 Ga0373934_0111791_178_1065 295
721 3300035088 Ga0373940_0003638 Ga0373940_0003638_1913_2800 295
722 3300035088 Ga0373940_0025596 Ga0373940_0025596_622_1509 295
723 3300035090 Ga0373949_0002356 Ga0373949_0002356_1140_2027 295
724 3300035090 Ga0373949_0002759 Ga0373949_0002759_3400_4287 295
725 3300035091 Ga0373951_0003109 Ga0373951_0003109_1860_2747 295
726 3300035091 Ga0373951_0004829 Ga0373951_0004829_1670_2557 295
727 3300035092 Ga0373952_0016434 Ga0373952_0016434_278_1165 295
728 3300035111 Ga0373923_0024434 Ga0373923_0024434_1274_2164 295
729 3300035112 Ga0373932_0004854 Ga0373932_0004854_812_1699 295
730 3300035112 Ga0373932_0010920 Ga0373932_0010920_1132_2019 295
731 3300035112 Ga0373932_0019069 Ga0373932_0019069_800_1687 295
732 3300035114 Ga0373939_0001233 Ga0373939_0001233_4982_5869 295
733 3300035115 Ga0373941_0021850 Ga0373941_0021850_133_1020 295
734 3300035115 Ga0373941_0109674 Ga0373941_0109674_34_921 295
735 3300035117 Ga0373953_0003874 Ga0373953_0003874_945_1835 295
736 3300035117 Ga0373953_0005397 Ga0373953_0005397_1747_2637 295
737 3300035117 Ga0373953_0016741 Ga0373953_0016741_1734_2621 295
738 3300035118 Ga0373954_0001845 Ga0373954_0001845_4453_5343 295
739 3300035120 Ga0373957_0001073 Ga0373957_0001073_2435_3322 295
740 3300035121 Ga0373960_0000880 Ga0373960_0000880_1292_2179 295
741 3300035121 Ga0373960_0003195 Ga0373960_0003195_2233_3120 295
742 3300035170 Ga0373943_0016099 Ga0373943_0016099_1516_2403 295
743 3300035172 Ga0373955_0001003 Ga0373955_0001003_2355_3242 295
744 3300035172 Ga0373955_0003829 Ga0373955_0003829_1442_2332 295
745 3300035172 Ga0373955_0005598 Ga0373955_0005598_768_1658 295
746 3300035207 Ga0373942_0008727 Ga0373942_0008727_513_1400 295
747 3300035241 Ga0373961_0001257 Ga0373961_0001257_4445_5332 295
748 3300035242 Ga0373962_0016674 Ga0373962_0016674_595_1482 295
749 3300035410 Ga0373924_0016437 Ga0373924_0016437_1349_2239 295
750 3300035691 Ga0373931_0002231 Ga0373931_0002231_4748_5635 295
751 3300035691 Ga0373931_0008138 Ga0373931_0008138_2635_3522 295
752 3300035724 Ga0373933_0000562 Ga0373933_0000562_6210_7100 295
753 3300035724 Ga0373933_0003500 Ga0373933_0003500_6583_7470 295
754 3300035725 Ga0373947_0047748 Ga0373947_0047748_400_1287 295
755 3300036401 Ga0373937_0000935 Ga0373937_0000935_21121_22011 295
756 3300036401 Ga0373937_0003782 Ga0373937_0003782_5590_6480 295
757 3300036401 Ga0373937_0004562 Ga0373937_0004562_1237_2124 295
758 3300037068 Ga0373925_0070415 Ga0373925_0070415_1323_2210 295
759 3300037068 Ga0373925_0072197 Ga0373925_0072197_12_902 295
760 3300037466 Ga0395898_0382342 Ga0395898_0382342_266_1153 295
761 3300039437 Ga0436365_0069514 Ga0436365_0069514_3653_4540 295
762 3300039437 Ga0436365_0518063 Ga0436365_0518063_473_1360 295
763 3300039437 Ga0436365_1724574 Ga0436365_1724574_2999_3886 295
764 3300039447 Ga0436361_0174868 Ga0436361_0174868_29_916 295
765 3300042016 Ga0439463_038340 Ga0439463_038340_131_1018 295
766 3300044684 Ga0466966_0001275 Ga0466966_0001275_7809_8696 295
767 3300044693 Ga0466961_0002805 Ga0466961_0002805_5997_6884 295
768 3300044694 Ga0466963_0056152 Ga0466963_0056152_622_1509 295
769 3300044842 Ga0466957_0015701 Ga0466957_0015701_976_1863 295
770 3300044842 Ga0466957_0401730 Ga0466957_0401730_23_910 295
771 3300045049 Ga0466959_0010634 Ga0466959_0010634_5614_6501 295
772 3300045836 Ga0466958_0011534 Ga0466958_0011534_3945_4832 295
773 3300046454 Ga0495592_0000755 Ga0495592_0000755_6681_7571 295
774 3300046454 Ga0495592_0024816 Ga0495592_0024816_1304_2194 295
775 3300046460 Ga0495638_0009619 Ga0495638_0009619_1637_2527 295
776 3300046460 Ga0495638_0028565 Ga0495638_0028565_1562_2449 295
777 3300046460 Ga0495638_0111672 Ga0495638_0111672_670_1557 295
778 3300046462 Ga0495651_0039432 Ga0495651_0039432_1592_2482 295
779 3300046463 Ga0495653_0003235 Ga0495653_0003235_9250_10140 295
780 3300046463 Ga0495653_0309200 Ga0495653_0309200_58_945 295
781 3300046472 Ga0495580_0314163 Ga0495580_0314163_159_1049 295
782 3300046473 Ga0495582_0074166 Ga0495582_0074166_319_1209 295
783 3300046475 Ga0495639_0119113 Ga0495639_0119113_62_952 295
784 3300046476 Ga0495662_0036623 Ga0495662_0036623_315_1205 295
785 3300046477 Ga0495664_0216571 Ga0495664_0216571_220_1110 295
786 3300046499 Ga0495594_0111271 Ga0495594_0111271_62_952 295
787 3300046511 Ga0495608_0000909 Ga0495608_0000909_8351_9241 295
788 3300046511 Ga0495608_0037441 Ga0495608_0037441_531_1418 295
789 3300046516 Ga0495628_0005724 Ga0495628_0005724_1943_2833 295
790 3300046516 Ga0495628_0026118 Ga0495628_0026118_1237_2127 295
791 3300046517 Ga0495630_0139869 Ga0495630_0139869_407_1297 295
792 3300046526 Ga0495666_0103014 Ga0495666_0103014_146_1036 295
793 3300046529 Ga0495652_0003415 Ga0495652_0003415_2825_3715 295
794 3300046529 Ga0495652_0004853 Ga0495652_0004853_10250_11140 295
795 3300046533 Ga0495640_0052041 Ga0495640_0052041_345_1232 295
796 3300046533 Ga0495640_0072503 Ga0495640_0072503_309_1199 295
797 3300046536 Ga0495587_0000335 Ga0495587_0000335_950_1840 295
798 3300046536 Ga0495587_0049250 Ga0495587_0049250_640_1527 295
799 3300046543 Ga0495645_0006430 Ga0495645_0006430_4859_5749 295
800 3300046559 Ga0495667_0000333 Ga0495667_0000333_7068_7958 295
801 3300046559 Ga0495667_0001149 Ga0495667_0001149_11513_12400 295
802 3300046559 Ga0495667_0049025 Ga0495667_0049025_1205_2095 295
803 3300046663 Ga0495635_0015934 Ga0495635_0015934_4156_5046 295
804 3300046674 Ga0495588_0031463 Ga0495588_0031463_800_1690 295
805 3300046675 Ga0495657_0008927 Ga0495657_0008927_2755_3642 295
806 3300046675 Ga0495657_0030475 Ga0495657_0030475_288_1178 295
807 3300046678 Ga0495599_0002084 Ga0495599_0002084_1238_2128 295
808 3300046679 Ga0495623_0006023 Ga0495623_0006023_4292_5182 295
809 3300046680 Ga0495646_0000174 Ga0495646_0000174_21133_22023 295
810 3300046680 Ga0495646_0113783 Ga0495646_0113783_197_1087 295
811 3300046683 Ga0495658_0038554 Ga0495658_0038554_1314_2204 295
812 3300046683 Ga0495658_0122096 Ga0495658_0122096_427_1317 295
813 3300046684 Ga0495669_0046308 Ga0495669_0046308_964_1851 295
814 3300046690 Ga0495624_0054432 Ga0495624_0054432_1619_2509 295
815 3300046809 Ga0495600_0009519 Ga0495600_0009519_658_1548 295
816 3300046809 Ga0495600_0010622 Ga0495600_0010622_4014_4904 295
817 3300046809 Ga0495600_0027331 Ga0495600_0027331_467_1354 295
818 3300047317 Ga0495604_0002160 Ga0495604_0002160_1109_1999 295
819 3300047317 Ga0495604_0014145 Ga0495604_0014145_1071_1958 295
820 3300047317 Ga0495604_0020405 Ga0495604_0020405_3708_4598 295
821 3300047319 Ga0495674_0007775 Ga0495674_0007775_32_922 295
822 3300047319 Ga0495674_0019628 Ga0495674_0019628_33_923 295
823 3300047322 Ga0495680_0011470 Ga0495680_0011470_4238_5128 295
824 3300047322 Ga0495680_0024811 Ga0495680_0024811_2687_3574 295
825 3300047444 Ga0495675_0000139 Ga0495675_0000139_30119_31009 295
826 3300047444 Ga0495675_0020530 Ga0495675_0020530_2289_3176 295
827 3300047444 Ga0495675_0032480 Ga0495675_0032480_2058_2948 295
828 3300047471 Ga0495684_0133792 Ga0495684_0133792_907_1797 295
829 3300047673 Ga0495593_0025441 Ga0495593_0025441_884_1774 295
830 3300048088 Ga0495602_0000310 Ga0495602_0000310_19412_20302 295
831 3300048088 Ga0495602_0003234 Ga0495602_0003234_7706_8596 295
832 3300048088 Ga0495602_0035932 Ga0495602_0035932_858_1745 295
833 3300048089 Ga0495614_0034702 Ga0495614_0034702_884_1774 295
834 3300048903 Ga0496100_0006174 Ga0496100_0006174_895_1782 295
835 3300048903 Ga0496100_0020290 Ga0496100_0020290_227_1114 295
836 3300048904 Ga0496101_0000924 Ga0496101_0000924_15894_16781 295
837 3300048904 Ga0496101_0104882 Ga0496101_0104882_367_1257 295
838 3300048904 Ga0496101_0176283 Ga0496101_0176283_368_1255 295
839 3300048904 Ga0496101_0178918 Ga0496101_0178918_368_1255 295
840 3300048904 Ga0496101_0385529 Ga0496101_0385529_173_1060 295
841 3300048905 Ga0496102_0021645 Ga0496102_0021645_2146_3036 295
842 3300048905 Ga0496102_0025763 Ga0496102_0025763_371_1258 295
843 3300048905 Ga0496102_0511989 Ga0496102_0511989_220_1107 295
844 3300048906 Ga0496103_0037828 Ga0496103_0037828_638_1525 295
845 3300048907 Ga0496104_0000217 Ga0496104_0000217_23239_24129 295
846 3300048907 Ga0496104_0034046 Ga0496104_0034046_3490_4380 295
847 3300048907 Ga0496104_0047679 Ga0496104_0047679_2405_3292 295
848 3300048907 Ga0496104_0114561 Ga0496104_0114561_370_1257 295
849 3300048907 Ga0496104_0126748 Ga0496104_0126748_1177_2064 295
850 3300048907 Ga0496104_0142607 Ga0496104_0142607_354_1241 295
851 3300048908 Ga0496105_0058838 Ga0496105_0058838_1918_2805 295
852 3300048908 Ga0496105_0191786 Ga0496105_0191786_355_1242 295
853 3300048909 Ga0496106_0000894 Ga0496106_0000894_1630_2598 295
854 3300048909 Ga0496106_0003651 Ga0496106_0003651_1434_2321 295
855 3300048909 Ga0496106_0069234 Ga0496106_0069234_1114_2001 295
856 3300048909 Ga0496106_0096396 Ga0496106_0096396_1015_1917 295
857 3300048910 Ga0496107_0005058 Ga0496107_0005058_7465_8352 295
858 3300048910 Ga0496107_0101421 Ga0496107_0101421_714_1604 295
859 3300048911 Ga0496108_0043186 Ga0496108_0043186_1818_2705 295
860 3300048911 Ga0496108_0087135 Ga0496108_0087135_839_1726 295
861 3300048912 Ga0496109_0039228 Ga0496109_0039228_2281_3171 295
862 3300048912 Ga0496109_0053061 Ga0496109_0053061_2466_3353 295
863 3300048912 Ga0496109_0059559 Ga0496109_0059559_2173_3060 295
864 3300048912 Ga0496109_0120218 Ga0496109_0120218_1230_2198 295
865 3300048912 Ga0496109_0173069 Ga0496109_0173069_665_1567 295
866 3300048913 Ga0496110_0063024 Ga0496110_0063024_995_1885 295
867 3300048913 Ga0496110_0111637 Ga0496110_0111637_1320_2222 295
868 3300048914 Ga0496111_0142936 Ga0496111_0142936_777_1664 295
869 3300048915 Ga0496112_0049492 Ga0496112_0049492_2173_3060 295
870 3300048915 Ga0496112_0294019 Ga0496112_0294019_363_1250 295
871 3300048915 Ga0496112_0412965 Ga0496112_0412965_42_929 295
872 3300048916 Ga0496113_0046247 Ga0496113_0046247_1676_2563 295
873 3300048917 Ga0496114_0013618 Ga0496114_0013618_3437_4324 295
874 3300048917 Ga0496114_0019154 Ga0496114_0019154_1544_2431 295
875 3300048917 Ga0496114_0043119 Ga0496114_0043119_384_1274 295
876 3300048918 Ga0496115_0004158 Ga0496115_0004158_8581_9468 295
877 3300048918 Ga0496115_0033213 Ga0496115_0033213_551_1441 295
878 3300048918 Ga0496115_0111789 Ga0496115_0111789_1177_2064 295
879 3300049568 Ga0501031_0006819 Ga0501031_0006819_2976_3866 295
880 3300049569 Ga0501032_0065765 Ga0501032_0065765_807_1697 295
881 3300049570 Ga0501033_0011756 Ga0501033_0011756_4166_5056 295
882 3300049571 Ga0501034_0095115 Ga0501034_0095115_441_1328 295
883 3300049572 Ga0501036_0011648 Ga0501036_0011648_5673_6563 295
884 3300049573 Ga0501037_0019553 Ga0501037_0019553_940_1830 295
885 3300049577 Ga0501041_0104610 Ga0501041_0104610_371_1258 295
886 3300049579 Ga0501043_0203226 Ga0501043_0203226_280_1170 295
887 3300049581 Ga0501047_0010921 Ga0501047_0010921_3785_4675 295
888 3300049581 Ga0501047_0010998 Ga0501047_0010998_3194_4081 295
889 3300049586 Ga0501070_0014059 Ga0501070_0014059_4701_5588 295
890 3300049586 Ga0501070_0159730 Ga0501070_0159730_916_1806 295
891 3300049586 Ga0501070_0188395 Ga0501070_0188395_322_1212 295
892 3300049587 Ga0501071_0077893 Ga0501071_0077893_1488_2378 295
893 3300049588 Ga0501072_0413864 Ga0501072_0413864_115_1011 295
894 3300049743 Ga0501081_0071525 Ga0501081_0071525_1178_2065 295
895 3300049822 Ga0501035_0018612 Ga0501035_0018612_3974_4864 295
896 3300049823 Ga0501044_0050174 Ga0501044_0050174_536_1423 295
897 3300049823 Ga0501044_0276295 Ga0501044_0276295_664_1554 295
898 3300050493 nmdc:mga0k408_24007_c1 nmdc:mga0k408_24007_c1_886_1773 295
899 3300050494 nmdc:mga06z11_12529_c1 nmdc:mga06z11_12529_c1_2314_3201 295
900 3300050494 nmdc:mga06z11_65020_c1 nmdc:mga06z11_65020_c1_204_1091 295
901 3300050496 nmdc:mga07m45_69470_c1 nmdc:mga07m45_69470_c1_491_1378 295
902 3300050507 nmdc:mga05p37_200042_c1 nmdc:mga05p37_200042_c1_1337_2227 295
903 3300050507 nmdc:mga05p37_265489_c1 nmdc:mga05p37_265489_c1_1027_1917 295
904 3300050507 nmdc:mga05p37_43990_c1 nmdc:mga05p37_43990_c1_4021_4908 295
905 3300050507 nmdc:mga05p37_5345_c1 nmdc:mga05p37_5345_c1_12876_13763 295
906 3300050508 nmdc:mga09592_183790_c1 nmdc:mga09592_183790_c1_820_1710 295
907 3300050509 nmdc:mga0qj67_70762_c1 nmdc:mga0qj67_70762_c1_69_959 295
908 3300050509 nmdc:mga0qj67_86566_c1 nmdc:mga0qj67_86566_c1_1610_2497 295
909 3300050511 nmdc:mga08y16_2968_c1 nmdc:mga08y16_2968_c1_3138_4025 295
910 3300050511 nmdc:mga08y16_8363_c1 nmdc:mga08y16_8363_c1_4459_5349 295
911 3300050512 nmdc:mga0n895_101152_c1 nmdc:mga0n895_101152_c1_1353_2240 295
912 3300050512 nmdc:mga0n895_12603_c1 nmdc:mga0n895_12603_c1_2488_3375 295
913 3300050512 nmdc:mga0n895_142142_c1 nmdc:mga0n895_142142_c1_78_965 295
914 3300050513 nmdc:mga0rr50_175655_c1 nmdc:mga0rr50_175655_c1_109_996 295
915 3300050515 nmdc:mga0a205_40346_c1 nmdc:mga0a205_40346_c1_1998_2885 295
916 3300050515 nmdc:mga0a205_75013_c1 nmdc:mga0a205_75013_c1_101_988 295
917 3300053077 Ga0495601_0003097 Ga0495601_0003097_2306_3196 295
918 3300053077 Ga0495601_0004639 Ga0495601_0004639_1953_2840 295
919 3300053077 Ga0495601_0005848 Ga0495601_0005848_4331_5221 295
920 3300053078 Ga0495612_0000857 Ga0495612_0000857_6138_7028 295
921 3300053078 Ga0495612_0007748 Ga0495612_0007748_572_1462 295
922 3300053078 Ga0495612_0025192 Ga0495612_0025192_708_1595 295
923 3300053084 Ga0495595_0000207 Ga0495595_0000207_1997_2887 295
924 3300053084 Ga0495595_0001895 Ga0495595_0001895_815_1705 295
925 3300053084 Ga0495595_0015608 Ga0495595_0015608_1141_2028 295
926 3300053085 Ga0495619_0000108 Ga0495619_0000108_34675_35565 295
927 3300053085 Ga0495619_0000225 Ga0495619_0000225_33552_34442 295
928 3300053085 Ga0495619_0001982 Ga0495619_0001982_5795_6685 295
929 3300053085 Ga0495619_0008701 Ga0495619_0008701_4502_5389 295
930 3300053088 Ga0500644_0000428 Ga0500644_0000428_10928_11815 295
931 3300053093 Ga0500651_0070006 Ga0500651_0070006_332_1219 295
932 3300053096 Ga0500641_0025612 Ga0500641_0025612_1155_2042 295
933 3300053098 Ga0500650_0071339 Ga0500650_0071339_473_1360 295
934 3300053153 Ga0500616_0000006 Ga0500616_0000006_621349_622236 295
935 3300053153 Ga0500616_0011892 Ga0500616_0011892_879_1766 295
936 3300053730 Ga0500645_000033 Ga0500645_000033_73107_73994 295
937 3300054114 Ga0501084_0230516 Ga0501084_0230516_211_1098 295
938 3300060353 Ga0501082_0215839 Ga0501082_0215839_649_1536 295
939 3300061734 Ga0530510_0058419 Ga0530510_0058419_301_1188 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

131

276

0.91

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

113

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zsz-assembly1.cif.gz_A catechol 2,3-dioxygenase (c23o64) from diaphorobacter sp ds2 0.9227 2 248
1mpy-assembly1.cif.gz_D structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2 0.9215 3 246
5znh-assembly1.cif.gz_A catechol 2,3-dioxygenase with 4-methyl catechol from diaphorobacter sp ds2 0.9173 2 248
3lm4-assembly1.cif.gz_B crystal structure of 2,3-dihydroxy biphenyl dioxygenase from rhodococcus sp. (strain rha1) 0.9173 2 247
7q2a-assembly1.cif.gz_A crystal structure of aphc in complex with 4-ethylcatechol 0.9171 2 247
ID Description Score Start End Superfamily
3b59F02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9331 135 248 3.10.180.10
5zszA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9283 135 248 3.10.180.10
5znhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9281 135 248 3.10.180.10
1mpyA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9273 134 247 3.10.180.10
1eilA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8916 4 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3D2LIL4-F1-model_v4 deleted 0.9599 130 247
AF-A0A5J6XS81-F1-model_v4 VOC domain-containing protein 0.9488 1 164
AF-A0A345PE51-F1-model_v4 VOC domain-containing protein 0.9445 1 247
AF-A0A212Q6K0-F1-model_v4 deleted 0.9427 1 220
AF-A0A654CTN7-F1-model_v4 Catechol-2,3-dioxygenase 0.9407 132 247 GO:0051213

Feature Viewer

pLDDT pTM Quality
87.85 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map