F486181

General Info

Members Datasets Scaffolds Average Seq Length
935 404 933 106

Family's Representative Sequence

Representative Sequence 3300059477|Ga0587084_011725|Ga0587084_011725_444_761
Length 105
Sequence MAKKQAAAVDNRHSDVIVAPHITEKSTMVSEHNAVVFKVARDATKPEIKAAVEALFPSVKVTGVNTIVQKGKTKKWKGKPYTRSDVKKAIVTLADGDQIDVTQGI

Samples

Sample ID Description Type Environment
1 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
107 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
224 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
225 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
228 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
231 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
232 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
236 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
242 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
302 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
326 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
327 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
328 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
329 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
330 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
331 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
332 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
333 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
334 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
335 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
336 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
339 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
340 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
341 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
342 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
343 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
349 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
350 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
353 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
355 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
356 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
357 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
358 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.7
Metatranscriptomes 12.09
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 3.21
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J14986_101847 3300001432 Bacteria 1154
2 JGI24741J21665_1001920 3300001915 Bacteria 5620
3 JGI24741J21665_1015360 3300001915 Bacteria 1265
4 JGI24752J21851_1000007 3300001976 Bacteria 24778
5 JGI24747J21853_1005899 3300001978 Bacteria 1143
6 JGI24740J21852_10015856 3300001979 Bacteria 2738
7 JGI24739J22299_10134605 3300001989 Bacteria 734
8 JGI24737J22298_10043760 3300001990 Bacteria 1370
9 JGI24737J22298_10139036 3300001990 Bacteria 717
10 JGI24735J21928_10011436 3300002067 Bacteria 2813
11 JGI24750J21931_1000298 3300002070 Bacteria 8551
12 JGI24748J21848_1000070 3300002074 Bacteria 36407
13 JGI24748J21848_1008969 3300002074 Bacteria 1178
14 JGI24749J21850_1000118 3300002076 Bacteria 13310
15 JGI24033J26618_1044558 3300002155 Bacteria 625
16 JGI24034J26672_10000038 3300002239 Bacteria 75372
17 JGI24034J26672_10014302 3300002239 Bacteria 1210
18 JGI24034J26672_10049632 3300002239 Bacteria 719
19 JGI24742J22300_10001588 3300002244 Bacteria 3613
20 JGI24742J22300_10003980 3300002244 Bacteria 2410
21 JGI24751J29686_10010345 3300002459 Bacteria 1922
22 JGI25165J46597_1000023 3300003214 Bacteria 338873
23 JGI25153J46596_10000173 3300003215 Bacteria 64195
24 Ga0032354_1119435 3300003693 Bacteria 542
25 Ga0055525_1000012 3300003759 Bacteria 486564
26 Ga0055542_1001518 3300003762 Bacteria 11230
27 Ga0055529_1000014 3300003763 Bacteria 367283
28 Ga0055530_10015010 3300003791 Bacteria 2552
29 Ga0055531_10032620 3300003794 Bacteria 1697
30 Ga0055531_10100522 3300003794 Bacteria 595
31 Ga0058860_11860095 3300004801 Bacteria 568
32 Ga0065712_10100550 3300005290 Bacteria 2059
33 Ga0065712_10213194 3300005290 Bacteria 1065
34 Ga0065712_10339614 3300005290 Bacteria 801
35 Ga0065715_10029418 3300005293 Bacteria 1977
36 Ga0065715_10051509 3300005293 Bacteria 992
37 Ga0065715_10448200 3300005293 Bacteria 829
38 Ga0065715_10565818 3300005293 Bacteria 730
39 Ga0065715_10598461 3300005293 Bacteria 687
40 Ga0065707_10525541 3300005295 Bacteria 739
41 Ga0070658_10034849 3300005327 Bacteria 4051
42 Ga0070658_10354895 3300005327 Bacteria 1255
43 Ga0070658_10470961 3300005327 Bacteria 1083
44 Ga0070658_10488853 3300005327 Bacteria 1062
45 Ga0070658_10739176 3300005327 Bacteria 854
46 Ga0070658_10790314 3300005327 Bacteria 824
47 Ga0070658_11019730 3300005327 Bacteria 720
48 Ga0070658_11444257 3300005327 Bacteria 597
49 Ga0070676_10033009 3300005328 Bacteria 2968
50 Ga0070676_10585954 3300005328 Bacteria 802
51 Ga0070676_10770661 3300005328 Bacteria 708
52 Ga0070683_100438274 3300005329 Bacteria 1247
53 Ga0070683_100974924 3300005329 Bacteria 814
54 Ga0070683_101634463 3300005329 Bacteria 619
55 Ga0070690_100000097 3300005330 Bacteria 44576
56 Ga0070670_100010675 3300005331 Bacteria 7846
57 Ga0070670_100034259 3300005331 Bacteria 4370
58 Ga0070670_100161717 3300005331 Bacteria 1940
59 Ga0070670_100436289 3300005331 Bacteria 1159
60 Ga0070677_10037474 3300005333 Bacteria 1892
61 Ga0070677_10062061 3300005333 Bacteria 1544
62 Ga0070677_10074850 3300005333 Bacteria 1433
63 Ga0068869_101112408 3300005334 Bacteria 692
64 Ga0070666_10000004 3300005335 Bacteria 372098
65 Ga0070666_10191087 3300005335 Bacteria 1439
66 Ga0070666_10490911 3300005335 Bacteria 890
67 Ga0070680_100363294 3300005336 Bacteria 1231
68 Ga0070682_100379432 3300005337 Bacteria 1063
69 Ga0070682_101020532 3300005337 Bacteria 688
70 Ga0068868_100049745 3300005338 Bacteria 3290
71 Ga0070660_100096538 3300005339 Bacteria 2337
72 Ga0070660_100188024 3300005339 Bacteria 1672
73 Ga0070660_100205715 3300005339 Bacteria 1597
74 Ga0070660_100390605 3300005339 Bacteria 1149
75 Ga0070660_100419886 3300005339 Bacteria 1107
76 Ga0070660_100682995 3300005339 Bacteria 860
77 Ga0070660_101060484 3300005339 Bacteria 685
78 Ga0070689_100106270 3300005340 Bacteria 2227
79 Ga0070687_100263328 3300005343 Bacteria 1077
80 Ga0070661_100033195 3300005344 Bacteria 3738
81 Ga0070661_100101205 3300005344 Bacteria 2143
82 Ga0070661_100122997 3300005344 Bacteria 1944
83 Ga0070661_100353376 3300005344 Bacteria 1153
84 Ga0070661_100410927 3300005344 Bacteria 1071
85 Ga0070661_100763169 3300005344 Bacteria 791
86 Ga0070661_101222862 3300005344 Bacteria 629
87 Ga0070692_10047048 3300005345 Bacteria 2231
88 Ga0070668_100078782 3300005347 Bacteria 2578
89 Ga0070668_100164638 3300005347 Bacteria 1801
90 Ga0070668_100367114 3300005347 Bacteria 1222
91 Ga0070668_100773108 3300005347 Bacteria 851
92 Ga0070669_100000296 3300005353 Bacteria 39004
93 Ga0070669_100177439 3300005353 Bacteria 1665
94 Ga0070669_100200612 3300005353 Bacteria 1569
95 Ga0070669_100285920 3300005353 Bacteria 1322
96 Ga0070669_100485009 3300005353 Bacteria 1023
97 Ga0070669_100971176 3300005353 Bacteria 728
98 Ga0070669_101061793 3300005353 Bacteria 696
99 Ga0070669_101128734 3300005353 Bacteria 676
100 Ga0070669_101391820 3300005353 Bacteria 609
101 Ga0070675_100190962 3300005354 Bacteria 1775
102 Ga0070675_100775834 3300005354 Bacteria 875
103 Ga0070675_100929592 3300005354 Bacteria 797
104 Ga0070671_100012607 3300005355 Bacteria 6811
105 Ga0070671_100023714 3300005355 Bacteria 5023
106 Ga0070671_100203448 3300005355 Bacteria 1679
107 Ga0070671_100258242 3300005355 Bacteria 1481
108 Ga0070671_100402823 3300005355 Bacteria 1170
109 Ga0070671_100490132 3300005355 Bacteria 1057
110 Ga0070674_100112061 3300005356 Bacteria 2005
111 Ga0070674_100242117 3300005356 Bacteria 1413
112 Ga0070673_100127669 3300005364 Bacteria 2129
113 Ga0070673_100880830 3300005364 Bacteria 829
114 Ga0070688_100002383 3300005365 Bacteria 9493
115 Ga0070659_100033177 3300005366 Bacteria 4008
116 Ga0070659_100235299 3300005366 Bacteria 1514
117 Ga0070659_100242738 3300005366 Bacteria 1491
118 Ga0070659_100278332 3300005366 Bacteria 1392
119 Ga0070659_101135244 3300005366 Bacteria 690
120 Ga0070659_101152500 3300005366 Bacteria 684
121 Ga0070659_101427295 3300005366 Bacteria 616
122 Ga0070667_100061703 3300005367 Bacteria 3174
123 Ga0070667_100200068 3300005367 Bacteria 1772
124 Ga0070667_102150601 3300005367 Bacteria 526
125 Ga0070714_100025886 3300005435 Bacteria 4845
126 Ga0070714_100507601 3300005435 Bacteria 1150
127 Ga0070713_100239005 3300005436 Bacteria 1654
128 Ga0070700_101543717 3300005441 Bacteria 566
129 Ga0070663_100080949 3300005455 Bacteria 2386
130 Ga0070663_100751747 3300005455 Bacteria 832
131 Ga0070663_101348259 3300005455 Bacteria 630
132 Ga0070678_100017885 3300005456 Bacteria 4578
133 Ga0070678_100403125 3300005456 Bacteria 1189
134 Ga0070662_100046495 3300005457 Bacteria 3119
135 Ga0070662_100064573 3300005457 Bacteria 2681
136 Ga0070662_100483155 3300005457 Bacteria 1031
137 Ga0070681_10807026 3300005458 Bacteria 856
138 Ga0070681_10847619 3300005458 Bacteria 832
139 Ga0068867_100321187 3300005459 Bacteria 1283
140 Ga0070685_10000262 3300005466 Bacteria 33728
141 Ga0070679_100226535 3300005530 Bacteria 1829
142 Ga0070679_100321123 3300005530 Bacteria 1498
143 Ga0070679_101542479 3300005530 Bacteria 611
144 Ga0070684_100653704 3300005535 Bacteria 979
145 Ga0070684_101371812 3300005535 Bacteria 665
146 Ga0068853_100079177 3300005539 Bacteria 2873
147 Ga0068853_100151532 3300005539 Bacteria 2087
148 Ga0068853_100535457 3300005539 Bacteria 1108
149 Ga0068853_100674894 3300005539 Bacteria 984
150 Ga0068853_102312984 3300005539 Bacteria 521
151 Ga0070672_100207425 3300005543 Bacteria 1640
152 Ga0070686_100000061 3300005544 Bacteria 83811
153 Ga0070696_100112118 3300005546 Bacteria 1965
154 Ga0070665_100000004 3300005548 Bacteria 785500
155 Ga0070665_100009730 3300005548 Bacteria 9719
156 Ga0070665_100280359 3300005548 Bacteria 1668
157 Ga0070665_100339978 3300005548 Bacteria 1506
158 Ga0070665_101500274 3300005548 Bacteria 683
159 Ga0068855_100616645 3300005563 Bacteria 1168
160 Ga0070664_100101975 3300005564 Bacteria 2496
161 Ga0070664_100216063 3300005564 Bacteria 1714
162 Ga0070664_100325070 3300005564 Bacteria 1394
163 Ga0070664_100520843 3300005564 Bacteria 1097
164 Ga0070664_100749325 3300005564 Bacteria 912
165 Ga0070664_100898377 3300005564 Bacteria 830
166 Ga0070664_101327312 3300005564 Bacteria 679
167 Ga0070664_101808126 3300005564 Bacteria 579
168 Ga0070664_102074491 3300005564 Bacteria 539
169 Ga0068857_100226553 3300005577 Bacteria 1708
170 Ga0068857_100686033 3300005577 Bacteria 972
171 Ga0068857_100808385 3300005577 Bacteria 895
172 Ga0068857_101067976 3300005577 Bacteria 779
173 Ga0068854_100063035 3300005578 Bacteria 2690
174 Ga0068854_100217907 3300005578 Bacteria 1509
175 Ga0068856_100050714 3300005614 Bacteria 4091
176 Ga0068856_100150227 3300005614 Bacteria 2338
177 Ga0068856_102249078 3300005614 Bacteria 554
178 Ga0068852_100218546 3300005616 Bacteria 1811
179 Ga0068852_100329391 3300005616 Bacteria 1485
180 Ga0068852_100931418 3300005616 Bacteria 886
181 Ga0068852_100947817 3300005616 Bacteria 879
182 Ga0068859_100001416 3300005617 Bacteria 24328
183 Ga0068859_100010520 3300005617 Bacteria 9310
184 Ga0068859_100275602 3300005617 Bacteria 1774
185 Ga0068859_100839699 3300005617 Bacteria 1005
186 Ga0068859_101860805 3300005617 Bacteria 665
187 Ga0068864_100002567 3300005618 Bacteria 14987
188 Ga0068864_101049438 3300005618 Bacteria 810
189 Ga0068861_100000040 3300005719 Bacteria 59725
190 Ga0068861_100002842 3300005719 Bacteria 11386
191 Ga0068861_101088385 3300005719 Bacteria 768
192 Ga0068851_10011439 3300005834 Bacteria 4162
193 Ga0068851_10360727 3300005834 Bacteria 847
194 Ga0068851_10423600 3300005834 Bacteria 786
195 Ga0068870_10272613 3300005840 Bacteria 1058
196 Ga0068870_11021802 3300005840 Bacteria 591
197 Ga0068863_100000013 3300005841 Bacteria 220357
198 Ga0068863_100909232 3300005841 Bacteria 881
199 Ga0068858_100000664 3300005842 Bacteria 35973
200 Ga0068858_100008722 3300005842 Bacteria 9734
201 Ga0068860_100000009 3300005843 Bacteria 372089
202 Ga0068860_100007808 3300005843 Bacteria 10684
203 Ga0068860_100544238 3300005843 Bacteria 1163
204 Ga0068862_100001446 3300005844 Bacteria 21877
205 Ga0081539_10018995 3300005985 Bacteria 4732
206 Ga0070717_11649270 3300006028 Bacteria 581
207 Ga0075367_10454611 3300006178 Bacteria 812
208 Ga0097621_100066302 3300006237 Bacteria 2973
209 Ga0075370_10375338 3300006353 Bacteria 851
210 Ga0075370_10388167 3300006353 Bacteria 837
211 Ga0068871_100064899 3300006358 Bacteria 2990
212 Ga0075430_101382922 3300006846 Bacteria 579
213 Ga0068865_100650878 3300006881 Bacteria 896
214 Ga0068865_101545290 3300006881 Bacteria 596
215 Ga0097620_100001416 3300006931 Bacteria 24328
216 Ga0097620_100010519 3300006931 Bacteria 9310
217 Ga0097620_100275611 3300006931 Bacteria 1774
218 Ga0097620_100839823 3300006931 Bacteria 1005
219 Ga0097620_101860871 3300006931 Bacteria 665
220 Ga0105250_10073036 3300009092 Bacteria 1387
221 Ga0105240_10206568 3300009093 Bacteria 2298
222 Ga0105240_10700183 3300009093 Bacteria 1106
223 Ga0105245_12705906 3300009098 Bacteria 549
224 Ga0105243_10003106 3300009148 Bacteria 13657
225 Ga0105243_10737663 3300009148 Bacteria 964
226 Ga0105241_12401405 3300009174 Bacteria 526
227 Ga0105241_12609145 3300009174 Bacteria 508
228 Ga0105248_10023935 3300009177 Bacteria 6788
229 Ga0105248_10316717 3300009177 Bacteria 1757
230 Ga0105248_10573441 3300009177 Bacteria 1273
231 Ga0105248_11013124 3300009177 Bacteria 938
232 Ga0105248_11284805 3300009177 Bacteria 828
233 Ga0105237_12029783 3300009545 Bacteria 584
234 Ga0105238_10931313 3300009551 Bacteria 888
235 Ga0105238_11034238 3300009551 Bacteria 843
236 Ga0105238_11508862 3300009551 Bacteria 701
237 Ga0105249_10000006 3300009553 Bacteria 354449
238 Ga0105148_117490 3300009978 Bacteria 569
239 Ga0105239_10090567 3300010375 Bacteria 3374
240 Ga0105239_13502082 3300010375 Bacteria 510
241 Ga0105246_10099608 3300011119 Bacteria 2113
242 Ga0157317_1000418 3300012475 Bacteria 1780
243 Ga0157327_1023822 3300012512 Bacteria 713
244 Ga0157373_10425298 3300013100 Bacteria 954
245 Ga0157373_10426491 3300013100 Bacteria 952
246 Ga0157373_10501180 3300013100 Bacteria 877
247 Ga0157373_11121058 3300013100 Bacteria 591
248 Ga0157371_10000059 3300013102 Bacteria 170541
249 Ga0157371_10123034 3300013102 Bacteria 1845
250 Ga0157371_11159258 3300013102 Bacteria 594
251 Ga0157370_10024969 3300013104 Bacteria 5914
252 Ga0157370_11334238 3300013104 Bacteria 646
253 Ga0157370_11633359 3300013104 Bacteria 579
254 Ga0157369_10034063 3300013105 Bacteria 5592
255 Ga0157369_10552266 3300013105 Bacteria 1190
256 Ga0157369_11190963 3300013105 Bacteria 778
257 Ga0157369_11220717 3300013105 Bacteria 767
258 Ga0157374_10104316 3300013296 Bacteria 2722
259 Ga0157374_10414168 3300013296 Bacteria 1346
260 Ga0157378_10232281 3300013297 Bacteria 1758
261 Ga0157378_10273729 3300013297 Bacteria 1625
262 Ga0163162_10034071 3300013306 Bacteria 5066
263 Ga0163162_10072394 3300013306 Bacteria 3501
264 Ga0163162_10109281 3300013306 Bacteria 2862
265 Ga0163162_10789338 3300013306 Bacteria 1067
266 Ga0163162_11697639 3300013306 Bacteria 721
267 Ga0157372_10308225 3300013307 Bacteria 1842
268 Ga0157372_10659289 3300013307 Bacteria 1218
269 Ga0157372_10774507 3300013307 Bacteria 1115
270 Ga0157372_11061209 3300013307 Bacteria 938
271 Ga0157372_11111232 3300013307 Bacteria 914
272 Ga0157375_10657450 3300013308 Bacteria 1204
273 Ga0157375_12866978 3300013308 Bacteria 576
274 Ga0157375_13433680 3300013308 Bacteria 527
275 Ga0157375_13535204 3300013308 Bacteria 520
276 Ga0163163_10019994 3300014325 Bacteria 6300
277 Ga0157380_10116019 3300014326 Bacteria 2259
278 Ga0157380_10235709 3300014326 Bacteria 1647
279 Ga0157380_11993450 3300014326 Bacteria 642
280 Ga0157379_10001735 3300014968 Bacteria 18043
281 Ga0157379_10003973 3300014968 Bacteria 12609
282 Ga0163161_10000208 3300017792 Bacteria 53837
283 Ga0163161_10222559 3300017792 Bacteria 1462
284 Ga0163161_10441763 3300017792 Bacteria 1050
285 Ga0163161_10751429 3300017792 Bacteria 816
286 Ga0197907_10820967 3300020069 Bacteria 835
287 Ga0197907_10990692 3300020069 Bacteria 515
288 Ga0206355_1017096 3300020076 Bacteria 1277
289 Ga0206352_10437088 3300020078 Bacteria 792
290 Ga0213876_10166713 3300021384 Bacteria 1172
291 Ga0213875_10001626 3300021388 Bacteria 14182
292 Ga0207672_1001700 3300025223 Bacteria 1545
293 Ga0209674_102700 3300025226 Bacteria 3641
294 Ga0209563_100030 3300025230 Bacteria 489259
295 Ga0207427_100986 3300025231 Bacteria 12010
296 Ga0209026_1000352 3300025250 Bacteria 43432
297 Ga0209148_1000011 3300025254 Bacteria 1196503
298 Ga0209759_1033090 3300025256 Bacteria 985
299 Ga0209233_1000003 3300025261 Bacteria 1607366
300 Ga0209455_1000006 3300025272 Bacteria 1196503
301 Ga0209758_1000001 3300025297 Bacteria 1981790
302 Ga0209050_1021913 3300025298 Bacteria 2308
303 Ga0209257_1000577 3300025304 Bacteria 61710
304 Ga0209257_1000597 3300025304 Bacteria 59900
305 Ga0209257_1006247 3300025304 Bacteria 7796
306 Ga0207697_10101229 3300025315 Bacteria 1228
307 Ga0207697_10161798 3300025315 Bacteria 977
308 Ga0207697_10172294 3300025315 Bacteria 947
309 Ga0207656_10002150 3300025321 Bacteria 6586
310 Ga0207656_10043235 3300025321 Bacteria 1921
311 Ga0207682_10073759 3300025893 Bacteria 1450
312 Ga0207682_10092570 3300025893 Bacteria 1312
313 Ga0207682_10487689 3300025893 Bacteria 584
314 Ga0207680_10000010 3300025903 Bacteria 414170
315 Ga0207680_10225072 3300025903 Bacteria 1287
316 Ga0207680_10490110 3300025903 Bacteria 875
317 Ga0207645_10026399 3300025907 Bacteria 3754
318 Ga0207645_10174952 3300025907 Bacteria 1408
319 Ga0207645_10567128 3300025907 Bacteria 770
320 Ga0207645_10728755 3300025907 Bacteria 674
321 Ga0207643_10178103 3300025908 Bacteria 1285
322 Ga0207643_10411592 3300025908 Bacteria 856
323 Ga0207705_10000511 3300025909 Bacteria 33036
324 Ga0207705_10001825 3300025909 Bacteria 16767
325 Ga0207705_10026545 3300025909 Bacteria 4130
326 Ga0207705_10207656 3300025909 Bacteria 1485
327 Ga0207705_10460666 3300025909 Bacteria 986
328 Ga0207654_11246107 3300025911 Bacteria 542
329 Ga0207707_10362538 3300025912 Bacteria 1248
330 Ga0207707_10757610 3300025912 Bacteria 811
331 Ga0207695_10003496 3300025913 Bacteria 22050
332 Ga0207695_11296827 3300025913 Bacteria 609
333 Ga0207671_10004021 3300025914 Bacteria 14287
334 Ga0207660_10884083 3300025917 Bacteria 729
335 Ga0207662_10431934 3300025918 Bacteria 898
336 Ga0207662_10438171 3300025918 Bacteria 892
337 Ga0207662_10741161 3300025918 Bacteria 690
338 Ga0207662_10813593 3300025918 Bacteria 659
339 Ga0207657_10061226 3300025919 Bacteria 3228
340 Ga0207657_10132430 3300025919 Bacteria 2043
341 Ga0207657_10231765 3300025919 Bacteria 1477
342 Ga0207657_10348096 3300025919 Bacteria 1169
343 Ga0207657_10587063 3300025919 Bacteria 870
344 Ga0207657_10671567 3300025919 Bacteria 806
345 Ga0207649_10363671 3300025920 Bacteria 1074
346 Ga0207649_10366653 3300025920 Bacteria 1070
347 Ga0207649_11415093 3300025920 Bacteria 550
348 Ga0207652_10226817 3300025921 Bacteria 1684
349 Ga0207652_10573323 3300025921 Bacteria 1013
350 Ga0207681_10000197 3300025923 Bacteria 48475
351 Ga0207681_10104132 3300025923 Bacteria 2052
352 Ga0207681_10226635 3300025923 Bacteria 1449
353 Ga0207681_10446773 3300025923 Bacteria 1051
354 Ga0207681_10788222 3300025923 Bacteria 793
355 Ga0207694_10054679 3300025924 Bacteria 3097
356 Ga0207694_10417758 3300025924 Bacteria 1117
357 Ga0207650_10001567 3300025925 Bacteria 16344
358 Ga0207650_10102411 3300025925 Bacteria 2206
359 Ga0207650_10181519 3300025925 Bacteria 1677
360 Ga0207659_10002689 3300025926 Bacteria 10592
361 Ga0207659_10035680 3300025926 Bacteria 3440
362 Ga0207659_10521695 3300025926 Bacteria 1007
363 Ga0207659_10830814 3300025926 Bacteria 794
364 Ga0207700_10528921 3300025928 Bacteria 1045
365 Ga0207664_10356883 3300025929 Bacteria 1294
366 Ga0207644_10005181 3300025931 Bacteria 8514
367 Ga0207644_10008230 3300025931 Bacteria 6831
368 Ga0207644_10261373 3300025931 Bacteria 1384
369 Ga0207690_10003585 3300025932 Bacteria 9247
370 Ga0207690_10063154 3300025932 Bacteria 2524
371 Ga0207690_10596524 3300025932 Bacteria 901
372 Ga0207690_11047541 3300025932 Bacteria 679
373 Ga0207690_11379996 3300025932 Bacteria 589
374 Ga0207706_10041209 3300025933 Bacteria 4094
375 Ga0207706_10079122 3300025933 Bacteria 2891
376 Ga0207706_10141807 3300025933 Bacteria 2114
377 Ga0207706_10178089 3300025933 Bacteria 1868
378 Ga0207686_10324797 3300025934 Bacteria 1151
379 Ga0207709_10000246 3300025935 Bacteria 66685
380 Ga0207670_10087907 3300025936 Bacteria 2190
381 Ga0207669_10190199 3300025937 Bacteria 1480
382 Ga0207669_10390138 3300025937 Bacteria 1087
383 Ga0207704_11679469 3300025938 Bacteria 546
384 Ga0207691_10036228 3300025940 Bacteria 4571
385 Ga0207691_10040894 3300025940 Bacteria 4282
386 Ga0207691_10201747 3300025940 Bacteria 1730
387 Ga0207711_10006762 3300025941 Bacteria 9642
388 Ga0207711_10023215 3300025941 Bacteria 5191
389 Ga0207711_10258467 3300025941 Bacteria 1600
390 Ga0207711_11042046 3300025941 Bacteria 758
391 Ga0207689_10983605 3300025942 Bacteria 712
392 Ga0207661_11104522 3300025944 Bacteria 730
393 Ga0207661_11515151 3300025944 Bacteria 614
394 Ga0207661_11593960 3300025944 Bacteria 597
395 Ga0207679_10001466 3300025945 Bacteria 14785
396 Ga0207679_10010673 3300025945 Bacteria 5922
397 Ga0207679_10082101 3300025945 Bacteria 2467
398 Ga0207679_10408309 3300025945 Bacteria 1196
399 Ga0207679_10410191 3300025945 Bacteria 1193
400 Ga0207679_10571387 3300025945 Bacteria 1016
401 Ga0207679_10978667 3300025945 Bacteria 775
402 Ga0207679_11063512 3300025945 Bacteria 742
403 Ga0207679_11467690 3300025945 Bacteria 626
404 Ga0207667_10000002 3300025949 Bacteria 895662
405 Ga0207667_10742685 3300025949 Bacteria 981
406 Ga0207651_10407069 3300025960 Bacteria 1158
407 Ga0207651_10764349 3300025960 Bacteria 855
408 Ga0207651_11202960 3300025960 Bacteria 680
409 Ga0207712_10000014 3300025961 Bacteria 375393
410 Ga0207668_10000402 3300025972 Bacteria 27270
411 Ga0207668_10066198 3300025972 Bacteria 2560
412 Ga0207668_10348910 3300025972 Bacteria 1237
413 Ga0207668_11637182 3300025972 Bacteria 581
414 Ga0207640_10002027 3300025981 Bacteria 10944
415 Ga0207640_10075290 3300025981 Bacteria 2287
416 Ga0207640_10461720 3300025981 Bacteria 1049
417 Ga0207640_10924496 3300025981 Bacteria 763
418 Ga0207658_10000428 3300025986 Bacteria 39861
419 Ga0207658_10364702 3300025986 Bacteria 1261
420 Ga0207677_10292498 3300026023 Bacteria 1342
421 Ga0207703_10002426 3300026035 Bacteria 16170
422 Ga0207703_10101770 3300026035 Bacteria 2436
423 Ga0207639_10003616 3300026041 Bacteria 10382
424 Ga0207639_10371981 3300026041 Bacteria 1281
425 Ga0207639_11075163 3300026041 Bacteria 754
426 Ga0207639_11347168 3300026041 Bacteria 670
427 Ga0207639_12146318 3300026041 Bacteria 520
428 Ga0207639_12242416 3300026041 Bacteria 507
429 Ga0207678_10004876 3300026067 Bacteria 12048
430 Ga0207678_10053905 3300026067 Bacteria 3464
431 Ga0207678_10224561 3300026067 Bacteria 1608
432 Ga0207678_10253198 3300026067 Bacteria 1508
433 Ga0207678_11674042 3300026067 Bacteria 559
434 Ga0207702_10050310 3300026078 Bacteria 3518
435 Ga0207702_10425095 3300026078 Bacteria 1285
436 Ga0207702_11087542 3300026078 Bacteria 793
437 Ga0207641_10000099 3300026088 Bacteria 122892
438 Ga0207641_11103809 3300026088 Bacteria 792
439 Ga0207641_11530673 3300026088 Bacteria 669
440 Ga0207648_10339403 3300026089 Bacteria 1353
441 Ga0207648_10432267 3300026089 Bacteria 1197
442 Ga0207676_10001345 3300026095 Bacteria 18261
443 Ga0207676_10214204 3300026095 Bacteria 1711
444 Ga0207676_10710927 3300026095 Bacteria 974
445 Ga0207676_11166737 3300026095 Bacteria 763
446 Ga0207676_11852928 3300026095 Bacteria 602
447 Ga0207674_10060601 3300026116 Bacteria 3826
448 Ga0207674_10219882 3300026116 Bacteria 1848
449 Ga0207674_10295063 3300026116 Bacteria 1570
450 Ga0207674_10397602 3300026116 Bacteria 1332
451 Ga0207675_100000157 3300026118 Bacteria 59865
452 Ga0207675_100006214 3300026118 Bacteria 11342
453 Ga0207675_101390482 3300026118 Bacteria 722
454 Ga0207675_102107866 3300026118 Bacteria 580
455 Ga0207683_10054331 3300026121 Bacteria 3512
456 Ga0207683_10092626 3300026121 Bacteria 2693
457 Ga0207683_10647030 3300026121 Bacteria 979
458 Ga0207683_11075667 3300026121 Bacteria 746
459 Ga0207683_12118535 3300026121 Bacteria 510
460 Ga0207698_10002491 3300026142 Bacteria 10925
461 Ga0207698_10177021 3300026142 Bacteria 1885
462 Ga0207698_10476228 3300026142 Bacteria 1210
463 Ga0207698_10829115 3300026142 Bacteria 929
464 Ga0207698_12055575 3300026142 Bacteria 585
465 Ga0209967_1018450 3300027364 Bacteria 1011
466 Ga0209967_1023094 3300027364 Bacteria 914
467 Ga0209984_1015877 3300027424 Bacteria 1003
468 Ga0210000_1086907 3300027462 Bacteria 515
469 Ga0209999_1039061 3300027543 Bacteria 888
470 Ga0209998_10071771 3300027717 Bacteria 828
471 Ga0209974_10165900 3300027876 Bacteria 803
472 Ga0268266_10000009 3300028379 Bacteria 1097737
473 Ga0268266_10022523 3300028379 Bacteria 5368
474 Ga0268266_10140961 3300028379 Bacteria 2163
475 Ga0268266_10396572 3300028379 Bacteria 1304
476 Ga0268265_10000047 3300028380 Bacteria 179354
477 Ga0268265_10000074 3300028380 Bacteria 127599
478 Ga0268264_10000023 3300028381 Bacteria 471408
479 Ga0268264_10000215 3300028381 Bacteria 113994
480 Ga0307408_100006443 3300031548 Bacteria 7780
481 Ga0307408_100199693 3300031548 Bacteria 1617
482 Ga0307408_100206209 3300031548 Bacteria 1594
483 Ga0307408_100225187 3300031548 Bacteria 1532
484 Ga0307408_100287569 3300031548 Bacteria 1371
485 Ga0307408_100342407 3300031548 Bacteria 1266
486 Ga0307408_100485545 3300031548 Bacteria 1078
487 Ga0307408_100553889 3300031548 Bacteria 1015
488 Ga0307408_100790692 3300031548 Bacteria 860
489 Ga0307408_100910882 3300031548 Bacteria 805
490 Ga0307408_102519534 3300031548 Bacteria 500
491 Ga0307405_10019698 3300031731 Bacteria 3754
492 Ga0307405_10059852 3300031731 Bacteria 2401
493 Ga0307405_10194476 3300031731 Bacteria 1467
494 Ga0307405_10207937 3300031731 Bacteria 1426
495 Ga0307405_10266437 3300031731 Bacteria 1282
496 Ga0307405_10272146 3300031731 Bacteria 1270
497 Ga0307405_10295455 3300031731 Bacteria 1226
498 Ga0307405_10375159 3300031731 Bacteria 1105
499 Ga0307405_10407978 3300031731 Bacteria 1065
500 Ga0307405_11027308 3300031731 Bacteria 705
501 Ga0307413_10008194 3300031824 Bacteria 4915
502 Ga0307413_10029315 3300031824 Bacteria 3077
503 Ga0307413_10070575 3300031824 Bacteria 2197
504 Ga0307413_10129469 3300031824 Bacteria 1724
505 Ga0307413_10140586 3300031824 Bacteria 1667
506 Ga0307413_10154999 3300031824 Bacteria 1601
507 Ga0307413_10272832 3300031824 Bacteria 1267
508 Ga0307413_10295163 3300031824 Bacteria 1226
509 Ga0307413_10297407 3300031824 Bacteria 1222
510 Ga0307413_10307518 3300031824 Bacteria 1205
511 Ga0307413_10386170 3300031824 Bacteria 1092
512 Ga0307413_10532399 3300031824 Bacteria 949
513 Ga0307413_10569105 3300031824 Bacteria 922
514 Ga0307413_10655336 3300031824 Bacteria 866
515 Ga0307413_10851390 3300031824 Bacteria 770
516 Ga0307413_10910711 3300031824 Bacteria 747
517 Ga0307413_11294230 3300031824 Bacteria 637
518 Ga0307413_12093706 3300031824 Bacteria 511
519 Ga0307410_10030817 3300031852 Bacteria 3432
520 Ga0307410_10043934 3300031852 Bacteria 2964
521 Ga0307410_10049247 3300031852 Bacteria 2827
522 Ga0307410_10059688 3300031852 Bacteria 2604
523 Ga0307410_10096687 3300031852 Bacteria 2108
524 Ga0307410_10112543 3300031852 Bacteria 1971
525 Ga0307410_10134883 3300031852 Bacteria 1818
526 Ga0307410_10206925 3300031852 Bacteria 1501
527 Ga0307410_10401523 3300031852 Bacteria 1107
528 Ga0307410_10443534 3300031852 Bacteria 1057
529 Ga0307410_10448809 3300031852 Bacteria 1051
530 Ga0307410_10462985 3300031852 Bacteria 1036
531 Ga0307410_10830753 3300031852 Bacteria 787
532 Ga0307410_12099412 3300031852 Bacteria 505
533 Ga0307406_10020638 3300031901 Bacteria 3883
534 Ga0307406_10061019 3300031901 Bacteria 2433
535 Ga0307406_10186863 3300031901 Bacteria 1513
536 Ga0307406_10251545 3300031901 Bacteria 1331
537 Ga0307406_10344780 3300031901 Bacteria 1161
538 Ga0307406_10352551 3300031901 Bacteria 1150
539 Ga0307406_10557983 3300031901 Bacteria 938
540 Ga0307406_10864871 3300031901 Bacteria 767
541 Ga0307406_10874259 3300031901 Bacteria 763
542 Ga0307406_11863970 3300031901 Bacteria 535
543 Ga0307406_12037098 3300031901 Bacteria 513
544 Ga0307407_10002227 3300031903 Bacteria 7491
545 Ga0307407_10060971 3300031903 Bacteria 2203
546 Ga0307407_10063358 3300031903 Bacteria 2168
547 Ga0307407_10086266 3300031903 Bacteria 1912
548 Ga0307407_10127566 3300031903 Bacteria 1622
549 Ga0307407_10263189 3300031903 Bacteria 1187
550 Ga0307407_10285829 3300031903 Bacteria 1144
551 Ga0307407_10328575 3300031903 Bacteria 1075
552 Ga0307407_10818762 3300031903 Bacteria 709
553 Ga0307407_11047507 3300031903 Bacteria 632
554 Ga0307407_11057895 3300031903 Bacteria 629
555 Ga0307412_10005349 3300031911 Bacteria 7203
556 Ga0307412_10063129 3300031911 Bacteria 2497
557 Ga0307412_10096207 3300031911 Bacteria 2083
558 Ga0307412_10148277 3300031911 Bacteria 1727
559 Ga0307412_10151533 3300031911 Bacteria 1711
560 Ga0307412_10192076 3300031911 Bacteria 1544
561 Ga0307412_10256539 3300031911 Bacteria 1360
562 Ga0307412_10344895 3300031911 Bacteria 1193
563 Ga0307412_10668682 3300031911 Bacteria 888
564 Ga0307412_10734973 3300031911 Bacteria 850
565 Ga0307412_10906005 3300031911 Bacteria 773
566 Ga0307412_11710472 3300031911 Bacteria 577
567 Ga0307409_100028799 3300031995 Bacteria 3964
568 Ga0307409_100048409 3300031995 Bacteria 3234
569 Ga0307409_100050697 3300031995 Bacteria 3171
570 Ga0307409_100052112 3300031995 Bacteria 3135
571 Ga0307409_100233479 3300031995 Bacteria 1669
572 Ga0307409_100277274 3300031995 Bacteria 1547
573 Ga0307409_100334980 3300031995 Bacteria 1421
574 Ga0307409_100380008 3300031995 Bacteria 1342
575 Ga0307409_100574346 3300031995 Bacteria 1110
576 Ga0307409_100734720 3300031995 Bacteria 990
577 Ga0307409_100738005 3300031995 Bacteria 987
578 Ga0307409_100805247 3300031995 Bacteria 947
579 Ga0307409_100847781 3300031995 Bacteria 924
580 Ga0307409_101847849 3300031995 Bacteria 633
581 Ga0307416_100007111 3300032002 Bacteria 7076
582 Ga0307416_100016950 3300032002 Bacteria 5081
583 Ga0307416_100108559 3300032002 Bacteria 2438
584 Ga0307416_100171661 3300032002 Bacteria 2020
585 Ga0307416_100205947 3300032002 Bacteria 1871
586 Ga0307416_100544887 3300032002 Bacteria 1232
587 Ga0307416_100761587 3300032002 Bacteria 1061
588 Ga0307416_100786304 3300032002 Bacteria 1046
589 Ga0307416_100930422 3300032002 Bacteria 970
590 Ga0307416_101967543 3300032002 Bacteria 687
591 Ga0307416_102165424 3300032002 Bacteria 657
592 Ga0307416_102285026 3300032002 Bacteria 641
593 Ga0307416_103150535 3300032002 Bacteria 552
594 Ga0307414_10013980 3300032004 Bacteria 4795
595 Ga0307414_10020158 3300032004 Bacteria 4150
596 Ga0307414_10024828 3300032004 Bacteria 3828
597 Ga0307414_10040497 3300032004 Bacteria 3147
598 Ga0307414_10096707 3300032004 Bacteria 2210
599 Ga0307414_10101494 3300032004 Bacteria 2166
600 Ga0307414_10151662 3300032004 Bacteria 1829
601 Ga0307414_10189348 3300032004 Bacteria 1663
602 Ga0307414_10568803 3300032004 Bacteria 1012
603 Ga0307414_10635994 3300032004 Bacteria 960
604 Ga0307414_10693567 3300032004 Bacteria 921
605 Ga0307414_10821854 3300032004 Bacteria 848
606 Ga0307414_11054577 3300032004 Bacteria 749
607 Ga0307414_11285888 3300032004 Bacteria 678
608 Ga0307414_11355946 3300032004 Bacteria 660
609 Ga0307414_11780676 3300032004 Bacteria 575
610 Ga0307414_11956290 3300032004 Bacteria 547
611 Ga0307411_10004327 3300032005 Bacteria 6777
612 Ga0307411_10039443 3300032005 Bacteria 2987
613 Ga0307411_10046354 3300032005 Bacteria 2801
614 Ga0307411_10207985 3300032005 Bacteria 1508
615 Ga0307411_10211902 3300032005 Bacteria 1496
616 Ga0307411_10308714 3300032005 Bacteria 1272
617 Ga0307411_10311147 3300032005 Bacteria 1267
618 Ga0307411_10316985 3300032005 Bacteria 1257
619 Ga0307411_10413567 3300032005 Bacteria 1118
620 Ga0307411_10602835 3300032005 Bacteria 944
621 Ga0307411_10672801 3300032005 Bacteria 898
622 Ga0307411_10789134 3300032005 Bacteria 835
623 Ga0307411_10805665 3300032005 Bacteria 827
624 Ga0307411_11099298 3300032005 Bacteria 716
625 Ga0307411_11406574 3300032005 Bacteria 638
626 Ga0307411_11474747 3300032005 Bacteria 624
627 Ga0307411_11484809 3300032005 Bacteria 622
628 Ga0307411_11897157 3300032005 Bacteria 554
629 Ga0307411_11981529 3300032005 Bacteria 543
630 Ga0307411_12002180 3300032005 Bacteria 541
631 Ga0307411_12026548 3300032005 Bacteria 537
632 Ga0307411_12135839 3300032005 Bacteria 524
633 Ga0307415_100006247 3300032126 Bacteria 6400
634 Ga0307415_100083964 3300032126 Bacteria 2283
635 Ga0307415_100084799 3300032126 Bacteria 2274
636 Ga0307415_100276281 3300032126 Bacteria 1379
637 Ga0307415_100335060 3300032126 Bacteria 1267
638 Ga0307415_100357100 3300032126 Bacteria 1232
639 Ga0307415_100359095 3300032126 Bacteria 1229
640 Ga0307415_100577513 3300032126 Bacteria 996
641 Ga0307415_100647899 3300032126 Bacteria 946
642 Ga0307415_100857668 3300032126 Bacteria 834
643 Ga0307415_100862787 3300032126 Bacteria 831
644 Ga0307415_101190348 3300032126 Bacteria 717
645 Ga0307415_101958698 3300032126 Bacteria 570
646 Ga0307415_102141503 3300032126 Bacteria 546
647 Ga0373941_0300741 3300035115 Bacteria 640
648 Ga0395899_0000406 3300037312 Bacteria 50248
649 Ga0395899_0191462 3300037312 Bacteria 1431
650 Ga0395899_0220425 3300037312 Bacteria 1314
651 Ga0395900_0021924 3300037418 Bacteria 6531
652 Ga0395900_0043394 3300037418 Bacteria 4635
653 Ga0395900_0120641 3300037418 Bacteria 2690
654 Ga0395900_0595623 3300037418 Bacteria 1046
655 Ga0395900_0600356 3300037418 Bacteria 1041
656 Ga0395900_0747509 3300037418 Bacteria 908
657 Ga0395898_0250288 3300037466 Bacteria 1690
658 Ga0395898_0273138 3300037466 Bacteria 1612
659 Ga0395898_0358176 3300037466 Bacteria 1391
660 Ga0395898_0521882 3300037466 Bacteria 1129
661 Ga0395898_0742267 3300037466 Bacteria 923
662 Ga0395905_0001805 3300037471 Bacteria 24778
663 Ga0395905_0007986 3300037471 Bacteria 10455
664 Ga0395905_0022623 3300037471 Bacteria 5942
665 Ga0395905_0821624 3300037471 Bacteria 832
666 Ga0436364_1065372 3300037853 Bacteria 196587
667 Ga0436364_1491317 3300037853 Bacteria 574
668 Ga0395901_0012081 3300038443 Bacteria 8760
669 Ga0395901_0062202 3300038443 Bacteria 3885
670 Ga0395901_0278245 3300038443 Bacteria 1739
671 Ga0395901_0431323 3300038443 Bacteria 1350
672 Ga0395901_0564338 3300038443 Bacteria 1152
673 Ga0395901_1667373 3300038443 Bacteria 589
674 Ga0436365_0298268 3300039437 Bacteria 2267
675 Ga0439439_0128420 3300041406 Bacteria 711
676 Ga0439466_0079543 3300041411 Bacteria 1035
677 Ga0439465_0015647 3300041413 Bacteria 2366
678 Ga0451789_0478013 3300041443 Bacteria 850
679 Ga0451794_37204 3300041446 Bacteria 583
680 Ga0451797_1289161 3300041453 Bacteria 956
681 Ga0451802_0774086 3300041460 Bacteria 3431
682 Ga0451806_236297 3300041462 Bacteria 2200
683 Ga0451804_0241769 3300041463 Bacteria 610
684 Ga0451807_0895683 3300041486 Bacteria 2177
685 Ga0451837_1607676 3300041494 Bacteria 544
686 Ga0451839_0681194 3300041496 Bacteria 719
687 Ga0451845_0925973 3300041501 Bacteria 559
688 Ga0451843_1160977 3300041509 Bacteria 530
689 Ga0439433_0067820 3300041999 Bacteria 857
690 Ga0439445_0225339 3300042004 Bacteria 557
691 Ga0439432_055513 3300042006 Bacteria 1229
692 Ga0439449_0067357 3300042007 Bacteria 1320
693 Ga0439449_0101276 3300042007 Bacteria 1065
694 Ga0439452_044323 3300042010 Bacteria 1038
695 Ga0439452_078916 3300042010 Bacteria 719
696 Ga0439455_0005591 3300042012 Bacteria 2559
697 Ga0439462_0208767 3300042015 Bacteria 557
698 Ga0450912_010825 3300042116 Bacteria 786
699 Ga0450894_081837 3300042131 Bacteria 504
700 Ga0439458_0212146 3300042157 Bacteria 532
701 Ga0439434_0145500 3300042435 Bacteria 783
702 Ga0451577_0768435 3300042876 Bacteria 871
703 Ga0451577_1420766 3300042876 Bacteria 615
704 Ga0453684_0507510 3300044712 Bacteria 1334
705 Ga0466968_0326633 3300044735 Bacteria 742
706 Ga0466970_0066546 3300044765 Bacteria 1934
707 Ga0466957_0951414 3300044842 Bacteria 615
708 Ga0451576_2038486 3300045051 Bacteria 591
709 Ga0466958_0538395 3300045836 Bacteria 758
710 Ga0466967_1276514 3300045976 Bacteria 731
711 Ga0495584_0059740 3300046491 Bacteria 1917
712 Ga0495584_0642604 3300046491 Bacteria 541
713 Ga0495585_0207909 3300046492 Bacteria 993
714 Ga0495583_0195098 3300046506 Bacteria 825
715 Ga0495620_0214338 3300046515 Bacteria 738
716 Ga0495631_0119026 3300046518 Bacteria 1136
717 Ga0495643_0514717 3300046522 Bacteria 513
718 Ga0495663_0007544 3300046525 Bacteria 3009
719 Ga0495663_0175157 3300046525 Bacteria 741
720 Ga0495663_0395046 3300046525 Bacteria 508
721 Ga0495642_0044719 3300046528 Bacteria 1808
722 Ga0495642_0313201 3300046528 Bacteria 688
723 Ga0495654_0240736 3300046530 Bacteria 757
724 Ga0495598_0001038 3300046537 Bacteria 5332
725 Ga0495621_0036568 3300046539 Bacteria 1704
726 Ga0495622_0039363 3300046557 Bacteria 2202
727 Ga0495633_0001763 3300046558 Bacteria 16049
728 Ga0495633_0243849 3300046558 Bacteria 820
729 Ga0495656_0098455 3300046615 Bacteria 1349
730 Ga0495668_0270987 3300046616 Bacteria 930
731 Ga0495625_0267913 3300046660 Bacteria 1103
732 Ga0495669_0010966 3300046684 Bacteria 3837
733 Ga0495669_0034570 3300046684 Bacteria 2228
734 Ga0495669_0268506 3300046684 Bacteria 820
735 Ga0495669_0278529 3300046684 Bacteria 804
736 Ga0495670_0000015 3300046691 Bacteria 131137
737 Ga0495670_0049768 3300046691 Bacteria 2097
738 Ga0495670_0091225 3300046691 Bacteria 1559
739 Ga0495670_0147119 3300046691 Bacteria 1234
740 Ga0495670_0560598 3300046691 Bacteria 622
741 Ga0495671_0008086 3300046692 Bacteria 5938
742 Ga0495672_0431330 3300047320 Bacteria 598
743 Ga0495687_207677 3300047443 Bacteria 616
744 Ga0495677_0014214 3300047445 Bacteria 2899
745 Ga0495677_0105204 3300047445 Bacteria 1070
746 Ga0495677_0117747 3300047445 Bacteria 1012
747 Ga0495686_0000486 3300047472 Bacteria 58640
748 Ga0495686_0007665 3300047472 Bacteria 8057
749 Ga0495686_0158108 3300047472 Bacteria 1326
750 Ga0495686_0386994 3300047472 Bacteria 753
751 Ga0495615_0313283 3300048090 Bacteria 511
752 Ga0496100_0764831 3300048903 Bacteria 756
753 Ga0496102_0022640 3300048905 Bacteria 5568
754 Ga0496102_0194172 3300048905 Bacteria 1913
755 Ga0496102_1513698 3300048905 Bacteria 589
756 Ga0496103_0001458 3300048906 Bacteria 15842
757 Ga0496103_0215571 3300048906 Bacteria 1234
758 Ga0496103_0383193 3300048906 Bacteria 903
759 Ga0496104_0695513 3300048907 Bacteria 925
760 Ga0496105_0118457 3300048908 Bacteria 2184
761 Ga0496105_0250296 3300048908 Bacteria 1436
762 Ga0496105_0550267 3300048908 Bacteria 901
763 Ga0496108_0359849 3300048911 Bacteria 1270
764 Ga0496109_0445967 3300048912 Bacteria 1222
765 Ga0496109_0907800 3300048912 Bacteria 819
766 Ga0496109_1075906 3300048912 Bacteria 741
767 Ga0496109_1296408 3300048912 Bacteria 664
768 Ga0496109_1526623 3300048912 Bacteria 603
769 Ga0496110_0453040 3300048913 Bacteria 1169
770 Ga0496110_0987985 3300048913 Bacteria 749
771 Ga0496111_0129963 3300048914 Bacteria 1863
772 Ga0496111_0599572 3300048914 Bacteria 806
773 Ga0496111_0672456 3300048914 Bacteria 754
774 Ga0496114_0966010 3300048917 Bacteria 735
775 Ga0496117_0005438 3300048920 Bacteria 13377
776 Ga0496118_0004152 3300048921 Bacteria 17499
777 Ga0496118_0027308 3300048921 Bacteria 4835
778 Ga0496119_0096043 3300048922 Bacteria 1673
779 Ga0496120_0260064 3300048923 Bacteria 811
780 Ga0496122_0001531 3300048925 Bacteria 36790
781 Ga0496123_0021568 3300048926 Bacteria 5001
782 Ga0496124_0109237 3300048927 Bacteria 2229
783 Ga0496124_0231018 3300048927 Bacteria 1383
784 Ga0501306_006319 3300049127 Bacteria 1386
785 Ga0501306_031216 3300049127 Bacteria 792
786 Ga0501306_041409 3300049127 Bacteria 716
787 Ga0501306_060438 3300049127 Bacteria 623
788 Ga0501308_006500 3300049128 Bacteria 1200
789 Ga0501308_036283 3300049128 Bacteria 680
790 Ga0501309_008114 3300049129 Bacteria 1316
791 Ga0501309_014992 3300049129 Bacteria 1045
792 Ga0501310_001218 3300049130 Bacteria 2307
793 Ga0501310_003306 3300049130 Bacteria 1573
794 Ga0501310_028079 3300049130 Bacteria 736
795 Ga0501304_016532 3300049160 Bacteria 699
796 Ga0501304_034151 3300049160 Bacteria 550
797 Ga0501305_013093 3300049161 Bacteria 1142
798 Ga0501305_028003 3300049161 Bacteria 866
799 Ga0501305_111502 3300049161 Bacteria 518
800 Ga0501305_111658 3300049161 Bacteria 518
801 Ga0501307_009615 3300049162 Bacteria 1108
802 Ga0501307_015926 3300049162 Bacteria 933
803 Ga0501307_023755 3300049162 Bacteria 814
804 Ga0501307_026073 3300049162 Bacteria 788
805 Ga0501307_096024 3300049162 Bacteria 500
806 Ga0501292_028292 3300049515 Bacteria 933
807 Ga0501311_021033 3300049527 Bacteria 887
808 Ga0501311_025146 3300049527 Bacteria 833
809 Ga0501312_029704 3300049528 Bacteria 852
810 Ga0501312_066811 3300049528 Bacteria 631
811 Ga0501313_029182 3300049529 Bacteria 710
812 Ga0501315_037732 3300049531 Bacteria 721
813 Ga0501315_049783 3300049531 Bacteria 656
814 Ga0501316_020777 3300049532 Bacteria 826
815 Ga0501316_021899 3300049532 Bacteria 811
816 Ga0501317_014767 3300049533 Bacteria 994
817 Ga0501317_025845 3300049533 Bacteria 825
818 Ga0501320_006472 3300049536 Bacteria 1099
819 Ga0501320_048744 3300049536 Bacteria 572
820 Ga0501321_078425 3300049537 Bacteria 523
821 Ga0501322_004865 3300049538 Bacteria 916
822 Ga0501323_025314 3300049539 Bacteria 807
823 Ga0501323_076951 3300049539 Bacteria 541
824 Ga0501324_008845 3300049540 Bacteria 894
825 Ga0501325_025102 3300049541 Bacteria 652
826 Ga0501333_009111 3300049549 Bacteria 693
827 Ga0501334_23126 3300049550 Bacteria 507
828 Ga0501335_044513 3300049551 Bacteria 530
829 Ga0501340_011323 3300049556 Bacteria 663
830 Ga0501032_0502502 3300049569 Bacteria 775
831 Ga0501032_0710334 3300049569 Bacteria 637
832 Ga0501034_0190380 3300049571 Bacteria 2014
833 Ga0501036_1168557 3300049572 Bacteria 628
834 Ga0501038_1245342 3300049574 Bacteria 539
835 Ga0501039_0140668 3300049575 Bacteria 1896
836 Ga0501071_0586635 3300049587 Bacteria 857
837 Ga0501075_0816081 3300049591 Bacteria 710
838 Ga0501202_126721 3300049652 Bacteria 647
839 Ga0501209_253846 3300049656 Bacteria 550
840 Ga0501214_034943 3300049659 Bacteria 706
841 Ga0501217_044278 3300049661 Bacteria 1143
842 Ga0501224_066310 3300049664 Bacteria 568
843 Ga0501235_046846 3300049669 Bacteria 996
844 Ga0501249_178118 3300049679 Bacteria 548
845 Ga0501253_026120 3300049683 Bacteria 1074
846 Ga0501259_203007 3300049688 Bacteria 509
847 Ga0501221_086156 3300049704 Bacteria 762
848 Ga0501225_0090544 3300049705 Bacteria 886
849 Ga0501245_037372 3300049708 Bacteria 824
850 Ga0501079_1508672 3300049741 Bacteria 529
851 Ga0501266_010321 3300049763 Bacteria 1188
852 Ga0501268_004965 3300049765 Bacteria 1893
853 Ga0501270_154734 3300049767 Bacteria 525
854 Ga0501271_013331 3300049768 Bacteria 900
855 Ga0501271_058606 3300049768 Bacteria 536
856 Ga0501272_048841 3300049769 Bacteria 583
857 Ga0501279_104482 3300049775 Bacteria 514
858 Ga0501035_0767010 3300049822 Bacteria 773
859 Ga0501044_0227503 3300049823 Bacteria 1814
860 Ga0501045_0695140 3300049824 Bacteria 751
861 nmdc:mga0k408_324758_c1 3300050493 Bacteria 918
862 Ga0500643_077119 3300053087 Bacteria 919
863 Ga0500646_0059765 3300053090 Bacteria 1119
864 Ga0500647_0181633 3300053091 Bacteria 965
865 Ga0500641_0003980 3300053096 Bacteria 5223
866 Ga0500594_0005507 3300053118 Bacteria 2809
867 Ga0500658_0113824 3300053134 Bacteria 1193
868 Ga0500559_0049464 3300053136 Bacteria 1852
869 Ga0500559_0100471 3300053136 Bacteria 1332
870 Ga0500577_0253966 3300053142 Bacteria 764
871 Ga0500636_0039359 3300053177 Bacteria 2796
872 Ga0500596_003226 3300053735 Bacteria 3130
873 Ga0587084_000368 3300059477 Bacteria 3388
874 Ga0587084_011725 3300059477 Bacteria 1174
875 Ga0587093_018465 3300059478 Bacteria 909
876 Ga0587066_001465 3300059490 Bacteria 2373
877 Ga0587070_042355 3300059491 Bacteria 877
878 Ga0587077_001167 3300059493 Bacteria 2718
879 Ga0587077_069562 3300059493 Bacteria 783
880 Ga0587080_014969 3300059503 Bacteria 1206
881 Ga0587080_031497 3300059503 Bacteria 926
882 Ga0587080_081322 3300059503 Bacteria 665
883 Ga0587082_008501 3300059504 Bacteria 1433
884 Ga0587083_0037171 3300059505 Bacteria 1001
885 Ga0587085_007179 3300059506 Bacteria 1381
886 Ga0587086_006030 3300059507 Bacteria 1336
887 Ga0587088_007942 3300059508 Bacteria 1485
888 Ga0587088_048881 3300059508 Bacteria 822
889 Ga0587088_211511 3300059508 Bacteria 500
890 Ga0587089_006060 3300059509 Bacteria 1394
891 Ga0587090_001175 3300059510 Bacteria 2574
892 Ga0587090_028878 3300059510 Bacteria 916
893 Ga0587090_118078 3300059510 Bacteria 573
894 Ga0587091_000254 3300059511 Bacteria 3983
895 Ga0587092_007157 3300059512 Bacteria 1436
896 Ga0587092_012652 3300059512 Bacteria 1194
897 Ga0587094_000504 3300059513 Bacteria 3090
898 Ga0587098_006412 3300059604 Bacteria 1192
899 Ga0587106_011511 3300059605 Bacteria 1168
900 Ga0587121_04918 3300059606 Bacteria 762
901 Ga0587129_003262 3300059608 Bacteria 1014
902 Ga0587099_003045 3300059622 Bacteria 1366
903 Ga0587101_000706 3300059623 Bacteria 2535
904 Ga0587117_010629 3300059627 Bacteria 1127
905 Ga0587128_000194 3300059630 Bacteria 3676
906 Ga0587062_138535 3300059639 Bacteria 506
907 Ga0587068_000363 3300059641 Bacteria 3920
908 Ga0587069_009859 3300059642 Bacteria 1242
909 Ga0587072_158655 3300059643 Bacteria 551
910 Ga0587075_079900 3300059644 Bacteria 622
911 Ga0587076_014253 3300059645 Bacteria 1221
912 Ga0587076_023390 3300059645 Bacteria 1040
913 Ga0587076_060180 3300059645 Bacteria 764
914 Ga0587078_000705 3300059646 Bacteria 2686
915 Ga0587078_013100 3300059646 Bacteria 979
916 Ga0587079_008963 3300059647 Bacteria 1545
917 Ga0587100_000732 3300059648 Bacteria 1701
918 Ga0587102_000570 3300059649 Bacteria 2182
919 Ga0587104_003534 3300059650 Bacteria 962
920 Ga0587105_000848 3300059651 Bacteria 1428
921 Ga0587107_000546 3300059652 Bacteria 2535
922 Ga0587110_050021 3300059654 Bacteria 557
923 Ga0587114_008517 3300059655 Bacteria 1208
924 Ga0587118_01767 3300059657 Bacteria 1348
925 Ga0587119_000105 3300059658 Bacteria 3906
926 Ga0587120_005626 3300059659 Bacteria 967
927 Ga0587124_007519 3300059660 Bacteria 918
928 Ga0587124_037851 3300059660 Bacteria 554
929 Ga0587096_00847 3300060247 Bacteria 934
930 Ga0587071_000753 3300060344 Bacteria 3553
931 Ga0587111_0032114 3300060346 Bacteria 1078
932 Ga0587111_0112702 3300060346 Bacteria 691
933 Ga0587111_0153669 3300060346 Bacteria 620

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041411 Ga0439466_0079543 Ga0439466_0079543_747_1025 89
2 3300041446 Ga0451794_37204 Ga0451794_37204_226_498 89
3 3300047320 Ga0495672_0431330 Ga0495672_0431330_13_282 89
4 3300045836 Ga0466958_0538395 Ga0466958_0538395_15_305 96
5 iso_pu_bacteria 8057101203 8057102137 98
6 iso_pu_bacteria 2885429604 2885431646 100
7 3300005355 Ga0070671_100258242 Ga0070671_1002582422 101
8 3300009177 Ga0105248_10316717 Ga0105248_103167172 101
9 3300009978 Ga0105148_117490 Ga0105148_1174902 101
10 3300025941 Ga0207711_10258467 Ga0207711_102584672 101
11 3300026121 Ga0207683_11075667 Ga0207683_110756671 101
12 3300048921 Ga0496118_0027308 Ga0496118_0027308_96_407 101
13 3300003791 Ga0055530_10015010 Ga0055530_100150105 102
14 3300003794 Ga0055531_10032620 Ga0055531_100326202 102
15 3300003794 Ga0055531_10100522 Ga0055531_101005222 102
16 3300025298 Ga0209050_1021913 Ga0209050_10219133 102
17 3300025304 Ga0209257_1000577 Ga0209257_100057778 102
18 3300025304 Ga0209257_1000597 Ga0209257_100059778 102
19 3300025304 Ga0209257_1006247 Ga0209257_10062478 102
20 3300026041 Ga0207639_11347168 Ga0207639_113471682 102
21 3300027717 Ga0209998_10071771 Ga0209998_100717712 102
22 3300031824 Ga0307413_10307518 Ga0307413_103075182 102
23 3300031911 Ga0307412_11710472 Ga0307412_117104722 102
24 3300032126 Ga0307415_101958698 Ga0307415_1019586982 102
25 3300041443 Ga0451789_0478013 Ga0451789_0478013_122_436 102
26 3300041509 Ga0451843_1160977 Ga0451843_1160977_77_391 102
27 3300042876 Ga0451577_1420766 Ga0451577_1420766_180_488 102
28 3300044735 Ga0466968_0326633 Ga0466968_0326633_11_325 102
29 3300046491 Ga0495584_0642604 Ga0495584_0642604_116_430 102
30 3300046691 Ga0495670_0000015 Ga0495670_0000015_106875_107189 102
31 3300049569 Ga0501032_0502502 Ga0501032_0502502_213_530 102
32 3300049823 Ga0501044_0227503 Ga0501044_0227503_48_362 102
33 3300050493 nmdc:mga0k408_324758_c1 nmdc:mga0k408_324758_c1_34_348 102
34 3300053087 Ga0500643_077119 Ga0500643_077119_288_608 102
35 3300053090 Ga0500646_0059765 Ga0500646_0059765_455_769 102
36 3300053096 Ga0500641_0003980 Ga0500641_0003980_3307_3621 102
37 3300053136 Ga0500559_0049464 Ga0500559_0049464_1142_1456 102
38 3300059477 Ga0587084_011725 Ga0587084_011725_444_761 102
39 3300059491 Ga0587070_042355 Ga0587070_042355_455_775 102
40 3300059493 Ga0587077_069562 Ga0587077_069562_158_472 102
41 3300059503 Ga0587080_081322 Ga0587080_081322_200_520 102
42 3300059510 Ga0587090_028878 Ga0587090_028878_522_836 102
43 3300059639 Ga0587062_138535 Ga0587062_138535_31_348 102
44 3300059643 Ga0587072_158655 Ga0587072_158655_26_346 102
45 3300059645 Ga0587076_023390 Ga0587076_023390_616_936 102
46 3300059646 Ga0587078_013100 Ga0587078_013100_412_726 102
47 3300059654 Ga0587110_050021 Ga0587110_050021_143_460 102
48 3300059660 Ga0587124_037851 Ga0587124_037851_209_529 102
49 3300060346 Ga0587111_0153669 Ga0587111_0153669_166_486 102
50 3300001915 JGI24741J21665_1001920 JGI24741J21665_10019204 103
51 3300001978 JGI24747J21853_1005899 JGI24747J21853_10058992 103
52 3300001979 JGI24740J21852_10015856 JGI24740J21852_100158562 103
53 3300001990 JGI24737J22298_10043760 JGI24737J22298_100437603 103
54 3300002155 JGI24033J26618_1044558 JGI24033J26618_10445582 103
55 3300002244 JGI24742J22300_10001588 JGI24742J22300_100015884 103
56 3300003215 JGI25153J46596_10000173 JGI25153J46596_100001732 103
57 3300003693 Ga0032354_1119435 Ga0032354_11194352 103
58 3300003759 Ga0055525_1000012 Ga0055525_1000012148 103
59 3300003762 Ga0055542_1001518 Ga0055542_10015186 103
60 3300003763 Ga0055529_1000014 Ga0055529_1000014267 103
61 3300005290 Ga0065712_10213194 Ga0065712_102131941 103
62 3300005290 Ga0065712_10339614 Ga0065712_103396142 103
63 3300005293 Ga0065715_10051509 Ga0065715_100515092 103
64 3300005293 Ga0065715_10565818 Ga0065715_105658181 103
65 3300005327 Ga0070658_10034849 Ga0070658_100348495 103
66 3300005327 Ga0070658_11019730 Ga0070658_110197302 103
67 3300005328 Ga0070676_10033009 Ga0070676_100330095 103
68 3300005328 Ga0070676_10585954 Ga0070676_105859541 103
69 3300005329 Ga0070683_100438274 Ga0070683_1004382742 103
70 3300005331 Ga0070670_100161717 Ga0070670_1001617173 103
71 3300005331 Ga0070670_100436289 Ga0070670_1004362891 103
72 3300005333 Ga0070677_10062061 Ga0070677_100620612 103
73 3300005333 Ga0070677_10074850 Ga0070677_100748501 103
74 3300005334 Ga0068869_101112408 Ga0068869_1011124082 103
75 3300005337 Ga0070682_101020532 Ga0070682_1010205322 103
76 3300005338 Ga0068868_100049745 Ga0068868_1000497454 103
77 3300005339 Ga0070660_100682995 Ga0070660_1006829952 103
78 3300005344 Ga0070661_100122997 Ga0070661_1001229973 103
79 3300005344 Ga0070661_100763169 Ga0070661_1007631691 103
80 3300005344 Ga0070661_101222862 Ga0070661_1012228621 103
81 3300005347 Ga0070668_100773108 Ga0070668_1007731082 103
82 3300005353 Ga0070669_100200612 Ga0070669_1002006122 103
83 3300005353 Ga0070669_100485009 Ga0070669_1004850092 103
84 3300005353 Ga0070669_101061793 Ga0070669_1010617931 103
85 3300005353 Ga0070669_101128734 Ga0070669_1011287342 103
86 3300005354 Ga0070675_100775834 Ga0070675_1007758342 103
87 3300005355 Ga0070671_100203448 Ga0070671_1002034482 103
88 3300005355 Ga0070671_100402823 Ga0070671_1004028231 103
89 3300005364 Ga0070673_100127669 Ga0070673_1001276693 103
90 3300005366 Ga0070659_100033177 Ga0070659_1000331774 103
91 3300005366 Ga0070659_100278332 Ga0070659_1002783321 103
92 3300005366 Ga0070659_101135244 Ga0070659_1011352441 103
93 3300005441 Ga0070700_101543717 Ga0070700_1015437171 103
94 3300005456 Ga0070678_100017885 Ga0070678_1000178854 103
95 3300005457 Ga0070662_100483155 Ga0070662_1004831551 103
96 3300005459 Ga0068867_100321187 Ga0068867_1003211872 103
97 3300005535 Ga0070684_100653704 Ga0070684_1006537042 103
98 3300005539 Ga0068853_100151532 Ga0068853_1001515324 103
99 3300005539 Ga0068853_102312984 Ga0068853_1023129842 103
100 3300005548 Ga0070665_100280359 Ga0070665_1002803592 103
101 3300005563 Ga0068855_100616645 Ga0068855_1006166452 103
102 3300005564 Ga0070664_100216063 Ga0070664_1002160632 103
103 3300005564 Ga0070664_100749325 Ga0070664_1007493252 103
104 3300005564 Ga0070664_101327312 Ga0070664_1013273122 103
105 3300005577 Ga0068857_100686033 Ga0068857_1006860332 103
106 3300005578 Ga0068854_100063035 Ga0068854_1000630353 103
107 3300005578 Ga0068854_100217907 Ga0068854_1002179072 103
108 3300005614 Ga0068856_102249078 Ga0068856_1022490781 103
109 3300005617 Ga0068859_100001416 Ga0068859_1000014167 103
110 3300005617 Ga0068859_101860805 Ga0068859_1018608052 103
111 3300005719 Ga0068861_100000040 Ga0068861_10000004019 103
112 3300005834 Ga0068851_10423600 Ga0068851_104236002 103
113 3300005840 Ga0068870_10272613 Ga0068870_102726132 103
114 3300006178 Ga0075367_10454611 Ga0075367_104546112 103
115 3300006237 Ga0097621_100066302 Ga0097621_1000663024 103
116 3300006353 Ga0075370_10388167 Ga0075370_103881672 103
117 3300006358 Ga0068871_100064899 Ga0068871_1000648995 103
118 3300006881 Ga0068865_100650878 Ga0068865_1006508782 103
119 3300006931 Ga0097620_100001416 Ga0097620_10000141635 103
120 3300006931 Ga0097620_101860871 Ga0097620_1018608712 103
121 3300009098 Ga0105245_12705906 Ga0105245_127059062 103
122 3300009148 Ga0105243_10003106 Ga0105243_1000310624 103
123 3300009148 Ga0105243_10737663 Ga0105243_107376632 103
124 3300009174 Ga0105241_12401405 Ga0105241_124014052 103
125 3300009177 Ga0105248_11013124 Ga0105248_110131242 103
126 3300009545 Ga0105237_12029783 Ga0105237_120297832 103
127 3300010375 Ga0105239_10090567 Ga0105239_100905672 103
128 3300012475 Ga0157317_1000418 Ga0157317_10004182 103
129 3300012512 Ga0157327_1023822 Ga0157327_10238221 103
130 3300013100 Ga0157373_10501180 Ga0157373_105011802 103
131 3300013102 Ga0157371_10000059 Ga0157371_100000595 103
132 3300013105 Ga0157369_10552266 Ga0157369_105522662 103
133 3300013296 Ga0157374_10104316 Ga0157374_101043162 103
134 3300013297 Ga0157378_10273729 Ga0157378_102737293 103
135 3300013306 Ga0163162_11697639 Ga0163162_116976392 103
136 3300013307 Ga0157372_10774507 Ga0157372_107745072 103
137 3300014326 Ga0157380_10116019 Ga0157380_101160193 103
138 3300014326 Ga0157380_11993450 Ga0157380_119934502 103
139 3300017792 Ga0163161_10441763 Ga0163161_104417632 103
140 3300020069 Ga0197907_10820967 Ga0197907_108209672 103
141 3300020076 Ga0206355_1017096 Ga0206355_10170962 103
142 3300021384 Ga0213876_10166713 Ga0213876_101667132 103
143 3300021388 Ga0213875_10001626 Ga0213875_100016265 103
144 3300025226 Ga0209674_102700 Ga0209674_1027002 103
145 3300025230 Ga0209563_100030 Ga0209563_100030300 103
146 3300025254 Ga0209148_1000011 Ga0209148_1000011271 103
147 3300025272 Ga0209455_1000006 Ga0209455_1000006923 103
148 3300025297 Ga0209758_1000001 Ga0209758_1000001627 103
149 3300025315 Ga0207697_10101229 Ga0207697_101012292 103
150 3300025315 Ga0207697_10161798 Ga0207697_101617982 103
151 3300025315 Ga0207697_10172294 Ga0207697_101722942 103
152 3300025321 Ga0207656_10002150 Ga0207656_100021502 103
153 3300025893 Ga0207682_10073759 Ga0207682_100737593 103
154 3300025893 Ga0207682_10092570 Ga0207682_100925702 103
155 3300025907 Ga0207645_10026399 Ga0207645_100263993 103
156 3300025907 Ga0207645_10174952 Ga0207645_101749522 103
157 3300025907 Ga0207645_10728755 Ga0207645_107287552 103
158 3300025908 Ga0207643_10178103 Ga0207643_101781032 103
159 3300025908 Ga0207643_10411592 Ga0207643_104115921 103
160 3300025909 Ga0207705_10000511 Ga0207705_1000051119 103
161 3300025913 Ga0207695_10003496 Ga0207695_1000349626 103
162 3300025914 Ga0207671_10004021 Ga0207671_1000402114 103
163 3300025918 Ga0207662_10431934 Ga0207662_104319342 103
164 3300025919 Ga0207657_10061226 Ga0207657_100612262 103
165 3300025920 Ga0207649_10366653 Ga0207649_103666532 103
166 3300025923 Ga0207681_10446773 Ga0207681_104467732 103
167 3300025923 Ga0207681_10788222 Ga0207681_107882222 103
168 3300025924 Ga0207694_10054679 Ga0207694_100546796 103
169 3300025926 Ga0207659_10035680 Ga0207659_100356808 103
170 3300025926 Ga0207659_10830814 Ga0207659_108308142 103
171 3300025932 Ga0207690_10003585 Ga0207690_1000358514 103
172 3300025932 Ga0207690_10596524 Ga0207690_105965242 103
173 3300025932 Ga0207690_11379996 Ga0207690_113799962 103
174 3300025933 Ga0207706_10141807 Ga0207706_101418072 103
175 3300025933 Ga0207706_10178089 Ga0207706_101780893 103
176 3300025934 Ga0207686_10324797 Ga0207686_103247972 103
177 3300025935 Ga0207709_10000246 Ga0207709_1000024668 103
178 3300025940 Ga0207691_10040894 Ga0207691_100408944 103
179 3300025941 Ga0207711_10023215 Ga0207711_100232152 103
180 3300025942 Ga0207689_10983605 Ga0207689_109836052 103
181 3300025944 Ga0207661_11104522 Ga0207661_111045222 103
182 3300025945 Ga0207679_10082101 Ga0207679_100821015 103
183 3300025945 Ga0207679_10410191 Ga0207679_104101912 103
184 3300025945 Ga0207679_11063512 Ga0207679_110635121 103
185 3300025949 Ga0207667_10000002 Ga0207667_10000002153 103
186 3300025960 Ga0207651_10407069 Ga0207651_104070693 103
187 3300025960 Ga0207651_11202960 Ga0207651_112029602 103
188 3300025972 Ga0207668_11637182 Ga0207668_116371822 103
189 3300025981 Ga0207640_10002027 Ga0207640_100020274 103
190 3300025981 Ga0207640_10075290 Ga0207640_100752905 103
191 3300025981 Ga0207640_10924496 Ga0207640_109244962 103
192 3300026023 Ga0207677_10292498 Ga0207677_102924982 103
193 3300026041 Ga0207639_10003616 Ga0207639_1000361620 103
194 3300026041 Ga0207639_12242416 Ga0207639_122424162 103
195 3300026067 Ga0207678_10004876 Ga0207678_100048765 103
196 3300026067 Ga0207678_10224561 Ga0207678_102245612 103
197 3300026088 Ga0207641_11530673 Ga0207641_115306732 103
198 3300026089 Ga0207648_10339403 Ga0207648_103394032 103
199 3300026089 Ga0207648_10432267 Ga0207648_104322672 103
200 3300026095 Ga0207676_10710927 Ga0207676_107109272 103
201 3300026116 Ga0207674_10060601 Ga0207674_100606012 103
202 3300026116 Ga0207674_10295063 Ga0207674_102950632 103
203 3300026118 Ga0207675_100000157 Ga0207675_10000015750 103
204 3300026118 Ga0207675_101390482 Ga0207675_1013904822 103
205 3300026121 Ga0207683_10054331 Ga0207683_100543312 103
206 3300026121 Ga0207683_10092626 Ga0207683_100926262 103
207 3300026142 Ga0207698_10002491 Ga0207698_1000249120 103
208 3300027364 Ga0209967_1023094 Ga0209967_10230942 103
209 3300027462 Ga0210000_1086907 Ga0210000_10869071 103
210 3300027876 Ga0209974_10165900 Ga0209974_101659002 103
211 3300028379 Ga0268266_10022523 Ga0268266_100225234 103
212 3300031548 Ga0307408_100485545 Ga0307408_1004855452 103
213 3300031548 Ga0307408_100910882 Ga0307408_1009108822 103
214 3300031731 Ga0307405_10059852 Ga0307405_100598523 103
215 3300031731 Ga0307405_10375159 Ga0307405_103751592 103
216 3300031824 Ga0307413_10008194 Ga0307413_100081944 103
217 3300031824 Ga0307413_10070575 Ga0307413_100705754 103
218 3300031824 Ga0307413_10129469 Ga0307413_101294693 103
219 3300031824 Ga0307413_10272832 Ga0307413_102728323 103
220 3300031824 Ga0307413_10569105 Ga0307413_105691051 103
221 3300031824 Ga0307413_10851390 Ga0307413_108513902 103
222 3300031852 Ga0307410_10049247 Ga0307410_100492471 103
223 3300031852 Ga0307410_10206925 Ga0307410_102069253 103
224 3300031852 Ga0307410_10462985 Ga0307410_104629852 103
225 3300031852 Ga0307410_10830753 Ga0307410_108307532 103
226 3300031852 Ga0307410_12099412 Ga0307410_120994122 103
227 3300031901 Ga0307406_10061019 Ga0307406_100610193 103
228 3300031903 Ga0307407_10060971 Ga0307407_100609714 103
229 3300031903 Ga0307407_10127566 Ga0307407_101275663 103
230 3300031903 Ga0307407_11047507 Ga0307407_110475071 103
231 3300031903 Ga0307407_11057895 Ga0307407_110578952 103
232 3300031911 Ga0307412_10256539 Ga0307412_102565392 103
233 3300031911 Ga0307412_10344895 Ga0307412_103448952 103
234 3300031995 Ga0307409_100277274 Ga0307409_1002772743 103
235 3300031995 Ga0307409_100334980 Ga0307409_1003349802 103
236 3300031995 Ga0307409_100380008 Ga0307409_1003800082 103
237 3300031995 Ga0307409_100574346 Ga0307409_1005743462 103
238 3300032002 Ga0307416_100786304 Ga0307416_1007863042 103
239 3300032002 Ga0307416_102165424 Ga0307416_1021654242 103
240 3300032004 Ga0307414_10020158 Ga0307414_100201583 103
241 3300032004 Ga0307414_10101494 Ga0307414_101014942 103
242 3300032004 Ga0307414_10151662 Ga0307414_101516622 103
243 3300032004 Ga0307414_10568803 Ga0307414_105688032 103
244 3300032005 Ga0307411_10039443 Ga0307411_100394432 103
245 3300032005 Ga0307411_10311147 Ga0307411_103111471 103
246 3300032005 Ga0307411_10413567 Ga0307411_104135672 103
247 3300032005 Ga0307411_10602835 Ga0307411_106028352 103
248 3300032005 Ga0307411_10805665 Ga0307411_108056652 103
249 3300032005 Ga0307411_11406574 Ga0307411_114065742 103
250 3300032005 Ga0307411_11484809 Ga0307411_114848092 103
251 3300032005 Ga0307411_11897157 Ga0307411_118971571 103
252 3300032126 Ga0307415_100359095 Ga0307415_1003590952 103
253 3300032126 Ga0307415_100862787 Ga0307415_1008627872 103
254 3300032126 Ga0307415_101190348 Ga0307415_1011903482 103
255 3300037312 Ga0395899_0220425 Ga0395899_0220425_345_668 103
256 3300037418 Ga0395900_0747509 Ga0395900_0747509_443_766 103
257 3300037466 Ga0395898_0742267 Ga0395898_0742267_79_402 103
258 3300037471 Ga0395905_0821624 Ga0395905_0821624_375_698 103
259 3300037853 Ga0436364_1065372 Ga0436364_1065372_105529_105846 103
260 3300038443 Ga0395901_0564338 Ga0395901_0564338_698_1021 103
261 3300038443 Ga0395901_1667373 Ga0395901_1667373_247_570 103
262 3300039437 Ga0436365_0298268 Ga0436365_0298268_1568_1885 103
263 3300041406 Ga0439439_0128420 Ga0439439_0128420_122_442 103
264 3300041413 Ga0439465_0015647 Ga0439465_0015647_952_1275 103
265 3300041496 Ga0451839_0681194 Ga0451839_0681194_340_660 103
266 3300041999 Ga0439433_0067820 Ga0439433_0067820_277_597 103
267 3300042004 Ga0439445_0225339 Ga0439445_0225339_23_346 103
268 3300042006 Ga0439432_055513 Ga0439432_055513_53_373 103
269 3300042007 Ga0439449_0067357 Ga0439449_0067357_245_565 103
270 3300042007 Ga0439449_0101276 Ga0439449_0101276_636_959 103
271 3300042010 Ga0439452_044323 Ga0439452_044323_110_430 103
272 3300042010 Ga0439452_078916 Ga0439452_078916_81_401 103
273 3300042015 Ga0439462_0208767 Ga0439462_0208767_64_387 103
274 3300042116 Ga0450912_010825 Ga0450912_010825_271_594 103
275 3300042131 Ga0450894_081837 Ga0450894_081837_18_341 103
276 3300042157 Ga0439458_0212146 Ga0439458_0212146_174_494 103
277 3300042435 Ga0439434_0145500 Ga0439434_0145500_220_543 103
278 3300042876 Ga0451577_0768435 Ga0451577_0768435_106_426 103
279 3300044712 Ga0453684_0507510 Ga0453684_0507510_733_1053 103
280 3300045051 Ga0451576_2038486 Ga0451576_2038486_238_558 103
281 3300046491 Ga0495584_0059740 Ga0495584_0059740_293_616 103
282 3300046506 Ga0495583_0195098 Ga0495583_0195098_130_450 103
283 3300046515 Ga0495620_0214338 Ga0495620_0214338_179_502 103
284 3300046525 Ga0495663_0395046 Ga0495663_0395046_162_482 103
285 3300046528 Ga0495642_0044719 Ga0495642_0044719_1032_1355 103
286 3300046530 Ga0495654_0240736 Ga0495654_0240736_313_633 103
287 3300046557 Ga0495622_0039363 Ga0495622_0039363_946_1266 103
288 3300046558 Ga0495633_0243849 Ga0495633_0243849_160_480 103
289 3300046616 Ga0495668_0270987 Ga0495668_0270987_406_726 103
290 3300046684 Ga0495669_0268506 Ga0495669_0268506_49_369 103
291 3300046684 Ga0495669_0278529 Ga0495669_0278529_352_672 103
292 3300046691 Ga0495670_0147119 Ga0495670_0147119_681_1001 103
293 3300046691 Ga0495670_0560598 Ga0495670_0560598_45_359 103
294 3300046692 Ga0495671_0008086 Ga0495671_0008086_2993_3313 103
295 3300047445 Ga0495677_0014214 Ga0495677_0014214_1710_2033 103
296 3300047445 Ga0495677_0105204 Ga0495677_0105204_418_741 103
297 3300047472 Ga0495686_0000486 Ga0495686_0000486_56725_57045 103
298 3300047472 Ga0495686_0158108 Ga0495686_0158108_452_775 103
299 3300048090 Ga0495615_0313283 Ga0495615_0313283_11_331 103
300 3300048905 Ga0496102_0194172 Ga0496102_0194172_968_1282 103
301 3300048905 Ga0496102_1513698 Ga0496102_1513698_88_408 103
302 3300048906 Ga0496103_0215571 Ga0496103_0215571_498_818 103
303 3300048906 Ga0496103_0383193 Ga0496103_0383193_250_564 103
304 3300048908 Ga0496105_0250296 Ga0496105_0250296_113_427 103
305 3300048912 Ga0496109_0445967 Ga0496109_0445967_868_1188 103
306 3300048914 Ga0496111_0129963 Ga0496111_0129963_562_882 103
307 3300049127 Ga0501306_031216 Ga0501306_031216_442_762 103
308 3300049130 Ga0501310_028079 Ga0501310_028079_272_595 103
309 3300049162 Ga0501307_023755 Ga0501307_023755_353_673 103
310 3300049162 Ga0501307_026073 Ga0501307_026073_452_772 103
311 3300049527 Ga0501311_021033 Ga0501311_021033_316_636 103
312 3300049527 Ga0501311_025146 Ga0501311_025146_89_406 103
313 3300049531 Ga0501315_037732 Ga0501315_037732_369_689 103
314 3300049539 Ga0501323_076951 Ga0501323_076951_198_518 103
315 3300049540 Ga0501324_008845 Ga0501324_008845_544_864 103
316 3300049575 Ga0501039_0140668 Ga0501039_0140668_1404_1724 103
317 3300049587 Ga0501071_0586635 Ga0501071_0586635_76_396 103
318 3300049591 Ga0501075_0816081 Ga0501075_0816081_135_455 103
319 3300049656 Ga0501209_253846 Ga0501209_253846_164_484 103
320 3300049664 Ga0501224_066310 Ga0501224_066310_22_336 103
321 3300049741 Ga0501079_1508672 Ga0501079_1508672_138_458 103
322 3300049824 Ga0501045_0695140 Ga0501045_0695140_46_366 103
323 3300053118 Ga0500594_0005507 Ga0500594_0005507_1286_1606 103
324 3300053136 Ga0500559_0100471 Ga0500559_0100471_146_463 103
325 3300053735 Ga0500596_003226 Ga0500596_003226_2448_2771 103
326 3300059477 Ga0587084_000368 Ga0587084_000368_870_1193 103
327 3300059478 Ga0587093_018465 Ga0587093_018465_491_814 103
328 3300059490 Ga0587066_001465 Ga0587066_001465_1648_1971 103
329 3300059493 Ga0587077_001167 Ga0587077_001167_182_505 103
330 3300059503 Ga0587080_014969 Ga0587080_014969_348_671 103
331 3300059504 Ga0587082_008501 Ga0587082_008501_652_975 103
332 3300059505 Ga0587083_0037171 Ga0587083_0037171_497_820 103
333 3300059506 Ga0587085_007179 Ga0587085_007179_705_1028 103
334 3300059507 Ga0587086_006030 Ga0587086_006030_442_765 103
335 3300059508 Ga0587088_007942 Ga0587088_007942_699_1022 103
336 3300059508 Ga0587088_048881 Ga0587088_048881_36_359 103
337 3300059509 Ga0587089_006060 Ga0587089_006060_501_824 103
338 3300059510 Ga0587090_001175 Ga0587090_001175_37_360 103
339 3300059510 Ga0587090_118078 Ga0587090_118078_21_341 103
340 3300059511 Ga0587091_000254 Ga0587091_000254_2101_2424 103
341 3300059512 Ga0587092_007157 Ga0587092_007157_482_805 103
342 3300059513 Ga0587094_000504 Ga0587094_000504_2152_2475 103
343 3300059604 Ga0587098_006412 Ga0587098_006412_484_807 103
344 3300059605 Ga0587106_011511 Ga0587106_011511_664_987 103
345 3300059606 Ga0587121_04918 Ga0587121_04918_203_526 103
346 3300059608 Ga0587129_003262 Ga0587129_003262_392_715 103
347 3300059622 Ga0587099_003045 Ga0587099_003045_381_704 103
348 3300059623 Ga0587101_000706 Ga0587101_000706_2117_2440 103
349 3300059627 Ga0587117_010629 Ga0587117_010629_257_580 103
350 3300059630 Ga0587128_000194 Ga0587128_000194_982_1305 103
351 3300059641 Ga0587068_000363 Ga0587068_000363_1735_2058 103
352 3300059642 Ga0587069_009859 Ga0587069_009859_627_950 103
353 3300059644 Ga0587075_079900 Ga0587075_079900_263_586 103
354 3300059645 Ga0587076_014253 Ga0587076_014253_293_616 103
355 3300059645 Ga0587076_060180 Ga0587076_060180_47_370 103
356 3300059646 Ga0587078_000705 Ga0587078_000705_2182_2505 103
357 3300059647 Ga0587079_008963 Ga0587079_008963_399_722 103
358 3300059648 Ga0587100_000732 Ga0587100_000732_703_1026 103
359 3300059649 Ga0587102_000570 Ga0587102_000570_293_616 103
360 3300059650 Ga0587104_003534 Ga0587104_003534_351_674 103
361 3300059651 Ga0587105_000848 Ga0587105_000848_612_935 103
362 3300059652 Ga0587107_000546 Ga0587107_000546_1794_2117 103
363 3300059655 Ga0587114_008517 Ga0587114_008517_371_694 103
364 3300059657 Ga0587118_01767 Ga0587118_01767_455_778 103
365 3300059658 Ga0587119_000105 Ga0587119_000105_2100_2423 103
366 3300059659 Ga0587120_005626 Ga0587120_005626_315_638 103
367 3300059660 Ga0587124_007519 Ga0587124_007519_228_551 103
368 3300060247 Ga0587096_00847 Ga0587096_00847_430_753 103
369 3300060344 Ga0587071_000753 Ga0587071_000753_870_1193 103
370 3300060346 Ga0587111_0032114 Ga0587111_0032114_719_1042 103
371 3300060346 Ga0587111_0112702 Ga0587111_0112702_332_655 103
372 3300001432 JGI24034J14986_101847 JGI24034J14986_1018472 104
373 3300001915 JGI24741J21665_1015360 JGI24741J21665_10153601 104
374 3300001976 JGI24752J21851_1000007 JGI24752J21851_100000711 104
375 3300001989 JGI24739J22299_10134605 JGI24739J22299_101346052 104
376 3300001990 JGI24737J22298_10139036 JGI24737J22298_101390362 104
377 3300002067 JGI24735J21928_10011436 JGI24735J21928_100114363 104
378 3300002070 JGI24750J21931_1000298 JGI24750J21931_10002982 104
379 3300002074 JGI24748J21848_1000070 JGI24748J21848_100007027 104
380 3300002074 JGI24748J21848_1008969 JGI24748J21848_10089692 104
381 3300002076 JGI24749J21850_1000118 JGI24749J21850_100011820 104
382 3300002239 JGI24034J26672_10000038 JGI24034J26672_1000003826 104
383 3300002239 JGI24034J26672_10014302 JGI24034J26672_100143022 104
384 3300002239 JGI24034J26672_10049632 JGI24034J26672_100496322 104
385 3300002244 JGI24742J22300_10003980 JGI24742J22300_100039804 104
386 3300002459 JGI24751J29686_10010345 JGI24751J29686_100103452 104
387 3300003214 JGI25165J46597_1000023 JGI25165J46597_100002399 104
388 3300004801 Ga0058860_11860095 Ga0058860_118600951 104
389 3300005290 Ga0065712_10100550 Ga0065712_101005504 104
390 3300005293 Ga0065715_10029418 Ga0065715_100294182 104
391 3300005293 Ga0065715_10448200 Ga0065715_104482002 104
392 3300005293 Ga0065715_10598461 Ga0065715_105984612 104
393 3300005295 Ga0065707_10525541 Ga0065707_105255411 104
394 3300005327 Ga0070658_10354895 Ga0070658_103548951 104
395 3300005327 Ga0070658_10470961 Ga0070658_104709612 104
396 3300005327 Ga0070658_10488853 Ga0070658_104888532 104
397 3300005327 Ga0070658_10739176 Ga0070658_107391762 104
398 3300005327 Ga0070658_10790314 Ga0070658_107903141 104
399 3300005327 Ga0070658_11444257 Ga0070658_114442571 104
400 3300005328 Ga0070676_10770661 Ga0070676_107706611 104
401 3300005329 Ga0070683_100974924 Ga0070683_1009749242 104
402 3300005329 Ga0070683_101634463 Ga0070683_1016344632 104
403 3300005330 Ga0070690_100000097 Ga0070690_10000009743 104
404 3300005331 Ga0070670_100010675 Ga0070670_1000106752 104
405 3300005331 Ga0070670_100034259 Ga0070670_1000342592 104
406 3300005333 Ga0070677_10037474 Ga0070677_100374741 104
407 3300005335 Ga0070666_10000004 Ga0070666_10000004290 104
408 3300005335 Ga0070666_10191087 Ga0070666_101910872 104
409 3300005335 Ga0070666_10490911 Ga0070666_104909112 104
410 3300005336 Ga0070680_100363294 Ga0070680_1003632942 104
411 3300005337 Ga0070682_100379432 Ga0070682_1003794321 104
412 3300005339 Ga0070660_100096538 Ga0070660_1000965382 104
413 3300005339 Ga0070660_100188024 Ga0070660_1001880242 104
414 3300005339 Ga0070660_100205715 Ga0070660_1002057152 104
415 3300005339 Ga0070660_100390605 Ga0070660_1003906051 104
416 3300005339 Ga0070660_100419886 Ga0070660_1004198862 104
417 3300005339 Ga0070660_101060484 Ga0070660_1010604842 104
418 3300005340 Ga0070689_100106270 Ga0070689_1001062702 104
419 3300005343 Ga0070687_100263328 Ga0070687_1002633282 104
420 3300005344 Ga0070661_100033195 Ga0070661_1000331955 104
421 3300005344 Ga0070661_100101205 Ga0070661_1001012053 104
422 3300005344 Ga0070661_100353376 Ga0070661_1003533761 104
423 3300005344 Ga0070661_100410927 Ga0070661_1004109271 104
424 3300005345 Ga0070692_10047048 Ga0070692_100470482 104
425 3300005347 Ga0070668_100078782 Ga0070668_1000787823 104
426 3300005347 Ga0070668_100164638 Ga0070668_1001646383 104
427 3300005347 Ga0070668_100367114 Ga0070668_1003671142 104
428 3300005353 Ga0070669_100000296 Ga0070669_10000029643 104
429 3300005353 Ga0070669_100177439 Ga0070669_1001774393 104
430 3300005353 Ga0070669_100285920 Ga0070669_1002859201 104
431 3300005353 Ga0070669_100971176 Ga0070669_1009711762 104
432 3300005353 Ga0070669_101391820 Ga0070669_1013918201 104
433 3300005354 Ga0070675_100190962 Ga0070675_1001909621 104
434 3300005354 Ga0070675_100929592 Ga0070675_1009295921 104
435 3300005355 Ga0070671_100012607 Ga0070671_10001260711 104
436 3300005355 Ga0070671_100023714 Ga0070671_1000237145 104
437 3300005355 Ga0070671_100490132 Ga0070671_1004901322 104
438 3300005356 Ga0070674_100112061 Ga0070674_1001120612 104
439 3300005356 Ga0070674_100242117 Ga0070674_1002421171 104
440 3300005364 Ga0070673_100880830 Ga0070673_1008808302 104
441 3300005365 Ga0070688_100002383 Ga0070688_10000238310 104
442 3300005366 Ga0070659_100235299 Ga0070659_1002352992 104
443 3300005366 Ga0070659_100242738 Ga0070659_1002427382 104
444 3300005366 Ga0070659_101152500 Ga0070659_1011525001 104
445 3300005366 Ga0070659_101427295 Ga0070659_1014272952 104
446 3300005367 Ga0070667_100061703 Ga0070667_1000617032 104
447 3300005367 Ga0070667_100200068 Ga0070667_1002000682 104
448 3300005367 Ga0070667_102150601 Ga0070667_1021506011 104
449 3300005435 Ga0070714_100025886 Ga0070714_1000258861 104
450 3300005435 Ga0070714_100507601 Ga0070714_1005076012 104
451 3300005436 Ga0070713_100239005 Ga0070713_1002390052 104
452 3300005455 Ga0070663_100080949 Ga0070663_1000809492 104
453 3300005455 Ga0070663_100751747 Ga0070663_1007517472 104
454 3300005455 Ga0070663_101348259 Ga0070663_1013482591 104
455 3300005456 Ga0070678_100403125 Ga0070678_1004031252 104
456 3300005457 Ga0070662_100046495 Ga0070662_1000464952 104
457 3300005457 Ga0070662_100064573 Ga0070662_1000645732 104
458 3300005458 Ga0070681_10807026 Ga0070681_108070262 104
459 3300005458 Ga0070681_10847619 Ga0070681_108476192 104
460 3300005466 Ga0070685_10000262 Ga0070685_1000026234 104
461 3300005530 Ga0070679_100226535 Ga0070679_1002265352 104
462 3300005530 Ga0070679_100321123 Ga0070679_1003211231 104
463 3300005530 Ga0070679_101542479 Ga0070679_1015424791 104
464 3300005535 Ga0070684_101371812 Ga0070684_1013718122 104
465 3300005539 Ga0068853_100079177 Ga0068853_1000791773 104
466 3300005539 Ga0068853_100535457 Ga0068853_1005354571 104
467 3300005539 Ga0068853_100674894 Ga0068853_1006748941 104
468 3300005543 Ga0070672_100207425 Ga0070672_1002074252 104
469 3300005544 Ga0070686_100000061 Ga0070686_10000006178 104
470 3300005546 Ga0070696_100112118 Ga0070696_1001121182 104
471 3300005548 Ga0070665_100000004 Ga0070665_100000004668 104
472 3300005548 Ga0070665_100009730 Ga0070665_1000097302 104
473 3300005548 Ga0070665_100339978 Ga0070665_1003399783 104
474 3300005548 Ga0070665_101500274 Ga0070665_1015002742 104
475 3300005564 Ga0070664_100101975 Ga0070664_1001019753 104
476 3300005564 Ga0070664_100325070 Ga0070664_1003250702 104
477 3300005564 Ga0070664_100520843 Ga0070664_1005208432 104
478 3300005564 Ga0070664_100898377 Ga0070664_1008983772 104
479 3300005564 Ga0070664_101808126 Ga0070664_1018081262 104
480 3300005564 Ga0070664_102074491 Ga0070664_1020744912 104
481 3300005577 Ga0068857_100226553 Ga0068857_1002265533 104
482 3300005577 Ga0068857_100808385 Ga0068857_1008083851 104
483 3300005577 Ga0068857_101067976 Ga0068857_1010679762 104
484 3300005614 Ga0068856_100050714 Ga0068856_1000507142 104
485 3300005614 Ga0068856_100150227 Ga0068856_1001502274 104
486 3300005616 Ga0068852_100218546 Ga0068852_1002185462 104
487 3300005616 Ga0068852_100329391 Ga0068852_1003293913 104
488 3300005616 Ga0068852_100931418 Ga0068852_1009314182 104
489 3300005616 Ga0068852_100947817 Ga0068852_1009478172 104
490 3300005617 Ga0068859_100010520 Ga0068859_1000105204 104
491 3300005617 Ga0068859_100275602 Ga0068859_1002756022 104
492 3300005617 Ga0068859_100839699 Ga0068859_1008396992 104
493 3300005618 Ga0068864_100002567 Ga0068864_10000256719 104
494 3300005618 Ga0068864_101049438 Ga0068864_1010494381 104
495 3300005719 Ga0068861_100002842 Ga0068861_1000028422 104
496 3300005719 Ga0068861_101088385 Ga0068861_1010883851 104
497 3300005834 Ga0068851_10011439 Ga0068851_100114395 104
498 3300005834 Ga0068851_10360727 Ga0068851_103607272 104
499 3300005840 Ga0068870_11021802 Ga0068870_110218022 104
500 3300005841 Ga0068863_100000013 Ga0068863_100000013214 104
501 3300005841 Ga0068863_100909232 Ga0068863_1009092322 104
502 3300005842 Ga0068858_100000664 Ga0068858_10000066418 104
503 3300005842 Ga0068858_100008722 Ga0068858_1000087228 104
504 3300005843 Ga0068860_100000009 Ga0068860_100000009289 104
505 3300005843 Ga0068860_100007808 Ga0068860_10000780814 104
506 3300005843 Ga0068860_100544238 Ga0068860_1005442382 104
507 3300005844 Ga0068862_100001446 Ga0068862_10000144622 104
508 3300005985 Ga0081539_10018995 Ga0081539_100189952 104
509 3300006028 Ga0070717_11649270 Ga0070717_116492701 104
510 3300006353 Ga0075370_10375338 Ga0075370_103753382 104
511 3300006846 Ga0075430_101382922 Ga0075430_1013829221 104
512 3300006881 Ga0068865_101545290 Ga0068865_1015452902 104
513 3300006931 Ga0097620_100010519 Ga0097620_1000105194 104
514 3300006931 Ga0097620_100275611 Ga0097620_1002756113 104
515 3300006931 Ga0097620_100839823 Ga0097620_1008398232 104
516 3300009092 Ga0105250_10073036 Ga0105250_100730363 104
517 3300009093 Ga0105240_10206568 Ga0105240_102065684 104
518 3300009093 Ga0105240_10700183 Ga0105240_107001832 104
519 3300009174 Ga0105241_12609145 Ga0105241_126091451 104
520 3300009177 Ga0105248_10023935 Ga0105248_1002393515 104
521 3300009177 Ga0105248_10573441 Ga0105248_105734412 104
522 3300009177 Ga0105248_11284805 Ga0105248_112848052 104
523 3300009551 Ga0105238_10931313 Ga0105238_109313132 104
524 3300009551 Ga0105238_11034238 Ga0105238_110342382 104
525 3300009551 Ga0105238_11508862 Ga0105238_115088621 104
526 3300009553 Ga0105249_10000006 Ga0105249_1000000675 104
527 3300010375 Ga0105239_13502082 Ga0105239_135020822 104
528 3300011119 Ga0105246_10099608 Ga0105246_100996082 104
529 3300013100 Ga0157373_10425298 Ga0157373_104252982 104
530 3300013100 Ga0157373_10426491 Ga0157373_104264912 104
531 3300013100 Ga0157373_11121058 Ga0157373_111210581 104
532 3300013102 Ga0157371_10123034 Ga0157371_101230342 104
533 3300013102 Ga0157371_11159258 Ga0157371_111592581 104
534 3300013104 Ga0157370_10024969 Ga0157370_100249696 104
535 3300013104 Ga0157370_11334238 Ga0157370_113342382 104
536 3300013104 Ga0157370_11633359 Ga0157370_116333592 104
537 3300013105 Ga0157369_10034063 Ga0157369_100340635 104
538 3300013105 Ga0157369_11190963 Ga0157369_111909632 104
539 3300013105 Ga0157369_11220717 Ga0157369_112207171 104
540 3300013296 Ga0157374_10414168 Ga0157374_104141682 104
541 3300013297 Ga0157378_10232281 Ga0157378_102322813 104
542 3300013306 Ga0163162_10034071 Ga0163162_100340715 104
543 3300013306 Ga0163162_10072394 Ga0163162_100723942 104
544 3300013306 Ga0163162_10109281 Ga0163162_101092814 104
545 3300013306 Ga0163162_10789338 Ga0163162_107893382 104
546 3300013307 Ga0157372_10308225 Ga0157372_103082252 104
547 3300013307 Ga0157372_10659289 Ga0157372_106592892 104
548 3300013307 Ga0157372_11061209 Ga0157372_110612092 104
549 3300013307 Ga0157372_11111232 Ga0157372_111112322 104
550 3300013308 Ga0157375_10657450 Ga0157375_106574502 104
551 3300013308 Ga0157375_12866978 Ga0157375_128669781 104
552 3300013308 Ga0157375_13433680 Ga0157375_134336802 104
553 3300013308 Ga0157375_13535204 Ga0157375_135352042 104
554 3300014325 Ga0163163_10019994 Ga0163163_100199942 104
555 3300014326 Ga0157380_10235709 Ga0157380_102357093 104
556 3300014968 Ga0157379_10001735 Ga0157379_1000173511 104
557 3300014968 Ga0157379_10003973 Ga0157379_100039736 104
558 3300017792 Ga0163161_10000208 Ga0163161_100002085 104
559 3300017792 Ga0163161_10222559 Ga0163161_102225593 104
560 3300017792 Ga0163161_10751429 Ga0163161_107514292 104
561 3300020069 Ga0197907_10990692 Ga0197907_109906922 104
562 3300020078 Ga0206352_10437088 Ga0206352_104370882 104
563 3300025223 Ga0207672_1001700 Ga0207672_10017003 104
564 3300025231 Ga0207427_100986 Ga0207427_10098612 104
565 3300025250 Ga0209026_1000352 Ga0209026_100035221 104
566 3300025256 Ga0209759_1033090 Ga0209759_10330902 104
567 3300025261 Ga0209233_1000003 Ga0209233_1000003938 104
568 3300025321 Ga0207656_10043235 Ga0207656_100432352 104
569 3300025893 Ga0207682_10487689 Ga0207682_104876892 104
570 3300025903 Ga0207680_10000010 Ga0207680_10000010118 104
571 3300025903 Ga0207680_10225072 Ga0207680_102250722 104
572 3300025903 Ga0207680_10490110 Ga0207680_104901102 104
573 3300025907 Ga0207645_10567128 Ga0207645_105671282 104
574 3300025909 Ga0207705_10001825 Ga0207705_100018256 104
575 3300025909 Ga0207705_10026545 Ga0207705_100265455 104
576 3300025909 Ga0207705_10207656 Ga0207705_102076562 104
577 3300025909 Ga0207705_10460666 Ga0207705_104606662 104
578 3300025911 Ga0207654_11246107 Ga0207654_112461071 104
579 3300025912 Ga0207707_10362538 Ga0207707_103625382 104
580 3300025912 Ga0207707_10757610 Ga0207707_107576102 104
581 3300025913 Ga0207695_11296827 Ga0207695_112968272 104
582 3300025917 Ga0207660_10884083 Ga0207660_108840832 104
583 3300025918 Ga0207662_10438171 Ga0207662_104381712 104
584 3300025918 Ga0207662_10741161 Ga0207662_107411612 104
585 3300025918 Ga0207662_10813593 Ga0207662_108135932 104
586 3300025919 Ga0207657_10132430 Ga0207657_101324302 104
587 3300025919 Ga0207657_10231765 Ga0207657_102317652 104
588 3300025919 Ga0207657_10348096 Ga0207657_103480962 104
589 3300025919 Ga0207657_10587063 Ga0207657_105870632 104
590 3300025919 Ga0207657_10671567 Ga0207657_106715672 104
591 3300025920 Ga0207649_10363671 Ga0207649_103636712 104
592 3300025920 Ga0207649_11415093 Ga0207649_114150932 104
593 3300025921 Ga0207652_10226817 Ga0207652_102268173 104
594 3300025921 Ga0207652_10573323 Ga0207652_105733232 104
595 3300025923 Ga0207681_10000197 Ga0207681_1000019727 104
596 3300025923 Ga0207681_10104132 Ga0207681_101041322 104
597 3300025923 Ga0207681_10226635 Ga0207681_102266352 104
598 3300025924 Ga0207694_10417758 Ga0207694_104177582 104
599 3300025925 Ga0207650_10001567 Ga0207650_100015677 104
600 3300025925 Ga0207650_10102411 Ga0207650_101024113 104
601 3300025925 Ga0207650_10181519 Ga0207650_101815192 104
602 3300025926 Ga0207659_10002689 Ga0207659_100026894 104
603 3300025926 Ga0207659_10521695 Ga0207659_105216952 104
604 3300025928 Ga0207700_10528921 Ga0207700_105289212 104
605 3300025929 Ga0207664_10356883 Ga0207664_103568832 104
606 3300025931 Ga0207644_10005181 Ga0207644_100051813 104
607 3300025931 Ga0207644_10008230 Ga0207644_100082305 104
608 3300025931 Ga0207644_10261373 Ga0207644_102613732 104
609 3300025932 Ga0207690_10063154 Ga0207690_100631542 104
610 3300025932 Ga0207690_11047541 Ga0207690_110475412 104
611 3300025933 Ga0207706_10041209 Ga0207706_100412095 104
612 3300025933 Ga0207706_10079122 Ga0207706_100791224 104
613 3300025936 Ga0207670_10087907 Ga0207670_100879074 104
614 3300025937 Ga0207669_10190199 Ga0207669_101901993 104
615 3300025937 Ga0207669_10390138 Ga0207669_103901381 104
616 3300025938 Ga0207704_11679469 Ga0207704_116794692 104
617 3300025940 Ga0207691_10036228 Ga0207691_100362282 104
618 3300025940 Ga0207691_10201747 Ga0207691_102017473 104
619 3300025941 Ga0207711_10006762 Ga0207711_1000676219 104
620 3300025941 Ga0207711_11042046 Ga0207711_110420462 104
621 3300025944 Ga0207661_11515151 Ga0207661_115151511 104
622 3300025944 Ga0207661_11593960 Ga0207661_115939602 104
623 3300025945 Ga0207679_10001466 Ga0207679_100014665 104
624 3300025945 Ga0207679_10010673 Ga0207679_100106732 104
625 3300025945 Ga0207679_10408309 Ga0207679_104083092 104
626 3300025945 Ga0207679_10571387 Ga0207679_105713872 104
627 3300025945 Ga0207679_10978667 Ga0207679_109786672 104
628 3300025945 Ga0207679_11467690 Ga0207679_114676901 104
629 3300025949 Ga0207667_10742685 Ga0207667_107426852 104
630 3300025960 Ga0207651_10764349 Ga0207651_107643492 104
631 3300025961 Ga0207712_10000014 Ga0207712_10000014289 104
632 3300025972 Ga0207668_10000402 Ga0207668_1000040227 104
633 3300025972 Ga0207668_10066198 Ga0207668_100661983 104
634 3300025972 Ga0207668_10348910 Ga0207668_103489102 104
635 3300025981 Ga0207640_10461720 Ga0207640_104617202 104
636 3300025986 Ga0207658_10000428 Ga0207658_1000042829 104
637 3300025986 Ga0207658_10364702 Ga0207658_103647022 104
638 3300026035 Ga0207703_10002426 Ga0207703_1000242622 104
639 3300026035 Ga0207703_10101770 Ga0207703_101017703 104
640 3300026041 Ga0207639_10371981 Ga0207639_103719812 104
641 3300026041 Ga0207639_11075163 Ga0207639_110751632 104
642 3300026041 Ga0207639_12146318 Ga0207639_121463182 104
643 3300026067 Ga0207678_10053905 Ga0207678_100539052 104
644 3300026067 Ga0207678_10253198 Ga0207678_102531982 104
645 3300026067 Ga0207678_11674042 Ga0207678_116740422 104
646 3300026078 Ga0207702_10050310 Ga0207702_100503105 104
647 3300026078 Ga0207702_10425095 Ga0207702_104250952 104
648 3300026078 Ga0207702_11087542 Ga0207702_110875422 104
649 3300026088 Ga0207641_10000099 Ga0207641_1000009935 104
650 3300026088 Ga0207641_11103809 Ga0207641_111038092 104
651 3300026095 Ga0207676_10001345 Ga0207676_100013459 104
652 3300026095 Ga0207676_10214204 Ga0207676_102142043 104
653 3300026095 Ga0207676_11166737 Ga0207676_111667372 104
654 3300026095 Ga0207676_11852928 Ga0207676_118529282 104
655 3300026116 Ga0207674_10219882 Ga0207674_102198822 104
656 3300026116 Ga0207674_10397602 Ga0207674_103976022 104
657 3300026118 Ga0207675_100006214 Ga0207675_10000621413 104
658 3300026118 Ga0207675_102107866 Ga0207675_1021078661 104
659 3300026121 Ga0207683_10647030 Ga0207683_106470302 104
660 3300026121 Ga0207683_12118535 Ga0207683_121185352 104
661 3300026142 Ga0207698_10177021 Ga0207698_101770212 104
662 3300026142 Ga0207698_10476228 Ga0207698_104762282 104
663 3300026142 Ga0207698_10829115 Ga0207698_108291152 104
664 3300026142 Ga0207698_12055575 Ga0207698_120555752 104
665 3300027364 Ga0209967_1018450 Ga0209967_10184502 104
666 3300027424 Ga0209984_1015877 Ga0209984_10158772 104
667 3300027543 Ga0209999_1039061 Ga0209999_10390612 104
668 3300028379 Ga0268266_10000009 Ga0268266_10000009135 104
669 3300028379 Ga0268266_10140961 Ga0268266_101409613 104
670 3300028379 Ga0268266_10396572 Ga0268266_103965722 104
671 3300028380 Ga0268265_10000047 Ga0268265_10000047114 104
672 3300028380 Ga0268265_10000074 Ga0268265_1000007452 104
673 3300028381 Ga0268264_10000023 Ga0268264_1000002376 104
674 3300028381 Ga0268264_10000215 Ga0268264_1000021560 104
675 3300031548 Ga0307408_100006443 Ga0307408_1000064436 104
676 3300031548 Ga0307408_100199693 Ga0307408_1001996932 104
677 3300031548 Ga0307408_100206209 Ga0307408_1002062092 104
678 3300031548 Ga0307408_100225187 Ga0307408_1002251873 104
679 3300031548 Ga0307408_100287569 Ga0307408_1002875692 104
680 3300031548 Ga0307408_100342407 Ga0307408_1003424073 104
681 3300031548 Ga0307408_100553889 Ga0307408_1005538891 104
682 3300031548 Ga0307408_100790692 Ga0307408_1007906921 104
683 3300031548 Ga0307408_102519534 Ga0307408_1025195341 104
684 3300031731 Ga0307405_10019698 Ga0307405_100196985 104
685 3300031731 Ga0307405_10194476 Ga0307405_101944762 104
686 3300031731 Ga0307405_10207937 Ga0307405_102079372 104
687 3300031731 Ga0307405_10266437 Ga0307405_102664372 104
688 3300031731 Ga0307405_10272146 Ga0307405_102721462 104
689 3300031731 Ga0307405_10295455 Ga0307405_102954552 104
690 3300031731 Ga0307405_10407978 Ga0307405_104079782 104
691 3300031731 Ga0307405_11027308 Ga0307405_110273082 104
692 3300031824 Ga0307413_10029315 Ga0307413_100293154 104
693 3300031824 Ga0307413_10140586 Ga0307413_101405862 104
694 3300031824 Ga0307413_10154999 Ga0307413_101549993 104
695 3300031824 Ga0307413_10295163 Ga0307413_102951632 104
696 3300031824 Ga0307413_10297407 Ga0307413_102974072 104
697 3300031824 Ga0307413_10386170 Ga0307413_103861702 104
698 3300031824 Ga0307413_10532399 Ga0307413_105323992 104
699 3300031824 Ga0307413_10655336 Ga0307413_106553362 104
700 3300031824 Ga0307413_10910711 Ga0307413_109107112 104
701 3300031824 Ga0307413_11294230 Ga0307413_112942302 104
702 3300031824 Ga0307413_12093706 Ga0307413_120937061 104
703 3300031852 Ga0307410_10030817 Ga0307410_100308171 104
704 3300031852 Ga0307410_10043934 Ga0307410_100439343 104
705 3300031852 Ga0307410_10059688 Ga0307410_100596884 104
706 3300031852 Ga0307410_10096687 Ga0307410_100966872 104
707 3300031852 Ga0307410_10112543 Ga0307410_101125432 104
708 3300031852 Ga0307410_10134883 Ga0307410_101348832 104
709 3300031852 Ga0307410_10401523 Ga0307410_104015232 104
710 3300031852 Ga0307410_10443534 Ga0307410_104435342 104
711 3300031852 Ga0307410_10448809 Ga0307410_104488092 104
712 3300031901 Ga0307406_10020638 Ga0307406_100206386 104
713 3300031901 Ga0307406_10186863 Ga0307406_101868632 104
714 3300031901 Ga0307406_10251545 Ga0307406_102515452 104
715 3300031901 Ga0307406_10344780 Ga0307406_103447801 104
716 3300031901 Ga0307406_10352551 Ga0307406_103525512 104
717 3300031901 Ga0307406_10557983 Ga0307406_105579832 104
718 3300031901 Ga0307406_10864871 Ga0307406_108648712 104
719 3300031901 Ga0307406_10874259 Ga0307406_108742592 104
720 3300031901 Ga0307406_11863970 Ga0307406_118639702 104
721 3300031901 Ga0307406_12037098 Ga0307406_120370982 104
722 3300031903 Ga0307407_10002227 Ga0307407_100022276 104
723 3300031903 Ga0307407_10063358 Ga0307407_100633581 104
724 3300031903 Ga0307407_10086266 Ga0307407_100862662 104
725 3300031903 Ga0307407_10263189 Ga0307407_102631892 104
726 3300031903 Ga0307407_10285829 Ga0307407_102858292 104
727 3300031903 Ga0307407_10328575 Ga0307407_103285752 104
728 3300031903 Ga0307407_10818762 Ga0307407_108187621 104
729 3300031911 Ga0307412_10005349 Ga0307412_100053495 104
730 3300031911 Ga0307412_10063129 Ga0307412_100631295 104
731 3300031911 Ga0307412_10096207 Ga0307412_100962072 104
732 3300031911 Ga0307412_10148277 Ga0307412_101482772 104
733 3300031911 Ga0307412_10151533 Ga0307412_101515332 104
734 3300031911 Ga0307412_10192076 Ga0307412_101920762 104
735 3300031911 Ga0307412_10668682 Ga0307412_106686822 104
736 3300031911 Ga0307412_10734973 Ga0307412_107349732 104
737 3300031911 Ga0307412_10906005 Ga0307412_109060052 104
738 3300031995 Ga0307409_100028799 Ga0307409_1000287995 104
739 3300031995 Ga0307409_100048409 Ga0307409_1000484095 104
740 3300031995 Ga0307409_100050697 Ga0307409_1000506974 104
741 3300031995 Ga0307409_100052112 Ga0307409_1000521126 104
742 3300031995 Ga0307409_100233479 Ga0307409_1002334793 104
743 3300031995 Ga0307409_100734720 Ga0307409_1007347202 104
744 3300031995 Ga0307409_100738005 Ga0307409_1007380052 104
745 3300031995 Ga0307409_100805247 Ga0307409_1008052472 104
746 3300031995 Ga0307409_100847781 Ga0307409_1008477812 104
747 3300031995 Ga0307409_101847849 Ga0307409_1018478492 104
748 3300032002 Ga0307416_100007111 Ga0307416_1000071115 104
749 3300032002 Ga0307416_100016950 Ga0307416_1000169502 104
750 3300032002 Ga0307416_100108559 Ga0307416_1001085592 104
751 3300032002 Ga0307416_100171661 Ga0307416_1001716613 104
752 3300032002 Ga0307416_100205947 Ga0307416_1002059472 104
753 3300032002 Ga0307416_100544887 Ga0307416_1005448872 104
754 3300032002 Ga0307416_100761587 Ga0307416_1007615872 104
755 3300032002 Ga0307416_100930422 Ga0307416_1009304222 104
756 3300032002 Ga0307416_101967543 Ga0307416_1019675432 104
757 3300032002 Ga0307416_102285026 Ga0307416_1022850262 104
758 3300032002 Ga0307416_103150535 Ga0307416_1031505352 104
759 3300032004 Ga0307414_10013980 Ga0307414_100139805 104
760 3300032004 Ga0307414_10024828 Ga0307414_100248284 104
761 3300032004 Ga0307414_10040497 Ga0307414_100404973 104
762 3300032004 Ga0307414_10096707 Ga0307414_100967074 104
763 3300032004 Ga0307414_10189348 Ga0307414_101893483 104
764 3300032004 Ga0307414_10635994 Ga0307414_106359942 104
765 3300032004 Ga0307414_10693567 Ga0307414_106935672 104
766 3300032004 Ga0307414_10821854 Ga0307414_108218542 104
767 3300032004 Ga0307414_11054577 Ga0307414_110545771 104
768 3300032004 Ga0307414_11285888 Ga0307414_112858882 104
769 3300032004 Ga0307414_11355946 Ga0307414_113559462 104
770 3300032004 Ga0307414_11780676 Ga0307414_117806761 104
771 3300032004 Ga0307414_11956290 Ga0307414_119562901 104
772 3300032005 Ga0307411_10004327 Ga0307411_100043278 104
773 3300032005 Ga0307411_10046354 Ga0307411_100463542 104
774 3300032005 Ga0307411_10207985 Ga0307411_102079852 104
775 3300032005 Ga0307411_10211902 Ga0307411_102119022 104
776 3300032005 Ga0307411_10308714 Ga0307411_103087142 104
777 3300032005 Ga0307411_10316985 Ga0307411_103169853 104
778 3300032005 Ga0307411_10672801 Ga0307411_106728012 104
779 3300032005 Ga0307411_10789134 Ga0307411_107891341 104
780 3300032005 Ga0307411_11099298 Ga0307411_110992982 104
781 3300032005 Ga0307411_11474747 Ga0307411_114747471 104
782 3300032005 Ga0307411_11981529 Ga0307411_119815292 104
783 3300032005 Ga0307411_12002180 Ga0307411_120021801 104
784 3300032005 Ga0307411_12026548 Ga0307411_120265482 104
785 3300032005 Ga0307411_12135839 Ga0307411_121358391 104
786 3300032126 Ga0307415_100006247 Ga0307415_1000062475 104
787 3300032126 Ga0307415_100083964 Ga0307415_1000839643 104
788 3300032126 Ga0307415_100084799 Ga0307415_1000847992 104
789 3300032126 Ga0307415_100276281 Ga0307415_1002762813 104
790 3300032126 Ga0307415_100335060 Ga0307415_1003350602 104
791 3300032126 Ga0307415_100357100 Ga0307415_1003571002 104
792 3300032126 Ga0307415_100577513 Ga0307415_1005775132 104
793 3300032126 Ga0307415_100647899 Ga0307415_1006478992 104
794 3300032126 Ga0307415_100857668 Ga0307415_1008576682 104
795 3300032126 Ga0307415_102141503 Ga0307415_1021415032 104
796 3300035115 Ga0373941_0300741 Ga0373941_0300741_87_407 104
797 3300037312 Ga0395899_0000406 Ga0395899_0000406_43811_44128 104
798 3300037312 Ga0395899_0191462 Ga0395899_0191462_625_945 104
799 3300037418 Ga0395900_0021924 Ga0395900_0021924_5161_5481 104
800 3300037418 Ga0395900_0043394 Ga0395900_0043394_76_393 104
801 3300037418 Ga0395900_0120641 Ga0395900_0120641_737_1057 104
802 3300037418 Ga0395900_0595623 Ga0395900_0595623_133_459 104
803 3300037418 Ga0395900_0600356 Ga0395900_0600356_230_547 104
804 3300037466 Ga0395898_0250288 Ga0395898_0250288_522_848 104
805 3300037466 Ga0395898_0273138 Ga0395898_0273138_261_578 104
806 3300037466 Ga0395898_0358176 Ga0395898_0358176_659_979 104
807 3300037466 Ga0395898_0521882 Ga0395898_0521882_172_489 104
808 3300037471 Ga0395905_0001805 Ga0395905_0001805_23378_23695 104
809 3300037471 Ga0395905_0007986 Ga0395905_0007986_5466_5786 104
810 3300037471 Ga0395905_0022623 Ga0395905_0022623_4714_5040 104
811 3300037853 Ga0436364_1491317 Ga0436364_1491317_94_417 104
812 3300038443 Ga0395901_0012081 Ga0395901_0012081_871_1191 104
813 3300038443 Ga0395901_0062202 Ga0395901_0062202_3207_3524 104
814 3300038443 Ga0395901_0278245 Ga0395901_0278245_1141_1461 104
815 3300038443 Ga0395901_0431323 Ga0395901_0431323_404_730 104
816 3300041453 Ga0451797_1289161 Ga0451797_1289161_608_934 104
817 3300041460 Ga0451802_0774086 Ga0451802_0774086_219_539 104
818 3300041462 Ga0451806_236297 Ga0451806_236297_1106_1426 104
819 3300041463 Ga0451804_0241769 Ga0451804_0241769_252_572 104
820 3300041486 Ga0451807_0895683 Ga0451807_0895683_825_1145 104
821 3300041494 Ga0451837_1607676 Ga0451837_1607676_170_490 104
822 3300041501 Ga0451845_0925973 Ga0451845_0925973_32_352 104
823 3300042012 Ga0439455_0005591 Ga0439455_0005591_1829_2146 104
824 3300044765 Ga0466970_0066546 Ga0466970_0066546_817_1137 104
825 3300044842 Ga0466957_0951414 Ga0466957_0951414_114_434 104
826 3300045976 Ga0466967_1276514 Ga0466967_1276514_252_569 104
827 3300046492 Ga0495585_0207909 Ga0495585_0207909_174_500 104
828 3300046518 Ga0495631_0119026 Ga0495631_0119026_143_469 104
829 3300046522 Ga0495643_0514717 Ga0495643_0514717_167_487 104
830 3300046525 Ga0495663_0007544 Ga0495663_0007544_110_436 104
831 3300046525 Ga0495663_0175157 Ga0495663_0175157_78_398 104
832 3300046528 Ga0495642_0313201 Ga0495642_0313201_206_526 104
833 3300046537 Ga0495598_0001038 Ga0495598_0001038_1156_1482 104
834 3300046539 Ga0495621_0036568 Ga0495621_0036568_103_429 104
835 3300046558 Ga0495633_0001763 Ga0495633_0001763_4942_5268 104
836 3300046615 Ga0495656_0098455 Ga0495656_0098455_270_596 104
837 3300046660 Ga0495625_0267913 Ga0495625_0267913_537_863 104
838 3300046684 Ga0495669_0010966 Ga0495669_0010966_3348_3671 104
839 3300046684 Ga0495669_0034570 Ga0495669_0034570_1350_1676 104
840 3300046691 Ga0495670_0049768 Ga0495670_0049768_66_389 104
841 3300046691 Ga0495670_0091225 Ga0495670_0091225_62_388 104
842 3300047443 Ga0495687_207677 Ga0495687_207677_199_516 104
843 3300047445 Ga0495677_0117747 Ga0495677_0117747_448_771 104
844 3300047472 Ga0495686_0007665 Ga0495686_0007665_5876_6196 104
845 3300047472 Ga0495686_0386994 Ga0495686_0386994_363_680 104
846 3300048903 Ga0496100_0764831 Ga0496100_0764831_155_469 104
847 3300048905 Ga0496102_0022640 Ga0496102_0022640_2910_3224 104
848 3300048906 Ga0496103_0001458 Ga0496103_0001458_4123_4437 104
849 3300048907 Ga0496104_0695513 Ga0496104_0695513_566_880 104
850 3300048908 Ga0496105_0118457 Ga0496105_0118457_909_1223 104
851 3300048908 Ga0496105_0550267 Ga0496105_0550267_192_506 104
852 3300048911 Ga0496108_0359849 Ga0496108_0359849_628_951 104
853 3300048912 Ga0496109_0907800 Ga0496109_0907800_10_324 104
854 3300048912 Ga0496109_1075906 Ga0496109_1075906_40_363 104
855 3300048912 Ga0496109_1296408 Ga0496109_1296408_147_470 104
856 3300048912 Ga0496109_1526623 Ga0496109_1526623_68_394 104
857 3300048913 Ga0496110_0453040 Ga0496110_0453040_367_690 104
858 3300048913 Ga0496110_0987985 Ga0496110_0987985_327_650 104
859 3300048914 Ga0496111_0599572 Ga0496111_0599572_312_629 104
860 3300048914 Ga0496111_0672456 Ga0496111_0672456_288_602 104
861 3300048917 Ga0496114_0966010 Ga0496114_0966010_159_482 104
862 3300048920 Ga0496117_0005438 Ga0496117_0005438_11180_11494 104
863 3300048921 Ga0496118_0004152 Ga0496118_0004152_2056_2370 104
864 3300048922 Ga0496119_0096043 Ga0496119_0096043_180_494 104
865 3300048923 Ga0496120_0260064 Ga0496120_0260064_416_730 104
866 3300048925 Ga0496122_0001531 Ga0496122_0001531_32401_32718 104
867 3300048926 Ga0496123_0021568 Ga0496123_0021568_4072_4389 104
868 3300048927 Ga0496124_0109237 Ga0496124_0109237_1302_1619 104
869 3300048927 Ga0496124_0231018 Ga0496124_0231018_843_1163 104
870 3300049127 Ga0501306_006319 Ga0501306_006319_589_906 104
871 3300049127 Ga0501306_041409 Ga0501306_041409_123_443 104
872 3300049127 Ga0501306_060438 Ga0501306_060438_155_475 104
873 3300049128 Ga0501308_006500 Ga0501308_006500_571_894 104
874 3300049128 Ga0501308_036283 Ga0501308_036283_276_596 104
875 3300049129 Ga0501309_008114 Ga0501309_008114_386_703 104
876 3300049129 Ga0501309_014992 Ga0501309_014992_458_775 104
877 3300049130 Ga0501310_001218 Ga0501310_001218_436_759 104
878 3300049130 Ga0501310_003306 Ga0501310_003306_1215_1532 104
879 3300049160 Ga0501304_016532 Ga0501304_016532_109_432 104
880 3300049160 Ga0501304_034151 Ga0501304_034151_85_402 104
881 3300049161 Ga0501305_013093 Ga0501305_013093_615_938 104
882 3300049161 Ga0501305_028003 Ga0501305_028003_409_726 104
883 3300049161 Ga0501305_111502 Ga0501305_111502_55_375 104
884 3300049161 Ga0501305_111658 Ga0501305_111658_59_376 104
885 3300049162 Ga0501307_009615 Ga0501307_009615_561_878 104
886 3300049162 Ga0501307_015926 Ga0501307_015926_323_643 104
887 3300049162 Ga0501307_096024 Ga0501307_096024_37_354 104
888 3300049515 Ga0501292_028292 Ga0501292_028292_427_744 104
889 3300049528 Ga0501312_029704 Ga0501312_029704_159_476 104
890 3300049528 Ga0501312_066811 Ga0501312_066811_24_341 104
891 3300049529 Ga0501313_029182 Ga0501313_029182_289_606 104
892 3300049531 Ga0501315_049783 Ga0501315_049783_74_394 104
893 3300049532 Ga0501316_020777 Ga0501316_020777_377_700 104
894 3300049532 Ga0501316_021899 Ga0501316_021899_464_784 104
895 3300049533 Ga0501317_014767 Ga0501317_014767_422_739 104
896 3300049533 Ga0501317_025845 Ga0501317_025845_32_349 104
897 3300049536 Ga0501320_006472 Ga0501320_006472_281_598 104
898 3300049536 Ga0501320_048744 Ga0501320_048744_178_495 104
899 3300049537 Ga0501321_078425 Ga0501321_078425_53_373 104
900 3300049538 Ga0501322_004865 Ga0501322_004865_458_775 104
901 3300049539 Ga0501323_025314 Ga0501323_025314_140_457 104
902 3300049541 Ga0501325_025102 Ga0501325_025102_298_618 104
903 3300049549 Ga0501333_009111 Ga0501333_009111_30_347 104
904 3300049550 Ga0501334_23126 Ga0501334_23126_101_418 104
905 3300049551 Ga0501335_044513 Ga0501335_044513_78_395 104
906 3300049556 Ga0501340_011323 Ga0501340_011323_251_571 104
907 3300049569 Ga0501032_0710334 Ga0501032_0710334_94_414 104
908 3300049571 Ga0501034_0190380 Ga0501034_0190380_797_1117 104
909 3300049572 Ga0501036_1168557 Ga0501036_1168557_225_545 104
910 3300049574 Ga0501038_1245342 Ga0501038_1245342_170_490 104
911 3300049652 Ga0501202_126721 Ga0501202_126721_190_507 104
912 3300049659 Ga0501214_034943 Ga0501214_034943_357_674 104
913 3300049661 Ga0501217_044278 Ga0501217_044278_391_708 104
914 3300049669 Ga0501235_046846 Ga0501235_046846_315_632 104
915 3300049679 Ga0501249_178118 Ga0501249_178118_40_357 104
916 3300049683 Ga0501253_026120 Ga0501253_026120_351_668 104
917 3300049688 Ga0501259_203007 Ga0501259_203007_110_427 104
918 3300049704 Ga0501221_086156 Ga0501221_086156_107_424 104
919 3300049705 Ga0501225_0090544 Ga0501225_0090544_210_527 104
920 3300049708 Ga0501245_037372 Ga0501245_037372_247_564 104
921 3300049763 Ga0501266_010321 Ga0501266_010321_381_698 104
922 3300049765 Ga0501268_004965 Ga0501268_004965_190_507 104
923 3300049767 Ga0501270_154734 Ga0501270_154734_86_403 104
924 3300049768 Ga0501271_013331 Ga0501271_013331_429_746 104
925 3300049768 Ga0501271_058606 Ga0501271_058606_165_482 104
926 3300049769 Ga0501272_048841 Ga0501272_048841_22_339 104
927 3300049775 Ga0501279_104482 Ga0501279_104482_126_443 104
928 3300049822 Ga0501035_0767010 Ga0501035_0767010_301_630 104
929 3300053091 Ga0500647_0181633 Ga0500647_0181633_240_554 104
930 3300053134 Ga0500658_0113824 Ga0500658_0113824_835_1161 104
931 3300053142 Ga0500577_0253966 Ga0500577_0253966_428_748 104
932 3300053177 Ga0500636_0039359 Ga0500636_0039359_925_1239 104
933 3300059503 Ga0587080_031497 Ga0587080_031497_320_721 104
934 3300059508 Ga0587088_211511 Ga0587088_211511_159_479 104
935 3300059512 Ga0587092_012652 Ga0587092_012652_278_595 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

15

101

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9182 13 100
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9167 12 97
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9161 12 93
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.904 13 99
6spb-assembly1.cif.gz_T pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9025 11 99
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8924 13 99 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.865 10 98 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8624 15 99 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8609 12 98 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8552 13 99 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A6A5L882-F1-model_v4 deleted 0.9454 9 104
AF-A0A522CJT9-F1-model_v4 Large ribosomal subunit protein uL23 0.9441 11 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E4WGS7-F1-model_v4 Large ribosomal subunit protein uL23 0.9426 11 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7C9KLD3-F1-model_v4 Large ribosomal subunit protein uL23 0.9424 9 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6YI82-F1-model_v4 Large ribosomal subunit protein uL23 0.9416 10 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
77.99 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map