F486229

General Info

Members Datasets Scaffolds Average Seq Length
937 269 1874 146

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0067399|Ga0451576_0067399_68_616
Length 182
Sequence MRGCAARPQAQGSWLEPWALWALSLDSEQKEKTNMAIVKVDPFRELTAMQDRMARLFGDVYLRDEDTGFRGSWTPAVDIFETEHHDLVLKAEVPGMTRENIEVTVENGTLVLKGQKNFDTDVKEEHYRRIERSYGQFYRSFTLPNTVDTSKVAADYKNGILTVKLPFREEAKPRSINVEVAA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
100 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
191 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
222 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
245 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
251 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 0.43
Rhizosphere 98.93
Stem 0
Stem Tuber 0
Unclassified 19.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0067399 3300045051 Bacteria 3726
2 JGI24746J21847_1000909 3300001977 Bacteria 4622
3 JGI24750J21931_1027064 3300002070 Bacteria 828
4 JGI24749J21850_1010328 3300002076 Unclassified 1309
5 JGI24035J26624_1029462 3300002126 Archaea 595
6 JGI24751J29686_10093352 3300002459 Unclassified 626
7 JGI25406J46586_10012672 3300003203 Bacteria 3646
8 Ga0058860_11692652 3300004801 Archaea 502
9 Ga0058860_11970884 3300004801 Unclassified 618
10 Ga0058860_12184011 3300004801 Bacteria 617
11 Ga0065714_10342292 3300005288 Bacteria 617
12 Ga0065704_10077157 3300005289 Bacteria 4835
13 Ga0065704_10246247 3300005289 Bacteria 1001
14 Ga0065704_10347472 3300005289 Archaea 814
15 Ga0065704_10483285 3300005289 Unclassified 680
16 Ga0065712_10012047 3300005290 Bacteria 3073
17 Ga0065712_10019331 3300005290 Unclassified 1697
18 Ga0065712_10085635 3300005290 Bacteria 2685
19 Ga0065712_10086488 3300005290 Bacteria 2626
20 Ga0065712_10088620 3300005290 Bacteria 2500
21 Ga0065712_10223940 3300005290 Bacteria 1032
22 Ga0065712_10375391 3300005290 Unclassified 758
23 Ga0065712_10534061 3300005290 Unclassified 628
24 Ga0065715_10000879 3300005293 Bacteria 12771
25 Ga0065715_10096891 3300005293 Bacteria 3801
26 Ga0065715_10100717 3300005293 Bacteria 3275
27 Ga0065715_10624584 3300005293 Unclassified 693
28 Ga0065715_10701154 3300005293 Bacteria 653
29 Ga0065715_11083627 3300005293 Unclassified 524
30 Ga0065707_10006295 3300005295 Bacteria 3125
31 Ga0065707_10023887 3300005295 Bacteria 2106
32 Ga0065707_10275714 3300005295 Bacteria 1043
33 Ga0065707_10628294 3300005295 Archaea 654
34 Ga0065707_10805685 3300005295 Unclassified 597
35 Ga0070658_10477958 3300005327 Bacteria 1075
36 Ga0070658_11265126 3300005327 Bacteria 641
37 Ga0070658_11305960 3300005327 Unclassified 630
38 Ga0070676_10004240 3300005328 Bacteria 7536
39 Ga0070676_10126212 3300005328 Bacteria 1612
40 Ga0070676_10333427 3300005328 Unclassified 1038
41 Ga0070676_10402252 3300005328 Bacteria 953
42 Ga0070676_10959672 3300005328 Unclassified 640
43 Ga0070683_100065328 3300005329 Bacteria 3388
44 Ga0070683_100734194 3300005329 Bacteria 946
45 Ga0070683_101725729 3300005329 Unclassified 602
46 Ga0070690_100013733 3300005330 Bacteria 4796
47 Ga0070690_100016453 3300005330 Bacteria 4431
48 Ga0070690_100041224 3300005330 Bacteria 2922
49 Ga0070690_101516938 3300005330 Unclassified 542
50 Ga0070670_100021219 3300005331 Bacteria 5588
51 Ga0070670_100062034 3300005331 Bacteria 3209
52 Ga0070670_100069094 3300005331 Bacteria 3032
53 Ga0070670_100183131 3300005331 Bacteria 1819
54 Ga0070670_100268336 3300005331 Bacteria 1489
55 Ga0070670_100387732 3300005331 Bacteria 1231
56 Ga0070670_101120704 3300005331 Bacteria 718
57 Ga0070670_101218015 3300005331 Archaea 688
58 Ga0070670_101273836 3300005331 Bacteria 673
59 Ga0070677_10010650 3300005333 Bacteria 3150
60 Ga0070677_10321537 3300005333 Bacteria 793
61 Ga0068869_100003236 3300005334 Bacteria 9954
62 Ga0068869_100173747 3300005334 Bacteria 1685
63 Ga0068869_100309489 3300005334 Bacteria 1278
64 Ga0068869_100520169 3300005334 Unclassified 996
65 Ga0068869_100688548 3300005334 Bacteria 871
66 Ga0068869_100955344 3300005334 Bacteria 744
67 Ga0070666_10019167 3300005335 Bacteria 4413
68 Ga0070666_10025313 3300005335 Bacteria 3867
69 Ga0070666_10056738 3300005335 Bacteria 2645
70 Ga0070666_10750475 3300005335 Unclassified 717
71 Ga0070680_100189453 3300005336 Bacteria 1733
72 Ga0070680_100290096 3300005336 Bacteria 1387
73 Ga0070680_101041765 3300005336 Bacteria 707
74 Ga0070682_100593957 3300005337 Archaea 873
75 Ga0070682_102066207 3300005337 Unclassified 502
76 Ga0068868_100007147 3300005338 Bacteria 7935
77 Ga0068868_100132565 3300005338 Bacteria 2040
78 Ga0068868_100300595 3300005338 Bacteria 1363
79 Ga0068868_101566876 3300005338 Unclassified 618
80 Ga0070660_101288933 3300005339 Unclassified 620
81 Ga0070689_100006102 3300005340 Bacteria 8305
82 Ga0070689_100008169 3300005340 Bacteria 7356
83 Ga0070689_100062418 3300005340 Bacteria 2899
84 Ga0070689_100444795 3300005340 Bacteria 1102
85 Ga0070691_10169574 3300005341 Bacteria 1130
86 Ga0070687_100136219 3300005343 Bacteria 1424
87 Ga0070687_100584483 3300005343 Bacteria 765
88 Ga0070687_100643985 3300005343 Unclassified 734
89 Ga0070661_100033797 3300005344 Bacteria 3707
90 Ga0070661_100044414 3300005344 Bacteria 3247
91 Ga0070661_100230524 3300005344 Unclassified 1423
92 Ga0070661_100425074 3300005344 Bacteria 1054
93 Ga0070692_10086280 3300005345 Bacteria 1699
94 Ga0070692_10477954 3300005345 Archaea 803
95 Ga0070668_100107964 3300005347 Bacteria 2213
96 Ga0070668_100125945 3300005347 Bacteria 2052
97 Ga0070668_100332063 3300005347 Bacteria 1282
98 Ga0070668_101342214 3300005347 Bacteria 651
99 Ga0070669_100004669 3300005353 Bacteria 9888
100 Ga0070669_100007056 3300005353 Bacteria 8073
101 Ga0070669_100016438 3300005353 Bacteria 5279
102 Ga0070669_100097839 3300005353 Bacteria 2209
103 Ga0070669_100156477 3300005353 Bacteria 1768
104 Ga0070669_100193327 3300005353 Bacteria 1597
105 Ga0070669_100249264 3300005353 Unclassified 1413
106 Ga0070669_100431899 3300005353 Bacteria 1083
107 Ga0070675_100000998 3300005354 Bacteria 20285
108 Ga0070675_100003145 3300005354 Bacteria 12491
109 Ga0070675_100005576 3300005354 Bacteria 9637
110 Ga0070675_100017262 3300005354 Bacteria 5733
111 Ga0070675_100056448 3300005354 Bacteria 3236
112 Ga0070675_100068099 3300005354 Bacteria 2947
113 Ga0070675_100103317 3300005354 Bacteria 2403
114 Ga0070675_100176359 3300005354 Bacteria 1846
115 Ga0070675_100348068 3300005354 Unclassified 1314
116 Ga0070675_100358438 3300005354 Bacteria 1294
117 Ga0070675_100418093 3300005354 Bacteria 1198
118 Ga0070675_100571563 3300005354 Bacteria 1023
119 Ga0070675_100914156 3300005354 Bacteria 804
120 Ga0070675_101343057 3300005354 Unclassified 659
121 Ga0070675_101746188 3300005354 Unclassified 574
122 Ga0070671_100154900 3300005355 Bacteria 1936
123 Ga0070671_100338502 3300005355 Bacteria 1283
124 Ga0070674_100001500 3300005356 Bacteria 12440
125 Ga0070674_100126837 3300005356 Unclassified 1897
126 Ga0070674_100677382 3300005356 Unclassified 879
127 Ga0070674_101023128 3300005356 Unclassified 726
128 Ga0070674_101318208 3300005356 Unclassified 644
129 Ga0070673_100011067 3300005364 Bacteria 6147
130 Ga0070673_100024542 3300005364 Bacteria 4423
131 Ga0070673_100094764 3300005364 Unclassified 2447
132 Ga0070673_100142705 3300005364 Bacteria 2022
133 Ga0070673_100203331 3300005364 Bacteria 1706
134 Ga0070673_100266332 3300005364 Bacteria 1498
135 Ga0070673_100409621 3300005364 Bacteria 1214
136 Ga0070688_100020189 3300005365 Bacteria 3870
137 Ga0070688_100092983 3300005365 Bacteria 1974
138 Ga0070688_100164937 3300005365 Bacteria 1525
139 Ga0070688_100188539 3300005365 Unclassified 1435
140 Ga0070688_100393658 3300005365 Bacteria 1024
141 Ga0070688_100537017 3300005365 Bacteria 887
142 Ga0070688_101304894 3300005365 Unclassified 586
143 Ga0070659_100016032 3300005366 Bacteria 5621
144 Ga0070659_100821816 3300005366 Unclassified 809
145 Ga0070667_100025321 3300005367 Bacteria 4932
146 Ga0070667_100169857 3300005367 Bacteria 1925
147 Ga0070667_101069016 3300005367 Unclassified 754
148 Ga0070667_101368857 3300005367 Bacteria 664
149 Ga0070701_10079984 3300005438 Bacteria 1767
150 Ga0070701_10116834 3300005438 Bacteria 1498
151 Ga0070701_10276904 3300005438 Archaea 1023
152 Ga0070701_10455345 3300005438 Bacteria 822
153 Ga0070705_100001006 3300005440 Bacteria 15697
154 Ga0070705_100065913 3300005440 Bacteria 2170
155 Ga0070705_100169270 3300005440 Bacteria 1469
156 Ga0070705_100615398 3300005440 Bacteria 842
157 Ga0070705_100767487 3300005440 Unclassified 764
158 Ga0070700_100089978 3300005441 Bacteria 2001
159 Ga0070700_100152172 3300005441 Bacteria 1583
160 Ga0070700_100296060 3300005441 Bacteria 1179
161 Ga0070700_100303262 3300005441 Bacteria 1167
162 Ga0070694_100001224 3300005444 Bacteria 14823
163 Ga0070694_100002510 3300005444 Bacteria 10833
164 Ga0070694_100886870 3300005444 Viruses 736
165 Ga0070678_100019465 3300005456 Bacteria 4426
166 Ga0070678_100120646 3300005456 Unclassified 2067
167 Ga0070678_100129534 3300005456 Bacteria 2002
168 Ga0070678_100207670 3300005456 Bacteria 1620
169 Ga0070678_100443188 3300005456 Unclassified 1136
170 Ga0070678_100602360 3300005456 Bacteria 981
171 Ga0070678_101572406 3300005456 Unclassified 617
172 Ga0070662_100054409 3300005457 Bacteria 2900
173 Ga0070662_100063348 3300005457 Bacteria 2704
174 Ga0070662_100302125 3300005457 Bacteria 1301
175 Ga0070662_100548831 3300005457 Unclassified 968
176 Ga0070681_10018905 3300005458 Bacteria 6894
177 Ga0068867_100000147 3300005459 Bacteria 45184
178 Ga0068867_100163313 3300005459 Bacteria 1758
179 Ga0068867_100512027 3300005459 Bacteria 1033
180 Ga0068867_100580038 3300005459 Bacteria 975
181 Ga0068867_101319548 3300005459 Archaea 667
182 Ga0068867_101459412 3300005459 Unclassified 636
183 Ga0070685_10523763 3300005466 Bacteria 842
184 Ga0070685_11257714 3300005466 Unclassified 564
185 Ga0070685_11294069 3300005466 Bacteria 557
186 Ga0070707_100177536 3300005468 Bacteria 2076
187 Ga0070707_100182523 3300005468 Bacteria 2046
188 Ga0070698_100047613 3300005471 Bacteria 4382
189 Ga0070698_100329574 3300005471 Bacteria 1458
190 Ga0070698_100458203 3300005471 Unclassified 1211
191 Ga0070699_100002298 3300005518 Bacteria 17202
192 Ga0070699_100181189 3300005518 Bacteria 1869
193 Ga0070699_100220060 3300005518 Bacteria 1692
194 Ga0070699_100463047 3300005518 Bacteria 1150
195 Ga0070699_100521705 3300005518 Bacteria 1080
196 Ga0070679_100795251 3300005530 Bacteria 889
197 Ga0070679_101079940 3300005530 Bacteria 747
198 Ga0070684_100205443 3300005535 Bacteria 1795
199 Ga0070684_101315427 3300005535 Bacteria 680
200 Ga0070684_101438109 3300005535 Unclassified 649
201 Ga0070697_100152879 3300005536 Bacteria 1946
202 Ga0070697_100552502 3300005536 Unclassified 1010
203 Ga0070697_100590928 3300005536 Unclassified 975
204 Ga0070697_101035731 3300005536 Bacteria 730
205 Ga0068853_101545535 3300005539 Bacteria 643
206 Ga0070672_100014870 3300005543 Bacteria 5525
207 Ga0070672_100066226 3300005543 Bacteria 2860
208 Ga0070672_100078828 3300005543 Bacteria 2636
209 Ga0070672_100134439 3300005543 Unclassified 2036
210 Ga0070672_100258503 3300005543 Unclassified 1468
211 Ga0070672_100902142 3300005543 Bacteria 781
212 Ga0070686_100005406 3300005544 Bacteria 7073
213 Ga0070686_100126426 3300005544 Bacteria 1762
214 Ga0070686_100164530 3300005544 Bacteria 1565
215 Ga0070695_100000425 3300005545 Bacteria 21837
216 Ga0070695_100549752 3300005545 Bacteria 900
217 Ga0070695_100744111 3300005545 Unclassified 781
218 Ga0070696_100008088 3300005546 Bacteria 7028
219 Ga0070696_100093207 3300005546 Bacteria 2147
220 Ga0070696_100093556 3300005546 Bacteria 2144
221 Ga0070665_100063029 3300005548 Bacteria 3717
222 Ga0070704_100002260 3300005549 Bacteria 10750
223 Ga0070704_100002570 3300005549 Bacteria 10234
224 Ga0070704_100128184 3300005549 Bacteria 1962
225 Ga0070704_100184255 3300005549 Bacteria 1673
226 Ga0070704_100855012 3300005549 Unclassified 816
227 Ga0070664_100044718 3300005564 Bacteria 3739
228 Ga0070664_100052952 3300005564 Bacteria 3439
229 Ga0070664_100162791 3300005564 Bacteria 1975
230 Ga0070664_100403114 3300005564 Bacteria 1251
231 Ga0070664_100410841 3300005564 Bacteria 1239
232 Ga0070664_101347338 3300005564 Bacteria 674
233 Ga0070664_102294566 3300005564 Bacteria 512
234 Ga0068857_100164472 3300005577 Bacteria 2014
235 Ga0068857_100270782 3300005577 Bacteria 1561
236 Ga0068857_100363994 3300005577 Bacteria 1341
237 Ga0068854_101606235 3300005578 Archaea 593
238 Ga0070702_100054578 3300005615 Bacteria 2300
239 Ga0070702_100604312 3300005615 Unclassified 823
240 Ga0070702_100617564 3300005615 Unclassified 815
241 Ga0070702_100949974 3300005615 Bacteria 677
242 Ga0068852_100955304 3300005616 Unclassified 875
243 Ga0068852_101595063 3300005616 Bacteria 675
244 Ga0068852_101730433 3300005616 Archaea 648
245 Ga0068859_100002071 3300005617 Bacteria 20473
246 Ga0068859_100002533 3300005617 Bacteria 18549
247 Ga0068859_100022922 3300005617 Bacteria 6260
248 Ga0068859_100069602 3300005617 Unclassified 3554
249 Ga0068859_100185587 3300005617 Unclassified 2163
250 Ga0068859_101290359 3300005617 Bacteria 805
251 Ga0068859_102563362 3300005617 Unclassified 561
252 Ga0068864_100043267 3300005618 Bacteria 3856
253 Ga0068864_100067309 3300005618 Bacteria 3110
254 Ga0068864_100369486 3300005618 Bacteria 1357
255 Ga0068864_100431660 3300005618 Bacteria 1257
256 Ga0068864_100499665 3300005618 Bacteria 1170
257 Ga0068864_100586708 3300005618 Bacteria 1080
258 Ga0068866_10447546 3300005718 Bacteria 844
259 Ga0068866_11108478 3300005718 Bacteria 567
260 Ga0068861_100001293 3300005719 Bacteria 15634
261 Ga0068861_101108998 3300005719 Bacteria 761
262 Ga0068851_10849134 3300005834 Archaea 570
263 Ga0068870_10008632 3300005840 Bacteria 4593
264 Ga0068870_10014068 3300005840 Bacteria 3773
265 Ga0068870_10017998 3300005840 Bacteria 3404
266 Ga0068870_10026411 3300005840 Bacteria 2895
267 Ga0068870_10314003 3300005840 Unclassified 993
268 Ga0068870_10456817 3300005840 Unclassified 843
269 Ga0068870_10752093 3300005840 Bacteria 677
270 Ga0068863_100019665 3300005841 Bacteria 6459
271 Ga0068863_100186579 3300005841 Bacteria 1992
272 Ga0068863_100751413 3300005841 Unclassified 971
273 Ga0068863_100948241 3300005841 Bacteria 862
274 Ga0068858_100015339 3300005842 Bacteria 7208
275 Ga0068858_100052144 3300005842 Bacteria 3784
276 Ga0068858_100094724 3300005842 Bacteria 2781
277 Ga0068858_100585933 3300005842 Bacteria 1081
278 Ga0068860_100006114 3300005843 Bacteria 12108
279 Ga0068860_100038938 3300005843 Bacteria 4548
280 Ga0068860_101260478 3300005843 Unclassified 760
281 Ga0068862_100001293 3300005844 Bacteria 23404
282 Ga0068862_100004501 3300005844 Bacteria 11752
283 Ga0068862_100345180 3300005844 Bacteria 1380
284 Ga0068862_100580042 3300005844 Bacteria 1074
285 Ga0068862_100698178 3300005844 Bacteria 983
286 Ga0068862_100717161 3300005844 Bacteria 970
287 Ga0068862_101781073 3300005844 Unclassified 625
288 Ga0081539_10000013 3300005985 Bacteria 432395
289 Ga0081539_10000164 3300005985 Bacteria 154639
290 Ga0081539_10013539 3300005985 Bacteria 6136
291 Ga0081539_10058268 3300005985 Bacteria 2132
292 Ga0075432_10061975 3300006058 Bacteria 1333
293 Ga0075432_10088489 3300006058 Bacteria 1131
294 Ga0070712_101446797 3300006175 Unclassified 600
295 Ga0097621_100092943 3300006237 Bacteria 2527
296 Ga0097621_100255420 3300006237 Bacteria 1536
297 Ga0097621_100309097 3300006237 Bacteria 1398
298 Ga0097621_100995095 3300006237 Unclassified 784
299 Ga0068871_100065374 3300006358 Bacteria 2979
300 Ga0068871_100192405 3300006358 Bacteria 1758
301 Ga0068871_100218569 3300006358 Bacteria 1650
302 Ga0068871_100230976 3300006358 Unclassified 1606
303 Ga0068871_101280608 3300006358 Bacteria 689
304 Ga0075428_100000869 3300006844 Bacteria 31758
305 Ga0075428_100026891 3300006844 Bacteria 6371
306 Ga0075428_100038755 3300006844 Bacteria 5244
307 Ga0075428_100169423 3300006844 Unclassified 2368
308 Ga0075428_100181984 3300006844 Bacteria 2274
309 Ga0075428_100192975 3300006844 Bacteria 2203
310 Ga0075428_100234100 3300006844 Bacteria 1982
311 Ga0075428_100572935 3300006844 Bacteria 1206
312 Ga0075428_100884459 3300006844 Bacteria 948
313 Ga0075428_101247363 3300006844 Bacteria 783
314 Ga0075428_101818621 3300006844 Unclassified 634
315 Ga0075430_100005569 3300006846 Bacteria 10638
316 Ga0075430_100010153 3300006846 Bacteria 7971
317 Ga0075430_100015622 3300006846 Bacteria 6465
318 Ga0075430_100114945 3300006846 Bacteria 2242
319 Ga0075430_100164103 3300006846 Bacteria 1849
320 Ga0075430_100225283 3300006846 Bacteria 1555
321 Ga0075430_100569743 3300006846 Bacteria 934
322 Ga0075431_100000533 3300006847 Bacteria 31908
323 Ga0075431_100058743 3300006847 Bacteria 3969
324 Ga0075431_100117491 3300006847 Bacteria 2745
325 Ga0075431_100117777 3300006847 Bacteria 2741
326 Ga0075431_100455459 3300006847 Bacteria 1274
327 Ga0075431_100809648 3300006847 Bacteria 910
328 Ga0075433_10014616 3300006852 Bacteria 6418
329 Ga0075433_10030688 3300006852 Bacteria 4588
330 Ga0075433_10036407 3300006852 Bacteria 4239
331 Ga0075433_10053367 3300006852 Bacteria 3524
332 Ga0075433_10054073 3300006852 Bacteria 3502
333 Ga0075433_10183185 3300006852 Bacteria 1863
334 Ga0075433_10227894 3300006852 Bacteria 1655
335 Ga0075434_100008828 3300006871 Bacteria 9381
336 Ga0075434_100054222 3300006871 Bacteria 3984
337 Ga0075434_100098176 3300006871 Unclassified 2934
338 Ga0075434_100107712 3300006871 Bacteria 2797
339 Ga0075434_100268093 3300006871 Bacteria 1727
340 Ga0075434_101096201 3300006871 Unclassified 809
341 Ga0075429_100038051 3300006880 Bacteria 4187
342 Ga0075429_100044382 3300006880 Bacteria 3867
343 Ga0075429_100062109 3300006880 Bacteria 3255
344 Ga0075429_100380944 3300006880 Bacteria 1235
345 Ga0075429_100391003 3300006880 Bacteria 1218
346 Ga0068865_100150804 3300006881 Bacteria 1763
347 Ga0068865_100297666 3300006881 Bacteria 1290
348 Ga0068865_100338176 3300006881 Bacteria 1216
349 Ga0068865_100855738 3300006881 Unclassified 788
350 Ga0068865_100978026 3300006881 Bacteria 740
351 Ga0068865_101042451 3300006881 Unclassified 718
352 Ga0097620_100002071 3300006931 Bacteria 20473
353 Ga0097620_100002533 3300006931 Bacteria 18549
354 Ga0097620_100022927 3300006931 Bacteria 6260
355 Ga0097620_100069604 3300006931 Unclassified 3554
356 Ga0097620_100185599 3300006931 Unclassified 2163
357 Ga0097620_101290289 3300006931 Bacteria 805
358 Ga0097620_102562974 3300006931 Unclassified 561
359 Ga0075435_100005714 3300007076 Bacteria 8719
360 Ga0075435_100060230 3300007076 Bacteria 3078
361 Ga0075435_100637741 3300007076 Bacteria 924
362 Ga0111539_10000044 3300009094 Bacteria 125347
363 Ga0111539_10000769 3300009094 Bacteria 41797
364 Ga0111539_10001774 3300009094 Bacteria 28680
365 Ga0111539_10010913 3300009094 Bacteria 11433
366 Ga0111539_10022455 3300009094 Bacteria 7752
367 Ga0111539_10026374 3300009094 Bacteria 7105
368 Ga0111539_10139223 3300009094 Bacteria 2842
369 Ga0111539_10360069 3300009094 Bacteria 1693
370 Ga0111539_10419078 3300009094 Bacteria 1559
371 Ga0111539_10516430 3300009094 Unclassified 1391
372 Ga0111539_10654940 3300009094 Bacteria 1223
373 Ga0111539_10915013 3300009094 Bacteria 1020
374 Ga0111539_10926144 3300009094 Bacteria 1013
375 Ga0111539_11208015 3300009094 Unclassified 878
376 Ga0111539_12329190 3300009094 Bacteria 621
377 Ga0111539_12498185 3300009094 Unclassified 599
378 Ga0111539_13317903 3300009094 Unclassified 518
379 Ga0105245_10457378 3300009098 Bacteria 1286
380 Ga0114129_10003276 3300009147 Bacteria 22724
381 Ga0114129_10006054 3300009147 Bacteria 17152
382 Ga0114129_10008048 3300009147 Bacteria 15021
383 Ga0114129_10074700 3300009147 Bacteria 4722
384 Ga0114129_10088180 3300009147 Bacteria 4302
385 Ga0114129_10109324 3300009147 Bacteria 3817
386 Ga0114129_10113438 3300009147 Bacteria 3737
387 Ga0114129_10431633 3300009147 Bacteria 1731
388 Ga0114129_10610543 3300009147 Bacteria 1412
389 Ga0114129_10641114 3300009147 Bacteria 1372
390 Ga0114129_11204322 3300009147 Bacteria 943
391 Ga0114129_11329002 3300009147 Bacteria 890
392 Ga0114129_11330908 3300009147 Bacteria 889
393 Ga0114129_11365552 3300009147 Archaea 876
394 Ga0114129_12868545 3300009147 Unclassified 571
395 Ga0105243_10039279 3300009148 Bacteria 3688
396 Ga0105243_10281598 3300009148 Bacteria 1498
397 Ga0105243_11884064 3300009148 Bacteria 630
398 Ga0105242_10246359 3300009176 Bacteria 1608
399 Ga0105242_10467408 3300009176 Bacteria 1192
400 Ga0105242_10611704 3300009176 Bacteria 1054
401 Ga0105248_10076791 3300009177 Bacteria 3754
402 Ga0105248_10089923 3300009177 Bacteria 3457
403 Ga0105248_10158064 3300009177 Bacteria 2558
404 Ga0105249_10001334 3300009553 Bacteria 21606
405 Ga0105249_10133236 3300009553 Bacteria 2375
406 Ga0105249_10170129 3300009553 Bacteria 2112
407 Ga0105249_11948953 3300009553 Bacteria 660
408 Ga0105246_10095338 3300011119 Bacteria 2154
409 Ga0105246_10214474 3300011119 Bacteria 1505
410 Ga0105246_10827539 3300011119 Bacteria 824
411 Ga0105246_10905180 3300011119 Bacteria 791
412 Ga0157346_1019322 3300012480 Unclassified 581
413 Ga0157323_1007328 3300012495 Unclassified 793
414 Ga0157373_10981274 3300013100 Bacteria 630
415 Ga0157374_10037760 3300013296 Bacteria 4435
416 Ga0157374_10199239 3300013296 Bacteria 1960
417 Ga0157374_10321343 3300013296 Unclassified 1534
418 Ga0157378_10059392 3300013297 Bacteria 3412
419 Ga0157378_10089613 3300013297 Bacteria 2794
420 Ga0157378_10372797 3300013297 Bacteria 1400
421 Ga0163162_10016085 3300013306 Bacteria 7313
422 Ga0163162_10589379 3300013306 Bacteria 1238
423 Ga0163162_10912523 3300013306 Bacteria 991
424 Ga0157375_10009638 3300013308 Bacteria 8487
425 Ga0157375_10027823 3300013308 Bacteria 5290
426 Ga0157375_10304445 3300013308 Bacteria 1758
427 Ga0157375_10370261 3300013308 Bacteria 1599
428 Ga0163163_10017755 3300014325 Bacteria 6641
429 Ga0163163_10255424 3300014325 Bacteria 1803
430 Ga0163163_10513067 3300014325 Unclassified 1261
431 Ga0157380_10005619 3300014326 Bacteria 8764
432 Ga0157380_10021207 3300014326 Bacteria 4870
433 Ga0157380_10204245 3300014326 Bacteria 1755
434 Ga0157380_10700305 3300014326 Bacteria 1018
435 Ga0157380_10757404 3300014326 Bacteria 983
436 Ga0157380_11914128 3300014326 Unclassified 654
437 Ga0157377_10002991 3300014745 Bacteria 7572
438 Ga0157377_10034044 3300014745 Bacteria 2785
439 Ga0157377_10048960 3300014745 Bacteria 2374
440 Ga0157377_10078417 3300014745 Bacteria 1925
441 Ga0157377_10140301 3300014745 Bacteria 1485
442 Ga0157377_10681957 3300014745 Bacteria 744
443 Ga0157377_11044006 3300014745 Bacteria 622
444 Ga0157377_11316128 3300014745 Bacteria 566
445 Ga0157379_10003739 3300014968 Bacteria 12939
446 Ga0157379_10087853 3300014968 Bacteria 2787
447 Ga0157376_10068589 3300014969 Bacteria 3004
448 Ga0157376_10310734 3300014969 Bacteria 1495
449 Ga0157376_10927609 3300014969 Bacteria 890
450 Ga0157376_11247253 3300014969 Bacteria 772
451 Ga0157376_11523918 3300014969 Unclassified 702
452 Ga0157376_11528060 3300014969 Unclassified 701
453 Ga0163161_10011766 3300017792 Bacteria 6067
454 Ga0163161_10478577 3300017792 Unclassified 1011
455 Ga0163161_10552852 3300017792 Unclassified 944
456 Ga0163161_10553520 3300017792 Bacteria 943
457 Ga0163161_10583739 3300017792 Bacteria 919
458 Ga0163161_11582325 3300017792 Bacteria 577
459 Ga0207666_1077723 3300025271 Archaea 536
460 Ga0207673_1004738 3300025290 Unclassified 1636
461 Ga0207697_10001621 3300025315 Bacteria 12145
462 Ga0207697_10102352 3300025315 Bacteria 1221
463 Ga0207682_10001841 3300025893 Bacteria 9661
464 Ga0207682_10010257 3300025893 Bacteria 3674
465 Ga0207682_10013530 3300025893 Bacteria 3178
466 Ga0207682_10052606 3300025893 Bacteria 1688
467 Ga0207682_10593655 3300025893 Unclassified 522
468 Ga0207642_10186498 3300025899 Bacteria 1135
469 Ga0207688_10001443 3300025901 Bacteria 12425
470 Ga0207688_10059067 3300025901 Bacteria 2159
471 Ga0207688_10132575 3300025901 Bacteria 1461
472 Ga0207688_10699274 3300025901 Unclassified 641
473 Ga0207680_10018186 3300025903 Bacteria 3730
474 Ga0207680_10060337 3300025903 Unclassified 2308
475 Ga0207647_10047580 3300025904 Bacteria 2667
476 Ga0207645_10001881 3300025907 Bacteria 16948
477 Ga0207645_10217224 3300025907 Bacteria 1260
478 Ga0207645_10245118 3300025907 Bacteria 1184
479 Ga0207645_10266359 3300025907 Bacteria 1136
480 Ga0207645_10529058 3300025907 Unclassified 799
481 Ga0207643_10004144 3300025908 Bacteria 7810
482 Ga0207643_10005748 3300025908 Bacteria 6631
483 Ga0207643_10053082 3300025908 Bacteria 2302
484 Ga0207643_10053648 3300025908 Bacteria 2290
485 Ga0207643_10076499 3300025908 Bacteria 1933
486 Ga0207643_10234149 3300025908 Unclassified 1127
487 Ga0207643_10605897 3300025908 Bacteria 705
488 Ga0207705_10224675 3300025909 Bacteria 1427
489 Ga0207684_10115149 3300025910 Bacteria 2302
490 Ga0207707_10084480 3300025912 Bacteria 2772
491 Ga0207693_10434261 3300025915 Bacteria 1026
492 Ga0207660_10129706 3300025917 Bacteria 1918
493 Ga0207660_10199381 3300025917 Bacteria 1563
494 Ga0207660_10513750 3300025917 Unclassified 972
495 Ga0207660_10725343 3300025917 Bacteria 811
496 Ga0207662_10002054 3300025918 Bacteria 9973
497 Ga0207662_10004271 3300025918 Bacteria 7500
498 Ga0207662_10028524 3300025918 Bacteria 3228
499 Ga0207662_10129801 3300025918 Bacteria 1588
500 Ga0207657_10899733 3300025919 Unclassified 682
501 Ga0207649_10023217 3300025920 Bacteria 3590
502 Ga0207649_10267003 3300025920 Bacteria 1239
503 Ga0207649_10466101 3300025920 Bacteria 956
504 Ga0207649_11297535 3300025920 Unclassified 576
505 Ga0207652_10701069 3300025921 Unclassified 903
506 Ga0207652_10750787 3300025921 Bacteria 868
507 Ga0207646_10020399 3300025922 Bacteria 6142
508 Ga0207646_10166267 3300025922 Bacteria 1991
509 Ga0207646_10177495 3300025922 Bacteria 1924
510 Ga0207646_10231923 3300025922 Bacteria 1668
511 Ga0207646_10270986 3300025922 Bacteria 1534
512 Ga0207681_10000566 3300025923 Bacteria 25276
513 Ga0207681_10077568 3300025923 Bacteria 2336
514 Ga0207681_10088862 3300025923 Bacteria 2201
515 Ga0207681_10210141 3300025923 Bacteria 1499
516 Ga0207681_10542263 3300025923 Unclassified 956
517 Ga0207650_10037192 3300025925 Bacteria 3546
518 Ga0207650_10126129 3300025925 Bacteria 1998
519 Ga0207650_10148492 3300025925 Bacteria 1848
520 Ga0207650_10182355 3300025925 Bacteria 1673
521 Ga0207650_10273829 3300025925 Bacteria 1373
522 Ga0207650_10437743 3300025925 Bacteria 1087
523 Ga0207650_10569237 3300025925 Bacteria 951
524 Ga0207650_11065203 3300025925 Bacteria 688
525 Ga0207650_11118654 3300025925 Bacteria 670
526 Ga0207659_10001222 3300025926 Bacteria 15363
527 Ga0207659_10002242 3300025926 Bacteria 11514
528 Ga0207659_10004787 3300025926 Bacteria 8206
529 Ga0207659_10007569 3300025926 Bacteria 6690
530 Ga0207659_10027161 3300025926 Bacteria 3871
531 Ga0207659_10032972 3300025926 Bacteria 3559
532 Ga0207659_10048877 3300025926 Bacteria 2998
533 Ga0207659_10071033 3300025926 Bacteria 2541
534 Ga0207659_10402165 3300025926 Unclassified 1146
535 Ga0207659_10510909 3300025926 Bacteria 1018
536 Ga0207687_10849320 3300025927 Archaea 780
537 Ga0207644_10154004 3300025931 Bacteria 1781
538 Ga0207644_10748292 3300025931 Bacteria 816
539 Ga0207644_10882921 3300025931 Unclassified 749
540 Ga0207690_10165282 3300025932 Bacteria 1653
541 Ga0207690_10184925 3300025932 Bacteria 1572
542 Ga0207690_10250642 3300025932 Bacteria 1368
543 Ga0207706_10003425 3300025933 Bacteria 15142
544 Ga0207706_10037583 3300025933 Bacteria 4298
545 Ga0207706_10057657 3300025933 Bacteria 3421
546 Ga0207706_10146880 3300025933 Bacteria 2074
547 Ga0207706_10336125 3300025933 Bacteria 1314
548 Ga0207706_10766219 3300025933 Unclassified 821
549 Ga0207706_10833559 3300025933 Bacteria 782
550 Ga0207686_10113634 3300025934 Bacteria 1831
551 Ga0207686_10552084 3300025934 Bacteria 901
552 Ga0207686_10822442 3300025934 Bacteria 746
553 Ga0207709_10161212 3300025935 Bacteria 1564
554 Ga0207670_10003736 3300025936 Bacteria 8086
555 Ga0207670_10006525 3300025936 Bacteria 6477
556 Ga0207670_10362549 3300025936 Bacteria 1150
557 Ga0207669_10001529 3300025937 Bacteria 9860
558 Ga0207669_10428381 3300025937 Bacteria 1043
559 Ga0207669_10833780 3300025937 Bacteria 766
560 Ga0207669_11139124 3300025937 Unclassified 659
561 Ga0207704_10053194 3300025938 Bacteria 2459
562 Ga0207704_11537265 3300025938 Bacteria 571
563 Ga0207691_10012691 3300025940 Bacteria 8070
564 Ga0207691_10050039 3300025940 Bacteria 3826
565 Ga0207691_10055581 3300025940 Bacteria 3607
566 Ga0207691_10085089 3300025940 Bacteria 2838
567 Ga0207691_10088306 3300025940 Bacteria 2780
568 Ga0207691_10180664 3300025940 Bacteria 1844
569 Ga0207691_10256872 3300025940 Unclassified 1507
570 Ga0207691_10365531 3300025940 Bacteria 1233
571 Ga0207691_10817532 3300025940 Bacteria 782
572 Ga0207711_10083185 3300025941 Bacteria 2799
573 Ga0207711_10169955 3300025941 Unclassified 1978
574 Ga0207711_10242585 3300025941 Bacteria 1652
575 Ga0207689_10000831 3300025942 Bacteria 29759
576 Ga0207689_10048175 3300025942 Bacteria 3515
577 Ga0207689_10084887 3300025942 Bacteria 2603
578 Ga0207661_10028828 3300025944 Bacteria 4256
579 Ga0207679_10029892 3300025945 Bacteria 3798
580 Ga0207679_10082888 3300025945 Bacteria 2456
581 Ga0207679_10294889 3300025945 Bacteria 1395
582 Ga0207679_10586087 3300025945 Bacteria 1003
583 Ga0207679_10757637 3300025945 Bacteria 883
584 Ga0207679_11454145 3300025945 Bacteria 629
585 Ga0207651_10025082 3300025960 Bacteria 3701
586 Ga0207651_10096190 3300025960 Bacteria 2183
587 Ga0207651_10125337 3300025960 Bacteria 1956
588 Ga0207651_10180642 3300025960 Bacteria 1673
589 Ga0207651_10244533 3300025960 Bacteria 1464
590 Ga0207651_10380877 3300025960 Bacteria 1195
591 Ga0207651_10622228 3300025960 Bacteria 946
592 Ga0207651_10709019 3300025960 Bacteria 887
593 Ga0207712_10002418 3300025961 Bacteria 12069
594 Ga0207712_10464140 3300025961 Bacteria 1076
595 Ga0207668_10118148 3300025972 Bacteria 2003
596 Ga0207668_10150849 3300025972 Bacteria 1799
597 Ga0207668_10159885 3300025972 Bacteria 1754
598 Ga0207668_10269874 3300025972 Bacteria 1390
599 Ga0207668_11030614 3300025972 Bacteria 736
600 Ga0207640_10067322 3300025981 Bacteria 2396
601 Ga0207640_10250656 3300025981 Bacteria 1374
602 Ga0207640_11766552 3300025981 Unclassified 559
603 Ga0207640_12203733 3300025981 Unclassified 500
604 Ga0207658_10012438 3300025986 Bacteria 5814
605 Ga0207658_10346730 3300025986 Bacteria 1292
606 Ga0207658_11138384 3300025986 Unclassified 713
607 Ga0207658_11145954 3300025986 Unclassified 711
608 Ga0207677_10063258 3300026023 Bacteria 2571
609 Ga0207677_10145249 3300026023 Bacteria 1822
610 Ga0207677_10603857 3300026023 Unclassified 963
611 Ga0207703_10042317 3300026035 Bacteria 3654
612 Ga0207703_10141518 3300026035 Bacteria 2088
613 Ga0207703_10289415 3300026035 Unclassified 1490
614 Ga0207703_10472240 3300026035 Bacteria 1174
615 Ga0207639_11705257 3300026041 Bacteria 590
616 Ga0207708_10017222 3300026075 Bacteria 5439
617 Ga0207708_10095321 3300026075 Bacteria 2298
618 Ga0207708_10159192 3300026075 Bacteria 1782
619 Ga0207708_10269838 3300026075 Bacteria 1376
620 Ga0207708_11023236 3300026075 Bacteria 718
621 Ga0207641_10097682 3300026088 Bacteria 2582
622 Ga0207641_10105045 3300026088 Bacteria 2494
623 Ga0207641_10792093 3300026088 Bacteria 937
624 Ga0207641_11460006 3300026088 Bacteria 685
625 Ga0207641_11546920 3300026088 Unclassified 665
626 Ga0207648_10000446 3300026089 Bacteria 45706
627 Ga0207648_10046637 3300026089 Bacteria 3800
628 Ga0207648_10062997 3300026089 Unclassified 3232
629 Ga0207648_10410519 3300026089 Bacteria 1228
630 Ga0207648_10474768 3300026089 Unclassified 1141
631 Ga0207648_10708929 3300026089 Unclassified 933
632 Ga0207648_11114991 3300026089 Bacteria 740
633 Ga0207676_10010914 3300026095 Bacteria 6481
634 Ga0207676_10026175 3300026095 Bacteria 4337
635 Ga0207676_10306404 3300026095 Bacteria 1452
636 Ga0207676_11021163 3300026095 Bacteria 815
637 Ga0207676_11105762 3300026095 Bacteria 784
638 Ga0207674_10176364 3300026116 Bacteria 2089
639 Ga0207674_10185565 3300026116 Bacteria 2030
640 Ga0207674_10465004 3300026116 Bacteria 1223
641 Ga0207674_10633889 3300026116 Bacteria 1032
642 Ga0207674_11192251 3300026116 Archaea 731
643 Ga0207674_11281744 3300026116 Unclassified 702
644 Ga0207675_100001058 3300026118 Bacteria 27297
645 Ga0207675_100004015 3300026118 Bacteria 14272
646 Ga0207675_100094653 3300026118 Unclassified 2810
647 Ga0207675_100770580 3300026118 Bacteria 974
648 Ga0207675_100794938 3300026118 Unclassified 959
649 Ga0207675_101820305 3300026118 Bacteria 628
650 Ga0207683_10021244 3300026121 Bacteria 5554
651 Ga0207683_10128891 3300026121 Unclassified 2275
652 Ga0207683_10135522 3300026121 Bacteria 2216
653 Ga0207683_10451795 3300026121 Bacteria 1185
654 Ga0207683_10624160 3300026121 Bacteria 998
655 Ga0207683_10670690 3300026121 Unclassified 961
656 Ga0207683_10808344 3300026121 Bacteria 870
657 Ga0207683_10814772 3300026121 Bacteria 867
658 Ga0207698_10509518 3300026142 Unclassified 1172
659 Ga0209968_1053945 3300027526 Unclassified 702
660 Ga0210002_1084402 3300027617 Bacteria 567
661 Ga0207428_10000224 3300027907 Bacteria 78533
662 Ga0207428_10000353 3300027907 Bacteria 59325
663 Ga0207428_10004706 3300027907 Bacteria 12908
664 Ga0207428_10005989 3300027907 Bacteria 11257
665 Ga0207428_10010077 3300027907 Bacteria 8459
666 Ga0207428_10304822 3300027907 Bacteria 1178
667 Ga0207428_10465962 3300027907 Bacteria 920
668 Ga0268266_10312547 3300028379 Bacteria 1469
669 Ga0268265_10000540 3300028380 Bacteria 38471
670 Ga0268265_10055567 3300028380 Bacteria 3008
671 Ga0268265_10374861 3300028380 Bacteria 1307
672 Ga0268265_10622631 3300028380 Bacteria 1034
673 Ga0268265_10913339 3300028380 Bacteria 863
674 Ga0268265_11372760 3300028380 Unclassified 708
675 Ga0268265_12172198 3300028380 Unclassified 562
676 Ga0268264_10012807 3300028381 Bacteria 6902
677 Ga0268264_10115573 3300028381 Bacteria 2357
678 Ga0268264_10879495 3300028381 Unclassified 898
679 Ga0268264_11413075 3300028381 Unclassified 706
680 Ga0307408_100364100 3300031548 Unclassified 1231
681 Ga0307408_100388393 3300031548 Bacteria 1195
682 Ga0307408_101045124 3300031548 Unclassified 755
683 Ga0307405_10003692 3300031731 Bacteria 7100
684 Ga0307405_10091958 3300031731 Bacteria 2011
685 Ga0307405_10751537 3300031731 Unclassified 812
686 Ga0307413_10045918 3300031824 Bacteria 2593
687 Ga0307413_10140375 3300031824 Bacteria 1669
688 Ga0307413_11234604 3300031824 Unclassified 651
689 Ga0307413_11805844 3300031824 Unclassified 547
690 Ga0307410_10005392 3300031852 Bacteria 6761
691 Ga0307410_10123448 3300031852 Bacteria 1892
692 Ga0307410_10141882 3300031852 Bacteria 1778
693 Ga0307410_11728725 3300031852 Bacteria 555
694 Ga0307406_10041702 3300031901 Bacteria 2861
695 Ga0307406_11405123 3300031901 Bacteria 612
696 Ga0307407_10004637 3300031903 Bacteria 5864
697 Ga0307407_10060573 3300031903 Bacteria 2209
698 Ga0307407_10968281 3300031903 Bacteria 656
699 Ga0307412_10009853 3300031911 Bacteria 5490
700 Ga0307412_10083761 3300031911 Bacteria 2212
701 Ga0307412_10671720 3300031911 Bacteria 886
702 Ga0307412_10934579 3300031911 Bacteria 762
703 Ga0307409_100004850 3300031995 Bacteria 7639
704 Ga0307409_100018258 3300031995 Bacteria 4708
705 Ga0307409_100104257 3300031995 Bacteria 2361
706 Ga0307409_100115339 3300031995 Bacteria 2261
707 Ga0307409_100147164 3300031995 Bacteria 2039
708 Ga0307409_100334185 3300031995 Bacteria 1423
709 Ga0307409_100927127 3300031995 Bacteria 886
710 Ga0307416_100004482 3300032002 Bacteria 8423
711 Ga0307416_100012439 3300032002 Bacteria 5733
712 Ga0307416_100072394 3300032002 Bacteria 2868
713 Ga0307416_100119105 3300032002 Bacteria 2348
714 Ga0307416_100290128 3300032002 Bacteria 1619
715 Ga0307416_100530497 3300032002 Bacteria 1247
716 Ga0307416_100791711 3300032002 Bacteria 1043
717 Ga0307416_101584211 3300032002 Unclassified 760
718 Ga0307416_101974363 3300032002 Bacteria 686
719 Ga0307416_102130950 3300032002 Unclassified 662
720 Ga0307416_102784627 3300032002 Unclassified 585
721 Ga0307416_103018112 3300032002 Unclassified 563
722 Ga0307416_103157408 3300032002 Unclassified 551
723 Ga0307414_10366728 3300032004 Bacteria 1241
724 Ga0307414_10418639 3300032004 Bacteria 1168
725 Ga0307414_10549306 3300032004 Bacteria 1029
726 Ga0307411_10003247 3300032005 Bacteria 7497
727 Ga0307411_10029786 3300032005 Bacteria 3339
728 Ga0307411_10819408 3300032005 Bacteria 821
729 Ga0307411_12312917 3300032005 Bacteria 505
730 Ga0307415_100007237 3300032126 Bacteria 6058
731 Ga0307415_100068095 3300032126 Unclassified 2490
732 Ga0307415_100134002 3300032126 Bacteria 1880
733 Ga0307415_101561037 3300032126 Unclassified 633
734 Ga0373958_0149005 3300034819 Archaea 584
735 Ga0373940_0089324 3300035088 Bacteria 921
736 Ga0373939_0279073 3300035114 Unclassified 659
737 Ga0373941_0201517 3300035115 Unclassified 757
738 Ga0373941_0428774 3300035115 Archaea 551
739 Ga0373961_0222983 3300035241 Unclassified 673
740 Ga0242420_143832 3300038996 Unclassified 532
741 Ga0451853_1692674 3300041512 Unclassified 774
742 Ga0451853_3527350 3300041512 Unclassified 983
743 Ga0439442_126911 3300042002 Unclassified 560
744 Ga0439454_116389 3300042011 Archaea 514
745 Ga0439434_0071318 3300042435 Bacteria 1094
746 Ga0439444_0009088 3300042437 Bacteria 1560
747 Ga0439460_0244470 3300042461 Bacteria 619
748 Ga0451577_0607601 3300042876 Bacteria 992
749 Ga0439440_0104320 3300042993 Bacteria 774
750 Ga0451576_0007819 3300045051 Bacteria 12670
751 Ga0451576_0013731 3300045051 Bacteria 9047
752 Ga0451576_0079338 3300045051 Bacteria 3415
753 Ga0451576_0186928 3300045051 Bacteria 2163
754 Ga0451576_0705066 3300045051 Bacteria 1060
755 Ga0495603_0188771 3300046455 Bacteria 1192
756 Ga0495629_0057974 3300046459 Bacteria 2707
757 Ga0495580_0339705 3300046472 Bacteria 1019
758 Ga0495580_0532991 3300046472 Bacteria 781
759 Ga0495585_0147225 3300046492 Unclassified 1230
760 Ga0495594_0028254 3300046499 Bacteria 3026
761 Ga0495643_0001548 3300046522 Bacteria 20538
762 Ga0495644_0019673 3300046523 Bacteria 2578
763 Ga0495642_0046137 3300046528 Bacteria 1782
764 Ga0495642_0048601 3300046528 Bacteria 1741
765 Ga0495598_0240921 3300046537 Bacteria 667
766 Ga0495598_0383849 3300046537 Bacteria 546
767 Ga0495609_0147241 3300046538 Bacteria 1003
768 Ga0495621_0015340 3300046539 Bacteria 2442
769 Ga0495621_0107764 3300046539 Bacteria 1066
770 Ga0495621_0177265 3300046539 Unclassified 849
771 Ga0495656_0059120 3300046615 Bacteria 1666
772 Ga0495659_0003442 3300046664 Bacteria 5051
773 Ga0495659_0013145 3300046664 Bacteria 2693
774 Ga0495659_0190341 3300046664 Unclassified 838
775 Ga0495659_0308799 3300046664 Unclassified 669
776 Ga0495659_0348468 3300046664 Unclassified 632
777 Ga0495588_0024382 3300046674 Bacteria 3005
778 Ga0495658_0097707 3300046683 Bacteria 1748
779 Ga0495669_0462621 3300046684 Bacteria 616
780 Ga0495670_0118046 3300046691 Bacteria 1377
781 Ga0495670_0173556 3300046691 Unclassified 1136
782 Ga0495670_0483775 3300046691 Bacteria 672
783 Ga0495589_0492716 3300046794 Unclassified 560
784 Ga0495636_0063710 3300047318 Bacteria 1563
785 Ga0495677_0028335 3300047445 Bacteria 2034
786 Ga0495677_0195527 3300047445 Bacteria 786
787 Ga0496104_0815228 3300048907 Bacteria 839
788 Ga0496108_1280058 3300048911 Bacteria 617
789 Ga0496110_0387822 3300048913 Bacteria 1273
790 Ga0496112_1640137 3300048915 Unclassified 556
791 Ga0501290_071205 3300049513 Bacteria 577
792 Ga0501298_154992 3300049521 Unclassified 562
793 Ga0501031_0284762 3300049568 Unclassified 1072
794 Ga0501033_0768025 3300049570 Unclassified 653
795 Ga0501036_0315208 3300049572 Bacteria 1307
796 Ga0501036_0665359 3300049572 Unclassified 862
797 Ga0501037_0599418 3300049573 Unclassified 740
798 Ga0501037_0639497 3300049573 Unclassified 712
799 Ga0501038_0856032 3300049574 Bacteria 673
800 Ga0501038_1061858 3300049574 Unclassified 593
801 Ga0501039_0007557 3300049575 Bacteria 8303
802 Ga0501039_0056186 3300049575 Bacteria 3049
803 Ga0501039_0299496 3300049575 Bacteria 1264
804 Ga0501040_0012945 3300049576 Bacteria 5483
805 Ga0501041_0135843 3300049577 Bacteria 1532
806 Ga0501041_0227101 3300049577 Bacteria 1172
807 Ga0501042_0003889 3300049578 Bacteria 9445
808 Ga0501042_0286231 3300049578 Bacteria 1190
809 Ga0501042_0632904 3300049578 Bacteria 778
810 Ga0501043_0936479 3300049579 Unclassified 619
811 Ga0501046_0074757 3300049580 Bacteria 2628
812 Ga0501048_0035520 3300049582 Bacteria 3588
813 Ga0501048_0107006 3300049582 Bacteria 1974
814 Ga0501067_0296343 3300049583 Unclassified 900
815 Ga0501068_0368144 3300049584 Unclassified 925
816 Ga0501069_0586049 3300049585 Unclassified 669
817 Ga0501071_0821372 3300049587 Unclassified 717
818 Ga0501072_0008859 3300049588 Bacteria 7644
819 Ga0501072_0027578 3300049588 Bacteria 4430
820 Ga0501072_0205831 3300049588 Bacteria 1569
821 Ga0501072_0352631 3300049588 Bacteria 1168
822 Ga0501072_0392733 3300049588 Unclassified 1101
823 Ga0501075_0098439 3300049591 Bacteria 2220
824 Ga0501075_0156761 3300049591 Bacteria 1736
825 Ga0501075_0293114 3300049591 Bacteria 1239
826 Ga0501075_0502202 3300049591 Bacteria 925
827 Ga0501076_0009175 3300049592 Bacteria 7291
828 Ga0501076_0044775 3300049592 Bacteria 3491
829 Ga0501076_0156572 3300049592 Bacteria 1855
830 Ga0501076_0214437 3300049592 Bacteria 1574
831 Ga0501076_0311423 3300049592 Bacteria 1291
832 Ga0501076_1659100 3300049592 Bacteria 524
833 Ga0501208_041509 3300049655 Bacteria 851
834 Ga0501249_016262 3300049679 Bacteria 1597
835 Ga0501249_200628 3300049679 Unclassified 523
836 Ga0501221_137825 3300049704 Bacteria 637
837 Ga0501245_059587 3300049708 Bacteria 695
838 Ga0501079_0034154 3300049741 Bacteria 3913
839 Ga0501079_0075401 3300049741 Bacteria 2608
840 Ga0501079_0133364 3300049741 Bacteria 1933
841 Ga0501079_0445534 3300049741 Bacteria 1017
842 Ga0501079_0480084 3300049741 Bacteria 977
843 Ga0501080_0553263 3300049742 Unclassified 1025
844 Ga0501080_0994261 3300049742 Unclassified 728
845 Ga0501081_0048284 3300049743 Bacteria 2929
846 Ga0501081_0190447 3300049743 Bacteria 1485
847 Ga0501081_0224269 3300049743 Bacteria 1367
848 Ga0501081_0339545 3300049743 Bacteria 1106
849 Ga0501081_0384370 3300049743 Bacteria 1038
850 Ga0501081_0386495 3300049743 Unclassified 1035
851 Ga0501081_0625649 3300049743 Unclassified 806
852 Ga0501081_0869432 3300049743 Bacteria 679
853 Ga0501083_0641713 3300049744 Unclassified 691
854 Ga0501272_020596 3300049769 Unclassified 791
855 Ga0501283_035584 3300049779 Unclassified 848
856 Ga0501045_0024405 3300049824 Bacteria 4341
857 Ga0501045_0157688 3300049824 Unclassified 1689
858 nmdc:mga05p37_1167638_c1 3300050507 Bacteria 799
859 nmdc:mga05p37_155524_c1 3300050507 Bacteria 2795
860 nmdc:mga05p37_1654227_c1 3300050507 Unclassified 627
861 nmdc:mga05p37_1656263_c1 3300050507 Unclassified 627
862 nmdc:mga05p37_17011_c1 3300050507 Bacteria 8770
863 nmdc:mga05p37_200071_c1 3300050507 Bacteria 2420
864 nmdc:mga05p37_244730_c1 3300050507 Bacteria 2154
865 nmdc:mga05p37_395165_c1 3300050507 Bacteria 1616
866 nmdc:mga05p37_503469_c1 3300050507 Unclassified 1389
867 nmdc:mga05p37_56561_c1 3300050507 Bacteria 4830
868 nmdc:mga05p37_70703_c1 3300050507 Bacteria 4293
869 nmdc:mga05p37_974417_c1 3300050507 Bacteria 904
870 nmdc:mga09592_240558_c1 3300050508 Bacteria 1568
871 nmdc:mga09592_275748_c1 3300050508 Bacteria 1459
872 nmdc:mga09592_29049_c1 3300050508 Bacteria 4598
873 nmdc:mga09592_334982_c1 3300050508 Bacteria 1310
874 nmdc:mga09592_504093_c1 3300050508 Unclassified 1042
875 nmdc:mga09592_61109_c1 3300050508 Bacteria 3186
876 nmdc:mga09592_80073_c1 3300050508 Bacteria 2781
877 nmdc:mga0qj67_280529_c1 3300050509 Bacteria 1350
878 nmdc:mga0qj67_526_c1 3300050509 Bacteria 26048
879 nmdc:mga0qj67_5293_c1 3300050509 Bacteria 9413
880 nmdc:mga0qj67_541447_c1 3300050509 Bacteria 934
881 nmdc:mga0qj67_5798_c1 3300050509 Bacteria 9039
882 nmdc:mga06r32_107386_c1 3300050510 Bacteria 2743
883 nmdc:mga06r32_127805_c1 3300050510 Unclassified 2511
884 nmdc:mga06r32_18027_c1 3300050510 Bacteria 6456
885 nmdc:mga06r32_24815_c1 3300050510 Bacteria 5572
886 nmdc:mga06r32_310457_c1 3300050510 Bacteria 1563
887 nmdc:mga06r32_610525_c1 3300050510 Bacteria 1061
888 nmdc:mga08y16_15575_c1 3300050511 Bacteria 7995
889 nmdc:mga08y16_167360_c1 3300050511 Bacteria 2284
890 nmdc:mga08y16_168786_c1 3300050511 Bacteria 2273
891 nmdc:mga08y16_1836417_c1 3300050511 Unclassified 558
892 nmdc:mga08y16_41616_c1 3300050511 Bacteria 4813
893 nmdc:mga08y16_467911_c1 3300050511 Bacteria 1284
894 nmdc:mga08y16_575165_c1 3300050511 Bacteria 1138
895 nmdc:mga08y16_5828_c1 3300050511 Bacteria 12911
896 nmdc:mga08y16_60586_c1 3300050511 Bacteria 3953
897 nmdc:mga08y16_684391_c1 3300050511 Unclassified 1027
898 nmdc:mga08y16_945_c1 3300050511 Bacteria 28237
899 nmdc:mga08y16_958632_c1 3300050511 Bacteria 838
900 nmdc:mga08y16_979410_c1 3300050511 Bacteria 827
901 nmdc:mga0n895_1446644_c1 3300050512 Unclassified 655
902 nmdc:mga0n895_32666_c1 3300050512 Bacteria 4996
903 nmdc:mga0n895_465314_c1 3300050512 Bacteria 1276
904 nmdc:mga0n895_65768_c1 3300050512 Bacteria 3589
905 nmdc:mga0n895_809892_c1 3300050512 Unclassified 927
906 nmdc:mga0n895_88881_c1 3300050512 Bacteria 3090
907 nmdc:mga0n895_90365_c1 3300050512 Bacteria 3064
908 nmdc:mga0rr50_102607_c1 3300050513 Bacteria 2250
909 nmdc:mga0rr50_111579_c1 3300050513 Bacteria 2164
910 nmdc:mga0rr50_1506752_c1 3300050513 Bacteria 569
911 nmdc:mga0rr50_63989_c1 3300050513 Bacteria 2780
912 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
913 nmdc:mga0a205_107387_c1 3300050515 Bacteria 2689
914 nmdc:mga0a205_1497_c1 3300050515 Bacteria 19917
915 nmdc:mga0a205_161479_c1 3300050515 Bacteria 2137
916 nmdc:mga0a205_422640_c1 3300050515 Unclassified 1195
917 nmdc:mga0a205_55600_c1 3300050515 Bacteria 3822
918 nmdc:mga0a205_68363_c1 3300050515 Bacteria 3431
919 nmdc:mga0a205_91795_c1 3300050515 Bacteria 2934
920 nmdc:mga0a205_94654_c1 3300050515 Bacteria 2886
921 Ga0500556_0007638 3300053104 Bacteria 3095
922 Ga0501084_0148547 3300054114 Bacteria 1975
923 Ga0501084_0250372 3300054114 Bacteria 1496
924 Ga0501084_0465655 3300054114 Unclassified 1069
925 Ga0501084_0764188 3300054114 Bacteria 814
926 Ga0590071_000198 3300059421 Bacteria 17604
927 Ga0590071_001421 3300059421 Bacteria 6337
928 Ga0590071_007060 3300059421 Bacteria 2658
929 Ga0590074_009905 3300059423 Bacteria 1591
930 Ga0590075_000275 3300059424 Bacteria 14557
931 Ga0590075_007624 3300059424 Bacteria 2576
932 Ga0590077_000049 3300059426 Bacteria 28044
933 Ga0590077_001543 3300059426 Bacteria 5322
934 Ga0501082_0010321 3300060353 Bacteria 8043
935 Ga0501082_0211640 3300060353 Bacteria 1687
936 Ga0530510_0001774 3300061734 Bacteria 14711
937 Ga0530510_0173337 3300061734 Bacteria 1598
938 Ga0451576_0067399
939 JGI24746J21847_1000909
940 JGI24750J21931_1027064
941 JGI24749J21850_1010328
942 JGI24035J26624_1029462
943 JGI24751J29686_10093352
944 JGI25406J46586_10012672
945 Ga0058860_11692652
946 Ga0058860_11970884
947 Ga0058860_12184011
948 Ga0065714_10342292
949 Ga0065704_10077157
950 Ga0065704_10246247
951 Ga0065704_10347472
952 Ga0065704_10483285
953 Ga0065712_10012047
954 Ga0065712_10019331
955 Ga0065712_10085635
956 Ga0065712_10086488
957 Ga0065712_10088620
958 Ga0065712_10223940
959 Ga0065712_10375391
960 Ga0065712_10534061
961 Ga0065715_10000879
962 Ga0065715_10096891
963 Ga0065715_10100717
964 Ga0065715_10624584
965 Ga0065715_10701154
966 Ga0065715_11083627
967 Ga0065707_10006295
968 Ga0065707_10023887
969 Ga0065707_10275714
970 Ga0065707_10628294
971 Ga0065707_10805685
972 Ga0070658_10477958
973 Ga0070658_11265126
974 Ga0070658_11305960
975 Ga0070676_10004240
976 Ga0070676_10126212
977 Ga0070676_10333427
978 Ga0070676_10402252
979 Ga0070676_10959672
980 Ga0070683_100065328
981 Ga0070683_100734194
982 Ga0070683_101725729
983 Ga0070690_100013733
984 Ga0070690_100016453
985 Ga0070690_100041224
986 Ga0070690_101516938
987 Ga0070670_100021219
988 Ga0070670_100062034
989 Ga0070670_100069094
990 Ga0070670_100183131
991 Ga0070670_100268336
992 Ga0070670_100387732
993 Ga0070670_101120704
994 Ga0070670_101218015
995 Ga0070670_101273836
996 Ga0070677_10010650
997 Ga0070677_10321537
998 Ga0068869_100003236
999 Ga0068869_100173747
1000 Ga0068869_100309489
1001 Ga0068869_100520169
1002 Ga0068869_100688548
1003 Ga0068869_100955344
1004 Ga0070666_10019167
1005 Ga0070666_10025313
1006 Ga0070666_10056738
1007 Ga0070666_10750475
1008 Ga0070680_100189453
1009 Ga0070680_100290096
1010 Ga0070680_101041765
1011 Ga0070682_100593957
1012 Ga0070682_102066207
1013 Ga0068868_100007147
1014 Ga0068868_100132565
1015 Ga0068868_100300595
1016 Ga0068868_101566876
1017 Ga0070660_101288933
1018 Ga0070689_100006102
1019 Ga0070689_100008169
1020 Ga0070689_100062418
1021 Ga0070689_100444795
1022 Ga0070691_10169574
1023 Ga0070687_100136219
1024 Ga0070687_100584483
1025 Ga0070687_100643985
1026 Ga0070661_100033797
1027 Ga0070661_100044414
1028 Ga0070661_100230524
1029 Ga0070661_100425074
1030 Ga0070692_10086280
1031 Ga0070692_10477954
1032 Ga0070668_100107964
1033 Ga0070668_100125945
1034 Ga0070668_100332063
1035 Ga0070668_101342214
1036 Ga0070669_100004669
1037 Ga0070669_100007056
1038 Ga0070669_100016438
1039 Ga0070669_100097839
1040 Ga0070669_100156477
1041 Ga0070669_100193327
1042 Ga0070669_100249264
1043 Ga0070669_100431899
1044 Ga0070675_100000998
1045 Ga0070675_100003145
1046 Ga0070675_100005576
1047 Ga0070675_100017262
1048 Ga0070675_100056448
1049 Ga0070675_100068099
1050 Ga0070675_100103317
1051 Ga0070675_100176359
1052 Ga0070675_100348068
1053 Ga0070675_100358438
1054 Ga0070675_100418093
1055 Ga0070675_100571563
1056 Ga0070675_100914156
1057 Ga0070675_101343057
1058 Ga0070675_101746188
1059 Ga0070671_100154900
1060 Ga0070671_100338502
1061 Ga0070674_100001500
1062 Ga0070674_100126837
1063 Ga0070674_100677382
1064 Ga0070674_101023128
1065 Ga0070674_101318208
1066 Ga0070673_100011067
1067 Ga0070673_100024542
1068 Ga0070673_100094764
1069 Ga0070673_100142705
1070 Ga0070673_100203331
1071 Ga0070673_100266332
1072 Ga0070673_100409621
1073 Ga0070688_100020189
1074 Ga0070688_100092983
1075 Ga0070688_100164937
1076 Ga0070688_100188539
1077 Ga0070688_100393658
1078 Ga0070688_100537017
1079 Ga0070688_101304894
1080 Ga0070659_100016032
1081 Ga0070659_100821816
1082 Ga0070667_100025321
1083 Ga0070667_100169857
1084 Ga0070667_101069016
1085 Ga0070667_101368857
1086 Ga0070701_10079984
1087 Ga0070701_10116834
1088 Ga0070701_10276904
1089 Ga0070701_10455345
1090 Ga0070705_100001006
1091 Ga0070705_100065913
1092 Ga0070705_100169270
1093 Ga0070705_100615398
1094 Ga0070705_100767487
1095 Ga0070700_100089978
1096 Ga0070700_100152172
1097 Ga0070700_100296060
1098 Ga0070700_100303262
1099 Ga0070694_100001224
1100 Ga0070694_100002510
1101 Ga0070694_100886870
1102 Ga0070678_100019465
1103 Ga0070678_100120646
1104 Ga0070678_100129534
1105 Ga0070678_100207670
1106 Ga0070678_100443188
1107 Ga0070678_100602360
1108 Ga0070678_101572406
1109 Ga0070662_100054409
1110 Ga0070662_100063348
1111 Ga0070662_100302125
1112 Ga0070662_100548831
1113 Ga0070681_10018905
1114 Ga0068867_100000147
1115 Ga0068867_100163313
1116 Ga0068867_100512027
1117 Ga0068867_100580038
1118 Ga0068867_101319548
1119 Ga0068867_101459412
1120 Ga0070685_10523763
1121 Ga0070685_11257714
1122 Ga0070685_11294069
1123 Ga0070707_100177536
1124 Ga0070707_100182523
1125 Ga0070698_100047613
1126 Ga0070698_100329574
1127 Ga0070698_100458203
1128 Ga0070699_100002298
1129 Ga0070699_100181189
1130 Ga0070699_100220060
1131 Ga0070699_100463047
1132 Ga0070699_100521705
1133 Ga0070679_100795251
1134 Ga0070679_101079940
1135 Ga0070684_100205443
1136 Ga0070684_101315427
1137 Ga0070684_101438109
1138 Ga0070697_100152879
1139 Ga0070697_100552502
1140 Ga0070697_100590928
1141 Ga0070697_101035731
1142 Ga0068853_101545535
1143 Ga0070672_100014870
1144 Ga0070672_100066226
1145 Ga0070672_100078828
1146 Ga0070672_100134439
1147 Ga0070672_100258503
1148 Ga0070672_100902142
1149 Ga0070686_100005406
1150 Ga0070686_100126426
1151 Ga0070686_100164530
1152 Ga0070695_100000425
1153 Ga0070695_100549752
1154 Ga0070695_100744111
1155 Ga0070696_100008088
1156 Ga0070696_100093207
1157 Ga0070696_100093556
1158 Ga0070665_100063029
1159 Ga0070704_100002260
1160 Ga0070704_100002570
1161 Ga0070704_100128184
1162 Ga0070704_100184255
1163 Ga0070704_100855012
1164 Ga0070664_100044718
1165 Ga0070664_100052952
1166 Ga0070664_100162791
1167 Ga0070664_100403114
1168 Ga0070664_100410841
1169 Ga0070664_101347338
1170 Ga0070664_102294566
1171 Ga0068857_100164472
1172 Ga0068857_100270782
1173 Ga0068857_100363994
1174 Ga0068854_101606235
1175 Ga0070702_100054578
1176 Ga0070702_100604312
1177 Ga0070702_100617564
1178 Ga0070702_100949974
1179 Ga0068852_100955304
1180 Ga0068852_101595063
1181 Ga0068852_101730433
1182 Ga0068859_100002071
1183 Ga0068859_100002533
1184 Ga0068859_100022922
1185 Ga0068859_100069602
1186 Ga0068859_100185587
1187 Ga0068859_101290359
1188 Ga0068859_102563362
1189 Ga0068864_100043267
1190 Ga0068864_100067309
1191 Ga0068864_100369486
1192 Ga0068864_100431660
1193 Ga0068864_100499665
1194 Ga0068864_100586708
1195 Ga0068866_10447546
1196 Ga0068866_11108478
1197 Ga0068861_100001293
1198 Ga0068861_101108998
1199 Ga0068851_10849134
1200 Ga0068870_10008632
1201 Ga0068870_10014068
1202 Ga0068870_10017998
1203 Ga0068870_10026411
1204 Ga0068870_10314003
1205 Ga0068870_10456817
1206 Ga0068870_10752093
1207 Ga0068863_100019665
1208 Ga0068863_100186579
1209 Ga0068863_100751413
1210 Ga0068863_100948241
1211 Ga0068858_100015339
1212 Ga0068858_100052144
1213 Ga0068858_100094724
1214 Ga0068858_100585933
1215 Ga0068860_100006114
1216 Ga0068860_100038938
1217 Ga0068860_101260478
1218 Ga0068862_100001293
1219 Ga0068862_100004501
1220 Ga0068862_100345180
1221 Ga0068862_100580042
1222 Ga0068862_100698178
1223 Ga0068862_100717161
1224 Ga0068862_101781073
1225 Ga0081539_10000013
1226 Ga0081539_10000164
1227 Ga0081539_10013539
1228 Ga0081539_10058268
1229 Ga0075432_10061975
1230 Ga0075432_10088489
1231 Ga0070712_101446797
1232 Ga0097621_100092943
1233 Ga0097621_100255420
1234 Ga0097621_100309097
1235 Ga0097621_100995095
1236 Ga0068871_100065374
1237 Ga0068871_100192405
1238 Ga0068871_100218569
1239 Ga0068871_100230976
1240 Ga0068871_101280608
1241 Ga0075428_100000869
1242 Ga0075428_100026891
1243 Ga0075428_100038755
1244 Ga0075428_100169423
1245 Ga0075428_100181984
1246 Ga0075428_100192975
1247 Ga0075428_100234100
1248 Ga0075428_100572935
1249 Ga0075428_100884459
1250 Ga0075428_101247363
1251 Ga0075428_101818621
1252 Ga0075430_100005569
1253 Ga0075430_100010153
1254 Ga0075430_100015622
1255 Ga0075430_100114945
1256 Ga0075430_100164103
1257 Ga0075430_100225283
1258 Ga0075430_100569743
1259 Ga0075431_100000533
1260 Ga0075431_100058743
1261 Ga0075431_100117491
1262 Ga0075431_100117777
1263 Ga0075431_100455459
1264 Ga0075431_100809648
1265 Ga0075433_10014616
1266 Ga0075433_10030688
1267 Ga0075433_10036407
1268 Ga0075433_10053367
1269 Ga0075433_10054073
1270 Ga0075433_10183185
1271 Ga0075433_10227894
1272 Ga0075434_100008828
1273 Ga0075434_100054222
1274 Ga0075434_100098176
1275 Ga0075434_100107712
1276 Ga0075434_100268093
1277 Ga0075434_101096201
1278 Ga0075429_100038051
1279 Ga0075429_100044382
1280 Ga0075429_100062109
1281 Ga0075429_100380944
1282 Ga0075429_100391003
1283 Ga0068865_100150804
1284 Ga0068865_100297666
1285 Ga0068865_100338176
1286 Ga0068865_100855738
1287 Ga0068865_100978026
1288 Ga0068865_101042451
1289 Ga0097620_100002071
1290 Ga0097620_100002533
1291 Ga0097620_100022927
1292 Ga0097620_100069604
1293 Ga0097620_100185599
1294 Ga0097620_101290289
1295 Ga0097620_102562974
1296 Ga0075435_100005714
1297 Ga0075435_100060230
1298 Ga0075435_100637741
1299 Ga0111539_10000044
1300 Ga0111539_10000769
1301 Ga0111539_10001774
1302 Ga0111539_10010913
1303 Ga0111539_10022455
1304 Ga0111539_10026374
1305 Ga0111539_10139223
1306 Ga0111539_10360069
1307 Ga0111539_10419078
1308 Ga0111539_10516430
1309 Ga0111539_10654940
1310 Ga0111539_10915013
1311 Ga0111539_10926144
1312 Ga0111539_11208015
1313 Ga0111539_12329190
1314 Ga0111539_12498185
1315 Ga0111539_13317903
1316 Ga0105245_10457378
1317 Ga0114129_10003276
1318 Ga0114129_10006054
1319 Ga0114129_10008048
1320 Ga0114129_10074700
1321 Ga0114129_10088180
1322 Ga0114129_10109324
1323 Ga0114129_10113438
1324 Ga0114129_10431633
1325 Ga0114129_10610543
1326 Ga0114129_10641114
1327 Ga0114129_11204322
1328 Ga0114129_11329002
1329 Ga0114129_11330908
1330 Ga0114129_11365552
1331 Ga0114129_12868545
1332 Ga0105243_10039279
1333 Ga0105243_10281598
1334 Ga0105243_11884064
1335 Ga0105242_10246359
1336 Ga0105242_10467408
1337 Ga0105242_10611704
1338 Ga0105248_10076791
1339 Ga0105248_10089923
1340 Ga0105248_10158064
1341 Ga0105249_10001334
1342 Ga0105249_10133236
1343 Ga0105249_10170129
1344 Ga0105249_11948953
1345 Ga0105246_10095338
1346 Ga0105246_10214474
1347 Ga0105246_10827539
1348 Ga0105246_10905180
1349 Ga0157346_1019322
1350 Ga0157323_1007328
1351 Ga0157373_10981274
1352 Ga0157374_10037760
1353 Ga0157374_10199239
1354 Ga0157374_10321343
1355 Ga0157378_10059392
1356 Ga0157378_10089613
1357 Ga0157378_10372797
1358 Ga0163162_10016085
1359 Ga0163162_10589379
1360 Ga0163162_10912523
1361 Ga0157375_10009638
1362 Ga0157375_10027823
1363 Ga0157375_10304445
1364 Ga0157375_10370261
1365 Ga0163163_10017755
1366 Ga0163163_10255424
1367 Ga0163163_10513067
1368 Ga0157380_10005619
1369 Ga0157380_10021207
1370 Ga0157380_10204245
1371 Ga0157380_10700305
1372 Ga0157380_10757404
1373 Ga0157380_11914128
1374 Ga0157377_10002991
1375 Ga0157377_10034044
1376 Ga0157377_10048960
1377 Ga0157377_10078417
1378 Ga0157377_10140301
1379 Ga0157377_10681957
1380 Ga0157377_11044006
1381 Ga0157377_11316128
1382 Ga0157379_10003739
1383 Ga0157379_10087853
1384 Ga0157376_10068589
1385 Ga0157376_10310734
1386 Ga0157376_10927609
1387 Ga0157376_11247253
1388 Ga0157376_11523918
1389 Ga0157376_11528060
1390 Ga0163161_10011766
1391 Ga0163161_10478577
1392 Ga0163161_10552852
1393 Ga0163161_10553520
1394 Ga0163161_10583739
1395 Ga0163161_11582325
1396 Ga0207666_1077723
1397 Ga0207673_1004738
1398 Ga0207697_10001621
1399 Ga0207697_10102352
1400 Ga0207682_10001841
1401 Ga0207682_10010257
1402 Ga0207682_10013530
1403 Ga0207682_10052606
1404 Ga0207682_10593655
1405 Ga0207642_10186498
1406 Ga0207688_10001443
1407 Ga0207688_10059067
1408 Ga0207688_10132575
1409 Ga0207688_10699274
1410 Ga0207680_10018186
1411 Ga0207680_10060337
1412 Ga0207647_10047580
1413 Ga0207645_10001881
1414 Ga0207645_10217224
1415 Ga0207645_10245118
1416 Ga0207645_10266359
1417 Ga0207645_10529058
1418 Ga0207643_10004144
1419 Ga0207643_10005748
1420 Ga0207643_10053082
1421 Ga0207643_10053648
1422 Ga0207643_10076499
1423 Ga0207643_10234149
1424 Ga0207643_10605897
1425 Ga0207705_10224675
1426 Ga0207684_10115149
1427 Ga0207707_10084480
1428 Ga0207693_10434261
1429 Ga0207660_10129706
1430 Ga0207660_10199381
1431 Ga0207660_10513750
1432 Ga0207660_10725343
1433 Ga0207662_10002054
1434 Ga0207662_10004271
1435 Ga0207662_10028524
1436 Ga0207662_10129801
1437 Ga0207657_10899733
1438 Ga0207649_10023217
1439 Ga0207649_10267003
1440 Ga0207649_10466101
1441 Ga0207649_11297535
1442 Ga0207652_10701069
1443 Ga0207652_10750787
1444 Ga0207646_10020399
1445 Ga0207646_10166267
1446 Ga0207646_10177495
1447 Ga0207646_10231923
1448 Ga0207646_10270986
1449 Ga0207681_10000566
1450 Ga0207681_10077568
1451 Ga0207681_10088862
1452 Ga0207681_10210141
1453 Ga0207681_10542263
1454 Ga0207650_10037192
1455 Ga0207650_10126129
1456 Ga0207650_10148492
1457 Ga0207650_10182355
1458 Ga0207650_10273829
1459 Ga0207650_10437743
1460 Ga0207650_10569237
1461 Ga0207650_11065203
1462 Ga0207650_11118654
1463 Ga0207659_10001222
1464 Ga0207659_10002242
1465 Ga0207659_10004787
1466 Ga0207659_10007569
1467 Ga0207659_10027161
1468 Ga0207659_10032972
1469 Ga0207659_10048877
1470 Ga0207659_10071033
1471 Ga0207659_10402165
1472 Ga0207659_10510909
1473 Ga0207687_10849320
1474 Ga0207644_10154004
1475 Ga0207644_10748292
1476 Ga0207644_10882921
1477 Ga0207690_10165282
1478 Ga0207690_10184925
1479 Ga0207690_10250642
1480 Ga0207706_10003425
1481 Ga0207706_10037583
1482 Ga0207706_10057657
1483 Ga0207706_10146880
1484 Ga0207706_10336125
1485 Ga0207706_10766219
1486 Ga0207706_10833559
1487 Ga0207686_10113634
1488 Ga0207686_10552084
1489 Ga0207686_10822442
1490 Ga0207709_10161212
1491 Ga0207670_10003736
1492 Ga0207670_10006525
1493 Ga0207670_10362549
1494 Ga0207669_10001529
1495 Ga0207669_10428381
1496 Ga0207669_10833780
1497 Ga0207669_11139124
1498 Ga0207704_10053194
1499 Ga0207704_11537265
1500 Ga0207691_10012691
1501 Ga0207691_10050039
1502 Ga0207691_10055581
1503 Ga0207691_10085089
1504 Ga0207691_10088306
1505 Ga0207691_10180664
1506 Ga0207691_10256872
1507 Ga0207691_10365531
1508 Ga0207691_10817532
1509 Ga0207711_10083185
1510 Ga0207711_10169955
1511 Ga0207711_10242585
1512 Ga0207689_10000831
1513 Ga0207689_10048175
1514 Ga0207689_10084887
1515 Ga0207661_10028828
1516 Ga0207679_10029892
1517 Ga0207679_10082888
1518 Ga0207679_10294889
1519 Ga0207679_10586087
1520 Ga0207679_10757637
1521 Ga0207679_11454145
1522 Ga0207651_10025082
1523 Ga0207651_10096190
1524 Ga0207651_10125337
1525 Ga0207651_10180642
1526 Ga0207651_10244533
1527 Ga0207651_10380877
1528 Ga0207651_10622228
1529 Ga0207651_10709019
1530 Ga0207712_10002418
1531 Ga0207712_10464140
1532 Ga0207668_10118148
1533 Ga0207668_10150849
1534 Ga0207668_10159885
1535 Ga0207668_10269874
1536 Ga0207668_11030614
1537 Ga0207640_10067322
1538 Ga0207640_10250656
1539 Ga0207640_11766552
1540 Ga0207640_12203733
1541 Ga0207658_10012438
1542 Ga0207658_10346730
1543 Ga0207658_11138384
1544 Ga0207658_11145954
1545 Ga0207677_10063258
1546 Ga0207677_10145249
1547 Ga0207677_10603857
1548 Ga0207703_10042317
1549 Ga0207703_10141518
1550 Ga0207703_10289415
1551 Ga0207703_10472240
1552 Ga0207639_11705257
1553 Ga0207708_10017222
1554 Ga0207708_10095321
1555 Ga0207708_10159192
1556 Ga0207708_10269838
1557 Ga0207708_11023236
1558 Ga0207641_10097682
1559 Ga0207641_10105045
1560 Ga0207641_10792093
1561 Ga0207641_11460006
1562 Ga0207641_11546920
1563 Ga0207648_10000446
1564 Ga0207648_10046637
1565 Ga0207648_10062997
1566 Ga0207648_10410519
1567 Ga0207648_10474768
1568 Ga0207648_10708929
1569 Ga0207648_11114991
1570 Ga0207676_10010914
1571 Ga0207676_10026175
1572 Ga0207676_10306404
1573 Ga0207676_11021163
1574 Ga0207676_11105762
1575 Ga0207674_10176364
1576 Ga0207674_10185565
1577 Ga0207674_10465004
1578 Ga0207674_10633889
1579 Ga0207674_11192251
1580 Ga0207674_11281744
1581 Ga0207675_100001058
1582 Ga0207675_100004015
1583 Ga0207675_100094653
1584 Ga0207675_100770580
1585 Ga0207675_100794938
1586 Ga0207675_101820305
1587 Ga0207683_10021244
1588 Ga0207683_10128891
1589 Ga0207683_10135522
1590 Ga0207683_10451795
1591 Ga0207683_10624160
1592 Ga0207683_10670690
1593 Ga0207683_10808344
1594 Ga0207683_10814772
1595 Ga0207698_10509518
1596 Ga0209968_1053945
1597 Ga0210002_1084402
1598 Ga0207428_10000224
1599 Ga0207428_10000353
1600 Ga0207428_10004706
1601 Ga0207428_10005989
1602 Ga0207428_10010077
1603 Ga0207428_10304822
1604 Ga0207428_10465962
1605 Ga0268266_10312547
1606 Ga0268265_10000540
1607 Ga0268265_10055567
1608 Ga0268265_10374861
1609 Ga0268265_10622631
1610 Ga0268265_10913339
1611 Ga0268265_11372760
1612 Ga0268265_12172198
1613 Ga0268264_10012807
1614 Ga0268264_10115573
1615 Ga0268264_10879495
1616 Ga0268264_11413075
1617 Ga0307408_100364100
1618 Ga0307408_100388393
1619 Ga0307408_101045124
1620 Ga0307405_10003692
1621 Ga0307405_10091958
1622 Ga0307405_10751537
1623 Ga0307413_10045918
1624 Ga0307413_10140375
1625 Ga0307413_11234604
1626 Ga0307413_11805844
1627 Ga0307410_10005392
1628 Ga0307410_10123448
1629 Ga0307410_10141882
1630 Ga0307410_11728725
1631 Ga0307406_10041702
1632 Ga0307406_11405123
1633 Ga0307407_10004637
1634 Ga0307407_10060573
1635 Ga0307407_10968281
1636 Ga0307412_10009853
1637 Ga0307412_10083761
1638 Ga0307412_10671720
1639 Ga0307412_10934579
1640 Ga0307409_100004850
1641 Ga0307409_100018258
1642 Ga0307409_100104257
1643 Ga0307409_100115339
1644 Ga0307409_100147164
1645 Ga0307409_100334185
1646 Ga0307409_100927127
1647 Ga0307416_100004482
1648 Ga0307416_100012439
1649 Ga0307416_100072394
1650 Ga0307416_100119105
1651 Ga0307416_100290128
1652 Ga0307416_100530497
1653 Ga0307416_100791711
1654 Ga0307416_101584211
1655 Ga0307416_101974363
1656 Ga0307416_102130950
1657 Ga0307416_102784627
1658 Ga0307416_103018112
1659 Ga0307416_103157408
1660 Ga0307414_10366728
1661 Ga0307414_10418639
1662 Ga0307414_10549306
1663 Ga0307411_10003247
1664 Ga0307411_10029786
1665 Ga0307411_10819408
1666 Ga0307411_12312917
1667 Ga0307415_100007237
1668 Ga0307415_100068095
1669 Ga0307415_100134002
1670 Ga0307415_101561037
1671 Ga0373958_0149005
1672 Ga0373940_0089324
1673 Ga0373939_0279073
1674 Ga0373941_0201517
1675 Ga0373941_0428774
1676 Ga0373961_0222983
1677 Ga0242420_143832
1678 Ga0451853_1692674
1679 Ga0451853_3527350
1680 Ga0439442_126911
1681 Ga0439454_116389
1682 Ga0439434_0071318
1683 Ga0439444_0009088
1684 Ga0439460_0244470
1685 Ga0451577_0607601
1686 Ga0439440_0104320
1687 Ga0451576_0007819
1688 Ga0451576_0013731
1689 Ga0451576_0079338
1690 Ga0451576_0186928
1691 Ga0451576_0705066
1692 Ga0495603_0188771
1693 Ga0495629_0057974
1694 Ga0495580_0339705
1695 Ga0495580_0532991
1696 Ga0495585_0147225
1697 Ga0495594_0028254
1698 Ga0495643_0001548
1699 Ga0495644_0019673
1700 Ga0495642_0046137
1701 Ga0495642_0048601
1702 Ga0495598_0240921
1703 Ga0495598_0383849
1704 Ga0495609_0147241
1705 Ga0495621_0015340
1706 Ga0495621_0107764
1707 Ga0495621_0177265
1708 Ga0495656_0059120
1709 Ga0495659_0003442
1710 Ga0495659_0013145
1711 Ga0495659_0190341
1712 Ga0495659_0308799
1713 Ga0495659_0348468
1714 Ga0495588_0024382
1715 Ga0495658_0097707
1716 Ga0495669_0462621
1717 Ga0495670_0118046
1718 Ga0495670_0173556
1719 Ga0495670_0483775
1720 Ga0495589_0492716
1721 Ga0495636_0063710
1722 Ga0495677_0028335
1723 Ga0495677_0195527
1724 Ga0496104_0815228
1725 Ga0496108_1280058
1726 Ga0496110_0387822
1727 Ga0496112_1640137
1728 Ga0501290_071205
1729 Ga0501298_154992
1730 Ga0501031_0284762
1731 Ga0501033_0768025
1732 Ga0501036_0315208
1733 Ga0501036_0665359
1734 Ga0501037_0599418
1735 Ga0501037_0639497
1736 Ga0501038_0856032
1737 Ga0501038_1061858
1738 Ga0501039_0007557
1739 Ga0501039_0056186
1740 Ga0501039_0299496
1741 Ga0501040_0012945
1742 Ga0501041_0135843
1743 Ga0501041_0227101
1744 Ga0501042_0003889
1745 Ga0501042_0286231
1746 Ga0501042_0632904
1747 Ga0501043_0936479
1748 Ga0501046_0074757
1749 Ga0501048_0035520
1750 Ga0501048_0107006
1751 Ga0501067_0296343
1752 Ga0501068_0368144
1753 Ga0501069_0586049
1754 Ga0501071_0821372
1755 Ga0501072_0008859
1756 Ga0501072_0027578
1757 Ga0501072_0205831
1758 Ga0501072_0352631
1759 Ga0501072_0392733
1760 Ga0501075_0098439
1761 Ga0501075_0156761
1762 Ga0501075_0293114
1763 Ga0501075_0502202
1764 Ga0501076_0009175
1765 Ga0501076_0044775
1766 Ga0501076_0156572
1767 Ga0501076_0214437
1768 Ga0501076_0311423
1769 Ga0501076_1659100
1770 Ga0501208_041509
1771 Ga0501249_016262
1772 Ga0501249_200628
1773 Ga0501221_137825
1774 Ga0501245_059587
1775 Ga0501079_0034154
1776 Ga0501079_0075401
1777 Ga0501079_0133364
1778 Ga0501079_0445534
1779 Ga0501079_0480084
1780 Ga0501080_0553263
1781 Ga0501080_0994261
1782 Ga0501081_0048284
1783 Ga0501081_0190447
1784 Ga0501081_0224269
1785 Ga0501081_0339545
1786 Ga0501081_0384370
1787 Ga0501081_0386495
1788 Ga0501081_0625649
1789 Ga0501081_0869432
1790 Ga0501083_0641713
1791 Ga0501272_020596
1792 Ga0501283_035584
1793 Ga0501045_0024405
1794 Ga0501045_0157688
1795 nmdc:mga05p37_1167638_c1
1796 nmdc:mga05p37_155524_c1
1797 nmdc:mga05p37_1654227_c1
1798 nmdc:mga05p37_1656263_c1
1799 nmdc:mga05p37_17011_c1
1800 nmdc:mga05p37_200071_c1
1801 nmdc:mga05p37_244730_c1
1802 nmdc:mga05p37_395165_c1
1803 nmdc:mga05p37_503469_c1
1804 nmdc:mga05p37_56561_c1
1805 nmdc:mga05p37_70703_c1
1806 nmdc:mga05p37_974417_c1
1807 nmdc:mga09592_240558_c1
1808 nmdc:mga09592_275748_c1
1809 nmdc:mga09592_29049_c1
1810 nmdc:mga09592_334982_c1
1811 nmdc:mga09592_504093_c1
1812 nmdc:mga09592_61109_c1
1813 nmdc:mga09592_80073_c1
1814 nmdc:mga0qj67_280529_c1
1815 nmdc:mga0qj67_526_c1
1816 nmdc:mga0qj67_5293_c1
1817 nmdc:mga0qj67_541447_c1
1818 nmdc:mga0qj67_5798_c1
1819 nmdc:mga06r32_107386_c1
1820 nmdc:mga06r32_127805_c1
1821 nmdc:mga06r32_18027_c1
1822 nmdc:mga06r32_24815_c1
1823 nmdc:mga06r32_310457_c1
1824 nmdc:mga06r32_610525_c1
1825 nmdc:mga08y16_15575_c1
1826 nmdc:mga08y16_167360_c1
1827 nmdc:mga08y16_168786_c1
1828 nmdc:mga08y16_1836417_c1
1829 nmdc:mga08y16_41616_c1
1830 nmdc:mga08y16_467911_c1
1831 nmdc:mga08y16_575165_c1
1832 nmdc:mga08y16_5828_c1
1833 nmdc:mga08y16_60586_c1
1834 nmdc:mga08y16_684391_c1
1835 nmdc:mga08y16_945_c1
1836 nmdc:mga08y16_958632_c1
1837 nmdc:mga08y16_979410_c1
1838 nmdc:mga0n895_1446644_c1
1839 nmdc:mga0n895_32666_c1
1840 nmdc:mga0n895_465314_c1
1841 nmdc:mga0n895_65768_c1
1842 nmdc:mga0n895_809892_c1
1843 nmdc:mga0n895_88881_c1
1844 nmdc:mga0n895_90365_c1
1845 nmdc:mga0rr50_102607_c1
1846 nmdc:mga0rr50_111579_c1
1847 nmdc:mga0rr50_1506752_c1
1848 nmdc:mga0rr50_63989_c1
1849 nmdc:mga08x19_2_c1
1850 nmdc:mga0a205_107387_c1
1851 nmdc:mga0a205_1497_c1
1852 nmdc:mga0a205_161479_c1
1853 nmdc:mga0a205_422640_c1
1854 nmdc:mga0a205_55600_c1
1855 nmdc:mga0a205_68363_c1
1856 nmdc:mga0a205_91795_c1
1857 nmdc:mga0a205_94654_c1
1858 Ga0500556_0007638
1859 Ga0501084_0148547
1860 Ga0501084_0250372
1861 Ga0501084_0465655
1862 Ga0501084_0764188
1863 Ga0590071_000198
1864 Ga0590071_001421
1865 Ga0590071_007060
1866 Ga0590074_009905
1867 Ga0590075_000275
1868 Ga0590075_007624
1869 Ga0590077_000049
1870 Ga0590077_001543
1871 Ga0501082_0010321
1872 Ga0501082_0211640
1873 Ga0530510_0001774
1874 Ga0530510_0173337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

84

165

0.97

PF00011

HSP20

Hsp20/alpha crystallin family

78

180

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.9138 37 132
3guf-assembly1.cif.gz_B crystal structure of the hspa from xanthomonas axonopodis 0.8995 37 134
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8979 42 132
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8943 41 132
5zul-assembly1.cif.gz_A-2 small heat shock protein from mycobacterium marinum m : form-3 0.8896 37 132
ID Description Score Start End Superfamily
3glaB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9057 39 135 2.60.40.790
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8943 41 132 2.60.40.790
af_K7KYJ0_12_113_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8919 37 134 2.60.40.790
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.888 38 133 2.60.40.790
af_C0PJF1_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8869 37 135 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A3M1PHI6-F1-model_v4 Hsp20/alpha crystallin family protein 0.9259 37 145
AF-A0A0L0H616-F1-model_v4 SHSP domain-containing protein 0.9258 39 145
AF-A0A7V5G6R0-F1-model_v4 Hsp20/alpha crystallin family protein 0.9226 39 134
AF-A0A2D4Z8W5-F1-model_v4 deleted 0.9163 39 147
AF-A0A7V5G6R0-F1-model_v4 Hsp20/alpha crystallin family protein 0.9137 39 134

Map