F486181
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 404 | 933 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300059477|Ga0587084_011725|Ga0587084_011725_444_761 |
| Length | 105 |
| Sequence | MAKKQAAAVDNRHSDVIVAPHITEKSTMVSEHNAVVFKVARDATKPEIKAAVEALFPSVKVTGVNTIVQKGKTKKWKGKPYTRSDVKKAIVTLADGDQIDVTQGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 2 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 107 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 123 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 126 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 221 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 222 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 223 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 225 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 231 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 232 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 235 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 236 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 237 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 238 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 239 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 240 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 241 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 242 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 243 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 244 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 290 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 291 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 292 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 302 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 326 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 327 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 328 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 329 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 330 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 332 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 333 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 334 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 335 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 339 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 341 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 342 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 348 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 349 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 350 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 351 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 355 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 358 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.7 |
| Metatranscriptomes | 12.09 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.64 |
| Nodule | 0 |
| Rhizoplane | 3.21 |
| Rhizosphere | 90.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J14986_101847 | 3300001432 | Bacteria | 1154 |
| 2 | JGI24741J21665_1001920 | 3300001915 | Bacteria | 5620 |
| 3 | JGI24741J21665_1015360 | 3300001915 | Bacteria | 1265 |
| 4 | JGI24752J21851_1000007 | 3300001976 | Bacteria | 24778 |
| 5 | JGI24747J21853_1005899 | 3300001978 | Bacteria | 1143 |
| 6 | JGI24740J21852_10015856 | 3300001979 | Bacteria | 2738 |
| 7 | JGI24739J22299_10134605 | 3300001989 | Bacteria | 734 |
| 8 | JGI24737J22298_10043760 | 3300001990 | Bacteria | 1370 |
| 9 | JGI24737J22298_10139036 | 3300001990 | Bacteria | 717 |
| 10 | JGI24735J21928_10011436 | 3300002067 | Bacteria | 2813 |
| 11 | JGI24750J21931_1000298 | 3300002070 | Bacteria | 8551 |
| 12 | JGI24748J21848_1000070 | 3300002074 | Bacteria | 36407 |
| 13 | JGI24748J21848_1008969 | 3300002074 | Bacteria | 1178 |
| 14 | JGI24749J21850_1000118 | 3300002076 | Bacteria | 13310 |
| 15 | JGI24033J26618_1044558 | 3300002155 | Bacteria | 625 |
| 16 | JGI24034J26672_10000038 | 3300002239 | Bacteria | 75372 |
| 17 | JGI24034J26672_10014302 | 3300002239 | Bacteria | 1210 |
| 18 | JGI24034J26672_10049632 | 3300002239 | Bacteria | 719 |
| 19 | JGI24742J22300_10001588 | 3300002244 | Bacteria | 3613 |
| 20 | JGI24742J22300_10003980 | 3300002244 | Bacteria | 2410 |
| 21 | JGI24751J29686_10010345 | 3300002459 | Bacteria | 1922 |
| 22 | JGI25165J46597_1000023 | 3300003214 | Bacteria | 338873 |
| 23 | JGI25153J46596_10000173 | 3300003215 | Bacteria | 64195 |
| 24 | Ga0032354_1119435 | 3300003693 | Bacteria | 542 |
| 25 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 26 | Ga0055542_1001518 | 3300003762 | Bacteria | 11230 |
| 27 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 28 | Ga0055530_10015010 | 3300003791 | Bacteria | 2552 |
| 29 | Ga0055531_10032620 | 3300003794 | Bacteria | 1697 |
| 30 | Ga0055531_10100522 | 3300003794 | Bacteria | 595 |
| 31 | Ga0058860_11860095 | 3300004801 | Bacteria | 568 |
| 32 | Ga0065712_10100550 | 3300005290 | Bacteria | 2059 |
| 33 | Ga0065712_10213194 | 3300005290 | Bacteria | 1065 |
| 34 | Ga0065712_10339614 | 3300005290 | Bacteria | 801 |
| 35 | Ga0065715_10029418 | 3300005293 | Bacteria | 1977 |
| 36 | Ga0065715_10051509 | 3300005293 | Bacteria | 992 |
| 37 | Ga0065715_10448200 | 3300005293 | Bacteria | 829 |
| 38 | Ga0065715_10565818 | 3300005293 | Bacteria | 730 |
| 39 | Ga0065715_10598461 | 3300005293 | Bacteria | 687 |
| 40 | Ga0065707_10525541 | 3300005295 | Bacteria | 739 |
| 41 | Ga0070658_10034849 | 3300005327 | Bacteria | 4051 |
| 42 | Ga0070658_10354895 | 3300005327 | Bacteria | 1255 |
| 43 | Ga0070658_10470961 | 3300005327 | Bacteria | 1083 |
| 44 | Ga0070658_10488853 | 3300005327 | Bacteria | 1062 |
| 45 | Ga0070658_10739176 | 3300005327 | Bacteria | 854 |
| 46 | Ga0070658_10790314 | 3300005327 | Bacteria | 824 |
| 47 | Ga0070658_11019730 | 3300005327 | Bacteria | 720 |
| 48 | Ga0070658_11444257 | 3300005327 | Bacteria | 597 |
| 49 | Ga0070676_10033009 | 3300005328 | Bacteria | 2968 |
| 50 | Ga0070676_10585954 | 3300005328 | Bacteria | 802 |
| 51 | Ga0070676_10770661 | 3300005328 | Bacteria | 708 |
| 52 | Ga0070683_100438274 | 3300005329 | Bacteria | 1247 |
| 53 | Ga0070683_100974924 | 3300005329 | Bacteria | 814 |
| 54 | Ga0070683_101634463 | 3300005329 | Bacteria | 619 |
| 55 | Ga0070690_100000097 | 3300005330 | Bacteria | 44576 |
| 56 | Ga0070670_100010675 | 3300005331 | Bacteria | 7846 |
| 57 | Ga0070670_100034259 | 3300005331 | Bacteria | 4370 |
| 58 | Ga0070670_100161717 | 3300005331 | Bacteria | 1940 |
| 59 | Ga0070670_100436289 | 3300005331 | Bacteria | 1159 |
| 60 | Ga0070677_10037474 | 3300005333 | Bacteria | 1892 |
| 61 | Ga0070677_10062061 | 3300005333 | Bacteria | 1544 |
| 62 | Ga0070677_10074850 | 3300005333 | Bacteria | 1433 |
| 63 | Ga0068869_101112408 | 3300005334 | Bacteria | 692 |
| 64 | Ga0070666_10000004 | 3300005335 | Bacteria | 372098 |
| 65 | Ga0070666_10191087 | 3300005335 | Bacteria | 1439 |
| 66 | Ga0070666_10490911 | 3300005335 | Bacteria | 890 |
| 67 | Ga0070680_100363294 | 3300005336 | Bacteria | 1231 |
| 68 | Ga0070682_100379432 | 3300005337 | Bacteria | 1063 |
| 69 | Ga0070682_101020532 | 3300005337 | Bacteria | 688 |
| 70 | Ga0068868_100049745 | 3300005338 | Bacteria | 3290 |
| 71 | Ga0070660_100096538 | 3300005339 | Bacteria | 2337 |
| 72 | Ga0070660_100188024 | 3300005339 | Bacteria | 1672 |
| 73 | Ga0070660_100205715 | 3300005339 | Bacteria | 1597 |
| 74 | Ga0070660_100390605 | 3300005339 | Bacteria | 1149 |
| 75 | Ga0070660_100419886 | 3300005339 | Bacteria | 1107 |
| 76 | Ga0070660_100682995 | 3300005339 | Bacteria | 860 |
| 77 | Ga0070660_101060484 | 3300005339 | Bacteria | 685 |
| 78 | Ga0070689_100106270 | 3300005340 | Bacteria | 2227 |
| 79 | Ga0070687_100263328 | 3300005343 | Bacteria | 1077 |
| 80 | Ga0070661_100033195 | 3300005344 | Bacteria | 3738 |
| 81 | Ga0070661_100101205 | 3300005344 | Bacteria | 2143 |
| 82 | Ga0070661_100122997 | 3300005344 | Bacteria | 1944 |
| 83 | Ga0070661_100353376 | 3300005344 | Bacteria | 1153 |
| 84 | Ga0070661_100410927 | 3300005344 | Bacteria | 1071 |
| 85 | Ga0070661_100763169 | 3300005344 | Bacteria | 791 |
| 86 | Ga0070661_101222862 | 3300005344 | Bacteria | 629 |
| 87 | Ga0070692_10047048 | 3300005345 | Bacteria | 2231 |
| 88 | Ga0070668_100078782 | 3300005347 | Bacteria | 2578 |
| 89 | Ga0070668_100164638 | 3300005347 | Bacteria | 1801 |
| 90 | Ga0070668_100367114 | 3300005347 | Bacteria | 1222 |
| 91 | Ga0070668_100773108 | 3300005347 | Bacteria | 851 |
| 92 | Ga0070669_100000296 | 3300005353 | Bacteria | 39004 |
| 93 | Ga0070669_100177439 | 3300005353 | Bacteria | 1665 |
| 94 | Ga0070669_100200612 | 3300005353 | Bacteria | 1569 |
| 95 | Ga0070669_100285920 | 3300005353 | Bacteria | 1322 |
| 96 | Ga0070669_100485009 | 3300005353 | Bacteria | 1023 |
| 97 | Ga0070669_100971176 | 3300005353 | Bacteria | 728 |
| 98 | Ga0070669_101061793 | 3300005353 | Bacteria | 696 |
| 99 | Ga0070669_101128734 | 3300005353 | Bacteria | 676 |
| 100 | Ga0070669_101391820 | 3300005353 | Bacteria | 609 |
| 101 | Ga0070675_100190962 | 3300005354 | Bacteria | 1775 |
| 102 | Ga0070675_100775834 | 3300005354 | Bacteria | 875 |
| 103 | Ga0070675_100929592 | 3300005354 | Bacteria | 797 |
| 104 | Ga0070671_100012607 | 3300005355 | Bacteria | 6811 |
| 105 | Ga0070671_100023714 | 3300005355 | Bacteria | 5023 |
| 106 | Ga0070671_100203448 | 3300005355 | Bacteria | 1679 |
| 107 | Ga0070671_100258242 | 3300005355 | Bacteria | 1481 |
| 108 | Ga0070671_100402823 | 3300005355 | Bacteria | 1170 |
| 109 | Ga0070671_100490132 | 3300005355 | Bacteria | 1057 |
| 110 | Ga0070674_100112061 | 3300005356 | Bacteria | 2005 |
| 111 | Ga0070674_100242117 | 3300005356 | Bacteria | 1413 |
| 112 | Ga0070673_100127669 | 3300005364 | Bacteria | 2129 |
| 113 | Ga0070673_100880830 | 3300005364 | Bacteria | 829 |
| 114 | Ga0070688_100002383 | 3300005365 | Bacteria | 9493 |
| 115 | Ga0070659_100033177 | 3300005366 | Bacteria | 4008 |
| 116 | Ga0070659_100235299 | 3300005366 | Bacteria | 1514 |
| 117 | Ga0070659_100242738 | 3300005366 | Bacteria | 1491 |
| 118 | Ga0070659_100278332 | 3300005366 | Bacteria | 1392 |
| 119 | Ga0070659_101135244 | 3300005366 | Bacteria | 690 |
| 120 | Ga0070659_101152500 | 3300005366 | Bacteria | 684 |
| 121 | Ga0070659_101427295 | 3300005366 | Bacteria | 616 |
| 122 | Ga0070667_100061703 | 3300005367 | Bacteria | 3174 |
| 123 | Ga0070667_100200068 | 3300005367 | Bacteria | 1772 |
| 124 | Ga0070667_102150601 | 3300005367 | Bacteria | 526 |
| 125 | Ga0070714_100025886 | 3300005435 | Bacteria | 4845 |
| 126 | Ga0070714_100507601 | 3300005435 | Bacteria | 1150 |
| 127 | Ga0070713_100239005 | 3300005436 | Bacteria | 1654 |
| 128 | Ga0070700_101543717 | 3300005441 | Bacteria | 566 |
| 129 | Ga0070663_100080949 | 3300005455 | Bacteria | 2386 |
| 130 | Ga0070663_100751747 | 3300005455 | Bacteria | 832 |
| 131 | Ga0070663_101348259 | 3300005455 | Bacteria | 630 |
| 132 | Ga0070678_100017885 | 3300005456 | Bacteria | 4578 |
| 133 | Ga0070678_100403125 | 3300005456 | Bacteria | 1189 |
| 134 | Ga0070662_100046495 | 3300005457 | Bacteria | 3119 |
| 135 | Ga0070662_100064573 | 3300005457 | Bacteria | 2681 |
| 136 | Ga0070662_100483155 | 3300005457 | Bacteria | 1031 |
| 137 | Ga0070681_10807026 | 3300005458 | Bacteria | 856 |
| 138 | Ga0070681_10847619 | 3300005458 | Bacteria | 832 |
| 139 | Ga0068867_100321187 | 3300005459 | Bacteria | 1283 |
| 140 | Ga0070685_10000262 | 3300005466 | Bacteria | 33728 |
| 141 | Ga0070679_100226535 | 3300005530 | Bacteria | 1829 |
| 142 | Ga0070679_100321123 | 3300005530 | Bacteria | 1498 |
| 143 | Ga0070679_101542479 | 3300005530 | Bacteria | 611 |
| 144 | Ga0070684_100653704 | 3300005535 | Bacteria | 979 |
| 145 | Ga0070684_101371812 | 3300005535 | Bacteria | 665 |
| 146 | Ga0068853_100079177 | 3300005539 | Bacteria | 2873 |
| 147 | Ga0068853_100151532 | 3300005539 | Bacteria | 2087 |
| 148 | Ga0068853_100535457 | 3300005539 | Bacteria | 1108 |
| 149 | Ga0068853_100674894 | 3300005539 | Bacteria | 984 |
| 150 | Ga0068853_102312984 | 3300005539 | Bacteria | 521 |
| 151 | Ga0070672_100207425 | 3300005543 | Bacteria | 1640 |
| 152 | Ga0070686_100000061 | 3300005544 | Bacteria | 83811 |
| 153 | Ga0070696_100112118 | 3300005546 | Bacteria | 1965 |
| 154 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 155 | Ga0070665_100009730 | 3300005548 | Bacteria | 9719 |
| 156 | Ga0070665_100280359 | 3300005548 | Bacteria | 1668 |
| 157 | Ga0070665_100339978 | 3300005548 | Bacteria | 1506 |
| 158 | Ga0070665_101500274 | 3300005548 | Bacteria | 683 |
| 159 | Ga0068855_100616645 | 3300005563 | Bacteria | 1168 |
| 160 | Ga0070664_100101975 | 3300005564 | Bacteria | 2496 |
| 161 | Ga0070664_100216063 | 3300005564 | Bacteria | 1714 |
| 162 | Ga0070664_100325070 | 3300005564 | Bacteria | 1394 |
| 163 | Ga0070664_100520843 | 3300005564 | Bacteria | 1097 |
| 164 | Ga0070664_100749325 | 3300005564 | Bacteria | 912 |
| 165 | Ga0070664_100898377 | 3300005564 | Bacteria | 830 |
| 166 | Ga0070664_101327312 | 3300005564 | Bacteria | 679 |
| 167 | Ga0070664_101808126 | 3300005564 | Bacteria | 579 |
| 168 | Ga0070664_102074491 | 3300005564 | Bacteria | 539 |
| 169 | Ga0068857_100226553 | 3300005577 | Bacteria | 1708 |
| 170 | Ga0068857_100686033 | 3300005577 | Bacteria | 972 |
| 171 | Ga0068857_100808385 | 3300005577 | Bacteria | 895 |
| 172 | Ga0068857_101067976 | 3300005577 | Bacteria | 779 |
| 173 | Ga0068854_100063035 | 3300005578 | Bacteria | 2690 |
| 174 | Ga0068854_100217907 | 3300005578 | Bacteria | 1509 |
| 175 | Ga0068856_100050714 | 3300005614 | Bacteria | 4091 |
| 176 | Ga0068856_100150227 | 3300005614 | Bacteria | 2338 |
| 177 | Ga0068856_102249078 | 3300005614 | Bacteria | 554 |
| 178 | Ga0068852_100218546 | 3300005616 | Bacteria | 1811 |
| 179 | Ga0068852_100329391 | 3300005616 | Bacteria | 1485 |
| 180 | Ga0068852_100931418 | 3300005616 | Bacteria | 886 |
| 181 | Ga0068852_100947817 | 3300005616 | Bacteria | 879 |
| 182 | Ga0068859_100001416 | 3300005617 | Bacteria | 24328 |
| 183 | Ga0068859_100010520 | 3300005617 | Bacteria | 9310 |
| 184 | Ga0068859_100275602 | 3300005617 | Bacteria | 1774 |
| 185 | Ga0068859_100839699 | 3300005617 | Bacteria | 1005 |
| 186 | Ga0068859_101860805 | 3300005617 | Bacteria | 665 |
| 187 | Ga0068864_100002567 | 3300005618 | Bacteria | 14987 |
| 188 | Ga0068864_101049438 | 3300005618 | Bacteria | 810 |
| 189 | Ga0068861_100000040 | 3300005719 | Bacteria | 59725 |
| 190 | Ga0068861_100002842 | 3300005719 | Bacteria | 11386 |
| 191 | Ga0068861_101088385 | 3300005719 | Bacteria | 768 |
| 192 | Ga0068851_10011439 | 3300005834 | Bacteria | 4162 |
| 193 | Ga0068851_10360727 | 3300005834 | Bacteria | 847 |
| 194 | Ga0068851_10423600 | 3300005834 | Bacteria | 786 |
| 195 | Ga0068870_10272613 | 3300005840 | Bacteria | 1058 |
| 196 | Ga0068870_11021802 | 3300005840 | Bacteria | 591 |
| 197 | Ga0068863_100000013 | 3300005841 | Bacteria | 220357 |
| 198 | Ga0068863_100909232 | 3300005841 | Bacteria | 881 |
| 199 | Ga0068858_100000664 | 3300005842 | Bacteria | 35973 |
| 200 | Ga0068858_100008722 | 3300005842 | Bacteria | 9734 |
| 201 | Ga0068860_100000009 | 3300005843 | Bacteria | 372089 |
| 202 | Ga0068860_100007808 | 3300005843 | Bacteria | 10684 |
| 203 | Ga0068860_100544238 | 3300005843 | Bacteria | 1163 |
| 204 | Ga0068862_100001446 | 3300005844 | Bacteria | 21877 |
| 205 | Ga0081539_10018995 | 3300005985 | Bacteria | 4732 |
| 206 | Ga0070717_11649270 | 3300006028 | Bacteria | 581 |
| 207 | Ga0075367_10454611 | 3300006178 | Bacteria | 812 |
| 208 | Ga0097621_100066302 | 3300006237 | Bacteria | 2973 |
| 209 | Ga0075370_10375338 | 3300006353 | Bacteria | 851 |
| 210 | Ga0075370_10388167 | 3300006353 | Bacteria | 837 |
| 211 | Ga0068871_100064899 | 3300006358 | Bacteria | 2990 |
| 212 | Ga0075430_101382922 | 3300006846 | Bacteria | 579 |
| 213 | Ga0068865_100650878 | 3300006881 | Bacteria | 896 |
| 214 | Ga0068865_101545290 | 3300006881 | Bacteria | 596 |
| 215 | Ga0097620_100001416 | 3300006931 | Bacteria | 24328 |
| 216 | Ga0097620_100010519 | 3300006931 | Bacteria | 9310 |
| 217 | Ga0097620_100275611 | 3300006931 | Bacteria | 1774 |
| 218 | Ga0097620_100839823 | 3300006931 | Bacteria | 1005 |
| 219 | Ga0097620_101860871 | 3300006931 | Bacteria | 665 |
| 220 | Ga0105250_10073036 | 3300009092 | Bacteria | 1387 |
| 221 | Ga0105240_10206568 | 3300009093 | Bacteria | 2298 |
| 222 | Ga0105240_10700183 | 3300009093 | Bacteria | 1106 |
| 223 | Ga0105245_12705906 | 3300009098 | Bacteria | 549 |
| 224 | Ga0105243_10003106 | 3300009148 | Bacteria | 13657 |
| 225 | Ga0105243_10737663 | 3300009148 | Bacteria | 964 |
| 226 | Ga0105241_12401405 | 3300009174 | Bacteria | 526 |
| 227 | Ga0105241_12609145 | 3300009174 | Bacteria | 508 |
| 228 | Ga0105248_10023935 | 3300009177 | Bacteria | 6788 |
| 229 | Ga0105248_10316717 | 3300009177 | Bacteria | 1757 |
| 230 | Ga0105248_10573441 | 3300009177 | Bacteria | 1273 |
| 231 | Ga0105248_11013124 | 3300009177 | Bacteria | 938 |
| 232 | Ga0105248_11284805 | 3300009177 | Bacteria | 828 |
| 233 | Ga0105237_12029783 | 3300009545 | Bacteria | 584 |
| 234 | Ga0105238_10931313 | 3300009551 | Bacteria | 888 |
| 235 | Ga0105238_11034238 | 3300009551 | Bacteria | 843 |
| 236 | Ga0105238_11508862 | 3300009551 | Bacteria | 701 |
| 237 | Ga0105249_10000006 | 3300009553 | Bacteria | 354449 |
| 238 | Ga0105148_117490 | 3300009978 | Bacteria | 569 |
| 239 | Ga0105239_10090567 | 3300010375 | Bacteria | 3374 |
| 240 | Ga0105239_13502082 | 3300010375 | Bacteria | 510 |
| 241 | Ga0105246_10099608 | 3300011119 | Bacteria | 2113 |
| 242 | Ga0157317_1000418 | 3300012475 | Bacteria | 1780 |
| 243 | Ga0157327_1023822 | 3300012512 | Bacteria | 713 |
| 244 | Ga0157373_10425298 | 3300013100 | Bacteria | 954 |
| 245 | Ga0157373_10426491 | 3300013100 | Bacteria | 952 |
| 246 | Ga0157373_10501180 | 3300013100 | Bacteria | 877 |
| 247 | Ga0157373_11121058 | 3300013100 | Bacteria | 591 |
| 248 | Ga0157371_10000059 | 3300013102 | Bacteria | 170541 |
| 249 | Ga0157371_10123034 | 3300013102 | Bacteria | 1845 |
| 250 | Ga0157371_11159258 | 3300013102 | Bacteria | 594 |
| 251 | Ga0157370_10024969 | 3300013104 | Bacteria | 5914 |
| 252 | Ga0157370_11334238 | 3300013104 | Bacteria | 646 |
| 253 | Ga0157370_11633359 | 3300013104 | Bacteria | 579 |
| 254 | Ga0157369_10034063 | 3300013105 | Bacteria | 5592 |
| 255 | Ga0157369_10552266 | 3300013105 | Bacteria | 1190 |
| 256 | Ga0157369_11190963 | 3300013105 | Bacteria | 778 |
| 257 | Ga0157369_11220717 | 3300013105 | Bacteria | 767 |
| 258 | Ga0157374_10104316 | 3300013296 | Bacteria | 2722 |
| 259 | Ga0157374_10414168 | 3300013296 | Bacteria | 1346 |
| 260 | Ga0157378_10232281 | 3300013297 | Bacteria | 1758 |
| 261 | Ga0157378_10273729 | 3300013297 | Bacteria | 1625 |
| 262 | Ga0163162_10034071 | 3300013306 | Bacteria | 5066 |
| 263 | Ga0163162_10072394 | 3300013306 | Bacteria | 3501 |
| 264 | Ga0163162_10109281 | 3300013306 | Bacteria | 2862 |
| 265 | Ga0163162_10789338 | 3300013306 | Bacteria | 1067 |
| 266 | Ga0163162_11697639 | 3300013306 | Bacteria | 721 |
| 267 | Ga0157372_10308225 | 3300013307 | Bacteria | 1842 |
| 268 | Ga0157372_10659289 | 3300013307 | Bacteria | 1218 |
| 269 | Ga0157372_10774507 | 3300013307 | Bacteria | 1115 |
| 270 | Ga0157372_11061209 | 3300013307 | Bacteria | 938 |
| 271 | Ga0157372_11111232 | 3300013307 | Bacteria | 914 |
| 272 | Ga0157375_10657450 | 3300013308 | Bacteria | 1204 |
| 273 | Ga0157375_12866978 | 3300013308 | Bacteria | 576 |
| 274 | Ga0157375_13433680 | 3300013308 | Bacteria | 527 |
| 275 | Ga0157375_13535204 | 3300013308 | Bacteria | 520 |
| 276 | Ga0163163_10019994 | 3300014325 | Bacteria | 6300 |
| 277 | Ga0157380_10116019 | 3300014326 | Bacteria | 2259 |
| 278 | Ga0157380_10235709 | 3300014326 | Bacteria | 1647 |
| 279 | Ga0157380_11993450 | 3300014326 | Bacteria | 642 |
| 280 | Ga0157379_10001735 | 3300014968 | Bacteria | 18043 |
| 281 | Ga0157379_10003973 | 3300014968 | Bacteria | 12609 |
| 282 | Ga0163161_10000208 | 3300017792 | Bacteria | 53837 |
| 283 | Ga0163161_10222559 | 3300017792 | Bacteria | 1462 |
| 284 | Ga0163161_10441763 | 3300017792 | Bacteria | 1050 |
| 285 | Ga0163161_10751429 | 3300017792 | Bacteria | 816 |
| 286 | Ga0197907_10820967 | 3300020069 | Bacteria | 835 |
| 287 | Ga0197907_10990692 | 3300020069 | Bacteria | 515 |
| 288 | Ga0206355_1017096 | 3300020076 | Bacteria | 1277 |
| 289 | Ga0206352_10437088 | 3300020078 | Bacteria | 792 |
| 290 | Ga0213876_10166713 | 3300021384 | Bacteria | 1172 |
| 291 | Ga0213875_10001626 | 3300021388 | Bacteria | 14182 |
| 292 | Ga0207672_1001700 | 3300025223 | Bacteria | 1545 |
| 293 | Ga0209674_102700 | 3300025226 | Bacteria | 3641 |
| 294 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 295 | Ga0207427_100986 | 3300025231 | Bacteria | 12010 |
| 296 | Ga0209026_1000352 | 3300025250 | Bacteria | 43432 |
| 297 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 298 | Ga0209759_1033090 | 3300025256 | Bacteria | 985 |
| 299 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 300 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 301 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 302 | Ga0209050_1021913 | 3300025298 | Bacteria | 2308 |
| 303 | Ga0209257_1000577 | 3300025304 | Bacteria | 61710 |
| 304 | Ga0209257_1000597 | 3300025304 | Bacteria | 59900 |
| 305 | Ga0209257_1006247 | 3300025304 | Bacteria | 7796 |
| 306 | Ga0207697_10101229 | 3300025315 | Bacteria | 1228 |
| 307 | Ga0207697_10161798 | 3300025315 | Bacteria | 977 |
| 308 | Ga0207697_10172294 | 3300025315 | Bacteria | 947 |
| 309 | Ga0207656_10002150 | 3300025321 | Bacteria | 6586 |
| 310 | Ga0207656_10043235 | 3300025321 | Bacteria | 1921 |
| 311 | Ga0207682_10073759 | 3300025893 | Bacteria | 1450 |
| 312 | Ga0207682_10092570 | 3300025893 | Bacteria | 1312 |
| 313 | Ga0207682_10487689 | 3300025893 | Bacteria | 584 |
| 314 | Ga0207680_10000010 | 3300025903 | Bacteria | 414170 |
| 315 | Ga0207680_10225072 | 3300025903 | Bacteria | 1287 |
| 316 | Ga0207680_10490110 | 3300025903 | Bacteria | 875 |
| 317 | Ga0207645_10026399 | 3300025907 | Bacteria | 3754 |
| 318 | Ga0207645_10174952 | 3300025907 | Bacteria | 1408 |
| 319 | Ga0207645_10567128 | 3300025907 | Bacteria | 770 |
| 320 | Ga0207645_10728755 | 3300025907 | Bacteria | 674 |
| 321 | Ga0207643_10178103 | 3300025908 | Bacteria | 1285 |
| 322 | Ga0207643_10411592 | 3300025908 | Bacteria | 856 |
| 323 | Ga0207705_10000511 | 3300025909 | Bacteria | 33036 |
| 324 | Ga0207705_10001825 | 3300025909 | Bacteria | 16767 |
| 325 | Ga0207705_10026545 | 3300025909 | Bacteria | 4130 |
| 326 | Ga0207705_10207656 | 3300025909 | Bacteria | 1485 |
| 327 | Ga0207705_10460666 | 3300025909 | Bacteria | 986 |
| 328 | Ga0207654_11246107 | 3300025911 | Bacteria | 542 |
| 329 | Ga0207707_10362538 | 3300025912 | Bacteria | 1248 |
| 330 | Ga0207707_10757610 | 3300025912 | Bacteria | 811 |
| 331 | Ga0207695_10003496 | 3300025913 | Bacteria | 22050 |
| 332 | Ga0207695_11296827 | 3300025913 | Bacteria | 609 |
| 333 | Ga0207671_10004021 | 3300025914 | Bacteria | 14287 |
| 334 | Ga0207660_10884083 | 3300025917 | Bacteria | 729 |
| 335 | Ga0207662_10431934 | 3300025918 | Bacteria | 898 |
| 336 | Ga0207662_10438171 | 3300025918 | Bacteria | 892 |
| 337 | Ga0207662_10741161 | 3300025918 | Bacteria | 690 |
| 338 | Ga0207662_10813593 | 3300025918 | Bacteria | 659 |
| 339 | Ga0207657_10061226 | 3300025919 | Bacteria | 3228 |
| 340 | Ga0207657_10132430 | 3300025919 | Bacteria | 2043 |
| 341 | Ga0207657_10231765 | 3300025919 | Bacteria | 1477 |
| 342 | Ga0207657_10348096 | 3300025919 | Bacteria | 1169 |
| 343 | Ga0207657_10587063 | 3300025919 | Bacteria | 870 |
| 344 | Ga0207657_10671567 | 3300025919 | Bacteria | 806 |
| 345 | Ga0207649_10363671 | 3300025920 | Bacteria | 1074 |
| 346 | Ga0207649_10366653 | 3300025920 | Bacteria | 1070 |
| 347 | Ga0207649_11415093 | 3300025920 | Bacteria | 550 |
| 348 | Ga0207652_10226817 | 3300025921 | Bacteria | 1684 |
| 349 | Ga0207652_10573323 | 3300025921 | Bacteria | 1013 |
| 350 | Ga0207681_10000197 | 3300025923 | Bacteria | 48475 |
| 351 | Ga0207681_10104132 | 3300025923 | Bacteria | 2052 |
| 352 | Ga0207681_10226635 | 3300025923 | Bacteria | 1449 |
| 353 | Ga0207681_10446773 | 3300025923 | Bacteria | 1051 |
| 354 | Ga0207681_10788222 | 3300025923 | Bacteria | 793 |
| 355 | Ga0207694_10054679 | 3300025924 | Bacteria | 3097 |
| 356 | Ga0207694_10417758 | 3300025924 | Bacteria | 1117 |
| 357 | Ga0207650_10001567 | 3300025925 | Bacteria | 16344 |
| 358 | Ga0207650_10102411 | 3300025925 | Bacteria | 2206 |
| 359 | Ga0207650_10181519 | 3300025925 | Bacteria | 1677 |
| 360 | Ga0207659_10002689 | 3300025926 | Bacteria | 10592 |
| 361 | Ga0207659_10035680 | 3300025926 | Bacteria | 3440 |
| 362 | Ga0207659_10521695 | 3300025926 | Bacteria | 1007 |
| 363 | Ga0207659_10830814 | 3300025926 | Bacteria | 794 |
| 364 | Ga0207700_10528921 | 3300025928 | Bacteria | 1045 |
| 365 | Ga0207664_10356883 | 3300025929 | Bacteria | 1294 |
| 366 | Ga0207644_10005181 | 3300025931 | Bacteria | 8514 |
| 367 | Ga0207644_10008230 | 3300025931 | Bacteria | 6831 |
| 368 | Ga0207644_10261373 | 3300025931 | Bacteria | 1384 |
| 369 | Ga0207690_10003585 | 3300025932 | Bacteria | 9247 |
| 370 | Ga0207690_10063154 | 3300025932 | Bacteria | 2524 |
| 371 | Ga0207690_10596524 | 3300025932 | Bacteria | 901 |
| 372 | Ga0207690_11047541 | 3300025932 | Bacteria | 679 |
| 373 | Ga0207690_11379996 | 3300025932 | Bacteria | 589 |
| 374 | Ga0207706_10041209 | 3300025933 | Bacteria | 4094 |
| 375 | Ga0207706_10079122 | 3300025933 | Bacteria | 2891 |
| 376 | Ga0207706_10141807 | 3300025933 | Bacteria | 2114 |
| 377 | Ga0207706_10178089 | 3300025933 | Bacteria | 1868 |
| 378 | Ga0207686_10324797 | 3300025934 | Bacteria | 1151 |
| 379 | Ga0207709_10000246 | 3300025935 | Bacteria | 66685 |
| 380 | Ga0207670_10087907 | 3300025936 | Bacteria | 2190 |
| 381 | Ga0207669_10190199 | 3300025937 | Bacteria | 1480 |
| 382 | Ga0207669_10390138 | 3300025937 | Bacteria | 1087 |
| 383 | Ga0207704_11679469 | 3300025938 | Bacteria | 546 |
| 384 | Ga0207691_10036228 | 3300025940 | Bacteria | 4571 |
| 385 | Ga0207691_10040894 | 3300025940 | Bacteria | 4282 |
| 386 | Ga0207691_10201747 | 3300025940 | Bacteria | 1730 |
| 387 | Ga0207711_10006762 | 3300025941 | Bacteria | 9642 |
| 388 | Ga0207711_10023215 | 3300025941 | Bacteria | 5191 |
| 389 | Ga0207711_10258467 | 3300025941 | Bacteria | 1600 |
| 390 | Ga0207711_11042046 | 3300025941 | Bacteria | 758 |
| 391 | Ga0207689_10983605 | 3300025942 | Bacteria | 712 |
| 392 | Ga0207661_11104522 | 3300025944 | Bacteria | 730 |
| 393 | Ga0207661_11515151 | 3300025944 | Bacteria | 614 |
| 394 | Ga0207661_11593960 | 3300025944 | Bacteria | 597 |
| 395 | Ga0207679_10001466 | 3300025945 | Bacteria | 14785 |
| 396 | Ga0207679_10010673 | 3300025945 | Bacteria | 5922 |
| 397 | Ga0207679_10082101 | 3300025945 | Bacteria | 2467 |
| 398 | Ga0207679_10408309 | 3300025945 | Bacteria | 1196 |
| 399 | Ga0207679_10410191 | 3300025945 | Bacteria | 1193 |
| 400 | Ga0207679_10571387 | 3300025945 | Bacteria | 1016 |
| 401 | Ga0207679_10978667 | 3300025945 | Bacteria | 775 |
| 402 | Ga0207679_11063512 | 3300025945 | Bacteria | 742 |
| 403 | Ga0207679_11467690 | 3300025945 | Bacteria | 626 |
| 404 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 405 | Ga0207667_10742685 | 3300025949 | Bacteria | 981 |
| 406 | Ga0207651_10407069 | 3300025960 | Bacteria | 1158 |
| 407 | Ga0207651_10764349 | 3300025960 | Bacteria | 855 |
| 408 | Ga0207651_11202960 | 3300025960 | Bacteria | 680 |
| 409 | Ga0207712_10000014 | 3300025961 | Bacteria | 375393 |
| 410 | Ga0207668_10000402 | 3300025972 | Bacteria | 27270 |
| 411 | Ga0207668_10066198 | 3300025972 | Bacteria | 2560 |
| 412 | Ga0207668_10348910 | 3300025972 | Bacteria | 1237 |
| 413 | Ga0207668_11637182 | 3300025972 | Bacteria | 581 |
| 414 | Ga0207640_10002027 | 3300025981 | Bacteria | 10944 |
| 415 | Ga0207640_10075290 | 3300025981 | Bacteria | 2287 |
| 416 | Ga0207640_10461720 | 3300025981 | Bacteria | 1049 |
| 417 | Ga0207640_10924496 | 3300025981 | Bacteria | 763 |
| 418 | Ga0207658_10000428 | 3300025986 | Bacteria | 39861 |
| 419 | Ga0207658_10364702 | 3300025986 | Bacteria | 1261 |
| 420 | Ga0207677_10292498 | 3300026023 | Bacteria | 1342 |
| 421 | Ga0207703_10002426 | 3300026035 | Bacteria | 16170 |
| 422 | Ga0207703_10101770 | 3300026035 | Bacteria | 2436 |
| 423 | Ga0207639_10003616 | 3300026041 | Bacteria | 10382 |
| 424 | Ga0207639_10371981 | 3300026041 | Bacteria | 1281 |
| 425 | Ga0207639_11075163 | 3300026041 | Bacteria | 754 |
| 426 | Ga0207639_11347168 | 3300026041 | Bacteria | 670 |
| 427 | Ga0207639_12146318 | 3300026041 | Bacteria | 520 |
| 428 | Ga0207639_12242416 | 3300026041 | Bacteria | 507 |
| 429 | Ga0207678_10004876 | 3300026067 | Bacteria | 12048 |
| 430 | Ga0207678_10053905 | 3300026067 | Bacteria | 3464 |
| 431 | Ga0207678_10224561 | 3300026067 | Bacteria | 1608 |
| 432 | Ga0207678_10253198 | 3300026067 | Bacteria | 1508 |
| 433 | Ga0207678_11674042 | 3300026067 | Bacteria | 559 |
| 434 | Ga0207702_10050310 | 3300026078 | Bacteria | 3518 |
| 435 | Ga0207702_10425095 | 3300026078 | Bacteria | 1285 |
| 436 | Ga0207702_11087542 | 3300026078 | Bacteria | 793 |
| 437 | Ga0207641_10000099 | 3300026088 | Bacteria | 122892 |
| 438 | Ga0207641_11103809 | 3300026088 | Bacteria | 792 |
| 439 | Ga0207641_11530673 | 3300026088 | Bacteria | 669 |
| 440 | Ga0207648_10339403 | 3300026089 | Bacteria | 1353 |
| 441 | Ga0207648_10432267 | 3300026089 | Bacteria | 1197 |
| 442 | Ga0207676_10001345 | 3300026095 | Bacteria | 18261 |
| 443 | Ga0207676_10214204 | 3300026095 | Bacteria | 1711 |
| 444 | Ga0207676_10710927 | 3300026095 | Bacteria | 974 |
| 445 | Ga0207676_11166737 | 3300026095 | Bacteria | 763 |
| 446 | Ga0207676_11852928 | 3300026095 | Bacteria | 602 |
| 447 | Ga0207674_10060601 | 3300026116 | Bacteria | 3826 |
| 448 | Ga0207674_10219882 | 3300026116 | Bacteria | 1848 |
| 449 | Ga0207674_10295063 | 3300026116 | Bacteria | 1570 |
| 450 | Ga0207674_10397602 | 3300026116 | Bacteria | 1332 |
| 451 | Ga0207675_100000157 | 3300026118 | Bacteria | 59865 |
| 452 | Ga0207675_100006214 | 3300026118 | Bacteria | 11342 |
| 453 | Ga0207675_101390482 | 3300026118 | Bacteria | 722 |
| 454 | Ga0207675_102107866 | 3300026118 | Bacteria | 580 |
| 455 | Ga0207683_10054331 | 3300026121 | Bacteria | 3512 |
| 456 | Ga0207683_10092626 | 3300026121 | Bacteria | 2693 |
| 457 | Ga0207683_10647030 | 3300026121 | Bacteria | 979 |
| 458 | Ga0207683_11075667 | 3300026121 | Bacteria | 746 |
| 459 | Ga0207683_12118535 | 3300026121 | Bacteria | 510 |
| 460 | Ga0207698_10002491 | 3300026142 | Bacteria | 10925 |
| 461 | Ga0207698_10177021 | 3300026142 | Bacteria | 1885 |
| 462 | Ga0207698_10476228 | 3300026142 | Bacteria | 1210 |
| 463 | Ga0207698_10829115 | 3300026142 | Bacteria | 929 |
| 464 | Ga0207698_12055575 | 3300026142 | Bacteria | 585 |
| 465 | Ga0209967_1018450 | 3300027364 | Bacteria | 1011 |
| 466 | Ga0209967_1023094 | 3300027364 | Bacteria | 914 |
| 467 | Ga0209984_1015877 | 3300027424 | Bacteria | 1003 |
| 468 | Ga0210000_1086907 | 3300027462 | Bacteria | 515 |
| 469 | Ga0209999_1039061 | 3300027543 | Bacteria | 888 |
| 470 | Ga0209998_10071771 | 3300027717 | Bacteria | 828 |
| 471 | Ga0209974_10165900 | 3300027876 | Bacteria | 803 |
| 472 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 473 | Ga0268266_10022523 | 3300028379 | Bacteria | 5368 |
| 474 | Ga0268266_10140961 | 3300028379 | Bacteria | 2163 |
| 475 | Ga0268266_10396572 | 3300028379 | Bacteria | 1304 |
| 476 | Ga0268265_10000047 | 3300028380 | Bacteria | 179354 |
| 477 | Ga0268265_10000074 | 3300028380 | Bacteria | 127599 |
| 478 | Ga0268264_10000023 | 3300028381 | Bacteria | 471408 |
| 479 | Ga0268264_10000215 | 3300028381 | Bacteria | 113994 |
| 480 | Ga0307408_100006443 | 3300031548 | Bacteria | 7780 |
| 481 | Ga0307408_100199693 | 3300031548 | Bacteria | 1617 |
| 482 | Ga0307408_100206209 | 3300031548 | Bacteria | 1594 |
| 483 | Ga0307408_100225187 | 3300031548 | Bacteria | 1532 |
| 484 | Ga0307408_100287569 | 3300031548 | Bacteria | 1371 |
| 485 | Ga0307408_100342407 | 3300031548 | Bacteria | 1266 |
| 486 | Ga0307408_100485545 | 3300031548 | Bacteria | 1078 |
| 487 | Ga0307408_100553889 | 3300031548 | Bacteria | 1015 |
| 488 | Ga0307408_100790692 | 3300031548 | Bacteria | 860 |
| 489 | Ga0307408_100910882 | 3300031548 | Bacteria | 805 |
| 490 | Ga0307408_102519534 | 3300031548 | Bacteria | 500 |
| 491 | Ga0307405_10019698 | 3300031731 | Bacteria | 3754 |
| 492 | Ga0307405_10059852 | 3300031731 | Bacteria | 2401 |
| 493 | Ga0307405_10194476 | 3300031731 | Bacteria | 1467 |
| 494 | Ga0307405_10207937 | 3300031731 | Bacteria | 1426 |
| 495 | Ga0307405_10266437 | 3300031731 | Bacteria | 1282 |
| 496 | Ga0307405_10272146 | 3300031731 | Bacteria | 1270 |
| 497 | Ga0307405_10295455 | 3300031731 | Bacteria | 1226 |
| 498 | Ga0307405_10375159 | 3300031731 | Bacteria | 1105 |
| 499 | Ga0307405_10407978 | 3300031731 | Bacteria | 1065 |
| 500 | Ga0307405_11027308 | 3300031731 | Bacteria | 705 |
| 501 | Ga0307413_10008194 | 3300031824 | Bacteria | 4915 |
| 502 | Ga0307413_10029315 | 3300031824 | Bacteria | 3077 |
| 503 | Ga0307413_10070575 | 3300031824 | Bacteria | 2197 |
| 504 | Ga0307413_10129469 | 3300031824 | Bacteria | 1724 |
| 505 | Ga0307413_10140586 | 3300031824 | Bacteria | 1667 |
| 506 | Ga0307413_10154999 | 3300031824 | Bacteria | 1601 |
| 507 | Ga0307413_10272832 | 3300031824 | Bacteria | 1267 |
| 508 | Ga0307413_10295163 | 3300031824 | Bacteria | 1226 |
| 509 | Ga0307413_10297407 | 3300031824 | Bacteria | 1222 |
| 510 | Ga0307413_10307518 | 3300031824 | Bacteria | 1205 |
| 511 | Ga0307413_10386170 | 3300031824 | Bacteria | 1092 |
| 512 | Ga0307413_10532399 | 3300031824 | Bacteria | 949 |
| 513 | Ga0307413_10569105 | 3300031824 | Bacteria | 922 |
| 514 | Ga0307413_10655336 | 3300031824 | Bacteria | 866 |
| 515 | Ga0307413_10851390 | 3300031824 | Bacteria | 770 |
| 516 | Ga0307413_10910711 | 3300031824 | Bacteria | 747 |
| 517 | Ga0307413_11294230 | 3300031824 | Bacteria | 637 |
| 518 | Ga0307413_12093706 | 3300031824 | Bacteria | 511 |
| 519 | Ga0307410_10030817 | 3300031852 | Bacteria | 3432 |
| 520 | Ga0307410_10043934 | 3300031852 | Bacteria | 2964 |
| 521 | Ga0307410_10049247 | 3300031852 | Bacteria | 2827 |
| 522 | Ga0307410_10059688 | 3300031852 | Bacteria | 2604 |
| 523 | Ga0307410_10096687 | 3300031852 | Bacteria | 2108 |
| 524 | Ga0307410_10112543 | 3300031852 | Bacteria | 1971 |
| 525 | Ga0307410_10134883 | 3300031852 | Bacteria | 1818 |
| 526 | Ga0307410_10206925 | 3300031852 | Bacteria | 1501 |
| 527 | Ga0307410_10401523 | 3300031852 | Bacteria | 1107 |
| 528 | Ga0307410_10443534 | 3300031852 | Bacteria | 1057 |
| 529 | Ga0307410_10448809 | 3300031852 | Bacteria | 1051 |
| 530 | Ga0307410_10462985 | 3300031852 | Bacteria | 1036 |
| 531 | Ga0307410_10830753 | 3300031852 | Bacteria | 787 |
| 532 | Ga0307410_12099412 | 3300031852 | Bacteria | 505 |
| 533 | Ga0307406_10020638 | 3300031901 | Bacteria | 3883 |
| 534 | Ga0307406_10061019 | 3300031901 | Bacteria | 2433 |
| 535 | Ga0307406_10186863 | 3300031901 | Bacteria | 1513 |
| 536 | Ga0307406_10251545 | 3300031901 | Bacteria | 1331 |
| 537 | Ga0307406_10344780 | 3300031901 | Bacteria | 1161 |
| 538 | Ga0307406_10352551 | 3300031901 | Bacteria | 1150 |
| 539 | Ga0307406_10557983 | 3300031901 | Bacteria | 938 |
| 540 | Ga0307406_10864871 | 3300031901 | Bacteria | 767 |
| 541 | Ga0307406_10874259 | 3300031901 | Bacteria | 763 |
| 542 | Ga0307406_11863970 | 3300031901 | Bacteria | 535 |
| 543 | Ga0307406_12037098 | 3300031901 | Bacteria | 513 |
| 544 | Ga0307407_10002227 | 3300031903 | Bacteria | 7491 |
| 545 | Ga0307407_10060971 | 3300031903 | Bacteria | 2203 |
| 546 | Ga0307407_10063358 | 3300031903 | Bacteria | 2168 |
| 547 | Ga0307407_10086266 | 3300031903 | Bacteria | 1912 |
| 548 | Ga0307407_10127566 | 3300031903 | Bacteria | 1622 |
| 549 | Ga0307407_10263189 | 3300031903 | Bacteria | 1187 |
| 550 | Ga0307407_10285829 | 3300031903 | Bacteria | 1144 |
| 551 | Ga0307407_10328575 | 3300031903 | Bacteria | 1075 |
| 552 | Ga0307407_10818762 | 3300031903 | Bacteria | 709 |
| 553 | Ga0307407_11047507 | 3300031903 | Bacteria | 632 |
| 554 | Ga0307407_11057895 | 3300031903 | Bacteria | 629 |
| 555 | Ga0307412_10005349 | 3300031911 | Bacteria | 7203 |
| 556 | Ga0307412_10063129 | 3300031911 | Bacteria | 2497 |
| 557 | Ga0307412_10096207 | 3300031911 | Bacteria | 2083 |
| 558 | Ga0307412_10148277 | 3300031911 | Bacteria | 1727 |
| 559 | Ga0307412_10151533 | 3300031911 | Bacteria | 1711 |
| 560 | Ga0307412_10192076 | 3300031911 | Bacteria | 1544 |
| 561 | Ga0307412_10256539 | 3300031911 | Bacteria | 1360 |
| 562 | Ga0307412_10344895 | 3300031911 | Bacteria | 1193 |
| 563 | Ga0307412_10668682 | 3300031911 | Bacteria | 888 |
| 564 | Ga0307412_10734973 | 3300031911 | Bacteria | 850 |
| 565 | Ga0307412_10906005 | 3300031911 | Bacteria | 773 |
| 566 | Ga0307412_11710472 | 3300031911 | Bacteria | 577 |
| 567 | Ga0307409_100028799 | 3300031995 | Bacteria | 3964 |
| 568 | Ga0307409_100048409 | 3300031995 | Bacteria | 3234 |
| 569 | Ga0307409_100050697 | 3300031995 | Bacteria | 3171 |
| 570 | Ga0307409_100052112 | 3300031995 | Bacteria | 3135 |
| 571 | Ga0307409_100233479 | 3300031995 | Bacteria | 1669 |
| 572 | Ga0307409_100277274 | 3300031995 | Bacteria | 1547 |
| 573 | Ga0307409_100334980 | 3300031995 | Bacteria | 1421 |
| 574 | Ga0307409_100380008 | 3300031995 | Bacteria | 1342 |
| 575 | Ga0307409_100574346 | 3300031995 | Bacteria | 1110 |
| 576 | Ga0307409_100734720 | 3300031995 | Bacteria | 990 |
| 577 | Ga0307409_100738005 | 3300031995 | Bacteria | 987 |
| 578 | Ga0307409_100805247 | 3300031995 | Bacteria | 947 |
| 579 | Ga0307409_100847781 | 3300031995 | Bacteria | 924 |
| 580 | Ga0307409_101847849 | 3300031995 | Bacteria | 633 |
| 581 | Ga0307416_100007111 | 3300032002 | Bacteria | 7076 |
| 582 | Ga0307416_100016950 | 3300032002 | Bacteria | 5081 |
| 583 | Ga0307416_100108559 | 3300032002 | Bacteria | 2438 |
| 584 | Ga0307416_100171661 | 3300032002 | Bacteria | 2020 |
| 585 | Ga0307416_100205947 | 3300032002 | Bacteria | 1871 |
| 586 | Ga0307416_100544887 | 3300032002 | Bacteria | 1232 |
| 587 | Ga0307416_100761587 | 3300032002 | Bacteria | 1061 |
| 588 | Ga0307416_100786304 | 3300032002 | Bacteria | 1046 |
| 589 | Ga0307416_100930422 | 3300032002 | Bacteria | 970 |
| 590 | Ga0307416_101967543 | 3300032002 | Bacteria | 687 |
| 591 | Ga0307416_102165424 | 3300032002 | Bacteria | 657 |
| 592 | Ga0307416_102285026 | 3300032002 | Bacteria | 641 |
| 593 | Ga0307416_103150535 | 3300032002 | Bacteria | 552 |
| 594 | Ga0307414_10013980 | 3300032004 | Bacteria | 4795 |
| 595 | Ga0307414_10020158 | 3300032004 | Bacteria | 4150 |
| 596 | Ga0307414_10024828 | 3300032004 | Bacteria | 3828 |
| 597 | Ga0307414_10040497 | 3300032004 | Bacteria | 3147 |
| 598 | Ga0307414_10096707 | 3300032004 | Bacteria | 2210 |
| 599 | Ga0307414_10101494 | 3300032004 | Bacteria | 2166 |
| 600 | Ga0307414_10151662 | 3300032004 | Bacteria | 1829 |
| 601 | Ga0307414_10189348 | 3300032004 | Bacteria | 1663 |
| 602 | Ga0307414_10568803 | 3300032004 | Bacteria | 1012 |
| 603 | Ga0307414_10635994 | 3300032004 | Bacteria | 960 |
| 604 | Ga0307414_10693567 | 3300032004 | Bacteria | 921 |
| 605 | Ga0307414_10821854 | 3300032004 | Bacteria | 848 |
| 606 | Ga0307414_11054577 | 3300032004 | Bacteria | 749 |
| 607 | Ga0307414_11285888 | 3300032004 | Bacteria | 678 |
| 608 | Ga0307414_11355946 | 3300032004 | Bacteria | 660 |
| 609 | Ga0307414_11780676 | 3300032004 | Bacteria | 575 |
| 610 | Ga0307414_11956290 | 3300032004 | Bacteria | 547 |
| 611 | Ga0307411_10004327 | 3300032005 | Bacteria | 6777 |
| 612 | Ga0307411_10039443 | 3300032005 | Bacteria | 2987 |
| 613 | Ga0307411_10046354 | 3300032005 | Bacteria | 2801 |
| 614 | Ga0307411_10207985 | 3300032005 | Bacteria | 1508 |
| 615 | Ga0307411_10211902 | 3300032005 | Bacteria | 1496 |
| 616 | Ga0307411_10308714 | 3300032005 | Bacteria | 1272 |
| 617 | Ga0307411_10311147 | 3300032005 | Bacteria | 1267 |
| 618 | Ga0307411_10316985 | 3300032005 | Bacteria | 1257 |
| 619 | Ga0307411_10413567 | 3300032005 | Bacteria | 1118 |
| 620 | Ga0307411_10602835 | 3300032005 | Bacteria | 944 |
| 621 | Ga0307411_10672801 | 3300032005 | Bacteria | 898 |
| 622 | Ga0307411_10789134 | 3300032005 | Bacteria | 835 |
| 623 | Ga0307411_10805665 | 3300032005 | Bacteria | 827 |
| 624 | Ga0307411_11099298 | 3300032005 | Bacteria | 716 |
| 625 | Ga0307411_11406574 | 3300032005 | Bacteria | 638 |
| 626 | Ga0307411_11474747 | 3300032005 | Bacteria | 624 |
| 627 | Ga0307411_11484809 | 3300032005 | Bacteria | 622 |
| 628 | Ga0307411_11897157 | 3300032005 | Bacteria | 554 |
| 629 | Ga0307411_11981529 | 3300032005 | Bacteria | 543 |
| 630 | Ga0307411_12002180 | 3300032005 | Bacteria | 541 |
| 631 | Ga0307411_12026548 | 3300032005 | Bacteria | 537 |
| 632 | Ga0307411_12135839 | 3300032005 | Bacteria | 524 |
| 633 | Ga0307415_100006247 | 3300032126 | Bacteria | 6400 |
| 634 | Ga0307415_100083964 | 3300032126 | Bacteria | 2283 |
| 635 | Ga0307415_100084799 | 3300032126 | Bacteria | 2274 |
| 636 | Ga0307415_100276281 | 3300032126 | Bacteria | 1379 |
| 637 | Ga0307415_100335060 | 3300032126 | Bacteria | 1267 |
| 638 | Ga0307415_100357100 | 3300032126 | Bacteria | 1232 |
| 639 | Ga0307415_100359095 | 3300032126 | Bacteria | 1229 |
| 640 | Ga0307415_100577513 | 3300032126 | Bacteria | 996 |
| 641 | Ga0307415_100647899 | 3300032126 | Bacteria | 946 |
| 642 | Ga0307415_100857668 | 3300032126 | Bacteria | 834 |
| 643 | Ga0307415_100862787 | 3300032126 | Bacteria | 831 |
| 644 | Ga0307415_101190348 | 3300032126 | Bacteria | 717 |
| 645 | Ga0307415_101958698 | 3300032126 | Bacteria | 570 |
| 646 | Ga0307415_102141503 | 3300032126 | Bacteria | 546 |
| 647 | Ga0373941_0300741 | 3300035115 | Bacteria | 640 |
| 648 | Ga0395899_0000406 | 3300037312 | Bacteria | 50248 |
| 649 | Ga0395899_0191462 | 3300037312 | Bacteria | 1431 |
| 650 | Ga0395899_0220425 | 3300037312 | Bacteria | 1314 |
| 651 | Ga0395900_0021924 | 3300037418 | Bacteria | 6531 |
| 652 | Ga0395900_0043394 | 3300037418 | Bacteria | 4635 |
| 653 | Ga0395900_0120641 | 3300037418 | Bacteria | 2690 |
| 654 | Ga0395900_0595623 | 3300037418 | Bacteria | 1046 |
| 655 | Ga0395900_0600356 | 3300037418 | Bacteria | 1041 |
| 656 | Ga0395900_0747509 | 3300037418 | Bacteria | 908 |
| 657 | Ga0395898_0250288 | 3300037466 | Bacteria | 1690 |
| 658 | Ga0395898_0273138 | 3300037466 | Bacteria | 1612 |
| 659 | Ga0395898_0358176 | 3300037466 | Bacteria | 1391 |
| 660 | Ga0395898_0521882 | 3300037466 | Bacteria | 1129 |
| 661 | Ga0395898_0742267 | 3300037466 | Bacteria | 923 |
| 662 | Ga0395905_0001805 | 3300037471 | Bacteria | 24778 |
| 663 | Ga0395905_0007986 | 3300037471 | Bacteria | 10455 |
| 664 | Ga0395905_0022623 | 3300037471 | Bacteria | 5942 |
| 665 | Ga0395905_0821624 | 3300037471 | Bacteria | 832 |
| 666 | Ga0436364_1065372 | 3300037853 | Bacteria | 196587 |
| 667 | Ga0436364_1491317 | 3300037853 | Bacteria | 574 |
| 668 | Ga0395901_0012081 | 3300038443 | Bacteria | 8760 |
| 669 | Ga0395901_0062202 | 3300038443 | Bacteria | 3885 |
| 670 | Ga0395901_0278245 | 3300038443 | Bacteria | 1739 |
| 671 | Ga0395901_0431323 | 3300038443 | Bacteria | 1350 |
| 672 | Ga0395901_0564338 | 3300038443 | Bacteria | 1152 |
| 673 | Ga0395901_1667373 | 3300038443 | Bacteria | 589 |
| 674 | Ga0436365_0298268 | 3300039437 | Bacteria | 2267 |
| 675 | Ga0439439_0128420 | 3300041406 | Bacteria | 711 |
| 676 | Ga0439466_0079543 | 3300041411 | Bacteria | 1035 |
| 677 | Ga0439465_0015647 | 3300041413 | Bacteria | 2366 |
| 678 | Ga0451789_0478013 | 3300041443 | Bacteria | 850 |
| 679 | Ga0451794_37204 | 3300041446 | Bacteria | 583 |
| 680 | Ga0451797_1289161 | 3300041453 | Bacteria | 956 |
| 681 | Ga0451802_0774086 | 3300041460 | Bacteria | 3431 |
| 682 | Ga0451806_236297 | 3300041462 | Bacteria | 2200 |
| 683 | Ga0451804_0241769 | 3300041463 | Bacteria | 610 |
| 684 | Ga0451807_0895683 | 3300041486 | Bacteria | 2177 |
| 685 | Ga0451837_1607676 | 3300041494 | Bacteria | 544 |
| 686 | Ga0451839_0681194 | 3300041496 | Bacteria | 719 |
| 687 | Ga0451845_0925973 | 3300041501 | Bacteria | 559 |
| 688 | Ga0451843_1160977 | 3300041509 | Bacteria | 530 |
| 689 | Ga0439433_0067820 | 3300041999 | Bacteria | 857 |
| 690 | Ga0439445_0225339 | 3300042004 | Bacteria | 557 |
| 691 | Ga0439432_055513 | 3300042006 | Bacteria | 1229 |
| 692 | Ga0439449_0067357 | 3300042007 | Bacteria | 1320 |
| 693 | Ga0439449_0101276 | 3300042007 | Bacteria | 1065 |
| 694 | Ga0439452_044323 | 3300042010 | Bacteria | 1038 |
| 695 | Ga0439452_078916 | 3300042010 | Bacteria | 719 |
| 696 | Ga0439455_0005591 | 3300042012 | Bacteria | 2559 |
| 697 | Ga0439462_0208767 | 3300042015 | Bacteria | 557 |
| 698 | Ga0450912_010825 | 3300042116 | Bacteria | 786 |
| 699 | Ga0450894_081837 | 3300042131 | Bacteria | 504 |
| 700 | Ga0439458_0212146 | 3300042157 | Bacteria | 532 |
| 701 | Ga0439434_0145500 | 3300042435 | Bacteria | 783 |
| 702 | Ga0451577_0768435 | 3300042876 | Bacteria | 871 |
| 703 | Ga0451577_1420766 | 3300042876 | Bacteria | 615 |
| 704 | Ga0453684_0507510 | 3300044712 | Bacteria | 1334 |
| 705 | Ga0466968_0326633 | 3300044735 | Bacteria | 742 |
| 706 | Ga0466970_0066546 | 3300044765 | Bacteria | 1934 |
| 707 | Ga0466957_0951414 | 3300044842 | Bacteria | 615 |
| 708 | Ga0451576_2038486 | 3300045051 | Bacteria | 591 |
| 709 | Ga0466958_0538395 | 3300045836 | Bacteria | 758 |
| 710 | Ga0466967_1276514 | 3300045976 | Bacteria | 731 |
| 711 | Ga0495584_0059740 | 3300046491 | Bacteria | 1917 |
| 712 | Ga0495584_0642604 | 3300046491 | Bacteria | 541 |
| 713 | Ga0495585_0207909 | 3300046492 | Bacteria | 993 |
| 714 | Ga0495583_0195098 | 3300046506 | Bacteria | 825 |
| 715 | Ga0495620_0214338 | 3300046515 | Bacteria | 738 |
| 716 | Ga0495631_0119026 | 3300046518 | Bacteria | 1136 |
| 717 | Ga0495643_0514717 | 3300046522 | Bacteria | 513 |
| 718 | Ga0495663_0007544 | 3300046525 | Bacteria | 3009 |
| 719 | Ga0495663_0175157 | 3300046525 | Bacteria | 741 |
| 720 | Ga0495663_0395046 | 3300046525 | Bacteria | 508 |
| 721 | Ga0495642_0044719 | 3300046528 | Bacteria | 1808 |
| 722 | Ga0495642_0313201 | 3300046528 | Bacteria | 688 |
| 723 | Ga0495654_0240736 | 3300046530 | Bacteria | 757 |
| 724 | Ga0495598_0001038 | 3300046537 | Bacteria | 5332 |
| 725 | Ga0495621_0036568 | 3300046539 | Bacteria | 1704 |
| 726 | Ga0495622_0039363 | 3300046557 | Bacteria | 2202 |
| 727 | Ga0495633_0001763 | 3300046558 | Bacteria | 16049 |
| 728 | Ga0495633_0243849 | 3300046558 | Bacteria | 820 |
| 729 | Ga0495656_0098455 | 3300046615 | Bacteria | 1349 |
| 730 | Ga0495668_0270987 | 3300046616 | Bacteria | 930 |
| 731 | Ga0495625_0267913 | 3300046660 | Bacteria | 1103 |
| 732 | Ga0495669_0010966 | 3300046684 | Bacteria | 3837 |
| 733 | Ga0495669_0034570 | 3300046684 | Bacteria | 2228 |
| 734 | Ga0495669_0268506 | 3300046684 | Bacteria | 820 |
| 735 | Ga0495669_0278529 | 3300046684 | Bacteria | 804 |
| 736 | Ga0495670_0000015 | 3300046691 | Bacteria | 131137 |
| 737 | Ga0495670_0049768 | 3300046691 | Bacteria | 2097 |
| 738 | Ga0495670_0091225 | 3300046691 | Bacteria | 1559 |
| 739 | Ga0495670_0147119 | 3300046691 | Bacteria | 1234 |
| 740 | Ga0495670_0560598 | 3300046691 | Bacteria | 622 |
| 741 | Ga0495671_0008086 | 3300046692 | Bacteria | 5938 |
| 742 | Ga0495672_0431330 | 3300047320 | Bacteria | 598 |
| 743 | Ga0495687_207677 | 3300047443 | Bacteria | 616 |
| 744 | Ga0495677_0014214 | 3300047445 | Bacteria | 2899 |
| 745 | Ga0495677_0105204 | 3300047445 | Bacteria | 1070 |
| 746 | Ga0495677_0117747 | 3300047445 | Bacteria | 1012 |
| 747 | Ga0495686_0000486 | 3300047472 | Bacteria | 58640 |
| 748 | Ga0495686_0007665 | 3300047472 | Bacteria | 8057 |
| 749 | Ga0495686_0158108 | 3300047472 | Bacteria | 1326 |
| 750 | Ga0495686_0386994 | 3300047472 | Bacteria | 753 |
| 751 | Ga0495615_0313283 | 3300048090 | Bacteria | 511 |
| 752 | Ga0496100_0764831 | 3300048903 | Bacteria | 756 |
| 753 | Ga0496102_0022640 | 3300048905 | Bacteria | 5568 |
| 754 | Ga0496102_0194172 | 3300048905 | Bacteria | 1913 |
| 755 | Ga0496102_1513698 | 3300048905 | Bacteria | 589 |
| 756 | Ga0496103_0001458 | 3300048906 | Bacteria | 15842 |
| 757 | Ga0496103_0215571 | 3300048906 | Bacteria | 1234 |
| 758 | Ga0496103_0383193 | 3300048906 | Bacteria | 903 |
| 759 | Ga0496104_0695513 | 3300048907 | Bacteria | 925 |
| 760 | Ga0496105_0118457 | 3300048908 | Bacteria | 2184 |
| 761 | Ga0496105_0250296 | 3300048908 | Bacteria | 1436 |
| 762 | Ga0496105_0550267 | 3300048908 | Bacteria | 901 |
| 763 | Ga0496108_0359849 | 3300048911 | Bacteria | 1270 |
| 764 | Ga0496109_0445967 | 3300048912 | Bacteria | 1222 |
| 765 | Ga0496109_0907800 | 3300048912 | Bacteria | 819 |
| 766 | Ga0496109_1075906 | 3300048912 | Bacteria | 741 |
| 767 | Ga0496109_1296408 | 3300048912 | Bacteria | 664 |
| 768 | Ga0496109_1526623 | 3300048912 | Bacteria | 603 |
| 769 | Ga0496110_0453040 | 3300048913 | Bacteria | 1169 |
| 770 | Ga0496110_0987985 | 3300048913 | Bacteria | 749 |
| 771 | Ga0496111_0129963 | 3300048914 | Bacteria | 1863 |
| 772 | Ga0496111_0599572 | 3300048914 | Bacteria | 806 |
| 773 | Ga0496111_0672456 | 3300048914 | Bacteria | 754 |
| 774 | Ga0496114_0966010 | 3300048917 | Bacteria | 735 |
| 775 | Ga0496117_0005438 | 3300048920 | Bacteria | 13377 |
| 776 | Ga0496118_0004152 | 3300048921 | Bacteria | 17499 |
| 777 | Ga0496118_0027308 | 3300048921 | Bacteria | 4835 |
| 778 | Ga0496119_0096043 | 3300048922 | Bacteria | 1673 |
| 779 | Ga0496120_0260064 | 3300048923 | Bacteria | 811 |
| 780 | Ga0496122_0001531 | 3300048925 | Bacteria | 36790 |
| 781 | Ga0496123_0021568 | 3300048926 | Bacteria | 5001 |
| 782 | Ga0496124_0109237 | 3300048927 | Bacteria | 2229 |
| 783 | Ga0496124_0231018 | 3300048927 | Bacteria | 1383 |
| 784 | Ga0501306_006319 | 3300049127 | Bacteria | 1386 |
| 785 | Ga0501306_031216 | 3300049127 | Bacteria | 792 |
| 786 | Ga0501306_041409 | 3300049127 | Bacteria | 716 |
| 787 | Ga0501306_060438 | 3300049127 | Bacteria | 623 |
| 788 | Ga0501308_006500 | 3300049128 | Bacteria | 1200 |
| 789 | Ga0501308_036283 | 3300049128 | Bacteria | 680 |
| 790 | Ga0501309_008114 | 3300049129 | Bacteria | 1316 |
| 791 | Ga0501309_014992 | 3300049129 | Bacteria | 1045 |
| 792 | Ga0501310_001218 | 3300049130 | Bacteria | 2307 |
| 793 | Ga0501310_003306 | 3300049130 | Bacteria | 1573 |
| 794 | Ga0501310_028079 | 3300049130 | Bacteria | 736 |
| 795 | Ga0501304_016532 | 3300049160 | Bacteria | 699 |
| 796 | Ga0501304_034151 | 3300049160 | Bacteria | 550 |
| 797 | Ga0501305_013093 | 3300049161 | Bacteria | 1142 |
| 798 | Ga0501305_028003 | 3300049161 | Bacteria | 866 |
| 799 | Ga0501305_111502 | 3300049161 | Bacteria | 518 |
| 800 | Ga0501305_111658 | 3300049161 | Bacteria | 518 |
| 801 | Ga0501307_009615 | 3300049162 | Bacteria | 1108 |
| 802 | Ga0501307_015926 | 3300049162 | Bacteria | 933 |
| 803 | Ga0501307_023755 | 3300049162 | Bacteria | 814 |
| 804 | Ga0501307_026073 | 3300049162 | Bacteria | 788 |
| 805 | Ga0501307_096024 | 3300049162 | Bacteria | 500 |
| 806 | Ga0501292_028292 | 3300049515 | Bacteria | 933 |
| 807 | Ga0501311_021033 | 3300049527 | Bacteria | 887 |
| 808 | Ga0501311_025146 | 3300049527 | Bacteria | 833 |
| 809 | Ga0501312_029704 | 3300049528 | Bacteria | 852 |
| 810 | Ga0501312_066811 | 3300049528 | Bacteria | 631 |
| 811 | Ga0501313_029182 | 3300049529 | Bacteria | 710 |
| 812 | Ga0501315_037732 | 3300049531 | Bacteria | 721 |
| 813 | Ga0501315_049783 | 3300049531 | Bacteria | 656 |
| 814 | Ga0501316_020777 | 3300049532 | Bacteria | 826 |
| 815 | Ga0501316_021899 | 3300049532 | Bacteria | 811 |
| 816 | Ga0501317_014767 | 3300049533 | Bacteria | 994 |
| 817 | Ga0501317_025845 | 3300049533 | Bacteria | 825 |
| 818 | Ga0501320_006472 | 3300049536 | Bacteria | 1099 |
| 819 | Ga0501320_048744 | 3300049536 | Bacteria | 572 |
| 820 | Ga0501321_078425 | 3300049537 | Bacteria | 523 |
| 821 | Ga0501322_004865 | 3300049538 | Bacteria | 916 |
| 822 | Ga0501323_025314 | 3300049539 | Bacteria | 807 |
| 823 | Ga0501323_076951 | 3300049539 | Bacteria | 541 |
| 824 | Ga0501324_008845 | 3300049540 | Bacteria | 894 |
| 825 | Ga0501325_025102 | 3300049541 | Bacteria | 652 |
| 826 | Ga0501333_009111 | 3300049549 | Bacteria | 693 |
| 827 | Ga0501334_23126 | 3300049550 | Bacteria | 507 |
| 828 | Ga0501335_044513 | 3300049551 | Bacteria | 530 |
| 829 | Ga0501340_011323 | 3300049556 | Bacteria | 663 |
| 830 | Ga0501032_0502502 | 3300049569 | Bacteria | 775 |
| 831 | Ga0501032_0710334 | 3300049569 | Bacteria | 637 |
| 832 | Ga0501034_0190380 | 3300049571 | Bacteria | 2014 |
| 833 | Ga0501036_1168557 | 3300049572 | Bacteria | 628 |
| 834 | Ga0501038_1245342 | 3300049574 | Bacteria | 539 |
| 835 | Ga0501039_0140668 | 3300049575 | Bacteria | 1896 |
| 836 | Ga0501071_0586635 | 3300049587 | Bacteria | 857 |
| 837 | Ga0501075_0816081 | 3300049591 | Bacteria | 710 |
| 838 | Ga0501202_126721 | 3300049652 | Bacteria | 647 |
| 839 | Ga0501209_253846 | 3300049656 | Bacteria | 550 |
| 840 | Ga0501214_034943 | 3300049659 | Bacteria | 706 |
| 841 | Ga0501217_044278 | 3300049661 | Bacteria | 1143 |
| 842 | Ga0501224_066310 | 3300049664 | Bacteria | 568 |
| 843 | Ga0501235_046846 | 3300049669 | Bacteria | 996 |
| 844 | Ga0501249_178118 | 3300049679 | Bacteria | 548 |
| 845 | Ga0501253_026120 | 3300049683 | Bacteria | 1074 |
| 846 | Ga0501259_203007 | 3300049688 | Bacteria | 509 |
| 847 | Ga0501221_086156 | 3300049704 | Bacteria | 762 |
| 848 | Ga0501225_0090544 | 3300049705 | Bacteria | 886 |
| 849 | Ga0501245_037372 | 3300049708 | Bacteria | 824 |
| 850 | Ga0501079_1508672 | 3300049741 | Bacteria | 529 |
| 851 | Ga0501266_010321 | 3300049763 | Bacteria | 1188 |
| 852 | Ga0501268_004965 | 3300049765 | Bacteria | 1893 |
| 853 | Ga0501270_154734 | 3300049767 | Bacteria | 525 |
| 854 | Ga0501271_013331 | 3300049768 | Bacteria | 900 |
| 855 | Ga0501271_058606 | 3300049768 | Bacteria | 536 |
| 856 | Ga0501272_048841 | 3300049769 | Bacteria | 583 |
| 857 | Ga0501279_104482 | 3300049775 | Bacteria | 514 |
| 858 | Ga0501035_0767010 | 3300049822 | Bacteria | 773 |
| 859 | Ga0501044_0227503 | 3300049823 | Bacteria | 1814 |
| 860 | Ga0501045_0695140 | 3300049824 | Bacteria | 751 |
| 861 | nmdc:mga0k408_324758_c1 | 3300050493 | Bacteria | 918 |
| 862 | Ga0500643_077119 | 3300053087 | Bacteria | 919 |
| 863 | Ga0500646_0059765 | 3300053090 | Bacteria | 1119 |
| 864 | Ga0500647_0181633 | 3300053091 | Bacteria | 965 |
| 865 | Ga0500641_0003980 | 3300053096 | Bacteria | 5223 |
| 866 | Ga0500594_0005507 | 3300053118 | Bacteria | 2809 |
| 867 | Ga0500658_0113824 | 3300053134 | Bacteria | 1193 |
| 868 | Ga0500559_0049464 | 3300053136 | Bacteria | 1852 |
| 869 | Ga0500559_0100471 | 3300053136 | Bacteria | 1332 |
| 870 | Ga0500577_0253966 | 3300053142 | Bacteria | 764 |
| 871 | Ga0500636_0039359 | 3300053177 | Bacteria | 2796 |
| 872 | Ga0500596_003226 | 3300053735 | Bacteria | 3130 |
| 873 | Ga0587084_000368 | 3300059477 | Bacteria | 3388 |
| 874 | Ga0587084_011725 | 3300059477 | Bacteria | 1174 |
| 875 | Ga0587093_018465 | 3300059478 | Bacteria | 909 |
| 876 | Ga0587066_001465 | 3300059490 | Bacteria | 2373 |
| 877 | Ga0587070_042355 | 3300059491 | Bacteria | 877 |
| 878 | Ga0587077_001167 | 3300059493 | Bacteria | 2718 |
| 879 | Ga0587077_069562 | 3300059493 | Bacteria | 783 |
| 880 | Ga0587080_014969 | 3300059503 | Bacteria | 1206 |
| 881 | Ga0587080_031497 | 3300059503 | Bacteria | 926 |
| 882 | Ga0587080_081322 | 3300059503 | Bacteria | 665 |
| 883 | Ga0587082_008501 | 3300059504 | Bacteria | 1433 |
| 884 | Ga0587083_0037171 | 3300059505 | Bacteria | 1001 |
| 885 | Ga0587085_007179 | 3300059506 | Bacteria | 1381 |
| 886 | Ga0587086_006030 | 3300059507 | Bacteria | 1336 |
| 887 | Ga0587088_007942 | 3300059508 | Bacteria | 1485 |
| 888 | Ga0587088_048881 | 3300059508 | Bacteria | 822 |
| 889 | Ga0587088_211511 | 3300059508 | Bacteria | 500 |
| 890 | Ga0587089_006060 | 3300059509 | Bacteria | 1394 |
| 891 | Ga0587090_001175 | 3300059510 | Bacteria | 2574 |
| 892 | Ga0587090_028878 | 3300059510 | Bacteria | 916 |
| 893 | Ga0587090_118078 | 3300059510 | Bacteria | 573 |
| 894 | Ga0587091_000254 | 3300059511 | Bacteria | 3983 |
| 895 | Ga0587092_007157 | 3300059512 | Bacteria | 1436 |
| 896 | Ga0587092_012652 | 3300059512 | Bacteria | 1194 |
| 897 | Ga0587094_000504 | 3300059513 | Bacteria | 3090 |
| 898 | Ga0587098_006412 | 3300059604 | Bacteria | 1192 |
| 899 | Ga0587106_011511 | 3300059605 | Bacteria | 1168 |
| 900 | Ga0587121_04918 | 3300059606 | Bacteria | 762 |
| 901 | Ga0587129_003262 | 3300059608 | Bacteria | 1014 |
| 902 | Ga0587099_003045 | 3300059622 | Bacteria | 1366 |
| 903 | Ga0587101_000706 | 3300059623 | Bacteria | 2535 |
| 904 | Ga0587117_010629 | 3300059627 | Bacteria | 1127 |
| 905 | Ga0587128_000194 | 3300059630 | Bacteria | 3676 |
| 906 | Ga0587062_138535 | 3300059639 | Bacteria | 506 |
| 907 | Ga0587068_000363 | 3300059641 | Bacteria | 3920 |
| 908 | Ga0587069_009859 | 3300059642 | Bacteria | 1242 |
| 909 | Ga0587072_158655 | 3300059643 | Bacteria | 551 |
| 910 | Ga0587075_079900 | 3300059644 | Bacteria | 622 |
| 911 | Ga0587076_014253 | 3300059645 | Bacteria | 1221 |
| 912 | Ga0587076_023390 | 3300059645 | Bacteria | 1040 |
| 913 | Ga0587076_060180 | 3300059645 | Bacteria | 764 |
| 914 | Ga0587078_000705 | 3300059646 | Bacteria | 2686 |
| 915 | Ga0587078_013100 | 3300059646 | Bacteria | 979 |
| 916 | Ga0587079_008963 | 3300059647 | Bacteria | 1545 |
| 917 | Ga0587100_000732 | 3300059648 | Bacteria | 1701 |
| 918 | Ga0587102_000570 | 3300059649 | Bacteria | 2182 |
| 919 | Ga0587104_003534 | 3300059650 | Bacteria | 962 |
| 920 | Ga0587105_000848 | 3300059651 | Bacteria | 1428 |
| 921 | Ga0587107_000546 | 3300059652 | Bacteria | 2535 |
| 922 | Ga0587110_050021 | 3300059654 | Bacteria | 557 |
| 923 | Ga0587114_008517 | 3300059655 | Bacteria | 1208 |
| 924 | Ga0587118_01767 | 3300059657 | Bacteria | 1348 |
| 925 | Ga0587119_000105 | 3300059658 | Bacteria | 3906 |
| 926 | Ga0587120_005626 | 3300059659 | Bacteria | 967 |
| 927 | Ga0587124_007519 | 3300059660 | Bacteria | 918 |
| 928 | Ga0587124_037851 | 3300059660 | Bacteria | 554 |
| 929 | Ga0587096_00847 | 3300060247 | Bacteria | 934 |
| 930 | Ga0587071_000753 | 3300060344 | Bacteria | 3553 |
| 931 | Ga0587111_0032114 | 3300060346 | Bacteria | 1078 |
| 932 | Ga0587111_0112702 | 3300060346 | Bacteria | 691 |
| 933 | Ga0587111_0153669 | 3300060346 | Bacteria | 620 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041411 | Ga0439466_0079543 | Ga0439466_0079543_747_1025 | 89 |
| 2 | 3300041446 | Ga0451794_37204 | Ga0451794_37204_226_498 | 89 |
| 3 | 3300047320 | Ga0495672_0431330 | Ga0495672_0431330_13_282 | 89 |
| 4 | 3300045836 | Ga0466958_0538395 | Ga0466958_0538395_15_305 | 96 |
| 5 | iso_pu_bacteria | 8057101203 | 8057102137 | 98 |
| 6 | iso_pu_bacteria | 2885429604 | 2885431646 | 100 |
| 7 | 3300005355 | Ga0070671_100258242 | Ga0070671_1002582422 | 101 |
| 8 | 3300009177 | Ga0105248_10316717 | Ga0105248_103167172 | 101 |
| 9 | 3300009978 | Ga0105148_117490 | Ga0105148_1174902 | 101 |
| 10 | 3300025941 | Ga0207711_10258467 | Ga0207711_102584672 | 101 |
| 11 | 3300026121 | Ga0207683_11075667 | Ga0207683_110756671 | 101 |
| 12 | 3300048921 | Ga0496118_0027308 | Ga0496118_0027308_96_407 | 101 |
| 13 | 3300003791 | Ga0055530_10015010 | Ga0055530_100150105 | 102 |
| 14 | 3300003794 | Ga0055531_10032620 | Ga0055531_100326202 | 102 |
| 15 | 3300003794 | Ga0055531_10100522 | Ga0055531_101005222 | 102 |
| 16 | 3300025298 | Ga0209050_1021913 | Ga0209050_10219133 | 102 |
| 17 | 3300025304 | Ga0209257_1000577 | Ga0209257_100057778 | 102 |
| 18 | 3300025304 | Ga0209257_1000597 | Ga0209257_100059778 | 102 |
| 19 | 3300025304 | Ga0209257_1006247 | Ga0209257_10062478 | 102 |
| 20 | 3300026041 | Ga0207639_11347168 | Ga0207639_113471682 | 102 |
| 21 | 3300027717 | Ga0209998_10071771 | Ga0209998_100717712 | 102 |
| 22 | 3300031824 | Ga0307413_10307518 | Ga0307413_103075182 | 102 |
| 23 | 3300031911 | Ga0307412_11710472 | Ga0307412_117104722 | 102 |
| 24 | 3300032126 | Ga0307415_101958698 | Ga0307415_1019586982 | 102 |
| 25 | 3300041443 | Ga0451789_0478013 | Ga0451789_0478013_122_436 | 102 |
| 26 | 3300041509 | Ga0451843_1160977 | Ga0451843_1160977_77_391 | 102 |
| 27 | 3300042876 | Ga0451577_1420766 | Ga0451577_1420766_180_488 | 102 |
| 28 | 3300044735 | Ga0466968_0326633 | Ga0466968_0326633_11_325 | 102 |
| 29 | 3300046491 | Ga0495584_0642604 | Ga0495584_0642604_116_430 | 102 |
| 30 | 3300046691 | Ga0495670_0000015 | Ga0495670_0000015_106875_107189 | 102 |
| 31 | 3300049569 | Ga0501032_0502502 | Ga0501032_0502502_213_530 | 102 |
| 32 | 3300049823 | Ga0501044_0227503 | Ga0501044_0227503_48_362 | 102 |
| 33 | 3300050493 | nmdc:mga0k408_324758_c1 | nmdc:mga0k408_324758_c1_34_348 | 102 |
| 34 | 3300053087 | Ga0500643_077119 | Ga0500643_077119_288_608 | 102 |
| 35 | 3300053090 | Ga0500646_0059765 | Ga0500646_0059765_455_769 | 102 |
| 36 | 3300053096 | Ga0500641_0003980 | Ga0500641_0003980_3307_3621 | 102 |
| 37 | 3300053136 | Ga0500559_0049464 | Ga0500559_0049464_1142_1456 | 102 |
| 38 | 3300059477 | Ga0587084_011725 | Ga0587084_011725_444_761 | 102 |
| 39 | 3300059491 | Ga0587070_042355 | Ga0587070_042355_455_775 | 102 |
| 40 | 3300059493 | Ga0587077_069562 | Ga0587077_069562_158_472 | 102 |
| 41 | 3300059503 | Ga0587080_081322 | Ga0587080_081322_200_520 | 102 |
| 42 | 3300059510 | Ga0587090_028878 | Ga0587090_028878_522_836 | 102 |
| 43 | 3300059639 | Ga0587062_138535 | Ga0587062_138535_31_348 | 102 |
| 44 | 3300059643 | Ga0587072_158655 | Ga0587072_158655_26_346 | 102 |
| 45 | 3300059645 | Ga0587076_023390 | Ga0587076_023390_616_936 | 102 |
| 46 | 3300059646 | Ga0587078_013100 | Ga0587078_013100_412_726 | 102 |
| 47 | 3300059654 | Ga0587110_050021 | Ga0587110_050021_143_460 | 102 |
| 48 | 3300059660 | Ga0587124_037851 | Ga0587124_037851_209_529 | 102 |
| 49 | 3300060346 | Ga0587111_0153669 | Ga0587111_0153669_166_486 | 102 |
| 50 | 3300001915 | JGI24741J21665_1001920 | JGI24741J21665_10019204 | 103 |
| 51 | 3300001978 | JGI24747J21853_1005899 | JGI24747J21853_10058992 | 103 |
| 52 | 3300001979 | JGI24740J21852_10015856 | JGI24740J21852_100158562 | 103 |
| 53 | 3300001990 | JGI24737J22298_10043760 | JGI24737J22298_100437603 | 103 |
| 54 | 3300002155 | JGI24033J26618_1044558 | JGI24033J26618_10445582 | 103 |
| 55 | 3300002244 | JGI24742J22300_10001588 | JGI24742J22300_100015884 | 103 |
| 56 | 3300003215 | JGI25153J46596_10000173 | JGI25153J46596_100001732 | 103 |
| 57 | 3300003693 | Ga0032354_1119435 | Ga0032354_11194352 | 103 |
| 58 | 3300003759 | Ga0055525_1000012 | Ga0055525_1000012148 | 103 |
| 59 | 3300003762 | Ga0055542_1001518 | Ga0055542_10015186 | 103 |
| 60 | 3300003763 | Ga0055529_1000014 | Ga0055529_1000014267 | 103 |
| 61 | 3300005290 | Ga0065712_10213194 | Ga0065712_102131941 | 103 |
| 62 | 3300005290 | Ga0065712_10339614 | Ga0065712_103396142 | 103 |
| 63 | 3300005293 | Ga0065715_10051509 | Ga0065715_100515092 | 103 |
| 64 | 3300005293 | Ga0065715_10565818 | Ga0065715_105658181 | 103 |
| 65 | 3300005327 | Ga0070658_10034849 | Ga0070658_100348495 | 103 |
| 66 | 3300005327 | Ga0070658_11019730 | Ga0070658_110197302 | 103 |
| 67 | 3300005328 | Ga0070676_10033009 | Ga0070676_100330095 | 103 |
| 68 | 3300005328 | Ga0070676_10585954 | Ga0070676_105859541 | 103 |
| 69 | 3300005329 | Ga0070683_100438274 | Ga0070683_1004382742 | 103 |
| 70 | 3300005331 | Ga0070670_100161717 | Ga0070670_1001617173 | 103 |
| 71 | 3300005331 | Ga0070670_100436289 | Ga0070670_1004362891 | 103 |
| 72 | 3300005333 | Ga0070677_10062061 | Ga0070677_100620612 | 103 |
| 73 | 3300005333 | Ga0070677_10074850 | Ga0070677_100748501 | 103 |
| 74 | 3300005334 | Ga0068869_101112408 | Ga0068869_1011124082 | 103 |
| 75 | 3300005337 | Ga0070682_101020532 | Ga0070682_1010205322 | 103 |
| 76 | 3300005338 | Ga0068868_100049745 | Ga0068868_1000497454 | 103 |
| 77 | 3300005339 | Ga0070660_100682995 | Ga0070660_1006829952 | 103 |
| 78 | 3300005344 | Ga0070661_100122997 | Ga0070661_1001229973 | 103 |
| 79 | 3300005344 | Ga0070661_100763169 | Ga0070661_1007631691 | 103 |
| 80 | 3300005344 | Ga0070661_101222862 | Ga0070661_1012228621 | 103 |
| 81 | 3300005347 | Ga0070668_100773108 | Ga0070668_1007731082 | 103 |
| 82 | 3300005353 | Ga0070669_100200612 | Ga0070669_1002006122 | 103 |
| 83 | 3300005353 | Ga0070669_100485009 | Ga0070669_1004850092 | 103 |
| 84 | 3300005353 | Ga0070669_101061793 | Ga0070669_1010617931 | 103 |
| 85 | 3300005353 | Ga0070669_101128734 | Ga0070669_1011287342 | 103 |
| 86 | 3300005354 | Ga0070675_100775834 | Ga0070675_1007758342 | 103 |
| 87 | 3300005355 | Ga0070671_100203448 | Ga0070671_1002034482 | 103 |
| 88 | 3300005355 | Ga0070671_100402823 | Ga0070671_1004028231 | 103 |
| 89 | 3300005364 | Ga0070673_100127669 | Ga0070673_1001276693 | 103 |
| 90 | 3300005366 | Ga0070659_100033177 | Ga0070659_1000331774 | 103 |
| 91 | 3300005366 | Ga0070659_100278332 | Ga0070659_1002783321 | 103 |
| 92 | 3300005366 | Ga0070659_101135244 | Ga0070659_1011352441 | 103 |
| 93 | 3300005441 | Ga0070700_101543717 | Ga0070700_1015437171 | 103 |
| 94 | 3300005456 | Ga0070678_100017885 | Ga0070678_1000178854 | 103 |
| 95 | 3300005457 | Ga0070662_100483155 | Ga0070662_1004831551 | 103 |
| 96 | 3300005459 | Ga0068867_100321187 | Ga0068867_1003211872 | 103 |
| 97 | 3300005535 | Ga0070684_100653704 | Ga0070684_1006537042 | 103 |
| 98 | 3300005539 | Ga0068853_100151532 | Ga0068853_1001515324 | 103 |
| 99 | 3300005539 | Ga0068853_102312984 | Ga0068853_1023129842 | 103 |
| 100 | 3300005548 | Ga0070665_100280359 | Ga0070665_1002803592 | 103 |
| 101 | 3300005563 | Ga0068855_100616645 | Ga0068855_1006166452 | 103 |
| 102 | 3300005564 | Ga0070664_100216063 | Ga0070664_1002160632 | 103 |
| 103 | 3300005564 | Ga0070664_100749325 | Ga0070664_1007493252 | 103 |
| 104 | 3300005564 | Ga0070664_101327312 | Ga0070664_1013273122 | 103 |
| 105 | 3300005577 | Ga0068857_100686033 | Ga0068857_1006860332 | 103 |
| 106 | 3300005578 | Ga0068854_100063035 | Ga0068854_1000630353 | 103 |
| 107 | 3300005578 | Ga0068854_100217907 | Ga0068854_1002179072 | 103 |
| 108 | 3300005614 | Ga0068856_102249078 | Ga0068856_1022490781 | 103 |
| 109 | 3300005617 | Ga0068859_100001416 | Ga0068859_1000014167 | 103 |
| 110 | 3300005617 | Ga0068859_101860805 | Ga0068859_1018608052 | 103 |
| 111 | 3300005719 | Ga0068861_100000040 | Ga0068861_10000004019 | 103 |
| 112 | 3300005834 | Ga0068851_10423600 | Ga0068851_104236002 | 103 |
| 113 | 3300005840 | Ga0068870_10272613 | Ga0068870_102726132 | 103 |
| 114 | 3300006178 | Ga0075367_10454611 | Ga0075367_104546112 | 103 |
| 115 | 3300006237 | Ga0097621_100066302 | Ga0097621_1000663024 | 103 |
| 116 | 3300006353 | Ga0075370_10388167 | Ga0075370_103881672 | 103 |
| 117 | 3300006358 | Ga0068871_100064899 | Ga0068871_1000648995 | 103 |
| 118 | 3300006881 | Ga0068865_100650878 | Ga0068865_1006508782 | 103 |
| 119 | 3300006931 | Ga0097620_100001416 | Ga0097620_10000141635 | 103 |
| 120 | 3300006931 | Ga0097620_101860871 | Ga0097620_1018608712 | 103 |
| 121 | 3300009098 | Ga0105245_12705906 | Ga0105245_127059062 | 103 |
| 122 | 3300009148 | Ga0105243_10003106 | Ga0105243_1000310624 | 103 |
| 123 | 3300009148 | Ga0105243_10737663 | Ga0105243_107376632 | 103 |
| 124 | 3300009174 | Ga0105241_12401405 | Ga0105241_124014052 | 103 |
| 125 | 3300009177 | Ga0105248_11013124 | Ga0105248_110131242 | 103 |
| 126 | 3300009545 | Ga0105237_12029783 | Ga0105237_120297832 | 103 |
| 127 | 3300010375 | Ga0105239_10090567 | Ga0105239_100905672 | 103 |
| 128 | 3300012475 | Ga0157317_1000418 | Ga0157317_10004182 | 103 |
| 129 | 3300012512 | Ga0157327_1023822 | Ga0157327_10238221 | 103 |
| 130 | 3300013100 | Ga0157373_10501180 | Ga0157373_105011802 | 103 |
| 131 | 3300013102 | Ga0157371_10000059 | Ga0157371_100000595 | 103 |
| 132 | 3300013105 | Ga0157369_10552266 | Ga0157369_105522662 | 103 |
| 133 | 3300013296 | Ga0157374_10104316 | Ga0157374_101043162 | 103 |
| 134 | 3300013297 | Ga0157378_10273729 | Ga0157378_102737293 | 103 |
| 135 | 3300013306 | Ga0163162_11697639 | Ga0163162_116976392 | 103 |
| 136 | 3300013307 | Ga0157372_10774507 | Ga0157372_107745072 | 103 |
| 137 | 3300014326 | Ga0157380_10116019 | Ga0157380_101160193 | 103 |
| 138 | 3300014326 | Ga0157380_11993450 | Ga0157380_119934502 | 103 |
| 139 | 3300017792 | Ga0163161_10441763 | Ga0163161_104417632 | 103 |
| 140 | 3300020069 | Ga0197907_10820967 | Ga0197907_108209672 | 103 |
| 141 | 3300020076 | Ga0206355_1017096 | Ga0206355_10170962 | 103 |
| 142 | 3300021384 | Ga0213876_10166713 | Ga0213876_101667132 | 103 |
| 143 | 3300021388 | Ga0213875_10001626 | Ga0213875_100016265 | 103 |
| 144 | 3300025226 | Ga0209674_102700 | Ga0209674_1027002 | 103 |
| 145 | 3300025230 | Ga0209563_100030 | Ga0209563_100030300 | 103 |
| 146 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011271 | 103 |
| 147 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006923 | 103 |
| 148 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001627 | 103 |
| 149 | 3300025315 | Ga0207697_10101229 | Ga0207697_101012292 | 103 |
| 150 | 3300025315 | Ga0207697_10161798 | Ga0207697_101617982 | 103 |
| 151 | 3300025315 | Ga0207697_10172294 | Ga0207697_101722942 | 103 |
| 152 | 3300025321 | Ga0207656_10002150 | Ga0207656_100021502 | 103 |
| 153 | 3300025893 | Ga0207682_10073759 | Ga0207682_100737593 | 103 |
| 154 | 3300025893 | Ga0207682_10092570 | Ga0207682_100925702 | 103 |
| 155 | 3300025907 | Ga0207645_10026399 | Ga0207645_100263993 | 103 |
| 156 | 3300025907 | Ga0207645_10174952 | Ga0207645_101749522 | 103 |
| 157 | 3300025907 | Ga0207645_10728755 | Ga0207645_107287552 | 103 |
| 158 | 3300025908 | Ga0207643_10178103 | Ga0207643_101781032 | 103 |
| 159 | 3300025908 | Ga0207643_10411592 | Ga0207643_104115921 | 103 |
| 160 | 3300025909 | Ga0207705_10000511 | Ga0207705_1000051119 | 103 |
| 161 | 3300025913 | Ga0207695_10003496 | Ga0207695_1000349626 | 103 |
| 162 | 3300025914 | Ga0207671_10004021 | Ga0207671_1000402114 | 103 |
| 163 | 3300025918 | Ga0207662_10431934 | Ga0207662_104319342 | 103 |
| 164 | 3300025919 | Ga0207657_10061226 | Ga0207657_100612262 | 103 |
| 165 | 3300025920 | Ga0207649_10366653 | Ga0207649_103666532 | 103 |
| 166 | 3300025923 | Ga0207681_10446773 | Ga0207681_104467732 | 103 |
| 167 | 3300025923 | Ga0207681_10788222 | Ga0207681_107882222 | 103 |
| 168 | 3300025924 | Ga0207694_10054679 | Ga0207694_100546796 | 103 |
| 169 | 3300025926 | Ga0207659_10035680 | Ga0207659_100356808 | 103 |
| 170 | 3300025926 | Ga0207659_10830814 | Ga0207659_108308142 | 103 |
| 171 | 3300025932 | Ga0207690_10003585 | Ga0207690_1000358514 | 103 |
| 172 | 3300025932 | Ga0207690_10596524 | Ga0207690_105965242 | 103 |
| 173 | 3300025932 | Ga0207690_11379996 | Ga0207690_113799962 | 103 |
| 174 | 3300025933 | Ga0207706_10141807 | Ga0207706_101418072 | 103 |
| 175 | 3300025933 | Ga0207706_10178089 | Ga0207706_101780893 | 103 |
| 176 | 3300025934 | Ga0207686_10324797 | Ga0207686_103247972 | 103 |
| 177 | 3300025935 | Ga0207709_10000246 | Ga0207709_1000024668 | 103 |
| 178 | 3300025940 | Ga0207691_10040894 | Ga0207691_100408944 | 103 |
| 179 | 3300025941 | Ga0207711_10023215 | Ga0207711_100232152 | 103 |
| 180 | 3300025942 | Ga0207689_10983605 | Ga0207689_109836052 | 103 |
| 181 | 3300025944 | Ga0207661_11104522 | Ga0207661_111045222 | 103 |
| 182 | 3300025945 | Ga0207679_10082101 | Ga0207679_100821015 | 103 |
| 183 | 3300025945 | Ga0207679_10410191 | Ga0207679_104101912 | 103 |
| 184 | 3300025945 | Ga0207679_11063512 | Ga0207679_110635121 | 103 |
| 185 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002153 | 103 |
| 186 | 3300025960 | Ga0207651_10407069 | Ga0207651_104070693 | 103 |
| 187 | 3300025960 | Ga0207651_11202960 | Ga0207651_112029602 | 103 |
| 188 | 3300025972 | Ga0207668_11637182 | Ga0207668_116371822 | 103 |
| 189 | 3300025981 | Ga0207640_10002027 | Ga0207640_100020274 | 103 |
| 190 | 3300025981 | Ga0207640_10075290 | Ga0207640_100752905 | 103 |
| 191 | 3300025981 | Ga0207640_10924496 | Ga0207640_109244962 | 103 |
| 192 | 3300026023 | Ga0207677_10292498 | Ga0207677_102924982 | 103 |
| 193 | 3300026041 | Ga0207639_10003616 | Ga0207639_1000361620 | 103 |
| 194 | 3300026041 | Ga0207639_12242416 | Ga0207639_122424162 | 103 |
| 195 | 3300026067 | Ga0207678_10004876 | Ga0207678_100048765 | 103 |
| 196 | 3300026067 | Ga0207678_10224561 | Ga0207678_102245612 | 103 |
| 197 | 3300026088 | Ga0207641_11530673 | Ga0207641_115306732 | 103 |
| 198 | 3300026089 | Ga0207648_10339403 | Ga0207648_103394032 | 103 |
| 199 | 3300026089 | Ga0207648_10432267 | Ga0207648_104322672 | 103 |
| 200 | 3300026095 | Ga0207676_10710927 | Ga0207676_107109272 | 103 |
| 201 | 3300026116 | Ga0207674_10060601 | Ga0207674_100606012 | 103 |
| 202 | 3300026116 | Ga0207674_10295063 | Ga0207674_102950632 | 103 |
| 203 | 3300026118 | Ga0207675_100000157 | Ga0207675_10000015750 | 103 |
| 204 | 3300026118 | Ga0207675_101390482 | Ga0207675_1013904822 | 103 |
| 205 | 3300026121 | Ga0207683_10054331 | Ga0207683_100543312 | 103 |
| 206 | 3300026121 | Ga0207683_10092626 | Ga0207683_100926262 | 103 |
| 207 | 3300026142 | Ga0207698_10002491 | Ga0207698_1000249120 | 103 |
| 208 | 3300027364 | Ga0209967_1023094 | Ga0209967_10230942 | 103 |
| 209 | 3300027462 | Ga0210000_1086907 | Ga0210000_10869071 | 103 |
| 210 | 3300027876 | Ga0209974_10165900 | Ga0209974_101659002 | 103 |
| 211 | 3300028379 | Ga0268266_10022523 | Ga0268266_100225234 | 103 |
| 212 | 3300031548 | Ga0307408_100485545 | Ga0307408_1004855452 | 103 |
| 213 | 3300031548 | Ga0307408_100910882 | Ga0307408_1009108822 | 103 |
| 214 | 3300031731 | Ga0307405_10059852 | Ga0307405_100598523 | 103 |
| 215 | 3300031731 | Ga0307405_10375159 | Ga0307405_103751592 | 103 |
| 216 | 3300031824 | Ga0307413_10008194 | Ga0307413_100081944 | 103 |
| 217 | 3300031824 | Ga0307413_10070575 | Ga0307413_100705754 | 103 |
| 218 | 3300031824 | Ga0307413_10129469 | Ga0307413_101294693 | 103 |
| 219 | 3300031824 | Ga0307413_10272832 | Ga0307413_102728323 | 103 |
| 220 | 3300031824 | Ga0307413_10569105 | Ga0307413_105691051 | 103 |
| 221 | 3300031824 | Ga0307413_10851390 | Ga0307413_108513902 | 103 |
| 222 | 3300031852 | Ga0307410_10049247 | Ga0307410_100492471 | 103 |
| 223 | 3300031852 | Ga0307410_10206925 | Ga0307410_102069253 | 103 |
| 224 | 3300031852 | Ga0307410_10462985 | Ga0307410_104629852 | 103 |
| 225 | 3300031852 | Ga0307410_10830753 | Ga0307410_108307532 | 103 |
| 226 | 3300031852 | Ga0307410_12099412 | Ga0307410_120994122 | 103 |
| 227 | 3300031901 | Ga0307406_10061019 | Ga0307406_100610193 | 103 |
| 228 | 3300031903 | Ga0307407_10060971 | Ga0307407_100609714 | 103 |
| 229 | 3300031903 | Ga0307407_10127566 | Ga0307407_101275663 | 103 |
| 230 | 3300031903 | Ga0307407_11047507 | Ga0307407_110475071 | 103 |
| 231 | 3300031903 | Ga0307407_11057895 | Ga0307407_110578952 | 103 |
| 232 | 3300031911 | Ga0307412_10256539 | Ga0307412_102565392 | 103 |
| 233 | 3300031911 | Ga0307412_10344895 | Ga0307412_103448952 | 103 |
| 234 | 3300031995 | Ga0307409_100277274 | Ga0307409_1002772743 | 103 |
| 235 | 3300031995 | Ga0307409_100334980 | Ga0307409_1003349802 | 103 |
| 236 | 3300031995 | Ga0307409_100380008 | Ga0307409_1003800082 | 103 |
| 237 | 3300031995 | Ga0307409_100574346 | Ga0307409_1005743462 | 103 |
| 238 | 3300032002 | Ga0307416_100786304 | Ga0307416_1007863042 | 103 |
| 239 | 3300032002 | Ga0307416_102165424 | Ga0307416_1021654242 | 103 |
| 240 | 3300032004 | Ga0307414_10020158 | Ga0307414_100201583 | 103 |
| 241 | 3300032004 | Ga0307414_10101494 | Ga0307414_101014942 | 103 |
| 242 | 3300032004 | Ga0307414_10151662 | Ga0307414_101516622 | 103 |
| 243 | 3300032004 | Ga0307414_10568803 | Ga0307414_105688032 | 103 |
| 244 | 3300032005 | Ga0307411_10039443 | Ga0307411_100394432 | 103 |
| 245 | 3300032005 | Ga0307411_10311147 | Ga0307411_103111471 | 103 |
| 246 | 3300032005 | Ga0307411_10413567 | Ga0307411_104135672 | 103 |
| 247 | 3300032005 | Ga0307411_10602835 | Ga0307411_106028352 | 103 |
| 248 | 3300032005 | Ga0307411_10805665 | Ga0307411_108056652 | 103 |
| 249 | 3300032005 | Ga0307411_11406574 | Ga0307411_114065742 | 103 |
| 250 | 3300032005 | Ga0307411_11484809 | Ga0307411_114848092 | 103 |
| 251 | 3300032005 | Ga0307411_11897157 | Ga0307411_118971571 | 103 |
| 252 | 3300032126 | Ga0307415_100359095 | Ga0307415_1003590952 | 103 |
| 253 | 3300032126 | Ga0307415_100862787 | Ga0307415_1008627872 | 103 |
| 254 | 3300032126 | Ga0307415_101190348 | Ga0307415_1011903482 | 103 |
| 255 | 3300037312 | Ga0395899_0220425 | Ga0395899_0220425_345_668 | 103 |
| 256 | 3300037418 | Ga0395900_0747509 | Ga0395900_0747509_443_766 | 103 |
| 257 | 3300037466 | Ga0395898_0742267 | Ga0395898_0742267_79_402 | 103 |
| 258 | 3300037471 | Ga0395905_0821624 | Ga0395905_0821624_375_698 | 103 |
| 259 | 3300037853 | Ga0436364_1065372 | Ga0436364_1065372_105529_105846 | 103 |
| 260 | 3300038443 | Ga0395901_0564338 | Ga0395901_0564338_698_1021 | 103 |
| 261 | 3300038443 | Ga0395901_1667373 | Ga0395901_1667373_247_570 | 103 |
| 262 | 3300039437 | Ga0436365_0298268 | Ga0436365_0298268_1568_1885 | 103 |
| 263 | 3300041406 | Ga0439439_0128420 | Ga0439439_0128420_122_442 | 103 |
| 264 | 3300041413 | Ga0439465_0015647 | Ga0439465_0015647_952_1275 | 103 |
| 265 | 3300041496 | Ga0451839_0681194 | Ga0451839_0681194_340_660 | 103 |
| 266 | 3300041999 | Ga0439433_0067820 | Ga0439433_0067820_277_597 | 103 |
| 267 | 3300042004 | Ga0439445_0225339 | Ga0439445_0225339_23_346 | 103 |
| 268 | 3300042006 | Ga0439432_055513 | Ga0439432_055513_53_373 | 103 |
| 269 | 3300042007 | Ga0439449_0067357 | Ga0439449_0067357_245_565 | 103 |
| 270 | 3300042007 | Ga0439449_0101276 | Ga0439449_0101276_636_959 | 103 |
| 271 | 3300042010 | Ga0439452_044323 | Ga0439452_044323_110_430 | 103 |
| 272 | 3300042010 | Ga0439452_078916 | Ga0439452_078916_81_401 | 103 |
| 273 | 3300042015 | Ga0439462_0208767 | Ga0439462_0208767_64_387 | 103 |
| 274 | 3300042116 | Ga0450912_010825 | Ga0450912_010825_271_594 | 103 |
| 275 | 3300042131 | Ga0450894_081837 | Ga0450894_081837_18_341 | 103 |
| 276 | 3300042157 | Ga0439458_0212146 | Ga0439458_0212146_174_494 | 103 |
| 277 | 3300042435 | Ga0439434_0145500 | Ga0439434_0145500_220_543 | 103 |
| 278 | 3300042876 | Ga0451577_0768435 | Ga0451577_0768435_106_426 | 103 |
| 279 | 3300044712 | Ga0453684_0507510 | Ga0453684_0507510_733_1053 | 103 |
| 280 | 3300045051 | Ga0451576_2038486 | Ga0451576_2038486_238_558 | 103 |
| 281 | 3300046491 | Ga0495584_0059740 | Ga0495584_0059740_293_616 | 103 |
| 282 | 3300046506 | Ga0495583_0195098 | Ga0495583_0195098_130_450 | 103 |
| 283 | 3300046515 | Ga0495620_0214338 | Ga0495620_0214338_179_502 | 103 |
| 284 | 3300046525 | Ga0495663_0395046 | Ga0495663_0395046_162_482 | 103 |
| 285 | 3300046528 | Ga0495642_0044719 | Ga0495642_0044719_1032_1355 | 103 |
| 286 | 3300046530 | Ga0495654_0240736 | Ga0495654_0240736_313_633 | 103 |
| 287 | 3300046557 | Ga0495622_0039363 | Ga0495622_0039363_946_1266 | 103 |
| 288 | 3300046558 | Ga0495633_0243849 | Ga0495633_0243849_160_480 | 103 |
| 289 | 3300046616 | Ga0495668_0270987 | Ga0495668_0270987_406_726 | 103 |
| 290 | 3300046684 | Ga0495669_0268506 | Ga0495669_0268506_49_369 | 103 |
| 291 | 3300046684 | Ga0495669_0278529 | Ga0495669_0278529_352_672 | 103 |
| 292 | 3300046691 | Ga0495670_0147119 | Ga0495670_0147119_681_1001 | 103 |
| 293 | 3300046691 | Ga0495670_0560598 | Ga0495670_0560598_45_359 | 103 |
| 294 | 3300046692 | Ga0495671_0008086 | Ga0495671_0008086_2993_3313 | 103 |
| 295 | 3300047445 | Ga0495677_0014214 | Ga0495677_0014214_1710_2033 | 103 |
| 296 | 3300047445 | Ga0495677_0105204 | Ga0495677_0105204_418_741 | 103 |
| 297 | 3300047472 | Ga0495686_0000486 | Ga0495686_0000486_56725_57045 | 103 |
| 298 | 3300047472 | Ga0495686_0158108 | Ga0495686_0158108_452_775 | 103 |
| 299 | 3300048090 | Ga0495615_0313283 | Ga0495615_0313283_11_331 | 103 |
| 300 | 3300048905 | Ga0496102_0194172 | Ga0496102_0194172_968_1282 | 103 |
| 301 | 3300048905 | Ga0496102_1513698 | Ga0496102_1513698_88_408 | 103 |
| 302 | 3300048906 | Ga0496103_0215571 | Ga0496103_0215571_498_818 | 103 |
| 303 | 3300048906 | Ga0496103_0383193 | Ga0496103_0383193_250_564 | 103 |
| 304 | 3300048908 | Ga0496105_0250296 | Ga0496105_0250296_113_427 | 103 |
| 305 | 3300048912 | Ga0496109_0445967 | Ga0496109_0445967_868_1188 | 103 |
| 306 | 3300048914 | Ga0496111_0129963 | Ga0496111_0129963_562_882 | 103 |
| 307 | 3300049127 | Ga0501306_031216 | Ga0501306_031216_442_762 | 103 |
| 308 | 3300049130 | Ga0501310_028079 | Ga0501310_028079_272_595 | 103 |
| 309 | 3300049162 | Ga0501307_023755 | Ga0501307_023755_353_673 | 103 |
| 310 | 3300049162 | Ga0501307_026073 | Ga0501307_026073_452_772 | 103 |
| 311 | 3300049527 | Ga0501311_021033 | Ga0501311_021033_316_636 | 103 |
| 312 | 3300049527 | Ga0501311_025146 | Ga0501311_025146_89_406 | 103 |
| 313 | 3300049531 | Ga0501315_037732 | Ga0501315_037732_369_689 | 103 |
| 314 | 3300049539 | Ga0501323_076951 | Ga0501323_076951_198_518 | 103 |
| 315 | 3300049540 | Ga0501324_008845 | Ga0501324_008845_544_864 | 103 |
| 316 | 3300049575 | Ga0501039_0140668 | Ga0501039_0140668_1404_1724 | 103 |
| 317 | 3300049587 | Ga0501071_0586635 | Ga0501071_0586635_76_396 | 103 |
| 318 | 3300049591 | Ga0501075_0816081 | Ga0501075_0816081_135_455 | 103 |
| 319 | 3300049656 | Ga0501209_253846 | Ga0501209_253846_164_484 | 103 |
| 320 | 3300049664 | Ga0501224_066310 | Ga0501224_066310_22_336 | 103 |
| 321 | 3300049741 | Ga0501079_1508672 | Ga0501079_1508672_138_458 | 103 |
| 322 | 3300049824 | Ga0501045_0695140 | Ga0501045_0695140_46_366 | 103 |
| 323 | 3300053118 | Ga0500594_0005507 | Ga0500594_0005507_1286_1606 | 103 |
| 324 | 3300053136 | Ga0500559_0100471 | Ga0500559_0100471_146_463 | 103 |
| 325 | 3300053735 | Ga0500596_003226 | Ga0500596_003226_2448_2771 | 103 |
| 326 | 3300059477 | Ga0587084_000368 | Ga0587084_000368_870_1193 | 103 |
| 327 | 3300059478 | Ga0587093_018465 | Ga0587093_018465_491_814 | 103 |
| 328 | 3300059490 | Ga0587066_001465 | Ga0587066_001465_1648_1971 | 103 |
| 329 | 3300059493 | Ga0587077_001167 | Ga0587077_001167_182_505 | 103 |
| 330 | 3300059503 | Ga0587080_014969 | Ga0587080_014969_348_671 | 103 |
| 331 | 3300059504 | Ga0587082_008501 | Ga0587082_008501_652_975 | 103 |
| 332 | 3300059505 | Ga0587083_0037171 | Ga0587083_0037171_497_820 | 103 |
| 333 | 3300059506 | Ga0587085_007179 | Ga0587085_007179_705_1028 | 103 |
| 334 | 3300059507 | Ga0587086_006030 | Ga0587086_006030_442_765 | 103 |
| 335 | 3300059508 | Ga0587088_007942 | Ga0587088_007942_699_1022 | 103 |
| 336 | 3300059508 | Ga0587088_048881 | Ga0587088_048881_36_359 | 103 |
| 337 | 3300059509 | Ga0587089_006060 | Ga0587089_006060_501_824 | 103 |
| 338 | 3300059510 | Ga0587090_001175 | Ga0587090_001175_37_360 | 103 |
| 339 | 3300059510 | Ga0587090_118078 | Ga0587090_118078_21_341 | 103 |
| 340 | 3300059511 | Ga0587091_000254 | Ga0587091_000254_2101_2424 | 103 |
| 341 | 3300059512 | Ga0587092_007157 | Ga0587092_007157_482_805 | 103 |
| 342 | 3300059513 | Ga0587094_000504 | Ga0587094_000504_2152_2475 | 103 |
| 343 | 3300059604 | Ga0587098_006412 | Ga0587098_006412_484_807 | 103 |
| 344 | 3300059605 | Ga0587106_011511 | Ga0587106_011511_664_987 | 103 |
| 345 | 3300059606 | Ga0587121_04918 | Ga0587121_04918_203_526 | 103 |
| 346 | 3300059608 | Ga0587129_003262 | Ga0587129_003262_392_715 | 103 |
| 347 | 3300059622 | Ga0587099_003045 | Ga0587099_003045_381_704 | 103 |
| 348 | 3300059623 | Ga0587101_000706 | Ga0587101_000706_2117_2440 | 103 |
| 349 | 3300059627 | Ga0587117_010629 | Ga0587117_010629_257_580 | 103 |
| 350 | 3300059630 | Ga0587128_000194 | Ga0587128_000194_982_1305 | 103 |
| 351 | 3300059641 | Ga0587068_000363 | Ga0587068_000363_1735_2058 | 103 |
| 352 | 3300059642 | Ga0587069_009859 | Ga0587069_009859_627_950 | 103 |
| 353 | 3300059644 | Ga0587075_079900 | Ga0587075_079900_263_586 | 103 |
| 354 | 3300059645 | Ga0587076_014253 | Ga0587076_014253_293_616 | 103 |
| 355 | 3300059645 | Ga0587076_060180 | Ga0587076_060180_47_370 | 103 |
| 356 | 3300059646 | Ga0587078_000705 | Ga0587078_000705_2182_2505 | 103 |
| 357 | 3300059647 | Ga0587079_008963 | Ga0587079_008963_399_722 | 103 |
| 358 | 3300059648 | Ga0587100_000732 | Ga0587100_000732_703_1026 | 103 |
| 359 | 3300059649 | Ga0587102_000570 | Ga0587102_000570_293_616 | 103 |
| 360 | 3300059650 | Ga0587104_003534 | Ga0587104_003534_351_674 | 103 |
| 361 | 3300059651 | Ga0587105_000848 | Ga0587105_000848_612_935 | 103 |
| 362 | 3300059652 | Ga0587107_000546 | Ga0587107_000546_1794_2117 | 103 |
| 363 | 3300059655 | Ga0587114_008517 | Ga0587114_008517_371_694 | 103 |
| 364 | 3300059657 | Ga0587118_01767 | Ga0587118_01767_455_778 | 103 |
| 365 | 3300059658 | Ga0587119_000105 | Ga0587119_000105_2100_2423 | 103 |
| 366 | 3300059659 | Ga0587120_005626 | Ga0587120_005626_315_638 | 103 |
| 367 | 3300059660 | Ga0587124_007519 | Ga0587124_007519_228_551 | 103 |
| 368 | 3300060247 | Ga0587096_00847 | Ga0587096_00847_430_753 | 103 |
| 369 | 3300060344 | Ga0587071_000753 | Ga0587071_000753_870_1193 | 103 |
| 370 | 3300060346 | Ga0587111_0032114 | Ga0587111_0032114_719_1042 | 103 |
| 371 | 3300060346 | Ga0587111_0112702 | Ga0587111_0112702_332_655 | 103 |
| 372 | 3300001432 | JGI24034J14986_101847 | JGI24034J14986_1018472 | 104 |
| 373 | 3300001915 | JGI24741J21665_1015360 | JGI24741J21665_10153601 | 104 |
| 374 | 3300001976 | JGI24752J21851_1000007 | JGI24752J21851_100000711 | 104 |
| 375 | 3300001989 | JGI24739J22299_10134605 | JGI24739J22299_101346052 | 104 |
| 376 | 3300001990 | JGI24737J22298_10139036 | JGI24737J22298_101390362 | 104 |
| 377 | 3300002067 | JGI24735J21928_10011436 | JGI24735J21928_100114363 | 104 |
| 378 | 3300002070 | JGI24750J21931_1000298 | JGI24750J21931_10002982 | 104 |
| 379 | 3300002074 | JGI24748J21848_1000070 | JGI24748J21848_100007027 | 104 |
| 380 | 3300002074 | JGI24748J21848_1008969 | JGI24748J21848_10089692 | 104 |
| 381 | 3300002076 | JGI24749J21850_1000118 | JGI24749J21850_100011820 | 104 |
| 382 | 3300002239 | JGI24034J26672_10000038 | JGI24034J26672_1000003826 | 104 |
| 383 | 3300002239 | JGI24034J26672_10014302 | JGI24034J26672_100143022 | 104 |
| 384 | 3300002239 | JGI24034J26672_10049632 | JGI24034J26672_100496322 | 104 |
| 385 | 3300002244 | JGI24742J22300_10003980 | JGI24742J22300_100039804 | 104 |
| 386 | 3300002459 | JGI24751J29686_10010345 | JGI24751J29686_100103452 | 104 |
| 387 | 3300003214 | JGI25165J46597_1000023 | JGI25165J46597_100002399 | 104 |
| 388 | 3300004801 | Ga0058860_11860095 | Ga0058860_118600951 | 104 |
| 389 | 3300005290 | Ga0065712_10100550 | Ga0065712_101005504 | 104 |
| 390 | 3300005293 | Ga0065715_10029418 | Ga0065715_100294182 | 104 |
| 391 | 3300005293 | Ga0065715_10448200 | Ga0065715_104482002 | 104 |
| 392 | 3300005293 | Ga0065715_10598461 | Ga0065715_105984612 | 104 |
| 393 | 3300005295 | Ga0065707_10525541 | Ga0065707_105255411 | 104 |
| 394 | 3300005327 | Ga0070658_10354895 | Ga0070658_103548951 | 104 |
| 395 | 3300005327 | Ga0070658_10470961 | Ga0070658_104709612 | 104 |
| 396 | 3300005327 | Ga0070658_10488853 | Ga0070658_104888532 | 104 |
| 397 | 3300005327 | Ga0070658_10739176 | Ga0070658_107391762 | 104 |
| 398 | 3300005327 | Ga0070658_10790314 | Ga0070658_107903141 | 104 |
| 399 | 3300005327 | Ga0070658_11444257 | Ga0070658_114442571 | 104 |
| 400 | 3300005328 | Ga0070676_10770661 | Ga0070676_107706611 | 104 |
| 401 | 3300005329 | Ga0070683_100974924 | Ga0070683_1009749242 | 104 |
| 402 | 3300005329 | Ga0070683_101634463 | Ga0070683_1016344632 | 104 |
| 403 | 3300005330 | Ga0070690_100000097 | Ga0070690_10000009743 | 104 |
| 404 | 3300005331 | Ga0070670_100010675 | Ga0070670_1000106752 | 104 |
| 405 | 3300005331 | Ga0070670_100034259 | Ga0070670_1000342592 | 104 |
| 406 | 3300005333 | Ga0070677_10037474 | Ga0070677_100374741 | 104 |
| 407 | 3300005335 | Ga0070666_10000004 | Ga0070666_10000004290 | 104 |
| 408 | 3300005335 | Ga0070666_10191087 | Ga0070666_101910872 | 104 |
| 409 | 3300005335 | Ga0070666_10490911 | Ga0070666_104909112 | 104 |
| 410 | 3300005336 | Ga0070680_100363294 | Ga0070680_1003632942 | 104 |
| 411 | 3300005337 | Ga0070682_100379432 | Ga0070682_1003794321 | 104 |
| 412 | 3300005339 | Ga0070660_100096538 | Ga0070660_1000965382 | 104 |
| 413 | 3300005339 | Ga0070660_100188024 | Ga0070660_1001880242 | 104 |
| 414 | 3300005339 | Ga0070660_100205715 | Ga0070660_1002057152 | 104 |
| 415 | 3300005339 | Ga0070660_100390605 | Ga0070660_1003906051 | 104 |
| 416 | 3300005339 | Ga0070660_100419886 | Ga0070660_1004198862 | 104 |
| 417 | 3300005339 | Ga0070660_101060484 | Ga0070660_1010604842 | 104 |
| 418 | 3300005340 | Ga0070689_100106270 | Ga0070689_1001062702 | 104 |
| 419 | 3300005343 | Ga0070687_100263328 | Ga0070687_1002633282 | 104 |
| 420 | 3300005344 | Ga0070661_100033195 | Ga0070661_1000331955 | 104 |
| 421 | 3300005344 | Ga0070661_100101205 | Ga0070661_1001012053 | 104 |
| 422 | 3300005344 | Ga0070661_100353376 | Ga0070661_1003533761 | 104 |
| 423 | 3300005344 | Ga0070661_100410927 | Ga0070661_1004109271 | 104 |
| 424 | 3300005345 | Ga0070692_10047048 | Ga0070692_100470482 | 104 |
| 425 | 3300005347 | Ga0070668_100078782 | Ga0070668_1000787823 | 104 |
| 426 | 3300005347 | Ga0070668_100164638 | Ga0070668_1001646383 | 104 |
| 427 | 3300005347 | Ga0070668_100367114 | Ga0070668_1003671142 | 104 |
| 428 | 3300005353 | Ga0070669_100000296 | Ga0070669_10000029643 | 104 |
| 429 | 3300005353 | Ga0070669_100177439 | Ga0070669_1001774393 | 104 |
| 430 | 3300005353 | Ga0070669_100285920 | Ga0070669_1002859201 | 104 |
| 431 | 3300005353 | Ga0070669_100971176 | Ga0070669_1009711762 | 104 |
| 432 | 3300005353 | Ga0070669_101391820 | Ga0070669_1013918201 | 104 |
| 433 | 3300005354 | Ga0070675_100190962 | Ga0070675_1001909621 | 104 |
| 434 | 3300005354 | Ga0070675_100929592 | Ga0070675_1009295921 | 104 |
| 435 | 3300005355 | Ga0070671_100012607 | Ga0070671_10001260711 | 104 |
| 436 | 3300005355 | Ga0070671_100023714 | Ga0070671_1000237145 | 104 |
| 437 | 3300005355 | Ga0070671_100490132 | Ga0070671_1004901322 | 104 |
| 438 | 3300005356 | Ga0070674_100112061 | Ga0070674_1001120612 | 104 |
| 439 | 3300005356 | Ga0070674_100242117 | Ga0070674_1002421171 | 104 |
| 440 | 3300005364 | Ga0070673_100880830 | Ga0070673_1008808302 | 104 |
| 441 | 3300005365 | Ga0070688_100002383 | Ga0070688_10000238310 | 104 |
| 442 | 3300005366 | Ga0070659_100235299 | Ga0070659_1002352992 | 104 |
| 443 | 3300005366 | Ga0070659_100242738 | Ga0070659_1002427382 | 104 |
| 444 | 3300005366 | Ga0070659_101152500 | Ga0070659_1011525001 | 104 |
| 445 | 3300005366 | Ga0070659_101427295 | Ga0070659_1014272952 | 104 |
| 446 | 3300005367 | Ga0070667_100061703 | Ga0070667_1000617032 | 104 |
| 447 | 3300005367 | Ga0070667_100200068 | Ga0070667_1002000682 | 104 |
| 448 | 3300005367 | Ga0070667_102150601 | Ga0070667_1021506011 | 104 |
| 449 | 3300005435 | Ga0070714_100025886 | Ga0070714_1000258861 | 104 |
| 450 | 3300005435 | Ga0070714_100507601 | Ga0070714_1005076012 | 104 |
| 451 | 3300005436 | Ga0070713_100239005 | Ga0070713_1002390052 | 104 |
| 452 | 3300005455 | Ga0070663_100080949 | Ga0070663_1000809492 | 104 |
| 453 | 3300005455 | Ga0070663_100751747 | Ga0070663_1007517472 | 104 |
| 454 | 3300005455 | Ga0070663_101348259 | Ga0070663_1013482591 | 104 |
| 455 | 3300005456 | Ga0070678_100403125 | Ga0070678_1004031252 | 104 |
| 456 | 3300005457 | Ga0070662_100046495 | Ga0070662_1000464952 | 104 |
| 457 | 3300005457 | Ga0070662_100064573 | Ga0070662_1000645732 | 104 |
| 458 | 3300005458 | Ga0070681_10807026 | Ga0070681_108070262 | 104 |
| 459 | 3300005458 | Ga0070681_10847619 | Ga0070681_108476192 | 104 |
| 460 | 3300005466 | Ga0070685_10000262 | Ga0070685_1000026234 | 104 |
| 461 | 3300005530 | Ga0070679_100226535 | Ga0070679_1002265352 | 104 |
| 462 | 3300005530 | Ga0070679_100321123 | Ga0070679_1003211231 | 104 |
| 463 | 3300005530 | Ga0070679_101542479 | Ga0070679_1015424791 | 104 |
| 464 | 3300005535 | Ga0070684_101371812 | Ga0070684_1013718122 | 104 |
| 465 | 3300005539 | Ga0068853_100079177 | Ga0068853_1000791773 | 104 |
| 466 | 3300005539 | Ga0068853_100535457 | Ga0068853_1005354571 | 104 |
| 467 | 3300005539 | Ga0068853_100674894 | Ga0068853_1006748941 | 104 |
| 468 | 3300005543 | Ga0070672_100207425 | Ga0070672_1002074252 | 104 |
| 469 | 3300005544 | Ga0070686_100000061 | Ga0070686_10000006178 | 104 |
| 470 | 3300005546 | Ga0070696_100112118 | Ga0070696_1001121182 | 104 |
| 471 | 3300005548 | Ga0070665_100000004 | Ga0070665_100000004668 | 104 |
| 472 | 3300005548 | Ga0070665_100009730 | Ga0070665_1000097302 | 104 |
| 473 | 3300005548 | Ga0070665_100339978 | Ga0070665_1003399783 | 104 |
| 474 | 3300005548 | Ga0070665_101500274 | Ga0070665_1015002742 | 104 |
| 475 | 3300005564 | Ga0070664_100101975 | Ga0070664_1001019753 | 104 |
| 476 | 3300005564 | Ga0070664_100325070 | Ga0070664_1003250702 | 104 |
| 477 | 3300005564 | Ga0070664_100520843 | Ga0070664_1005208432 | 104 |
| 478 | 3300005564 | Ga0070664_100898377 | Ga0070664_1008983772 | 104 |
| 479 | 3300005564 | Ga0070664_101808126 | Ga0070664_1018081262 | 104 |
| 480 | 3300005564 | Ga0070664_102074491 | Ga0070664_1020744912 | 104 |
| 481 | 3300005577 | Ga0068857_100226553 | Ga0068857_1002265533 | 104 |
| 482 | 3300005577 | Ga0068857_100808385 | Ga0068857_1008083851 | 104 |
| 483 | 3300005577 | Ga0068857_101067976 | Ga0068857_1010679762 | 104 |
| 484 | 3300005614 | Ga0068856_100050714 | Ga0068856_1000507142 | 104 |
| 485 | 3300005614 | Ga0068856_100150227 | Ga0068856_1001502274 | 104 |
| 486 | 3300005616 | Ga0068852_100218546 | Ga0068852_1002185462 | 104 |
| 487 | 3300005616 | Ga0068852_100329391 | Ga0068852_1003293913 | 104 |
| 488 | 3300005616 | Ga0068852_100931418 | Ga0068852_1009314182 | 104 |
| 489 | 3300005616 | Ga0068852_100947817 | Ga0068852_1009478172 | 104 |
| 490 | 3300005617 | Ga0068859_100010520 | Ga0068859_1000105204 | 104 |
| 491 | 3300005617 | Ga0068859_100275602 | Ga0068859_1002756022 | 104 |
| 492 | 3300005617 | Ga0068859_100839699 | Ga0068859_1008396992 | 104 |
| 493 | 3300005618 | Ga0068864_100002567 | Ga0068864_10000256719 | 104 |
| 494 | 3300005618 | Ga0068864_101049438 | Ga0068864_1010494381 | 104 |
| 495 | 3300005719 | Ga0068861_100002842 | Ga0068861_1000028422 | 104 |
| 496 | 3300005719 | Ga0068861_101088385 | Ga0068861_1010883851 | 104 |
| 497 | 3300005834 | Ga0068851_10011439 | Ga0068851_100114395 | 104 |
| 498 | 3300005834 | Ga0068851_10360727 | Ga0068851_103607272 | 104 |
| 499 | 3300005840 | Ga0068870_11021802 | Ga0068870_110218022 | 104 |
| 500 | 3300005841 | Ga0068863_100000013 | Ga0068863_100000013214 | 104 |
| 501 | 3300005841 | Ga0068863_100909232 | Ga0068863_1009092322 | 104 |
| 502 | 3300005842 | Ga0068858_100000664 | Ga0068858_10000066418 | 104 |
| 503 | 3300005842 | Ga0068858_100008722 | Ga0068858_1000087228 | 104 |
| 504 | 3300005843 | Ga0068860_100000009 | Ga0068860_100000009289 | 104 |
| 505 | 3300005843 | Ga0068860_100007808 | Ga0068860_10000780814 | 104 |
| 506 | 3300005843 | Ga0068860_100544238 | Ga0068860_1005442382 | 104 |
| 507 | 3300005844 | Ga0068862_100001446 | Ga0068862_10000144622 | 104 |
| 508 | 3300005985 | Ga0081539_10018995 | Ga0081539_100189952 | 104 |
| 509 | 3300006028 | Ga0070717_11649270 | Ga0070717_116492701 | 104 |
| 510 | 3300006353 | Ga0075370_10375338 | Ga0075370_103753382 | 104 |
| 511 | 3300006846 | Ga0075430_101382922 | Ga0075430_1013829221 | 104 |
| 512 | 3300006881 | Ga0068865_101545290 | Ga0068865_1015452902 | 104 |
| 513 | 3300006931 | Ga0097620_100010519 | Ga0097620_1000105194 | 104 |
| 514 | 3300006931 | Ga0097620_100275611 | Ga0097620_1002756113 | 104 |
| 515 | 3300006931 | Ga0097620_100839823 | Ga0097620_1008398232 | 104 |
| 516 | 3300009092 | Ga0105250_10073036 | Ga0105250_100730363 | 104 |
| 517 | 3300009093 | Ga0105240_10206568 | Ga0105240_102065684 | 104 |
| 518 | 3300009093 | Ga0105240_10700183 | Ga0105240_107001832 | 104 |
| 519 | 3300009174 | Ga0105241_12609145 | Ga0105241_126091451 | 104 |
| 520 | 3300009177 | Ga0105248_10023935 | Ga0105248_1002393515 | 104 |
| 521 | 3300009177 | Ga0105248_10573441 | Ga0105248_105734412 | 104 |
| 522 | 3300009177 | Ga0105248_11284805 | Ga0105248_112848052 | 104 |
| 523 | 3300009551 | Ga0105238_10931313 | Ga0105238_109313132 | 104 |
| 524 | 3300009551 | Ga0105238_11034238 | Ga0105238_110342382 | 104 |
| 525 | 3300009551 | Ga0105238_11508862 | Ga0105238_115088621 | 104 |
| 526 | 3300009553 | Ga0105249_10000006 | Ga0105249_1000000675 | 104 |
| 527 | 3300010375 | Ga0105239_13502082 | Ga0105239_135020822 | 104 |
| 528 | 3300011119 | Ga0105246_10099608 | Ga0105246_100996082 | 104 |
| 529 | 3300013100 | Ga0157373_10425298 | Ga0157373_104252982 | 104 |
| 530 | 3300013100 | Ga0157373_10426491 | Ga0157373_104264912 | 104 |
| 531 | 3300013100 | Ga0157373_11121058 | Ga0157373_111210581 | 104 |
| 532 | 3300013102 | Ga0157371_10123034 | Ga0157371_101230342 | 104 |
| 533 | 3300013102 | Ga0157371_11159258 | Ga0157371_111592581 | 104 |
| 534 | 3300013104 | Ga0157370_10024969 | Ga0157370_100249696 | 104 |
| 535 | 3300013104 | Ga0157370_11334238 | Ga0157370_113342382 | 104 |
| 536 | 3300013104 | Ga0157370_11633359 | Ga0157370_116333592 | 104 |
| 537 | 3300013105 | Ga0157369_10034063 | Ga0157369_100340635 | 104 |
| 538 | 3300013105 | Ga0157369_11190963 | Ga0157369_111909632 | 104 |
| 539 | 3300013105 | Ga0157369_11220717 | Ga0157369_112207171 | 104 |
| 540 | 3300013296 | Ga0157374_10414168 | Ga0157374_104141682 | 104 |
| 541 | 3300013297 | Ga0157378_10232281 | Ga0157378_102322813 | 104 |
| 542 | 3300013306 | Ga0163162_10034071 | Ga0163162_100340715 | 104 |
| 543 | 3300013306 | Ga0163162_10072394 | Ga0163162_100723942 | 104 |
| 544 | 3300013306 | Ga0163162_10109281 | Ga0163162_101092814 | 104 |
| 545 | 3300013306 | Ga0163162_10789338 | Ga0163162_107893382 | 104 |
| 546 | 3300013307 | Ga0157372_10308225 | Ga0157372_103082252 | 104 |
| 547 | 3300013307 | Ga0157372_10659289 | Ga0157372_106592892 | 104 |
| 548 | 3300013307 | Ga0157372_11061209 | Ga0157372_110612092 | 104 |
| 549 | 3300013307 | Ga0157372_11111232 | Ga0157372_111112322 | 104 |
| 550 | 3300013308 | Ga0157375_10657450 | Ga0157375_106574502 | 104 |
| 551 | 3300013308 | Ga0157375_12866978 | Ga0157375_128669781 | 104 |
| 552 | 3300013308 | Ga0157375_13433680 | Ga0157375_134336802 | 104 |
| 553 | 3300013308 | Ga0157375_13535204 | Ga0157375_135352042 | 104 |
| 554 | 3300014325 | Ga0163163_10019994 | Ga0163163_100199942 | 104 |
| 555 | 3300014326 | Ga0157380_10235709 | Ga0157380_102357093 | 104 |
| 556 | 3300014968 | Ga0157379_10001735 | Ga0157379_1000173511 | 104 |
| 557 | 3300014968 | Ga0157379_10003973 | Ga0157379_100039736 | 104 |
| 558 | 3300017792 | Ga0163161_10000208 | Ga0163161_100002085 | 104 |
| 559 | 3300017792 | Ga0163161_10222559 | Ga0163161_102225593 | 104 |
| 560 | 3300017792 | Ga0163161_10751429 | Ga0163161_107514292 | 104 |
| 561 | 3300020069 | Ga0197907_10990692 | Ga0197907_109906922 | 104 |
| 562 | 3300020078 | Ga0206352_10437088 | Ga0206352_104370882 | 104 |
| 563 | 3300025223 | Ga0207672_1001700 | Ga0207672_10017003 | 104 |
| 564 | 3300025231 | Ga0207427_100986 | Ga0207427_10098612 | 104 |
| 565 | 3300025250 | Ga0209026_1000352 | Ga0209026_100035221 | 104 |
| 566 | 3300025256 | Ga0209759_1033090 | Ga0209759_10330902 | 104 |
| 567 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003938 | 104 |
| 568 | 3300025321 | Ga0207656_10043235 | Ga0207656_100432352 | 104 |
| 569 | 3300025893 | Ga0207682_10487689 | Ga0207682_104876892 | 104 |
| 570 | 3300025903 | Ga0207680_10000010 | Ga0207680_10000010118 | 104 |
| 571 | 3300025903 | Ga0207680_10225072 | Ga0207680_102250722 | 104 |
| 572 | 3300025903 | Ga0207680_10490110 | Ga0207680_104901102 | 104 |
| 573 | 3300025907 | Ga0207645_10567128 | Ga0207645_105671282 | 104 |
| 574 | 3300025909 | Ga0207705_10001825 | Ga0207705_100018256 | 104 |
| 575 | 3300025909 | Ga0207705_10026545 | Ga0207705_100265455 | 104 |
| 576 | 3300025909 | Ga0207705_10207656 | Ga0207705_102076562 | 104 |
| 577 | 3300025909 | Ga0207705_10460666 | Ga0207705_104606662 | 104 |
| 578 | 3300025911 | Ga0207654_11246107 | Ga0207654_112461071 | 104 |
| 579 | 3300025912 | Ga0207707_10362538 | Ga0207707_103625382 | 104 |
| 580 | 3300025912 | Ga0207707_10757610 | Ga0207707_107576102 | 104 |
| 581 | 3300025913 | Ga0207695_11296827 | Ga0207695_112968272 | 104 |
| 582 | 3300025917 | Ga0207660_10884083 | Ga0207660_108840832 | 104 |
| 583 | 3300025918 | Ga0207662_10438171 | Ga0207662_104381712 | 104 |
| 584 | 3300025918 | Ga0207662_10741161 | Ga0207662_107411612 | 104 |
| 585 | 3300025918 | Ga0207662_10813593 | Ga0207662_108135932 | 104 |
| 586 | 3300025919 | Ga0207657_10132430 | Ga0207657_101324302 | 104 |
| 587 | 3300025919 | Ga0207657_10231765 | Ga0207657_102317652 | 104 |
| 588 | 3300025919 | Ga0207657_10348096 | Ga0207657_103480962 | 104 |
| 589 | 3300025919 | Ga0207657_10587063 | Ga0207657_105870632 | 104 |
| 590 | 3300025919 | Ga0207657_10671567 | Ga0207657_106715672 | 104 |
| 591 | 3300025920 | Ga0207649_10363671 | Ga0207649_103636712 | 104 |
| 592 | 3300025920 | Ga0207649_11415093 | Ga0207649_114150932 | 104 |
| 593 | 3300025921 | Ga0207652_10226817 | Ga0207652_102268173 | 104 |
| 594 | 3300025921 | Ga0207652_10573323 | Ga0207652_105733232 | 104 |
| 595 | 3300025923 | Ga0207681_10000197 | Ga0207681_1000019727 | 104 |
| 596 | 3300025923 | Ga0207681_10104132 | Ga0207681_101041322 | 104 |
| 597 | 3300025923 | Ga0207681_10226635 | Ga0207681_102266352 | 104 |
| 598 | 3300025924 | Ga0207694_10417758 | Ga0207694_104177582 | 104 |
| 599 | 3300025925 | Ga0207650_10001567 | Ga0207650_100015677 | 104 |
| 600 | 3300025925 | Ga0207650_10102411 | Ga0207650_101024113 | 104 |
| 601 | 3300025925 | Ga0207650_10181519 | Ga0207650_101815192 | 104 |
| 602 | 3300025926 | Ga0207659_10002689 | Ga0207659_100026894 | 104 |
| 603 | 3300025926 | Ga0207659_10521695 | Ga0207659_105216952 | 104 |
| 604 | 3300025928 | Ga0207700_10528921 | Ga0207700_105289212 | 104 |
| 605 | 3300025929 | Ga0207664_10356883 | Ga0207664_103568832 | 104 |
| 606 | 3300025931 | Ga0207644_10005181 | Ga0207644_100051813 | 104 |
| 607 | 3300025931 | Ga0207644_10008230 | Ga0207644_100082305 | 104 |
| 608 | 3300025931 | Ga0207644_10261373 | Ga0207644_102613732 | 104 |
| 609 | 3300025932 | Ga0207690_10063154 | Ga0207690_100631542 | 104 |
| 610 | 3300025932 | Ga0207690_11047541 | Ga0207690_110475412 | 104 |
| 611 | 3300025933 | Ga0207706_10041209 | Ga0207706_100412095 | 104 |
| 612 | 3300025933 | Ga0207706_10079122 | Ga0207706_100791224 | 104 |
| 613 | 3300025936 | Ga0207670_10087907 | Ga0207670_100879074 | 104 |
| 614 | 3300025937 | Ga0207669_10190199 | Ga0207669_101901993 | 104 |
| 615 | 3300025937 | Ga0207669_10390138 | Ga0207669_103901381 | 104 |
| 616 | 3300025938 | Ga0207704_11679469 | Ga0207704_116794692 | 104 |
| 617 | 3300025940 | Ga0207691_10036228 | Ga0207691_100362282 | 104 |
| 618 | 3300025940 | Ga0207691_10201747 | Ga0207691_102017473 | 104 |
| 619 | 3300025941 | Ga0207711_10006762 | Ga0207711_1000676219 | 104 |
| 620 | 3300025941 | Ga0207711_11042046 | Ga0207711_110420462 | 104 |
| 621 | 3300025944 | Ga0207661_11515151 | Ga0207661_115151511 | 104 |
| 622 | 3300025944 | Ga0207661_11593960 | Ga0207661_115939602 | 104 |
| 623 | 3300025945 | Ga0207679_10001466 | Ga0207679_100014665 | 104 |
| 624 | 3300025945 | Ga0207679_10010673 | Ga0207679_100106732 | 104 |
| 625 | 3300025945 | Ga0207679_10408309 | Ga0207679_104083092 | 104 |
| 626 | 3300025945 | Ga0207679_10571387 | Ga0207679_105713872 | 104 |
| 627 | 3300025945 | Ga0207679_10978667 | Ga0207679_109786672 | 104 |
| 628 | 3300025945 | Ga0207679_11467690 | Ga0207679_114676901 | 104 |
| 629 | 3300025949 | Ga0207667_10742685 | Ga0207667_107426852 | 104 |
| 630 | 3300025960 | Ga0207651_10764349 | Ga0207651_107643492 | 104 |
| 631 | 3300025961 | Ga0207712_10000014 | Ga0207712_10000014289 | 104 |
| 632 | 3300025972 | Ga0207668_10000402 | Ga0207668_1000040227 | 104 |
| 633 | 3300025972 | Ga0207668_10066198 | Ga0207668_100661983 | 104 |
| 634 | 3300025972 | Ga0207668_10348910 | Ga0207668_103489102 | 104 |
| 635 | 3300025981 | Ga0207640_10461720 | Ga0207640_104617202 | 104 |
| 636 | 3300025986 | Ga0207658_10000428 | Ga0207658_1000042829 | 104 |
| 637 | 3300025986 | Ga0207658_10364702 | Ga0207658_103647022 | 104 |
| 638 | 3300026035 | Ga0207703_10002426 | Ga0207703_1000242622 | 104 |
| 639 | 3300026035 | Ga0207703_10101770 | Ga0207703_101017703 | 104 |
| 640 | 3300026041 | Ga0207639_10371981 | Ga0207639_103719812 | 104 |
| 641 | 3300026041 | Ga0207639_11075163 | Ga0207639_110751632 | 104 |
| 642 | 3300026041 | Ga0207639_12146318 | Ga0207639_121463182 | 104 |
| 643 | 3300026067 | Ga0207678_10053905 | Ga0207678_100539052 | 104 |
| 644 | 3300026067 | Ga0207678_10253198 | Ga0207678_102531982 | 104 |
| 645 | 3300026067 | Ga0207678_11674042 | Ga0207678_116740422 | 104 |
| 646 | 3300026078 | Ga0207702_10050310 | Ga0207702_100503105 | 104 |
| 647 | 3300026078 | Ga0207702_10425095 | Ga0207702_104250952 | 104 |
| 648 | 3300026078 | Ga0207702_11087542 | Ga0207702_110875422 | 104 |
| 649 | 3300026088 | Ga0207641_10000099 | Ga0207641_1000009935 | 104 |
| 650 | 3300026088 | Ga0207641_11103809 | Ga0207641_111038092 | 104 |
| 651 | 3300026095 | Ga0207676_10001345 | Ga0207676_100013459 | 104 |
| 652 | 3300026095 | Ga0207676_10214204 | Ga0207676_102142043 | 104 |
| 653 | 3300026095 | Ga0207676_11166737 | Ga0207676_111667372 | 104 |
| 654 | 3300026095 | Ga0207676_11852928 | Ga0207676_118529282 | 104 |
| 655 | 3300026116 | Ga0207674_10219882 | Ga0207674_102198822 | 104 |
| 656 | 3300026116 | Ga0207674_10397602 | Ga0207674_103976022 | 104 |
| 657 | 3300026118 | Ga0207675_100006214 | Ga0207675_10000621413 | 104 |
| 658 | 3300026118 | Ga0207675_102107866 | Ga0207675_1021078661 | 104 |
| 659 | 3300026121 | Ga0207683_10647030 | Ga0207683_106470302 | 104 |
| 660 | 3300026121 | Ga0207683_12118535 | Ga0207683_121185352 | 104 |
| 661 | 3300026142 | Ga0207698_10177021 | Ga0207698_101770212 | 104 |
| 662 | 3300026142 | Ga0207698_10476228 | Ga0207698_104762282 | 104 |
| 663 | 3300026142 | Ga0207698_10829115 | Ga0207698_108291152 | 104 |
| 664 | 3300026142 | Ga0207698_12055575 | Ga0207698_120555752 | 104 |
| 665 | 3300027364 | Ga0209967_1018450 | Ga0209967_10184502 | 104 |
| 666 | 3300027424 | Ga0209984_1015877 | Ga0209984_10158772 | 104 |
| 667 | 3300027543 | Ga0209999_1039061 | Ga0209999_10390612 | 104 |
| 668 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009135 | 104 |
| 669 | 3300028379 | Ga0268266_10140961 | Ga0268266_101409613 | 104 |
| 670 | 3300028379 | Ga0268266_10396572 | Ga0268266_103965722 | 104 |
| 671 | 3300028380 | Ga0268265_10000047 | Ga0268265_10000047114 | 104 |
| 672 | 3300028380 | Ga0268265_10000074 | Ga0268265_1000007452 | 104 |
| 673 | 3300028381 | Ga0268264_10000023 | Ga0268264_1000002376 | 104 |
| 674 | 3300028381 | Ga0268264_10000215 | Ga0268264_1000021560 | 104 |
| 675 | 3300031548 | Ga0307408_100006443 | Ga0307408_1000064436 | 104 |
| 676 | 3300031548 | Ga0307408_100199693 | Ga0307408_1001996932 | 104 |
| 677 | 3300031548 | Ga0307408_100206209 | Ga0307408_1002062092 | 104 |
| 678 | 3300031548 | Ga0307408_100225187 | Ga0307408_1002251873 | 104 |
| 679 | 3300031548 | Ga0307408_100287569 | Ga0307408_1002875692 | 104 |
| 680 | 3300031548 | Ga0307408_100342407 | Ga0307408_1003424073 | 104 |
| 681 | 3300031548 | Ga0307408_100553889 | Ga0307408_1005538891 | 104 |
| 682 | 3300031548 | Ga0307408_100790692 | Ga0307408_1007906921 | 104 |
| 683 | 3300031548 | Ga0307408_102519534 | Ga0307408_1025195341 | 104 |
| 684 | 3300031731 | Ga0307405_10019698 | Ga0307405_100196985 | 104 |
| 685 | 3300031731 | Ga0307405_10194476 | Ga0307405_101944762 | 104 |
| 686 | 3300031731 | Ga0307405_10207937 | Ga0307405_102079372 | 104 |
| 687 | 3300031731 | Ga0307405_10266437 | Ga0307405_102664372 | 104 |
| 688 | 3300031731 | Ga0307405_10272146 | Ga0307405_102721462 | 104 |
| 689 | 3300031731 | Ga0307405_10295455 | Ga0307405_102954552 | 104 |
| 690 | 3300031731 | Ga0307405_10407978 | Ga0307405_104079782 | 104 |
| 691 | 3300031731 | Ga0307405_11027308 | Ga0307405_110273082 | 104 |
| 692 | 3300031824 | Ga0307413_10029315 | Ga0307413_100293154 | 104 |
| 693 | 3300031824 | Ga0307413_10140586 | Ga0307413_101405862 | 104 |
| 694 | 3300031824 | Ga0307413_10154999 | Ga0307413_101549993 | 104 |
| 695 | 3300031824 | Ga0307413_10295163 | Ga0307413_102951632 | 104 |
| 696 | 3300031824 | Ga0307413_10297407 | Ga0307413_102974072 | 104 |
| 697 | 3300031824 | Ga0307413_10386170 | Ga0307413_103861702 | 104 |
| 698 | 3300031824 | Ga0307413_10532399 | Ga0307413_105323992 | 104 |
| 699 | 3300031824 | Ga0307413_10655336 | Ga0307413_106553362 | 104 |
| 700 | 3300031824 | Ga0307413_10910711 | Ga0307413_109107112 | 104 |
| 701 | 3300031824 | Ga0307413_11294230 | Ga0307413_112942302 | 104 |
| 702 | 3300031824 | Ga0307413_12093706 | Ga0307413_120937061 | 104 |
| 703 | 3300031852 | Ga0307410_10030817 | Ga0307410_100308171 | 104 |
| 704 | 3300031852 | Ga0307410_10043934 | Ga0307410_100439343 | 104 |
| 705 | 3300031852 | Ga0307410_10059688 | Ga0307410_100596884 | 104 |
| 706 | 3300031852 | Ga0307410_10096687 | Ga0307410_100966872 | 104 |
| 707 | 3300031852 | Ga0307410_10112543 | Ga0307410_101125432 | 104 |
| 708 | 3300031852 | Ga0307410_10134883 | Ga0307410_101348832 | 104 |
| 709 | 3300031852 | Ga0307410_10401523 | Ga0307410_104015232 | 104 |
| 710 | 3300031852 | Ga0307410_10443534 | Ga0307410_104435342 | 104 |
| 711 | 3300031852 | Ga0307410_10448809 | Ga0307410_104488092 | 104 |
| 712 | 3300031901 | Ga0307406_10020638 | Ga0307406_100206386 | 104 |
| 713 | 3300031901 | Ga0307406_10186863 | Ga0307406_101868632 | 104 |
| 714 | 3300031901 | Ga0307406_10251545 | Ga0307406_102515452 | 104 |
| 715 | 3300031901 | Ga0307406_10344780 | Ga0307406_103447801 | 104 |
| 716 | 3300031901 | Ga0307406_10352551 | Ga0307406_103525512 | 104 |
| 717 | 3300031901 | Ga0307406_10557983 | Ga0307406_105579832 | 104 |
| 718 | 3300031901 | Ga0307406_10864871 | Ga0307406_108648712 | 104 |
| 719 | 3300031901 | Ga0307406_10874259 | Ga0307406_108742592 | 104 |
| 720 | 3300031901 | Ga0307406_11863970 | Ga0307406_118639702 | 104 |
| 721 | 3300031901 | Ga0307406_12037098 | Ga0307406_120370982 | 104 |
| 722 | 3300031903 | Ga0307407_10002227 | Ga0307407_100022276 | 104 |
| 723 | 3300031903 | Ga0307407_10063358 | Ga0307407_100633581 | 104 |
| 724 | 3300031903 | Ga0307407_10086266 | Ga0307407_100862662 | 104 |
| 725 | 3300031903 | Ga0307407_10263189 | Ga0307407_102631892 | 104 |
| 726 | 3300031903 | Ga0307407_10285829 | Ga0307407_102858292 | 104 |
| 727 | 3300031903 | Ga0307407_10328575 | Ga0307407_103285752 | 104 |
| 728 | 3300031903 | Ga0307407_10818762 | Ga0307407_108187621 | 104 |
| 729 | 3300031911 | Ga0307412_10005349 | Ga0307412_100053495 | 104 |
| 730 | 3300031911 | Ga0307412_10063129 | Ga0307412_100631295 | 104 |
| 731 | 3300031911 | Ga0307412_10096207 | Ga0307412_100962072 | 104 |
| 732 | 3300031911 | Ga0307412_10148277 | Ga0307412_101482772 | 104 |
| 733 | 3300031911 | Ga0307412_10151533 | Ga0307412_101515332 | 104 |
| 734 | 3300031911 | Ga0307412_10192076 | Ga0307412_101920762 | 104 |
| 735 | 3300031911 | Ga0307412_10668682 | Ga0307412_106686822 | 104 |
| 736 | 3300031911 | Ga0307412_10734973 | Ga0307412_107349732 | 104 |
| 737 | 3300031911 | Ga0307412_10906005 | Ga0307412_109060052 | 104 |
| 738 | 3300031995 | Ga0307409_100028799 | Ga0307409_1000287995 | 104 |
| 739 | 3300031995 | Ga0307409_100048409 | Ga0307409_1000484095 | 104 |
| 740 | 3300031995 | Ga0307409_100050697 | Ga0307409_1000506974 | 104 |
| 741 | 3300031995 | Ga0307409_100052112 | Ga0307409_1000521126 | 104 |
| 742 | 3300031995 | Ga0307409_100233479 | Ga0307409_1002334793 | 104 |
| 743 | 3300031995 | Ga0307409_100734720 | Ga0307409_1007347202 | 104 |
| 744 | 3300031995 | Ga0307409_100738005 | Ga0307409_1007380052 | 104 |
| 745 | 3300031995 | Ga0307409_100805247 | Ga0307409_1008052472 | 104 |
| 746 | 3300031995 | Ga0307409_100847781 | Ga0307409_1008477812 | 104 |
| 747 | 3300031995 | Ga0307409_101847849 | Ga0307409_1018478492 | 104 |
| 748 | 3300032002 | Ga0307416_100007111 | Ga0307416_1000071115 | 104 |
| 749 | 3300032002 | Ga0307416_100016950 | Ga0307416_1000169502 | 104 |
| 750 | 3300032002 | Ga0307416_100108559 | Ga0307416_1001085592 | 104 |
| 751 | 3300032002 | Ga0307416_100171661 | Ga0307416_1001716613 | 104 |
| 752 | 3300032002 | Ga0307416_100205947 | Ga0307416_1002059472 | 104 |
| 753 | 3300032002 | Ga0307416_100544887 | Ga0307416_1005448872 | 104 |
| 754 | 3300032002 | Ga0307416_100761587 | Ga0307416_1007615872 | 104 |
| 755 | 3300032002 | Ga0307416_100930422 | Ga0307416_1009304222 | 104 |
| 756 | 3300032002 | Ga0307416_101967543 | Ga0307416_1019675432 | 104 |
| 757 | 3300032002 | Ga0307416_102285026 | Ga0307416_1022850262 | 104 |
| 758 | 3300032002 | Ga0307416_103150535 | Ga0307416_1031505352 | 104 |
| 759 | 3300032004 | Ga0307414_10013980 | Ga0307414_100139805 | 104 |
| 760 | 3300032004 | Ga0307414_10024828 | Ga0307414_100248284 | 104 |
| 761 | 3300032004 | Ga0307414_10040497 | Ga0307414_100404973 | 104 |
| 762 | 3300032004 | Ga0307414_10096707 | Ga0307414_100967074 | 104 |
| 763 | 3300032004 | Ga0307414_10189348 | Ga0307414_101893483 | 104 |
| 764 | 3300032004 | Ga0307414_10635994 | Ga0307414_106359942 | 104 |
| 765 | 3300032004 | Ga0307414_10693567 | Ga0307414_106935672 | 104 |
| 766 | 3300032004 | Ga0307414_10821854 | Ga0307414_108218542 | 104 |
| 767 | 3300032004 | Ga0307414_11054577 | Ga0307414_110545771 | 104 |
| 768 | 3300032004 | Ga0307414_11285888 | Ga0307414_112858882 | 104 |
| 769 | 3300032004 | Ga0307414_11355946 | Ga0307414_113559462 | 104 |
| 770 | 3300032004 | Ga0307414_11780676 | Ga0307414_117806761 | 104 |
| 771 | 3300032004 | Ga0307414_11956290 | Ga0307414_119562901 | 104 |
| 772 | 3300032005 | Ga0307411_10004327 | Ga0307411_100043278 | 104 |
| 773 | 3300032005 | Ga0307411_10046354 | Ga0307411_100463542 | 104 |
| 774 | 3300032005 | Ga0307411_10207985 | Ga0307411_102079852 | 104 |
| 775 | 3300032005 | Ga0307411_10211902 | Ga0307411_102119022 | 104 |
| 776 | 3300032005 | Ga0307411_10308714 | Ga0307411_103087142 | 104 |
| 777 | 3300032005 | Ga0307411_10316985 | Ga0307411_103169853 | 104 |
| 778 | 3300032005 | Ga0307411_10672801 | Ga0307411_106728012 | 104 |
| 779 | 3300032005 | Ga0307411_10789134 | Ga0307411_107891341 | 104 |
| 780 | 3300032005 | Ga0307411_11099298 | Ga0307411_110992982 | 104 |
| 781 | 3300032005 | Ga0307411_11474747 | Ga0307411_114747471 | 104 |
| 782 | 3300032005 | Ga0307411_11981529 | Ga0307411_119815292 | 104 |
| 783 | 3300032005 | Ga0307411_12002180 | Ga0307411_120021801 | 104 |
| 784 | 3300032005 | Ga0307411_12026548 | Ga0307411_120265482 | 104 |
| 785 | 3300032005 | Ga0307411_12135839 | Ga0307411_121358391 | 104 |
| 786 | 3300032126 | Ga0307415_100006247 | Ga0307415_1000062475 | 104 |
| 787 | 3300032126 | Ga0307415_100083964 | Ga0307415_1000839643 | 104 |
| 788 | 3300032126 | Ga0307415_100084799 | Ga0307415_1000847992 | 104 |
| 789 | 3300032126 | Ga0307415_100276281 | Ga0307415_1002762813 | 104 |
| 790 | 3300032126 | Ga0307415_100335060 | Ga0307415_1003350602 | 104 |
| 791 | 3300032126 | Ga0307415_100357100 | Ga0307415_1003571002 | 104 |
| 792 | 3300032126 | Ga0307415_100577513 | Ga0307415_1005775132 | 104 |
| 793 | 3300032126 | Ga0307415_100647899 | Ga0307415_1006478992 | 104 |
| 794 | 3300032126 | Ga0307415_100857668 | Ga0307415_1008576682 | 104 |
| 795 | 3300032126 | Ga0307415_102141503 | Ga0307415_1021415032 | 104 |
| 796 | 3300035115 | Ga0373941_0300741 | Ga0373941_0300741_87_407 | 104 |
| 797 | 3300037312 | Ga0395899_0000406 | Ga0395899_0000406_43811_44128 | 104 |
| 798 | 3300037312 | Ga0395899_0191462 | Ga0395899_0191462_625_945 | 104 |
| 799 | 3300037418 | Ga0395900_0021924 | Ga0395900_0021924_5161_5481 | 104 |
| 800 | 3300037418 | Ga0395900_0043394 | Ga0395900_0043394_76_393 | 104 |
| 801 | 3300037418 | Ga0395900_0120641 | Ga0395900_0120641_737_1057 | 104 |
| 802 | 3300037418 | Ga0395900_0595623 | Ga0395900_0595623_133_459 | 104 |
| 803 | 3300037418 | Ga0395900_0600356 | Ga0395900_0600356_230_547 | 104 |
| 804 | 3300037466 | Ga0395898_0250288 | Ga0395898_0250288_522_848 | 104 |
| 805 | 3300037466 | Ga0395898_0273138 | Ga0395898_0273138_261_578 | 104 |
| 806 | 3300037466 | Ga0395898_0358176 | Ga0395898_0358176_659_979 | 104 |
| 807 | 3300037466 | Ga0395898_0521882 | Ga0395898_0521882_172_489 | 104 |
| 808 | 3300037471 | Ga0395905_0001805 | Ga0395905_0001805_23378_23695 | 104 |
| 809 | 3300037471 | Ga0395905_0007986 | Ga0395905_0007986_5466_5786 | 104 |
| 810 | 3300037471 | Ga0395905_0022623 | Ga0395905_0022623_4714_5040 | 104 |
| 811 | 3300037853 | Ga0436364_1491317 | Ga0436364_1491317_94_417 | 104 |
| 812 | 3300038443 | Ga0395901_0012081 | Ga0395901_0012081_871_1191 | 104 |
| 813 | 3300038443 | Ga0395901_0062202 | Ga0395901_0062202_3207_3524 | 104 |
| 814 | 3300038443 | Ga0395901_0278245 | Ga0395901_0278245_1141_1461 | 104 |
| 815 | 3300038443 | Ga0395901_0431323 | Ga0395901_0431323_404_730 | 104 |
| 816 | 3300041453 | Ga0451797_1289161 | Ga0451797_1289161_608_934 | 104 |
| 817 | 3300041460 | Ga0451802_0774086 | Ga0451802_0774086_219_539 | 104 |
| 818 | 3300041462 | Ga0451806_236297 | Ga0451806_236297_1106_1426 | 104 |
| 819 | 3300041463 | Ga0451804_0241769 | Ga0451804_0241769_252_572 | 104 |
| 820 | 3300041486 | Ga0451807_0895683 | Ga0451807_0895683_825_1145 | 104 |
| 821 | 3300041494 | Ga0451837_1607676 | Ga0451837_1607676_170_490 | 104 |
| 822 | 3300041501 | Ga0451845_0925973 | Ga0451845_0925973_32_352 | 104 |
| 823 | 3300042012 | Ga0439455_0005591 | Ga0439455_0005591_1829_2146 | 104 |
| 824 | 3300044765 | Ga0466970_0066546 | Ga0466970_0066546_817_1137 | 104 |
| 825 | 3300044842 | Ga0466957_0951414 | Ga0466957_0951414_114_434 | 104 |
| 826 | 3300045976 | Ga0466967_1276514 | Ga0466967_1276514_252_569 | 104 |
| 827 | 3300046492 | Ga0495585_0207909 | Ga0495585_0207909_174_500 | 104 |
| 828 | 3300046518 | Ga0495631_0119026 | Ga0495631_0119026_143_469 | 104 |
| 829 | 3300046522 | Ga0495643_0514717 | Ga0495643_0514717_167_487 | 104 |
| 830 | 3300046525 | Ga0495663_0007544 | Ga0495663_0007544_110_436 | 104 |
| 831 | 3300046525 | Ga0495663_0175157 | Ga0495663_0175157_78_398 | 104 |
| 832 | 3300046528 | Ga0495642_0313201 | Ga0495642_0313201_206_526 | 104 |
| 833 | 3300046537 | Ga0495598_0001038 | Ga0495598_0001038_1156_1482 | 104 |
| 834 | 3300046539 | Ga0495621_0036568 | Ga0495621_0036568_103_429 | 104 |
| 835 | 3300046558 | Ga0495633_0001763 | Ga0495633_0001763_4942_5268 | 104 |
| 836 | 3300046615 | Ga0495656_0098455 | Ga0495656_0098455_270_596 | 104 |
| 837 | 3300046660 | Ga0495625_0267913 | Ga0495625_0267913_537_863 | 104 |
| 838 | 3300046684 | Ga0495669_0010966 | Ga0495669_0010966_3348_3671 | 104 |
| 839 | 3300046684 | Ga0495669_0034570 | Ga0495669_0034570_1350_1676 | 104 |
| 840 | 3300046691 | Ga0495670_0049768 | Ga0495670_0049768_66_389 | 104 |
| 841 | 3300046691 | Ga0495670_0091225 | Ga0495670_0091225_62_388 | 104 |
| 842 | 3300047443 | Ga0495687_207677 | Ga0495687_207677_199_516 | 104 |
| 843 | 3300047445 | Ga0495677_0117747 | Ga0495677_0117747_448_771 | 104 |
| 844 | 3300047472 | Ga0495686_0007665 | Ga0495686_0007665_5876_6196 | 104 |
| 845 | 3300047472 | Ga0495686_0386994 | Ga0495686_0386994_363_680 | 104 |
| 846 | 3300048903 | Ga0496100_0764831 | Ga0496100_0764831_155_469 | 104 |
| 847 | 3300048905 | Ga0496102_0022640 | Ga0496102_0022640_2910_3224 | 104 |
| 848 | 3300048906 | Ga0496103_0001458 | Ga0496103_0001458_4123_4437 | 104 |
| 849 | 3300048907 | Ga0496104_0695513 | Ga0496104_0695513_566_880 | 104 |
| 850 | 3300048908 | Ga0496105_0118457 | Ga0496105_0118457_909_1223 | 104 |
| 851 | 3300048908 | Ga0496105_0550267 | Ga0496105_0550267_192_506 | 104 |
| 852 | 3300048911 | Ga0496108_0359849 | Ga0496108_0359849_628_951 | 104 |
| 853 | 3300048912 | Ga0496109_0907800 | Ga0496109_0907800_10_324 | 104 |
| 854 | 3300048912 | Ga0496109_1075906 | Ga0496109_1075906_40_363 | 104 |
| 855 | 3300048912 | Ga0496109_1296408 | Ga0496109_1296408_147_470 | 104 |
| 856 | 3300048912 | Ga0496109_1526623 | Ga0496109_1526623_68_394 | 104 |
| 857 | 3300048913 | Ga0496110_0453040 | Ga0496110_0453040_367_690 | 104 |
| 858 | 3300048913 | Ga0496110_0987985 | Ga0496110_0987985_327_650 | 104 |
| 859 | 3300048914 | Ga0496111_0599572 | Ga0496111_0599572_312_629 | 104 |
| 860 | 3300048914 | Ga0496111_0672456 | Ga0496111_0672456_288_602 | 104 |
| 861 | 3300048917 | Ga0496114_0966010 | Ga0496114_0966010_159_482 | 104 |
| 862 | 3300048920 | Ga0496117_0005438 | Ga0496117_0005438_11180_11494 | 104 |
| 863 | 3300048921 | Ga0496118_0004152 | Ga0496118_0004152_2056_2370 | 104 |
| 864 | 3300048922 | Ga0496119_0096043 | Ga0496119_0096043_180_494 | 104 |
| 865 | 3300048923 | Ga0496120_0260064 | Ga0496120_0260064_416_730 | 104 |
| 866 | 3300048925 | Ga0496122_0001531 | Ga0496122_0001531_32401_32718 | 104 |
| 867 | 3300048926 | Ga0496123_0021568 | Ga0496123_0021568_4072_4389 | 104 |
| 868 | 3300048927 | Ga0496124_0109237 | Ga0496124_0109237_1302_1619 | 104 |
| 869 | 3300048927 | Ga0496124_0231018 | Ga0496124_0231018_843_1163 | 104 |
| 870 | 3300049127 | Ga0501306_006319 | Ga0501306_006319_589_906 | 104 |
| 871 | 3300049127 | Ga0501306_041409 | Ga0501306_041409_123_443 | 104 |
| 872 | 3300049127 | Ga0501306_060438 | Ga0501306_060438_155_475 | 104 |
| 873 | 3300049128 | Ga0501308_006500 | Ga0501308_006500_571_894 | 104 |
| 874 | 3300049128 | Ga0501308_036283 | Ga0501308_036283_276_596 | 104 |
| 875 | 3300049129 | Ga0501309_008114 | Ga0501309_008114_386_703 | 104 |
| 876 | 3300049129 | Ga0501309_014992 | Ga0501309_014992_458_775 | 104 |
| 877 | 3300049130 | Ga0501310_001218 | Ga0501310_001218_436_759 | 104 |
| 878 | 3300049130 | Ga0501310_003306 | Ga0501310_003306_1215_1532 | 104 |
| 879 | 3300049160 | Ga0501304_016532 | Ga0501304_016532_109_432 | 104 |
| 880 | 3300049160 | Ga0501304_034151 | Ga0501304_034151_85_402 | 104 |
| 881 | 3300049161 | Ga0501305_013093 | Ga0501305_013093_615_938 | 104 |
| 882 | 3300049161 | Ga0501305_028003 | Ga0501305_028003_409_726 | 104 |
| 883 | 3300049161 | Ga0501305_111502 | Ga0501305_111502_55_375 | 104 |
| 884 | 3300049161 | Ga0501305_111658 | Ga0501305_111658_59_376 | 104 |
| 885 | 3300049162 | Ga0501307_009615 | Ga0501307_009615_561_878 | 104 |
| 886 | 3300049162 | Ga0501307_015926 | Ga0501307_015926_323_643 | 104 |
| 887 | 3300049162 | Ga0501307_096024 | Ga0501307_096024_37_354 | 104 |
| 888 | 3300049515 | Ga0501292_028292 | Ga0501292_028292_427_744 | 104 |
| 889 | 3300049528 | Ga0501312_029704 | Ga0501312_029704_159_476 | 104 |
| 890 | 3300049528 | Ga0501312_066811 | Ga0501312_066811_24_341 | 104 |
| 891 | 3300049529 | Ga0501313_029182 | Ga0501313_029182_289_606 | 104 |
| 892 | 3300049531 | Ga0501315_049783 | Ga0501315_049783_74_394 | 104 |
| 893 | 3300049532 | Ga0501316_020777 | Ga0501316_020777_377_700 | 104 |
| 894 | 3300049532 | Ga0501316_021899 | Ga0501316_021899_464_784 | 104 |
| 895 | 3300049533 | Ga0501317_014767 | Ga0501317_014767_422_739 | 104 |
| 896 | 3300049533 | Ga0501317_025845 | Ga0501317_025845_32_349 | 104 |
| 897 | 3300049536 | Ga0501320_006472 | Ga0501320_006472_281_598 | 104 |
| 898 | 3300049536 | Ga0501320_048744 | Ga0501320_048744_178_495 | 104 |
| 899 | 3300049537 | Ga0501321_078425 | Ga0501321_078425_53_373 | 104 |
| 900 | 3300049538 | Ga0501322_004865 | Ga0501322_004865_458_775 | 104 |
| 901 | 3300049539 | Ga0501323_025314 | Ga0501323_025314_140_457 | 104 |
| 902 | 3300049541 | Ga0501325_025102 | Ga0501325_025102_298_618 | 104 |
| 903 | 3300049549 | Ga0501333_009111 | Ga0501333_009111_30_347 | 104 |
| 904 | 3300049550 | Ga0501334_23126 | Ga0501334_23126_101_418 | 104 |
| 905 | 3300049551 | Ga0501335_044513 | Ga0501335_044513_78_395 | 104 |
| 906 | 3300049556 | Ga0501340_011323 | Ga0501340_011323_251_571 | 104 |
| 907 | 3300049569 | Ga0501032_0710334 | Ga0501032_0710334_94_414 | 104 |
| 908 | 3300049571 | Ga0501034_0190380 | Ga0501034_0190380_797_1117 | 104 |
| 909 | 3300049572 | Ga0501036_1168557 | Ga0501036_1168557_225_545 | 104 |
| 910 | 3300049574 | Ga0501038_1245342 | Ga0501038_1245342_170_490 | 104 |
| 911 | 3300049652 | Ga0501202_126721 | Ga0501202_126721_190_507 | 104 |
| 912 | 3300049659 | Ga0501214_034943 | Ga0501214_034943_357_674 | 104 |
| 913 | 3300049661 | Ga0501217_044278 | Ga0501217_044278_391_708 | 104 |
| 914 | 3300049669 | Ga0501235_046846 | Ga0501235_046846_315_632 | 104 |
| 915 | 3300049679 | Ga0501249_178118 | Ga0501249_178118_40_357 | 104 |
| 916 | 3300049683 | Ga0501253_026120 | Ga0501253_026120_351_668 | 104 |
| 917 | 3300049688 | Ga0501259_203007 | Ga0501259_203007_110_427 | 104 |
| 918 | 3300049704 | Ga0501221_086156 | Ga0501221_086156_107_424 | 104 |
| 919 | 3300049705 | Ga0501225_0090544 | Ga0501225_0090544_210_527 | 104 |
| 920 | 3300049708 | Ga0501245_037372 | Ga0501245_037372_247_564 | 104 |
| 921 | 3300049763 | Ga0501266_010321 | Ga0501266_010321_381_698 | 104 |
| 922 | 3300049765 | Ga0501268_004965 | Ga0501268_004965_190_507 | 104 |
| 923 | 3300049767 | Ga0501270_154734 | Ga0501270_154734_86_403 | 104 |
| 924 | 3300049768 | Ga0501271_013331 | Ga0501271_013331_429_746 | 104 |
| 925 | 3300049768 | Ga0501271_058606 | Ga0501271_058606_165_482 | 104 |
| 926 | 3300049769 | Ga0501272_048841 | Ga0501272_048841_22_339 | 104 |
| 927 | 3300049775 | Ga0501279_104482 | Ga0501279_104482_126_443 | 104 |
| 928 | 3300049822 | Ga0501035_0767010 | Ga0501035_0767010_301_630 | 104 |
| 929 | 3300053091 | Ga0500647_0181633 | Ga0500647_0181633_240_554 | 104 |
| 930 | 3300053134 | Ga0500658_0113824 | Ga0500658_0113824_835_1161 | 104 |
| 931 | 3300053142 | Ga0500577_0253966 | Ga0500577_0253966_428_748 | 104 |
| 932 | 3300053177 | Ga0500636_0039359 | Ga0500636_0039359_925_1239 | 104 |
| 933 | 3300059503 | Ga0587080_031497 | Ga0587080_031497_320_721 | 104 |
| 934 | 3300059508 | Ga0587088_211511 | Ga0587088_211511_159_479 | 104 |
| 935 | 3300059512 | Ga0587092_012652 | Ga0587092_012652_278_595 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9182 | 13 | 100 |
| 7m4z-assembly1.cif.gz_S | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9167 | 12 | 97 |
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9161 | 12 | 93 |
| 7nhn-assembly1.cif.gz_W | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.904 | 13 | 99 |
| 6spb-assembly1.cif.gz_T | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9025 | 11 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8924 | 13 | 99 | 3.30.70.330 |
| 4garT00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.865 | 10 | 98 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8624 | 15 | 99 | 3.30.70.330 |
| 6fu8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8609 | 12 | 98 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8552 | 13 | 99 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A5L882-F1-model_v4 | deleted | 0.9454 | 9 | 104 |
|
| AF-A0A522CJT9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9441 | 11 | 104 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E4WGS7-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9426 | 11 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7C9KLD3-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9424 | 9 | 104 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-G6YI82-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9416 | 10 | 104 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar