F486171

General Info

Members Datasets Scaffolds Average Seq Length
935 473 895 166

Family's Representative Sequence

Representative Sequence 3300046681|Ga0495647_0269454|Ga0495647_0269454_119_727
Length 202
Sequence MPSMNPESRDSGYALARALSDKRDALARGMTSIESMPDTKPYRPNVGIALFNAAGRVLIGRRFRDDGPEIILPGLEWQMPQGGIDAEENPREAVMRELWEETGVASAVYLGETDWLTYEFPPYAGPSSHRLAKFRGQRQKWFALRFTGADAEIDPLTPRNGQPAEFDQWRWERLDRVADLVVPFRREVYRTVALRFAEFAKR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
7 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
8 2643221734 Bosea sp. Root670 Isolate Unclassified
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
11 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
12 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
13 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
14 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
15 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
16 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
17 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
18 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
19 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
20 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
21 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
22 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
23 2906610324
24 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
25 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
26 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
27 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
28 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
29 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
30 2922425934
31 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
32 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
33 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
34 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
35 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
117 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
118 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
151 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
152 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
153 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
154 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
155 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
156 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
157 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
217 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
218 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
219 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
246 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
247 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
248 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
249 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
282 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
283 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
297 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
304 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
305 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
306 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
307 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
308 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
309 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
310 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
311 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
312 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
313 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
314 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
315 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
316 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
321 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
322 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
323 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
324 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
325 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
326 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
327 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
328 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
329 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
332 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
333 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
334 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
335 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
340 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
341 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
344 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
345 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
346 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
355 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
356 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
357 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
358 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
359 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
369 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
370 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
371 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
374 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
375 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
376 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
377 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
378 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
379 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
380 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
381 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
382 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
383 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
389 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
397 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
398 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
399 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
400 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
401 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
402 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
403 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
404 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
405 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
406 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
407 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
418 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
419 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
420 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
421 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
423 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
424 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
425 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
426 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
427 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
430 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
431 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
432 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
433 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
434 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
435 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
436 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
437 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
438 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
439 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
440 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
441 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
442 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
443 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
444 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
445 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
446 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
447 3300053112 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere Metagenome Endosphere
448 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
449 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
450 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
451 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
452 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
453 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
454 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
455 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
456 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
457 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
458 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
459 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
460 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
461 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
462 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
463 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
464 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
465 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
466 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
467 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
468 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
469 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
470 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
471 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
472 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
473 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0
Isolates 4.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.24
Nodule 3.53
Rhizoplane 7.38
Rhizosphere 72.83
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000635 3300001979 Bacteria 15165
2 JGI24739J22299_10002357 3300001989 Bacteria 7276
3 JGI24737J22298_10003086 3300001990 Bacteria 5902
4 JGI25406J46586_10000364 3300003203 Bacteria 20635
5 JGI25406J46586_10005263 3300003203 Bacteria 6004
6 JGI25404J52841_10055956 3300003659 Bacteria 828
7 Ga0055524_1047432 3300003775 Bacteria 1011
8 Ga0065165_1000014 3300005262 Bacteria 292366
9 Ga0070658_10009941 3300005327 Bacteria 7643
10 Ga0070658_10463689 3300005327 Bacteria 1092
11 Ga0070658_10579390 3300005327 Bacteria 972
12 Ga0070676_10060232 3300005328 Bacteria 2254
13 Ga0070683_100066945 3300005329 Bacteria 3345
14 Ga0070683_100100543 3300005329 Bacteria 2722
15 Ga0070670_100101013 3300005331 Bacteria 2484
16 Ga0070677_10574785 3300005333 Bacteria 621
17 Ga0068869_100013066 3300005334 Bacteria 5510
18 Ga0070680_100028929 3300005336 Bacteria 4448
19 Ga0070680_100213916 3300005336 Bacteria 1626
20 Ga0070682_100108314 3300005337 Bacteria 1847
21 Ga0068868_100040431 3300005338 Bacteria 3629
22 Ga0068868_100071424 3300005338 Bacteria 2768
23 Ga0070660_100402071 3300005339 Bacteria 1133
24 Ga0070691_10244466 3300005341 Bacteria 960
25 Ga0070661_100011760 3300005344 Bacteria 6107
26 Ga0070661_100177218 3300005344 Bacteria 1621
27 Ga0070668_100046179 3300005347 Bacteria 3343
28 Ga0070668_101214077 3300005347 Bacteria 683
29 Ga0070669_100113184 3300005353 Bacteria 2061
30 Ga0070675_100382549 3300005354 Bacteria 1253
31 Ga0070674_100498464 3300005356 Bacteria 1014
32 Ga0070674_101176733 3300005356 Bacteria 680
33 Ga0070673_100601818 3300005364 Bacteria 1003
34 Ga0070659_100036969 3300005366 Bacteria 3806
35 Ga0070659_100046072 3300005366 Bacteria 3418
36 Ga0070667_101306125 3300005367 Bacteria 680
37 Ga0070709_10011427 3300005434 Bacteria 4949
38 Ga0070709_10040833 3300005434 Bacteria 2855
39 Ga0070709_10097615 3300005434 Bacteria 1951
40 Ga0070709_10285542 3300005434 Bacteria 1201
41 Ga0070714_100029045 3300005435 Bacteria 4594
42 Ga0070714_100217983 3300005435 Bacteria 1752
43 Ga0070713_100056704 3300005436 Bacteria 3259
44 Ga0070713_100140678 3300005436 Bacteria 2137
45 Ga0070710_10051309 3300005437 Bacteria 2315
46 Ga0070710_10440555 3300005437 Bacteria 881
47 Ga0070711_100007751 3300005439 Bacteria 6541
48 Ga0070711_100019491 3300005439 Bacteria 4352
49 Ga0070711_100575956 3300005439 Bacteria 937
50 Ga0070700_100169054 3300005441 Bacteria 1512
51 Ga0070663_100090637 3300005455 Bacteria 2265
52 Ga0070663_100095227 3300005455 Bacteria 2212
53 Ga0070663_100132285 3300005455 Bacteria 1896
54 Ga0070663_100254678 3300005455 Bacteria 1390
55 Ga0070663_100298120 3300005455 Bacteria 1289
56 Ga0070663_100433266 3300005455 Bacteria 1081
57 Ga0070678_100011899 3300005456 Bacteria 5385
58 Ga0070678_100072529 3300005456 Bacteria 2581
59 Ga0070662_100015653 3300005457 Bacteria 5084
60 Ga0070681_10062073 3300005458 Bacteria 3711
61 Ga0070681_10417355 3300005458 Bacteria 1254
62 Ga0070681_10656376 3300005458 Bacteria 964
63 Ga0070685_10345417 3300005466 Bacteria 1016
64 Ga0070699_101176282 3300005518 Bacteria 703
65 Ga0070679_100520827 3300005530 Bacteria 1133
66 Ga0070679_100577136 3300005530 Bacteria 1068
67 Ga0070684_100000950 3300005535 Bacteria 20658
68 Ga0070684_100038404 3300005535 Bacteria 4112
69 Ga0070684_100289754 3300005535 Bacteria 1501
70 Ga0070697_100030494 3300005536 Bacteria 4332
71 Ga0070697_100773699 3300005536 Bacteria 849
72 Ga0068853_100007151 3300005539 Bacteria 8929
73 Ga0068853_100039602 3300005539 Bacteria 4020
74 Ga0068853_100046015 3300005539 Bacteria 3740
75 Ga0068853_100110950 3300005539 Bacteria 2436
76 Ga0068853_100137951 3300005539 Bacteria 2188
77 Ga0068853_100779797 3300005539 Bacteria 914
78 Ga0068853_101241844 3300005539 Bacteria 720
79 Ga0070672_100130481 3300005543 Bacteria 2065
80 Ga0070686_100091644 3300005544 Bacteria 2034
81 Ga0070693_100067784 3300005547 Bacteria 2093
82 Ga0070693_100125039 3300005547 Bacteria 1600
83 Ga0070665_100050356 3300005548 Bacteria 4179
84 Ga0070665_100067075 3300005548 Bacteria 3599
85 Ga0070665_101624430 3300005548 Bacteria 654
86 Ga0068855_100067225 3300005563 Bacteria 4177
87 Ga0068855_100106438 3300005563 Bacteria 3223
88 Ga0068855_100106967 3300005563 Bacteria 3214
89 Ga0068855_100664039 3300005563 Bacteria 1118
90 Ga0068855_100692404 3300005563 Bacteria 1091
91 Ga0068855_101468970 3300005563 Bacteria 701
92 Ga0070664_100028305 3300005564 Bacteria 4661
93 Ga0070664_100098691 3300005564 Bacteria 2537
94 Ga0068857_100028342 3300005577 Bacteria 4942
95 Ga0068857_100058005 3300005577 Bacteria 3437
96 Ga0068857_100128105 3300005577 Bacteria 2288
97 Ga0068854_100020662 3300005578 Bacteria 4460
98 Ga0068854_100042861 3300005578 Bacteria 3205
99 Ga0068854_100093481 3300005578 Bacteria 2241
100 Ga0068854_100682541 3300005578 Bacteria 885
101 Ga0068854_101114932 3300005578 Bacteria 704
102 Ga0068856_100003724 3300005614 Bacteria 15294
103 Ga0068856_100031694 3300005614 Bacteria 5173
104 Ga0068856_100053445 3300005614 Bacteria 3982
105 Ga0068856_100111325 3300005614 Bacteria 2735
106 Ga0070702_100058977 3300005615 Bacteria 2225
107 Ga0070702_100464687 3300005615 Bacteria 921
108 Ga0068852_100066422 3300005616 Bacteria 3149
109 Ga0068852_100081048 3300005616 Bacteria 2880
110 Ga0068852_100287592 3300005616 Bacteria 1587
111 Ga0068852_100530004 3300005616 Bacteria 1176
112 Ga0068859_100182698 3300005617 Bacteria 2180
113 Ga0068859_100249204 3300005617 Bacteria 1866
114 Ga0068864_100024535 3300005618 Bacteria 5073
115 Ga0068864_100618363 3300005618 Bacteria 1052
116 Ga0068864_100658846 3300005618 Bacteria 1020
117 Ga0068861_100385428 3300005719 Bacteria 1239
118 Ga0068861_100456186 3300005719 Bacteria 1146
119 Ga0068851_10001194 3300005834 Bacteria 11281
120 Ga0068863_100108690 3300005841 Bacteria 2639
121 Ga0068863_102005528 3300005841 Bacteria 589
122 Ga0068858_100095727 3300005842 Bacteria 2766
123 Ga0068860_100004778 3300005843 Bacteria 13804
124 Ga0068860_100058722 3300005843 Bacteria 3657
125 Ga0068860_100152141 3300005843 Bacteria 2228
126 Ga0068860_100368300 3300005843 Bacteria 1417
127 Ga0068860_101738495 3300005843 Bacteria 646
128 Ga0068862_100151650 3300005844 Bacteria 2063
129 Ga0081455_10010497 3300005937 Bacteria 9390
130 Ga0081455_10145426 3300005937 Bacteria 1835
131 Ga0081540_1000191 3300005983 Bacteria 63533
132 Ga0081540_1003921 3300005983 Bacteria 11587
133 Ga0081540_1017710 3300005983 Bacteria 4399
134 Ga0081540_1070729 3300005983 Bacteria 1615
135 Ga0081540_1085243 3300005983 Bacteria 1408
136 Ga0081540_1103057 3300005983 Bacteria 1224
137 Ga0081539_10000048 3300005985 Bacteria 272906
138 Ga0081539_10013194 3300005985 Bacteria 6253
139 Ga0081539_10211928 3300005985 Bacteria 887
140 Ga0070717_10098767 3300006028 Bacteria 2475
141 Ga0070717_10338637 3300006028 Bacteria 1343
142 Ga0075365_10144138 3300006038 Bacteria 1654
143 Ga0075365_10183266 3300006038 Bacteria 1464
144 Ga0075368_10020138 3300006042 Bacteria 2523
145 Ga0075363_100046611 3300006048 Bacteria 2300
146 Ga0075363_100378395 3300006048 Bacteria 830
147 Ga0075364_10022257 3300006051 Bacteria 4000
148 Ga0075364_10068069 3300006051 Bacteria 2341
149 Ga0075364_10266019 3300006051 Bacteria 1166
150 Ga0075432_10013182 3300006058 Bacteria 2808
151 Ga0070715_10008592 3300006163 Bacteria 3564
152 Ga0070716_100399754 3300006173 Bacteria 988
153 Ga0070712_100041741 3300006175 Bacteria 3151
154 Ga0075367_10034512 3300006178 Bacteria 2923
155 Ga0075369_10004251 3300006186 Bacteria 5276
156 Ga0075369_10072463 3300006186 Bacteria 1518
157 Ga0075366_10309841 3300006195 Bacteria 966
158 Ga0075370_10027487 3300006353 Bacteria 3156
159 Ga0068871_100044698 3300006358 Bacteria 3563
160 Ga0068871_100053846 3300006358 Bacteria 3263
161 Ga0075434_100147299 3300006871 Bacteria 2375
162 Ga0075434_100282056 3300006871 Bacteria 1681
163 Ga0097620_100182694 3300006931 Bacteria 2180
164 Ga0097620_100249207 3300006931 Bacteria 1866
165 Ga0099825_1045942 3300006941 Bacteria 1080
166 Ga0099824_1009785 3300006942 Bacteria 11635
167 Ga0099822_1005813 3300006943 Bacteria 16112
168 Ga0075435_100139336 3300007076 Bacteria 2034
169 Ga0105244_10428597 3300009036 Bacteria 608
170 Ga0105250_10229886 3300009092 Bacteria 788
171 Ga0105240_10036366 3300009093 Bacteria 6336
172 Ga0105240_10039683 3300009093 Bacteria 6027
173 Ga0105240_10096341 3300009093 Bacteria 3606
174 Ga0105240_10131211 3300009093 Bacteria 3005
175 Ga0105240_11849552 3300009093 Bacteria 629
176 Ga0111539_10059723 3300009094 Bacteria 4521
177 Ga0105245_10033417 3300009098 Bacteria 4559
178 Ga0105245_10128432 3300009098 Bacteria 2375
179 Ga0105245_10342331 3300009098 Bacteria 1479
180 Ga0105245_10475447 3300009098 Bacteria 1262
181 Ga0105247_10068652 3300009101 Bacteria 2210
182 Ga0105247_10310357 3300009101 Bacteria 1097
183 Ga0105247_10561726 3300009101 Bacteria 840
184 Ga0105243_10289444 3300009148 Bacteria 1479
185 Ga0105243_10602698 3300009148 Bacteria 1058
186 Ga0105241_10037198 3300009174 Bacteria 3666
187 Ga0105241_11830538 3300009174 Bacteria 593
188 Ga0105242_10125235 3300009176 Bacteria 2211
189 Ga0105242_11594257 3300009176 Bacteria 686
190 Ga0105242_12177174 3300009176 Bacteria 599
191 Ga0105248_10170027 3300009177 Bacteria 2456
192 Ga0105248_11104022 3300009177 Bacteria 897
193 Ga0105237_10019216 3300009545 Bacteria 7060
194 Ga0105237_10044051 3300009545 Bacteria 4494
195 Ga0105237_10109815 3300009545 Bacteria 2750
196 Ga0105238_10012578 3300009551 Bacteria 8543
197 Ga0105238_10015975 3300009551 Bacteria 7595
198 Ga0105238_10020486 3300009551 Bacteria 6733
199 Ga0105238_10104490 3300009551 Bacteria 2813
200 Ga0105249_10053869 3300009553 Bacteria 3677
201 Ga0105249_12604298 3300009553 Bacteria 578
202 Ga0099796_10096529 3300010159 Bacteria 1106
203 Ga0105239_10010073 3300010375 Bacteria 10596
204 Ga0105239_10036146 3300010375 Bacteria 5424
205 Ga0105239_10052959 3300010375 Bacteria 4452
206 Ga0105239_10082887 3300010375 Bacteria 3531
207 Ga0105239_10126168 3300010375 Bacteria 2844
208 Ga0105239_10128415 3300010375 Bacteria 2818
209 Ga0105246_10077783 3300011119 Bacteria 2354
210 Ga0105246_10458278 3300011119 Bacteria 1073
211 Ga0105246_10932987 3300011119 Bacteria 781
212 Ga0157373_10016212 3300013100 Bacteria 5437
213 Ga0157371_10028952 3300013102 Bacteria 4010
214 Ga0157370_10298450 3300013104 Bacteria 1488
215 Ga0157369_10044218 3300013105 Bacteria 4849
216 Ga0157369_10945911 3300013105 Bacteria 883
217 Ga0157374_10844124 3300013296 Bacteria 933
218 Ga0157374_11013257 3300013296 Bacteria 850
219 Ga0157378_10019963 3300013297 Bacteria 5893
220 Ga0157378_10171908 3300013297 Bacteria 2032
221 Ga0163162_10690270 3300013306 Bacteria 1143
222 Ga0157372_10200919 3300013307 Bacteria 2309
223 Ga0157372_11520180 3300013307 Bacteria 771
224 Ga0157375_10313632 3300013308 Bacteria 1733
225 Ga0163163_10517113 3300014325 Bacteria 1256
226 Ga0163163_11719558 3300014325 Bacteria 688
227 Ga0157380_10271255 3300014326 Bacteria 1547
228 Ga0157379_10496075 3300014968 Bacteria 1131
229 Ga0157376_10094852 3300014969 Bacteria 2593
230 Ga0157376_10939329 3300014969 Bacteria 885
231 Ga0157376_11157383 3300014969 Bacteria 801
232 Ga0157376_12306530 3300014969 Bacteria 577
233 Ga0163161_11544872 3300017792 Bacteria 584
234 Ga0214544_1000665 3300021320 Bacteria 65630
235 Ga0214542_1000486 3300021321 Bacteria 71884
236 Ga0214545_1000307 3300021324 Bacteria 71884
237 Ga0214543_1003627 3300021327 Bacteria 29806
238 Ga0213873_10013788 3300021358 Bacteria 1779
239 Ga0213872_10204540 3300021361 Bacteria 845
240 Ga0213874_10001916 3300021377 Bacteria 4376
241 Ga0213874_10143035 3300021377 Bacteria 829
242 Ga0213876_10003463 3300021384 Bacteria 9019
243 Ga0213876_10299065 3300021384 Bacteria 855
244 Ga0209233_1007434 3300025261 Bacteria 3473
245 Ga0209673_1035517 3300025273 Bacteria 1491
246 Ga0209130_1000024 3300025284 Bacteria 354212
247 Ga0209564_1001079 3300025295 Bacteria 32728
248 Ga0209564_1010374 3300025295 Bacteria 4298
249 Ga0209758_1009335 3300025297 Bacteria 6121
250 Ga0209758_1009523 3300025297 Bacteria 6015
251 Ga0209256_1001059 3300025299 Bacteria 31924
252 Ga0207426_1024685 3300025302 Bacteria 2037
253 Ga0207656_10003104 3300025321 Bacteria 5689
254 Ga0207656_10024798 3300025321 Bacteria 2429
255 Ga0207696_1019485 3300025711 Bacteria 2207
256 Ga0207692_10292941 3300025898 Bacteria 988
257 Ga0207642_10069573 3300025899 Bacteria 1670
258 Ga0207710_10023365 3300025900 Bacteria 2656
259 Ga0207688_10036584 3300025901 Bacteria 2721
260 Ga0207647_10008467 3300025904 Bacteria 7372
261 Ga0207647_10155432 3300025904 Bacteria 1336
262 Ga0207699_10033812 3300025906 Bacteria 2893
263 Ga0207699_10088646 3300025906 Bacteria 1937
264 Ga0207705_10308646 3300025909 Bacteria 1214
265 Ga0207654_10000210 3300025911 Bacteria 35799
266 Ga0207707_10004329 3300025912 Bacteria 12571
267 Ga0207707_10025404 3300025912 Bacteria 5182
268 Ga0207707_10031430 3300025912 Bacteria 4645
269 Ga0207695_10001435 3300025913 Bacteria 40061
270 Ga0207695_10010844 3300025913 Bacteria 11100
271 Ga0207695_10116136 3300025913 Bacteria 2650
272 Ga0207695_10128886 3300025913 Bacteria 2489
273 Ga0207695_10205887 3300025913 Bacteria 1880
274 Ga0207671_10028767 3300025914 Bacteria 4152
275 Ga0207671_10094407 3300025914 Bacteria 2258
276 Ga0207671_10211982 3300025914 Bacteria 1515
277 Ga0207671_10404952 3300025914 Bacteria 1085
278 Ga0207693_10060098 3300025915 Bacteria 2977
279 Ga0207693_10121333 3300025915 Bacteria 2053
280 Ga0207663_10007390 3300025916 Bacteria 5694
281 Ga0207663_10028537 3300025916 Bacteria 3267
282 Ga0207660_10001470 3300025917 Bacteria 15854
283 Ga0207660_10185729 3300025917 Bacteria 1617
284 Ga0207662_10198699 3300025918 Bacteria 1297
285 Ga0207657_10000700 3300025919 Bacteria 35601
286 Ga0207657_10119742 3300025919 Bacteria 2166
287 Ga0207649_10085619 3300025920 Bacteria 2051
288 Ga0207652_10007361 3300025921 Bacteria 8875
289 Ga0207652_10046543 3300025921 Bacteria 3701
290 Ga0207652_10163006 3300025921 Bacteria 1999
291 Ga0207694_10000106 3300025924 Bacteria 88467
292 Ga0207694_10014114 3300025924 Bacteria 6023
293 Ga0207694_10046065 3300025924 Bacteria 3370
294 Ga0207694_10055078 3300025924 Bacteria 3087
295 Ga0207694_10617111 3300025924 Bacteria 912
296 Ga0207659_10927912 3300025926 Bacteria 749
297 Ga0207687_10012071 3300025927 Bacteria 5649
298 Ga0207687_10601211 3300025927 Bacteria 927
299 Ga0207700_10049272 3300025928 Bacteria 3133
300 Ga0207700_10105138 3300025928 Bacteria 2260
301 Ga0207700_10155038 3300025928 Bacteria 1897
302 Ga0207664_10150552 3300025929 Bacteria 1976
303 Ga0207664_10237603 3300025929 Bacteria 1586
304 Ga0207644_10337051 3300025931 Bacteria 1222
305 Ga0207690_10023344 3300025932 Bacteria 3859
306 Ga0207690_10535097 3300025932 Bacteria 951
307 Ga0207706_10039352 3300025933 Bacteria 4192
308 Ga0207709_10315181 3300025935 Bacteria 1168
309 Ga0207709_10758431 3300025935 Bacteria 780
310 Ga0207669_10936564 3300025937 Bacteria 725
311 Ga0207669_11473601 3300025937 Bacteria 580
312 Ga0207665_10028607 3300025939 Bacteria 3682
313 Ga0207665_10106396 3300025939 Bacteria 1966
314 Ga0207711_10030008 3300025941 Bacteria 4587
315 Ga0207711_10408596 3300025941 Bacteria 1262
316 Ga0207711_10421302 3300025941 Bacteria 1242
317 Ga0207689_10054944 3300025942 Bacteria 3278
318 Ga0207689_10054996 3300025942 Bacteria 3277
319 Ga0207689_10310825 3300025942 Bacteria 1307
320 Ga0207661_10015572 3300025944 Bacteria 5600
321 Ga0207661_10133258 3300025944 Bacteria 2131
322 Ga0207679_11018658 3300025945 Bacteria 759
323 Ga0207667_10001909 3300025949 Bacteria 26170
324 Ga0207667_10010685 3300025949 Bacteria 10714
325 Ga0207667_10948055 3300025949 Bacteria 850
326 Ga0207667_10973523 3300025949 Bacteria 837
327 Ga0207667_11011183 3300025949 Bacteria 818
328 Ga0207651_10602871 3300025960 Bacteria 960
329 Ga0207712_10308204 3300025961 Bacteria 1302
330 Ga0207712_10750324 3300025961 Bacteria 855
331 Ga0207668_10038150 3300025972 Bacteria 3221
332 Ga0207668_10195017 3300025972 Bacteria 1608
333 Ga0207668_10946307 3300025972 Bacteria 768
334 Ga0207640_10018761 3300025981 Bacteria 4071
335 Ga0207640_10049905 3300025981 Bacteria 2712
336 Ga0207677_10044189 3300026023 Bacteria 2966
337 Ga0207677_10057193 3300026023 Bacteria 2676
338 Ga0207677_11018871 3300026023 Bacteria 751
339 Ga0207703_10121267 3300026035 Bacteria 2245
340 Ga0207703_10164191 3300026035 Bacteria 1947
341 Ga0207703_10749745 3300026035 Bacteria 930
342 Ga0207639_10002676 3300026041 Bacteria 11963
343 Ga0207639_10017628 3300026041 Bacteria 5063
344 Ga0207639_10304515 3300026041 Bacteria 1410
345 Ga0207639_10978510 3300026041 Bacteria 792
346 Ga0207639_11150404 3300026041 Bacteria 728
347 Ga0207678_10008508 3300026067 Bacteria 9045
348 Ga0207678_10041532 3300026067 Bacteria 3988
349 Ga0207678_10105285 3300026067 Bacteria 2407
350 Ga0207702_10000004 3300026078 Bacteria 422182
351 Ga0207702_10000546 3300026078 Bacteria 42023
352 Ga0207702_10229417 3300026078 Bacteria 1734
353 Ga0207702_10244823 3300026078 Bacteria 1681
354 Ga0207702_10702857 3300026078 Bacteria 996
355 Ga0207648_10740127 3300026089 Bacteria 913
356 Ga0207676_10038875 3300026095 Bacteria 3635
357 Ga0207676_10177444 3300026095 Bacteria 1862
358 Ga0207674_10018238 3300026116 Bacteria 7634
359 Ga0207674_10066904 3300026116 Bacteria 3618
360 Ga0207674_10074915 3300026116 Bacteria 3395
361 Ga0207674_10150152 3300026116 Bacteria 2288
362 Ga0207675_100506365 3300026118 Bacteria 1202
363 Ga0207683_10032853 3300026121 Bacteria 4508
364 Ga0207683_10070748 3300026121 Bacteria 3083
365 Ga0207683_10127400 3300026121 Bacteria 2289
366 Ga0207683_10205373 3300026121 Bacteria 1792
367 Ga0207698_10013935 3300026142 Bacteria 5325
368 Ga0207698_10062239 3300026142 Bacteria 2913
369 Ga0207698_10069148 3300026142 Bacteria 2791
370 Ga0207698_10289035 3300026142 Bacteria 1520
371 Ga0209589_1000035 3300027357 Bacteria 134091
372 Ga0209489_100079 3300027361 Bacteria 134091
373 Ga0209700_100077 3300027363 Bacteria 134091
374 Ga0209588_1002870 3300027671 Bacteria 4731
375 Ga0268266_10062908 3300028379 Bacteria 3203
376 Ga0268266_10115856 3300028379 Bacteria 2379
377 Ga0268266_10269427 3300028379 Bacteria 1580
378 Ga0268265_10061099 3300028380 Bacteria 2890
379 Ga0268264_10000062 3300028381 Bacteria 302110
380 Ga0268264_10078139 3300028381 Bacteria 2821
381 Ga0268264_10308314 3300028381 Bacteria 1492
382 Ga0265334_10005996 3300028573 Bacteria 5279
383 Ga0307515_10030422 3300028794 Bacteria 9065
384 Ga0307515_10137546 3300028794 Bacteria 2644
385 Ga0265338_10761647 3300028800 Bacteria 665
386 Ga0265330_10015040 3300031235 Bacteria 3583
387 Ga0265330_10033136 3300031235 Bacteria 2312
388 Ga0265330_10077895 3300031235 Bacteria 1430
389 Ga0265330_10098097 3300031235 Bacteria 1255
390 Ga0265332_10002500 3300031238 Bacteria 9344
391 Ga0265332_10127201 3300031238 Bacteria 1069
392 Ga0265325_10008179 3300031241 Bacteria 6196
393 Ga0265340_10059885 3300031247 Bacteria 1825
394 Ga0265340_10085252 3300031247 Bacteria 1482
395 Ga0265340_10250690 3300031247 Bacteria 789
396 Ga0265339_10032253 3300031249 Bacteria 2955
397 Ga0265339_10048152 3300031249 Bacteria 2338
398 Ga0265339_10085392 3300031249 Bacteria 1662
399 Ga0265331_10012649 3300031250 Bacteria 4564
400 Ga0265316_10100653 3300031344 Bacteria 2197
401 Ga0265316_10218705 3300031344 Bacteria 1406
402 Ga0307513_10154517 3300031456 Bacteria 2197
403 Ga0307509_10606463 3300031507 Bacteria 767
404 Ga0307408_100413760 3300031548 Bacteria 1161
405 Ga0307408_100749340 3300031548 Bacteria 882
406 Ga0307408_101145569 3300031548 Bacteria 723
407 Ga0307508_10152484 3300031616 Bacteria 1915
408 Ga0307508_10166436 3300031616 Bacteria 1808
409 Ga0307508_10169246 3300031616 Bacteria 1789
410 Ga0265314_10026988 3300031711 Bacteria 4306
411 Ga0265314_10049337 3300031711 Bacteria 2948
412 Ga0265314_10117320 3300031711 Bacteria 1682
413 Ga0265314_10137687 3300031711 Bacteria 1514
414 Ga0265314_10460891 3300031711 Bacteria 675
415 Ga0265342_10007969 3300031712 Bacteria 7669
416 Ga0265342_10026156 3300031712 Bacteria 3660
417 Ga0265342_10326251 3300031712 Bacteria 803
418 Ga0265342_10348656 3300031712 Bacteria 771
419 Ga0307516_10164027 3300031730 Bacteria 1969
420 Ga0307406_10115655 3300031901 Bacteria 1855
421 Ga0307406_10522409 3300031901 Bacteria 966
422 Ga0307412_10027981 3300031911 Bacteria 3522
423 Ga0307412_10381740 3300031911 Bacteria 1141
424 Ga0307409_101098149 3300031995 Bacteria 816
425 Ga0307416_100325612 3300032002 Bacteria 1541
426 Ga0307416_100492732 3300032002 Bacteria 1288
427 Ga0307416_101335066 3300032002 Bacteria 823
428 Ga0307411_10360605 3300032005 Bacteria 1188
429 Ga0307510_10014100 3300033180 Bacteria 9465
430 Ga0307510_10097348 3300033180 Bacteria 2753
431 Ga0373930_0008048 3300034816 Bacteria 1835
432 Ga0373958_0109169 3300034819 Bacteria 658
433 Ga0373929_0051418 3300035085 Bacteria 943
434 Ga0373934_0078402 3300035086 Bacteria 1325
435 Ga0373934_0107241 3300035086 Bacteria 1131
436 Ga0373944_0029669 3300035089 Bacteria 1637
437 Ga0373944_0173504 3300035089 Bacteria 770
438 Ga0373923_0002456 3300035111 Bacteria 5712
439 Ga0373923_0124871 3300035111 Bacteria 1152
440 Ga0373932_0025204 3300035112 Bacteria 1608
441 Ga0373936_0098217 3300035113 Bacteria 1234
442 Ga0373936_0425131 3300035113 Bacteria 612
443 Ga0373939_0118602 3300035114 Bacteria 931
444 Ga0373941_0242371 3300035115 Bacteria 701
445 Ga0373953_0006029 3300035117 Bacteria 3971
446 Ga0373953_0015403 3300035117 Bacteria 2770
447 Ga0373954_0006064 3300035118 Bacteria 5257
448 Ga0373954_0041778 3300035118 Bacteria 2138
449 Ga0373956_0000581 3300035119 Bacteria 14992
450 Ga0373956_0213345 3300035119 Bacteria 916
451 Ga0373957_0001140 3300035120 Bacteria 7044
452 Ga0373957_0034748 3300035120 Bacteria 1869
453 Ga0373957_0226591 3300035120 Bacteria 783
454 Ga0373943_0004960 3300035170 Bacteria 6009
455 Ga0373946_0005215 3300035171 Bacteria 4685
456 Ga0373946_0135029 3300035171 Bacteria 1139
457 Ga0373946_0139685 3300035171 Bacteria 1122
458 Ga0373955_0005025 3300035172 Bacteria 5912
459 Ga0373955_0018188 3300035172 Bacteria 3491
460 Ga0373942_0140426 3300035207 Bacteria 769
461 Ga0373924_0003746 3300035410 Bacteria 5257
462 Ga0373924_0031077 3300035410 Bacteria 2145
463 Ga0373931_0429106 3300035691 Bacteria 842
464 Ga0373935_0000595 3300035692 Bacteria 18877
465 Ga0373935_0104255 3300035692 Bacteria 1874
466 Ga0373935_0373992 3300035692 Bacteria 1019
467 Ga0373927_0001021 3300035695 Bacteria 21303
468 Ga0373927_0012902 3300035695 Bacteria 5557
469 Ga0373927_0312382 3300035695 Bacteria 1035
470 Ga0373927_0343719 3300035695 Bacteria 983
471 Ga0373933_0000218 3300035724 Bacteria 37928
472 Ga0373933_0001113 3300035724 Bacteria 16004
473 Ga0373933_0068376 3300035724 Bacteria 2157
474 Ga0373947_0000970 3300035725 Bacteria 17506
475 Ga0373947_0082864 3300035725 Bacteria 1988
476 Ga0373947_0392519 3300035725 Bacteria 935
477 Ga0373937_0015997 3300036401 Bacteria 6653
478 Ga0373937_0104647 3300036401 Bacteria 2629
479 Ga0373937_0236799 3300036401 Bacteria 1719
480 Ga0373925_0022227 3300037068 Bacteria 4625
481 Ga0373925_0047991 3300037068 Bacteria 3180
482 Ga0395900_0068610 3300037418 Bacteria 3644
483 Ga0395900_0169303 3300037418 Bacteria 2225
484 Ga0395900_0190863 3300037418 Bacteria 2078
485 Ga0395898_0233063 3300037466 Bacteria 1756
486 Ga0395898_0389877 3300037466 Bacteria 1328
487 Ga0395905_0150031 3300037471 Bacteria 2193
488 Ga0395905_0587127 3300037471 Bacteria 1016
489 Ga0395901_0258192 3300038443 Bacteria 1814
490 Ga0395901_0528410 3300038443 Bacteria 1198
491 Ga0237819_04025 3300038705 Bacteria 2489
492 Ga0436365_0345621 3300039437 Bacteria 1210
493 Ga0436365_0364359 3300039437 Bacteria 2347
494 Ga0436365_0747851 3300039437 Bacteria 599
495 Ga0436360_0339772 3300039438 Bacteria 4887
496 Ga0436360_0859761 3300039438 Bacteria 704
497 Ga0436360_1157986 3300039438 Bacteria 1032
498 Ga0436363_0784614 3300039450 Bacteria 4330
499 Ga0436363_1136180 3300039450 Bacteria 1688
500 Ga0436363_1514540 3300039450 Bacteria 637
501 Ga0436362_1002335 3300039453 Bacteria 7981
502 Ga0451793_0905474 3300041452 Bacteria 1312
503 Ga0451797_0420178 3300041453 Bacteria 1249
504 Ga0451847_0677595 3300041503 Bacteria 1000
505 Ga0466969_0056131 3300044656 Bacteria 1924
506 Ga0466972_0000804 3300044658 Bacteria 14929
507 Ga0466965_0027670 3300044683 Bacteria 2753
508 Ga0466965_0265746 3300044683 Bacteria 923
509 Ga0466966_0352077 3300044684 Bacteria 885
510 Ga0466966_0551757 3300044684 Bacteria 693
511 Ga0466961_0477019 3300044693 Bacteria 754
512 Ga0466963_0373793 3300044694 Bacteria 1004
513 Ga0466964_0054111 3300044706 Bacteria 1654
514 Ga0466971_0109001 3300044719 Bacteria 1277
515 Ga0466968_0200919 3300044735 Bacteria 934
516 Ga0466970_0052790 3300044765 Bacteria 2170
517 Ga0466959_0092328 3300045049 Bacteria 2173
518 Ga0466967_0133246 3300045976 Bacteria 2309
519 Ga0466967_0171920 3300045976 Bacteria 2039
520 Ga0466967_0708093 3300045976 Bacteria 997
521 Ga0495592_0004267 3300046454 Bacteria 10446
522 Ga0495592_0044642 3300046454 Bacteria 3310
523 Ga0495592_0334013 3300046454 Bacteria 976
524 Ga0495603_0001390 3300046455 Bacteria 14060
525 Ga0495603_0008445 3300046455 Bacteria 6221
526 Ga0495603_0012891 3300046455 Bacteria 5055
527 Ga0495603_0057866 3300046455 Bacteria 2293
528 Ga0495603_0064921 3300046455 Bacteria 2151
529 Ga0495603_0240265 3300046455 Bacteria 1043
530 Ga0495629_0000915 3300046459 Bacteria 23696
531 Ga0495629_0004437 3300046459 Bacteria 10512
532 Ga0495629_0049476 3300046459 Bacteria 2946
533 Ga0495629_0068873 3300046459 Bacteria 2469
534 Ga0495629_0314289 3300046459 Bacteria 1071
535 Ga0495638_0046132 3300046460 Bacteria 2738
536 Ga0495641_0007969 3300046461 Bacteria 6530
537 Ga0495641_0035619 3300046461 Bacteria 2344
538 Ga0495651_0021120 3300046462 Bacteria 5056
539 Ga0495651_0425836 3300046462 Bacteria 862
540 Ga0495651_0510912 3300046462 Bacteria 768
541 Ga0495653_0020185 3300046463 Bacteria 5401
542 Ga0495653_0054414 3300046463 Bacteria 3058
543 Ga0495580_0009685 3300046472 Bacteria 7560
544 Ga0495580_0250141 3300046472 Bacteria 1214
545 Ga0495582_0000302 3300046473 Bacteria 27218
546 Ga0495582_0345079 3300046473 Bacteria 857
547 Ga0495639_0016344 3300046475 Bacteria 3221
548 Ga0495639_0019607 3300046475 Bacteria 2953
549 Ga0495639_0022697 3300046475 Bacteria 2753
550 Ga0495662_0001985 3300046476 Bacteria 10261
551 Ga0495662_0047542 3300046476 Bacteria 2071
552 Ga0495664_0019091 3300046477 Bacteria 3937
553 Ga0495664_0029125 3300046477 Bacteria 3227
554 Ga0495664_0054710 3300046477 Bacteria 2373
555 Ga0495664_0347623 3300046477 Bacteria 893
556 Ga0495585_0192538 3300046492 Bacteria 1042
557 Ga0495594_0000046 3300046499 Bacteria 53822
558 Ga0495594_0006637 3300046499 Bacteria 5956
559 Ga0495596_0075852 3300046500 Bacteria 1306
560 Ga0495607_0252083 3300046501 Bacteria 849
561 Ga0495583_0130589 3300046506 Bacteria 1051
562 Ga0495583_0219465 3300046506 Bacteria 769
563 Ga0495606_0001471 3300046507 Bacteria 31450
564 Ga0495606_0270629 3300046507 Bacteria 933
565 Ga0495606_0401374 3300046507 Bacteria 714
566 Ga0495608_0040877 3300046511 Bacteria 3105
567 Ga0495608_0160446 3300046511 Bacteria 1430
568 Ga0495610_0121130 3300046512 Bacteria 1146
569 Ga0495616_0045646 3300046513 Bacteria 2216
570 Ga0495616_0059586 3300046513 Bacteria 1877
571 Ga0495618_0023457 3300046514 Bacteria 3816
572 Ga0495618_0029523 3300046514 Bacteria 3422
573 Ga0495620_0013237 3300046515 Bacteria 4230
574 Ga0495628_0032224 3300046516 Bacteria 4232
575 Ga0495628_0049222 3300046516 Bacteria 3337
576 Ga0495628_0187605 3300046516 Bacteria 1562
577 Ga0495628_0333812 3300046516 Bacteria 1117
578 Ga0495630_0004933 3300046517 Bacteria 9381
579 Ga0495631_0097076 3300046518 Bacteria 1268
580 Ga0495631_0098219 3300046518 Bacteria 1260
581 Ga0495631_0188122 3300046518 Bacteria 884
582 Ga0495632_0035025 3300046519 Bacteria 2565
583 Ga0495632_0293119 3300046519 Bacteria 723
584 Ga0495637_0081247 3300046520 Bacteria 1292
585 Ga0495643_0018786 3300046522 Bacteria 4007
586 Ga0495663_0207400 3300046525 Bacteria 685
587 Ga0495666_0094326 3300046526 Bacteria 1411
588 Ga0495652_0006987 3300046529 Bacteria 10432
589 Ga0495652_0056662 3300046529 Bacteria 3327
590 Ga0495652_0097330 3300046529 Bacteria 2394
591 Ga0495654_0062998 3300046530 Bacteria 1776
592 Ga0495665_0000335 3300046531 Bacteria 23811
593 Ga0495665_0495924 3300046531 Bacteria 615
594 Ga0495640_0011568 3300046533 Bacteria 6783
595 Ga0495640_0021072 3300046533 Bacteria 4791
596 Ga0495640_0209295 3300046533 Bacteria 1233
597 Ga0495586_0101878 3300046535 Bacteria 1594
598 Ga0495587_0297084 3300046536 Bacteria 903
599 Ga0495598_0013615 3300046537 Bacteria 2020
600 Ga0495609_0065976 3300046538 Bacteria 1595
601 Ga0495609_0148817 3300046538 Bacteria 996
602 Ga0495621_0051417 3300046539 Bacteria 1474
603 Ga0495645_0072915 3300046543 Bacteria 2473
604 Ga0495645_0143727 3300046543 Bacteria 1662
605 Ga0495645_0182261 3300046543 Bacteria 1438
606 Ga0495622_0001947 3300046557 Bacteria 10142
607 Ga0495622_0181910 3300046557 Bacteria 942
608 Ga0495633_0107148 3300046558 Bacteria 1296
609 Ga0495667_0038370 3300046559 Bacteria 3189
610 Ga0495667_0076968 3300046559 Bacteria 2170
611 Ga0495667_0212371 3300046559 Bacteria 1236
612 Ga0495656_0043366 3300046615 Bacteria 1888
613 Ga0495656_0103260 3300046615 Bacteria 1321
614 Ga0495656_0235570 3300046615 Bacteria 920
615 Ga0495668_0066637 3300046616 Bacteria 1981
616 Ga0495668_0183741 3300046616 Bacteria 1145
617 Ga0495634_0001329 3300046642 Bacteria 22513
618 Ga0495634_0009349 3300046642 Bacteria 7232
619 Ga0495611_0174808 3300046648 Bacteria 1003
620 Ga0495611_0237727 3300046648 Bacteria 846
621 Ga0495625_0124818 3300046660 Bacteria 1748
622 Ga0495625_0181728 3300046660 Bacteria 1398
623 Ga0495635_0011167 3300046663 Bacteria 6297
624 Ga0495635_0016673 3300046663 Bacteria 5131
625 Ga0495635_0032609 3300046663 Bacteria 3613
626 Ga0495635_0093692 3300046663 Bacteria 2054
627 Ga0495661_0074186 3300046665 Bacteria 1980
628 Ga0495588_0002250 3300046674 Bacteria 8263
629 Ga0495588_0005736 3300046674 Bacteria 5541
630 Ga0495657_0028680 3300046675 Bacteria 3911
631 Ga0495657_0046286 3300046675 Bacteria 2946
632 Ga0495657_0157955 3300046675 Bacteria 1404
633 Ga0495599_0007907 3300046678 Bacteria 6449
634 Ga0495599_0028351 3300046678 Bacteria 3509
635 Ga0495599_0358416 3300046678 Bacteria 873
636 Ga0495623_0020395 3300046679 Bacteria 4283
637 Ga0495623_0277154 3300046679 Bacteria 934
638 Ga0495623_0666656 3300046679 Bacteria 535
639 Ga0495646_0017629 3300046680 Bacteria 4528
640 Ga0495646_0039700 3300046680 Bacteria 2901
641 Ga0495646_0254534 3300046680 Bacteria 939
642 Ga0495647_0000898 3300046681 Bacteria 8925
643 Ga0495647_0032228 3300046681 Bacteria 1952
644 Ga0495647_0269454 3300046681 Bacteria 762
645 Ga0495658_0000201 3300046683 Bacteria 34784
646 Ga0495669_0028232 3300046684 Bacteria 2456
647 Ga0495613_0004521 3300046689 Bacteria 10429
648 Ga0495613_0013945 3300046689 Bacteria 5964
649 Ga0495613_0107083 3300046689 Bacteria 2017
650 Ga0495624_0004061 3300046690 Bacteria 10771
651 Ga0495624_0231555 3300046690 Bacteria 1119
652 Ga0495624_0779064 3300046690 Bacteria 566
653 Ga0495670_0063775 3300046691 Bacteria 1855
654 Ga0495649_0434866 3300046694 Bacteria 656
655 Ga0495589_0105225 3300046794 Bacteria 1364
656 Ga0495600_0078269 3300046809 Bacteria 2159
657 Ga0495600_0099016 3300046809 Bacteria 1900
658 Ga0495581_0000030 3300047315 Bacteria 53487
659 Ga0495581_0019419 3300047315 Bacteria 3945
660 Ga0495581_0162600 3300047315 Bacteria 1305
661 Ga0495581_0262381 3300047315 Bacteria 1010
662 Ga0495604_0013451 3300047317 Bacteria 6520
663 Ga0495604_0404292 3300047317 Bacteria 899
664 Ga0495604_0776886 3300047317 Bacteria 604
665 Ga0495674_0002494 3300047319 Bacteria 17944
666 Ga0495674_0022918 3300047319 Bacteria 5753
667 Ga0495674_0117626 3300047319 Bacteria 2248
668 Ga0495672_0011216 3300047320 Bacteria 6335
669 Ga0495672_0033255 3300047320 Bacteria 3196
670 Ga0495676_0005339 3300047321 Bacteria 11767
671 Ga0495680_0008534 3300047322 Bacteria 9307
672 Ga0495680_0028090 3300047322 Bacteria 4615
673 Ga0495680_0097180 3300047322 Bacteria 2199
674 Ga0495680_0791809 3300047322 Bacteria 620
675 Ga0495683_0289019 3300047323 Bacteria 707
676 Ga0495675_0010421 3300047444 Bacteria 5811
677 Ga0495675_0017447 3300047444 Bacteria 4549
678 Ga0495677_0135314 3300047445 Bacteria 944
679 Ga0495685_021155 3300047447 Bacteria 2237
680 Ga0495673_0115066 3300047469 Bacteria 1071
681 Ga0495673_0181708 3300047469 Bacteria 796
682 Ga0495681_0090192 3300047470 Bacteria 1355
683 Ga0495684_0013438 3300047471 Bacteria 6301
684 Ga0495684_0014274 3300047471 Bacteria 6112
685 Ga0495684_0099383 3300047471 Bacteria 2200
686 Ga0495686_0012793 3300047472 Bacteria 5855
687 Ga0495686_0139005 3300047472 Bacteria 1434
688 Ga0495686_0498469 3300047472 Bacteria 641
689 Ga0495593_0000100 3300047673 Bacteria 39337
690 Ga0495593_0000740 3300047673 Bacteria 18976
691 Ga0495593_0068818 3300047673 Bacteria 1842
692 Ga0495602_0045053 3300048088 Bacteria 3994
693 Ga0495602_0091663 3300048088 Bacteria 2519
694 Ga0495602_0272624 3300048088 Bacteria 1250
695 Ga0495602_0515858 3300048088 Bacteria 833
696 Ga0495614_0007180 3300048089 Bacteria 4968
697 Ga0495615_0060674 3300048090 Bacteria 997
698 Ga0495626_0060081 3300048091 Bacteria 1733
699 Ga0496100_0003200 3300048903 Bacteria 8504
700 Ga0496100_0108403 3300048903 Bacteria 1926
701 Ga0496101_0021912 3300048904 Bacteria 4391
702 Ga0496101_0157719 3300048904 Bacteria 1739
703 Ga0496101_0315228 3300048904 Bacteria 1227
704 Ga0496102_0025407 3300048905 Bacteria 5272
705 Ga0496102_0098842 3300048905 Bacteria 2708
706 Ga0496102_0112985 3300048905 Bacteria 2534
707 Ga0496102_0253625 3300048905 Bacteria 1659
708 Ga0496102_0265482 3300048905 Bacteria 1618
709 Ga0496102_0369963 3300048905 Bacteria 1349
710 Ga0496102_0596015 3300048905 Bacteria 1028
711 Ga0496102_0918503 3300048905 Bacteria 797
712 Ga0496102_1188152 3300048905 Bacteria 682
713 Ga0496103_0031134 3300048906 Bacteria 3250
714 Ga0496103_0193606 3300048906 Bacteria 1307
715 Ga0496104_0012106 3300048907 Bacteria 7744
716 Ga0496104_0133370 3300048907 Bacteria 2386
717 Ga0496104_1257594 3300048907 Bacteria 643
718 Ga0496105_0081851 3300048908 Bacteria 2666
719 Ga0496105_0136497 3300048908 Bacteria 2021
720 Ga0496106_0013334 3300048909 Bacteria 6067
721 Ga0496106_0031809 3300048909 Bacteria 3932
722 Ga0496106_0886439 3300048909 Bacteria 705
723 Ga0496106_1383308 3300048909 Bacteria 544
724 Ga0496107_0006358 3300048910 Bacteria 8120
725 Ga0496107_0029342 3300048910 Bacteria 3912
726 Ga0496107_0050760 3300048910 Bacteria 2991
727 Ga0496107_0165818 3300048910 Bacteria 1638
728 Ga0496108_0000160 3300048911 Bacteria 64120
729 Ga0496108_0019419 3300048911 Bacteria 5581
730 Ga0496108_0166431 3300048911 Bacteria 1906
731 Ga0496108_1285607 3300048911 Bacteria 616
732 Ga0496109_0000245 3300048912 Bacteria 52201
733 Ga0496109_0092517 3300048912 Bacteria 2797
734 Ga0496109_0105058 3300048912 Bacteria 2623
735 Ga0496109_0863893 3300048912 Bacteria 842
736 Ga0496109_0967809 3300048912 Bacteria 789
737 Ga0496109_1175280 3300048912 Bacteria 704
738 Ga0496110_0112856 3300048913 Bacteria 2443
739 Ga0496110_0196580 3300048913 Bacteria 1832
740 Ga0496110_0293506 3300048913 Bacteria 1481
741 Ga0496110_0293709 3300048913 Bacteria 1480
742 Ga0496110_0486920 3300048913 Bacteria 1123
743 Ga0496111_0109796 3300048914 Bacteria 2031
744 Ga0496111_0197788 3300048914 Bacteria 1494
745 Ga0496111_0211141 3300048914 Bacteria 1442
746 Ga0496112_0000018 3300048915 Bacteria 188820
747 Ga0496112_0004529 3300048915 Bacteria 11807
748 Ga0496112_0074784 3300048915 Bacteria 3350
749 Ga0496112_0084168 3300048915 Bacteria 3146
750 Ga0496112_0168495 3300048915 Bacteria 2156
751 Ga0496112_0174060 3300048915 Bacteria 2117
752 Ga0496112_0390338 3300048915 Bacteria 1332
753 Ga0496112_0607322 3300048915 Bacteria 1025
754 Ga0496113_0008153 3300048916 Bacteria 6804
755 Ga0496113_0110348 3300048916 Bacteria 2140
756 Ga0496113_0239520 3300048916 Bacteria 1447
757 Ga0496113_0419898 3300048916 Bacteria 1074
758 Ga0496114_0037094 3300048917 Bacteria 4031
759 Ga0496114_0090327 3300048917 Bacteria 2600
760 Ga0496114_0199892 3300048917 Bacteria 1750
761 Ga0496115_0000743 3300048918 Bacteria 24064
762 Ga0496115_0025011 3300048918 Bacteria 4645
763 Ga0496115_0047980 3300048918 Bacteria 3416
764 Ga0496116_0001672 3300048919 Bacteria 24354
765 Ga0496116_0235183 3300048919 Bacteria 925
766 Ga0496117_0040333 3300048920 Bacteria 3434
767 Ga0496117_0225219 3300048920 Bacteria 1040
768 Ga0496117_0451247 3300048920 Bacteria 636
769 Ga0496118_0050095 3300048921 Bacteria 3209
770 Ga0496118_0198075 3300048921 Bacteria 1193
771 Ga0496119_0178993 3300048922 Bacteria 1113
772 Ga0496120_0149386 3300048923 Bacteria 1176
773 Ga0496120_0158380 3300048923 Bacteria 1131
774 Ga0496121_0000278 3300048924 Bacteria 106838
775 Ga0496121_0013765 3300048924 Bacteria 8661
776 Ga0496121_0023451 3300048924 Bacteria 5942
777 Ga0496121_0042659 3300048924 Bacteria 3941
778 Ga0496121_0153022 3300048924 Bacteria 1695
779 Ga0496121_0231365 3300048924 Bacteria 1294
780 Ga0496121_0267658 3300048924 Bacteria 1176
781 Ga0496121_0306078 3300048924 Bacteria 1076
782 Ga0496122_0016548 3300048925 Bacteria 6964
783 Ga0496122_0129185 3300048925 Bacteria 1610
784 Ga0496123_0010686 3300048926 Bacteria 8075
785 Ga0496123_0017895 3300048926 Bacteria 5674
786 Ga0496124_0075956 3300048927 Bacteria 2775
787 Ga0496125_0000207 3300048928 Bacteria 122897
788 Ga0496125_0012675 3300048928 Bacteria 8344
789 Ga0496125_0013674 3300048928 Bacteria 7963
790 Ga0496125_0084547 3300048928 Bacteria 2409
791 Ga0496125_0180656 3300048928 Bacteria 1406
792 Ga0496126_0010955 3300048929 Bacteria 9444
793 Ga0496126_0062920 3300048929 Bacteria 3327
794 Ga0496126_0083916 3300048929 Bacteria 2811
795 Ga0496126_0120165 3300048929 Bacteria 2280
796 Ga0496126_0145205 3300048929 Bacteria 2038
797 Ga0496126_0163328 3300048929 Bacteria 1902
798 Ga0496126_0203863 3300048929 Bacteria 1668
799 Ga0496126_0567270 3300048929 Bacteria 898
800 Ga0496126_0670628 3300048929 Bacteria 809
801 Ga0496126_0736918 3300048929 Bacteria 762
802 Ga0501031_0265138 3300049568 Bacteria 1116
803 Ga0501032_0042579 3300049569 Bacteria 3079
804 Ga0501032_0494254 3300049569 Bacteria 782
805 Ga0501033_0078391 3300049570 Bacteria 2424
806 Ga0501033_0396207 3300049570 Bacteria 963
807 Ga0501034_0231621 3300049571 Bacteria 1796
808 Ga0501036_0270262 3300049572 Bacteria 1423
809 Ga0501038_0111039 3300049574 Bacteria 2271
810 Ga0501038_0171120 3300049574 Bacteria 1758
811 Ga0501038_0540309 3300049574 Bacteria 887
812 Ga0501039_0321447 3300049575 Bacteria 1216
813 Ga0501041_0656203 3300049577 Bacteria 671
814 Ga0501046_0122826 3300049580 Bacteria 1975
815 Ga0501047_0236061 3300049581 Bacteria 1680
816 Ga0501067_0071550 3300049583 Bacteria 1921
817 Ga0501067_0193270 3300049583 Bacteria 1134
818 Ga0501070_0203155 3300049586 Bacteria 1627
819 Ga0501070_0446170 3300049586 Bacteria 1043
820 Ga0501070_0879100 3300049586 Bacteria 700
821 Ga0501070_0887744 3300049586 Bacteria 696
822 Ga0501072_0001175 3300049588 Bacteria 19481
823 Ga0501074_0196720 3300049590 Bacteria 1437
824 Ga0501035_0091906 3300049822 Bacteria 2670
825 Ga0501035_0452299 3300049822 Bacteria 1062
826 Ga0501035_0770734 3300049822 Bacteria 770
827 Ga0501044_0312536 3300049823 Bacteria 1497
828 Ga0501044_0543391 3300049823 Bacteria 1060
829 nmdc:mga03n38_107709_c1 3300050490 Bacteria 1353
830 nmdc:mga00v17_2666_c1 3300050491 Bacteria 9152
831 nmdc:mga00v17_39990_c1 3300050491 Bacteria 2811
832 nmdc:mga0yw44_174945_c1 3300050492 Bacteria 1411
833 nmdc:mga0yw44_57766_c1 3300050492 Bacteria 2368
834 nmdc:mga0yw44_91064_c1 3300050492 Bacteria 1927
835 nmdc:mga0k408_16783_c1 3300050493 Bacteria 4069
836 nmdc:mga07m45_339041_c1 3300050496 Bacteria 874
837 nmdc:mga07m45_83022_c1 3300050496 Bacteria 1830
838 nmdc:mga08y16_264528_c1 3300050511 Bacteria 1776
839 nmdc:mga0rr50_160535_c1 3300050513 Bacteria 1824
840 nmdc:mga08x19_111942_c1 3300050514 Bacteria 1821
841 nmdc:mga0sz30_1770_c1 3300050516 Bacteria 7671
842 Ga0495601_0020279 3300053077 Bacteria 4059
843 Ga0495612_0008112 3300053078 Bacteria 4274
844 Ga0495612_0212665 3300053078 Bacteria 855
845 Ga0500635_0019445 3300053080 Bacteria 2064
846 Ga0495595_0001985 3300053084 Bacteria 7953
847 Ga0495595_0003331 3300053084 Bacteria 6376
848 Ga0495595_0403992 3300053084 Bacteria 692
849 Ga0495619_0013161 3300053085 Bacteria 5213
850 Ga0495619_0076187 3300053085 Bacteria 2251
851 Ga0495619_0087435 3300053085 Bacteria 2107
852 Ga0495619_0280022 3300053085 Bacteria 1156
853 Ga0495619_0738122 3300053085 Bacteria 668
854 Ga0500643_011603 3300053087 Bacteria 3202
855 Ga0500644_0017901 3300053088 Bacteria 2065
856 Ga0500581_079515 3300053089 Bacteria 1638
857 Ga0500646_0033732 3300053090 Bacteria 1417
858 Ga0500646_0075827 3300053090 Bacteria 1017
859 Ga0500583_0127484 3300053092 Bacteria 1261
860 Ga0500641_0018452 3300053096 Bacteria 2624
861 Ga0500554_004441 3300053102 Bacteria 2974
862 Ga0500556_0000006 3300053104 Bacteria 453982
863 Ga0500556_0059496 3300053104 Bacteria 1404
864 Ga0500562_005909 3300053108 Bacteria 3081
865 Ga0500562_055931 3300053108 Bacteria 1057
866 Ga0500569_001412 3300053109 Bacteria 4521
867 Ga0500575_172801 3300053112 Bacteria 693
868 Ga0500592_000600 3300053116 Bacteria 5910
869 Ga0500595_003189 3300053119 Bacteria 7758
870 Ga0500607_113450 3300053121 Bacteria 1324
871 Ga0500617_156877 3300053124 Bacteria 893
872 Ga0500642_0000004 3300053130 Bacteria 433122
873 Ga0500652_000160 3300053131 Bacteria 25768
874 Ga0500658_0085972 3300053134 Bacteria 1352
875 Ga0500658_0090933 3300053134 Bacteria 1319
876 Ga0500568_0002888 3300053139 Bacteria 9874
877 Ga0500568_0007069 3300053139 Bacteria 5546
878 Ga0500577_0032763 3300053142 Bacteria 1830
879 Ga0500586_000112 3300053145 Bacteria 14466
880 Ga0500588_0124971 3300053146 Bacteria 911
881 Ga0500588_0178200 3300053146 Bacteria 780
882 Ga0500590_135322 3300053148 Bacteria 1134
883 Ga0500603_001369 3300053150 Bacteria 5560
884 Ga0500616_0000022 3300053153 Bacteria 460463
885 Ga0500616_0214824 3300053153 Bacteria 843
886 Ga0500622_0003300 3300053156 Bacteria 10912
887 Ga0500627_0365214 3300053158 Bacteria 621
888 Ga0500634_0124148 3300053161 Bacteria 1251
889 Ga0500634_0292049 3300053161 Bacteria 651
890 Ga0500638_305919 3300053162 Bacteria 611
891 Ga0500637_0003374 3300053178 Bacteria 7365
892 Ga0500637_0198966 3300053178 Bacteria 1142
893 Ga0500611_005120 3300053727 Bacteria 1822
894 Ga0500611_169508 3300053727 Bacteria 607
895 Ga0500645_026788 3300053730 Bacteria 1752

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053727 Ga0500611_169508 Ga0500611_169508_23_487 154
2 3300041452 Ga0451793_0905474 Ga0451793_0905474_770_1240 155
3 3300048924 Ga0496121_0153022 Ga0496121_0153022_408_878 155
4 3300048926 Ga0496123_0017895 Ga0496123_0017895_4647_5117 155
5 3300046543 Ga0495645_0182261 Ga0495645_0182261_97_612 158
6 iso_pu_bacteria 2643221734 2644737830 158
7 3300046559 Ga0495667_0212371 Ga0495667_0212371_640_1146 159
8 3300046675 Ga0495657_0157955 Ga0495657_0157955_613_1119 159
9 3300053084 Ga0495595_0403992 Ga0495595_0403992_47_553 159
10 iso_pu_bacteria 2602042107 2603858599 160
11 iso_pu_bacteria 2857524615 2857526276 160
12 iso_pu_bacteria 2919073203 2919073871 160
13 iso_pu_bacteria 8056681323 8056682960 161
14 3300005548 Ga0070665_101624430 Ga0070665_1016244301 162
15 iso_pu_bacteria 2513237092 2513623909 162
16 iso_pu_bacteria 2513237096 2513659527 162
17 iso_pu_bacteria 2513237145 2513921540 162
18 iso_pu_bacteria 2524023228 2524537503 162
19 iso_pu_bacteria 2617270741 2617373513 162
20 iso_pu_bacteria 2667528175 2671124057 162
21 iso_pu_bacteria 2728368998 2728755268 162
22 iso_pu_bacteria 2791355196 2793062254 162
23 iso_pu_bacteria 2791355197 2793072693 162
24 iso_pu_bacteria 2824679649 2824684820 162
25 iso_pu_bacteria 2824732956 2824739294 162
26 iso_pu_bacteria 2824746037 2824751156 162
27 iso_pu_bacteria 2849076700 2849083230 162
28 iso_pu_bacteria 2874620515 2874621185 162
29 iso_pu_bacteria 2885374607 2885377574 162
30 iso_pu_bacteria 2903748898 2903758779 162
31 iso_pu_bacteria 2904666416 2904667730 162
32 iso_pu_bacteria 2904690495 2904690988 162
33 iso_pu_bacteria 2906610324 2906613553 162
34 iso_pu_bacteria 2906635258 2906636588 162
35 iso_pu_bacteria 2906660503 2906668090 162
36 iso_pu_bacteria 2908739725 2908747671 162
37 iso_pu_bacteria 2908756301 2908757046 162
38 iso_pu_bacteria 2908775508 2908775984 162
39 iso_pu_bacteria 2922425934 2922433994 162
40 iso_pu_bacteria 2935630451 2935636022 162
41 iso_pu_bacteria 2941507105 2941512674 162
42 iso_pu_bacteria 2941515067 2941520488 162
43 iso_pu_bacteria 2941523033 2941528502 162
44 iso_pu_bacteria 3005474847 3005475292 162
45 iso_pu_bacteria 8006933436 8006935985 162
46 iso_pu_bacteria 8006973647 8006975891 162
47 iso_pu_bacteria 8019555841 8019562672 162
48 iso_pu_bacteria 8056689827 8056693797 162
49 3300003775 Ga0055524_1047432 Ga0055524_10474322 163
50 3300005262 Ga0065165_1000014 Ga0065165_1000014253 163
51 3300005437 Ga0070710_10440555 Ga0070710_104405551 163
52 3300025284 Ga0209130_1000024 Ga0209130_100002423 163
53 3300025299 Ga0209256_1001059 Ga0209256_10010594 163
54 3300025302 Ga0207426_1024685 Ga0207426_10246852 163
55 3300038705 Ga0237819_04025 Ga0237819_04025_1138_1644 163
56 3300005327 Ga0070658_10463689 Ga0070658_104636892 164
57 3300005353 Ga0070669_100113184 Ga0070669_1001131843 164
58 3300005366 Ga0070659_100046072 Ga0070659_1000460723 164
59 3300005367 Ga0070667_101306125 Ga0070667_1013061251 164
60 3300005434 Ga0070709_10097615 Ga0070709_100976151 164
61 3300005437 Ga0070710_10051309 Ga0070710_100513093 164
62 3300005455 Ga0070663_100095227 Ga0070663_1000952273 164
63 3300005458 Ga0070681_10417355 Ga0070681_104173551 164
64 3300005518 Ga0070699_101176282 Ga0070699_1011762821 164
65 3300005563 Ga0068855_100664039 Ga0068855_1006640392 164
66 3300006038 Ga0075365_10144138 Ga0075365_101441383 164
67 3300006038 Ga0075365_10183266 Ga0075365_101832662 164
68 3300006051 Ga0075364_10068069 Ga0075364_100680693 164
69 3300006163 Ga0070715_10008592 Ga0070715_100085923 164
70 3300006186 Ga0075369_10004251 Ga0075369_100042512 164
71 3300006353 Ga0075370_10027487 Ga0075370_100274873 164
72 3300009092 Ga0105250_10229886 Ga0105250_102298861 164
73 3300009551 Ga0105238_10104490 Ga0105238_101044903 164
74 3300009553 Ga0105249_10053869 Ga0105249_100538693 164
75 3300009553 Ga0105249_12604298 Ga0105249_126042981 164
76 3300013100 Ga0157373_10016212 Ga0157373_100162124 164
77 3300013104 Ga0157370_10298450 Ga0157370_102984502 164
78 3300014969 Ga0157376_12306530 Ga0157376_123065301 164
79 3300025295 Ga0209564_1010374 Ga0209564_10103743 164
80 3300025904 Ga0207647_10155432 Ga0207647_101554322 164
81 3300025909 Ga0207705_10308646 Ga0207705_103086462 164
82 3300025919 Ga0207657_10000700 Ga0207657_1000070029 164
83 3300025921 Ga0207652_10163006 Ga0207652_101630063 164
84 3300025942 Ga0207689_10054944 Ga0207689_100549443 164
85 3300025949 Ga0207667_11011183 Ga0207667_110111831 164
86 3300025961 Ga0207712_10750324 Ga0207712_107503241 164
87 3300026041 Ga0207639_11150404 Ga0207639_111504041 164
88 3300026067 Ga0207678_10008508 Ga0207678_100085088 164
89 3300028380 Ga0268265_10061099 Ga0268265_100610993 164
90 3300028794 Ga0307515_10137546 Ga0307515_101375462 164
91 3300031247 Ga0265340_10085252 Ga0265340_100852522 164
92 3300031249 Ga0265339_10048152 Ga0265339_100481522 164
93 3300031250 Ga0265331_10012649 Ga0265331_100126494 164
94 3300031344 Ga0265316_10218705 Ga0265316_102187053 164
95 3300031711 Ga0265314_10049337 Ga0265314_100493373 164
96 3300031712 Ga0265342_10007969 Ga0265342_100079699 164
97 3300031712 Ga0265342_10026156 Ga0265342_100261563 164
98 3300031911 Ga0307412_10027981 Ga0307412_100279813 164
99 3300033180 Ga0307510_10097348 Ga0307510_100973483 164
100 3300035086 Ga0373934_0078402 Ga0373934_0078402_466_960 164
101 3300035111 Ga0373923_0002456 Ga0373923_0002456_1616_2110 164
102 3300035113 Ga0373936_0098217 Ga0373936_0098217_491_985 164
103 3300035114 Ga0373939_0118602 Ga0373939_0118602_357_851 164
104 3300035117 Ga0373953_0015403 Ga0373953_0015403_102_596 164
105 3300035118 Ga0373954_0006064 Ga0373954_0006064_2246_2740 164
106 3300035120 Ga0373957_0001140 Ga0373957_0001140_436_930 164
107 3300035120 Ga0373957_0226591 Ga0373957_0226591_61_564 164
108 3300035171 Ga0373946_0135029 Ga0373946_0135029_359_853 164
109 3300035172 Ga0373955_0018188 Ga0373955_0018188_2533_3027 164
110 3300035410 Ga0373924_0003746 Ga0373924_0003746_2164_2658 164
111 3300035692 Ga0373935_0104255 Ga0373935_0104255_413_907 164
112 3300035724 Ga0373933_0068376 Ga0373933_0068376_685_1179 164
113 3300036401 Ga0373937_0236799 Ga0373937_0236799_1203_1706 164
114 3300038443 Ga0395901_0528410 Ga0395901_0528410_20_517 164
115 3300039438 Ga0436360_0859761 Ga0436360_0859761_88_585 164
116 3300044656 Ga0466969_0056131 Ga0466969_0056131_825_1328 164
117 3300045049 Ga0466959_0092328 Ga0466959_0092328_593_1096 164
118 3300046454 Ga0495592_0044642 Ga0495592_0044642_1846_2340 164
119 3300046455 Ga0495603_0008445 Ga0495603_0008445_2993_3490 164
120 3300046459 Ga0495629_0068873 Ga0495629_0068873_888_1382 164
121 3300046460 Ga0495638_0046132 Ga0495638_0046132_2201_2695 164
122 3300046462 Ga0495651_0021120 Ga0495651_0021120_2641_3135 164
123 3300046473 Ga0495582_0345079 Ga0495582_0345079_287_781 164
124 3300046476 Ga0495662_0047542 Ga0495662_0047542_1204_1698 164
125 3300046477 Ga0495664_0029125 Ga0495664_0029125_1075_1569 164
126 3300046500 Ga0495596_0075852 Ga0495596_0075852_33_527 164
127 3300046506 Ga0495583_0130589 Ga0495583_0130589_285_779 164
128 3300046512 Ga0495610_0121130 Ga0495610_0121130_384_878 164
129 3300046513 Ga0495616_0045646 Ga0495616_0045646_1286_1780 164
130 3300046514 Ga0495618_0029523 Ga0495618_0029523_1385_1879 164
131 3300046516 Ga0495628_0032224 Ga0495628_0032224_2455_2949 164
132 3300046518 Ga0495631_0097076 Ga0495631_0097076_134_628 164
133 3300046522 Ga0495643_0018786 Ga0495643_0018786_3017_3511 164
134 3300046529 Ga0495652_0056662 Ga0495652_0056662_1270_1764 164
135 3300046530 Ga0495654_0062998 Ga0495654_0062998_793_1287 164
136 3300046533 Ga0495640_0011568 Ga0495640_0011568_1938_2432 164
137 3300046538 Ga0495609_0065976 Ga0495609_0065976_957_1451 164
138 3300046543 Ga0495645_0072915 Ga0495645_0072915_82_576 164
139 3300046559 Ga0495667_0038370 Ga0495667_0038370_1086_1580 164
140 3300046660 Ga0495625_0124818 Ga0495625_0124818_462_956 164
141 3300046663 Ga0495635_0032609 Ga0495635_0032609_1384_1878 164
142 3300046665 Ga0495661_0074186 Ga0495661_0074186_705_1199 164
143 3300046675 Ga0495657_0028680 Ga0495657_0028680_1650_2144 164
144 3300046678 Ga0495599_0028351 Ga0495599_0028351_1664_2158 164
145 3300046679 Ga0495623_0020395 Ga0495623_0020395_943_1437 164
146 3300046680 Ga0495646_0039700 Ga0495646_0039700_334_828 164
147 3300046794 Ga0495589_0105225 Ga0495589_0105225_619_1113 164
148 3300046809 Ga0495600_0078269 Ga0495600_0078269_814_1308 164
149 3300047317 Ga0495604_0013451 Ga0495604_0013451_4163_4657 164
150 3300047319 Ga0495674_0022918 Ga0495674_0022918_2386_2880 164
151 3300047322 Ga0495680_0008534 Ga0495680_0008534_5812_6306 164
152 3300047444 Ga0495675_0017447 Ga0495675_0017447_1282_1776 164
153 3300047447 Ga0495685_021155 Ga0495685_021155_219_719 164
154 3300047471 Ga0495684_0014274 Ga0495684_0014274_1628_2122 164
155 3300047472 Ga0495686_0012793 Ga0495686_0012793_4292_4822 164
156 3300047472 Ga0495686_0498469 Ga0495686_0498469_43_537 164
157 3300047673 Ga0495593_0068818 Ga0495593_0068818_1025_1519 164
158 3300048088 Ga0495602_0045053 Ga0495602_0045053_1745_2239 164
159 3300048088 Ga0495602_0272624 Ga0495602_0272624_123_626 164
160 3300048090 Ga0495615_0060674 Ga0495615_0060674_469_978 164
161 3300048091 Ga0495626_0060081 Ga0495626_0060081_918_1412 164
162 3300048905 Ga0496102_0253625 Ga0496102_0253625_299_793 164
163 3300048907 Ga0496104_1257594 Ga0496104_1257594_74_586 164
164 3300048909 Ga0496106_1383308 Ga0496106_1383308_38_532 164
165 3300048911 Ga0496108_1285607 Ga0496108_1285607_24_536 164
166 3300048915 Ga0496112_0004529 Ga0496112_0004529_1315_1827 164
167 3300048915 Ga0496112_0084168 Ga0496112_0084168_2514_3008 164
168 3300048916 Ga0496113_0419898 Ga0496113_0419898_132_659 164
169 3300048918 Ga0496115_0047980 Ga0496115_0047980_761_1264 164
170 3300048919 Ga0496116_0001672 Ga0496116_0001672_13719_14213 164
171 3300048919 Ga0496116_0235183 Ga0496116_0235183_261_755 164
172 3300048920 Ga0496117_0040333 Ga0496117_0040333_1808_2302 164
173 3300048920 Ga0496117_0225219 Ga0496117_0225219_440_934 164
174 3300048921 Ga0496118_0050095 Ga0496118_0050095_1116_1610 164
175 3300048922 Ga0496119_0178993 Ga0496119_0178993_577_1071 164
176 3300048923 Ga0496120_0149386 Ga0496120_0149386_312_806 164
177 3300048923 Ga0496120_0158380 Ga0496120_0158380_386_880 164
178 3300048924 Ga0496121_0013765 Ga0496121_0013765_4569_5063 164
179 3300048924 Ga0496121_0042659 Ga0496121_0042659_2701_3195 164
180 3300048925 Ga0496122_0016548 Ga0496122_0016548_3005_3499 164
181 3300048925 Ga0496122_0129185 Ga0496122_0129185_542_1036 164
182 3300048926 Ga0496123_0010686 Ga0496123_0010686_3356_3850 164
183 3300048927 Ga0496124_0075956 Ga0496124_0075956_1121_1615 164
184 3300048928 Ga0496125_0000207 Ga0496125_0000207_36902_37396 164
185 3300048928 Ga0496125_0012675 Ga0496125_0012675_1357_1851 164
186 3300048928 Ga0496125_0013674 Ga0496125_0013674_1732_2226 164
187 3300048929 Ga0496126_0062920 Ga0496126_0062920_172_675 164
188 3300048929 Ga0496126_0145205 Ga0496126_0145205_44_538 164
189 3300048929 Ga0496126_0163328 Ga0496126_0163328_288_788 164
190 3300048929 Ga0496126_0203863 Ga0496126_0203863_266_769 164
191 3300048929 Ga0496126_0567270 Ga0496126_0567270_44_538 164
192 3300049568 Ga0501031_0265138 Ga0501031_0265138_134_631 164
193 3300049569 Ga0501032_0042579 Ga0501032_0042579_185_682 164
194 3300049569 Ga0501032_0494254 Ga0501032_0494254_205_702 164
195 3300049570 Ga0501033_0078391 Ga0501033_0078391_1336_1833 164
196 3300049570 Ga0501033_0396207 Ga0501033_0396207_103_600 164
197 3300049571 Ga0501034_0231621 Ga0501034_0231621_1203_1700 164
198 3300049572 Ga0501036_0270262 Ga0501036_0270262_463_960 164
199 3300049574 Ga0501038_0111039 Ga0501038_0111039_1573_2070 164
200 3300049574 Ga0501038_0171120 Ga0501038_0171120_423_920 164
201 3300049575 Ga0501039_0321447 Ga0501039_0321447_356_853 164
202 3300049580 Ga0501046_0122826 Ga0501046_0122826_732_1229 164
203 3300049581 Ga0501047_0236061 Ga0501047_0236061_574_1071 164
204 3300049583 Ga0501067_0193270 Ga0501067_0193270_574_1071 164
205 3300049586 Ga0501070_0203155 Ga0501070_0203155_304_801 164
206 3300049586 Ga0501070_0446170 Ga0501070_0446170_377_874 164
207 3300049588 Ga0501072_0001175 Ga0501072_0001175_1814_2317 164
208 3300049590 Ga0501074_0196720 Ga0501074_0196720_79_576 164
209 3300049822 Ga0501035_0091906 Ga0501035_0091906_1963_2460 164
210 3300049822 Ga0501035_0452299 Ga0501035_0452299_144_641 164
211 3300049822 Ga0501035_0770734 Ga0501035_0770734_185_682 164
212 3300049823 Ga0501044_0312536 Ga0501044_0312536_126_623 164
213 3300050491 nmdc:mga00v17_2666_c1 nmdc:mga00v17_2666_c1_5971_6465 164
214 3300050492 nmdc:mga0yw44_174945_c1 nmdc:mga0yw44_174945_c1_444_938 164
215 3300050492 nmdc:mga0yw44_57766_c1 nmdc:mga0yw44_57766_c1_1055_1549 164
216 3300050496 nmdc:mga07m45_83022_c1 nmdc:mga07m45_83022_c1_1148_1642 164
217 3300050516 nmdc:mga0sz30_1770_c1 nmdc:mga0sz30_1770_c1_6783_7277 164
218 3300053078 Ga0495612_0008112 Ga0495612_0008112_2033_2527 164
219 3300053080 Ga0500635_0019445 Ga0500635_0019445_922_1419 164
220 3300053085 Ga0495619_0076187 Ga0495619_0076187_944_1438 164
221 3300053087 Ga0500643_011603 Ga0500643_011603_2653_3147 164
222 3300053088 Ga0500644_0017901 Ga0500644_0017901_860_1354 164
223 3300053089 Ga0500581_079515 Ga0500581_079515_644_1138 164
224 3300053090 Ga0500646_0033732 Ga0500646_0033732_751_1245 164
225 3300053096 Ga0500641_0018452 Ga0500641_0018452_1468_1962 164
226 3300053102 Ga0500554_004441 Ga0500554_004441_2092_2589 164
227 3300053104 Ga0500556_0000006 Ga0500556_0000006_258326_258820 164
228 3300053108 Ga0500562_005909 Ga0500562_005909_225_719 164
229 3300053108 Ga0500562_055931 Ga0500562_055931_499_993 164
230 3300053109 Ga0500569_001412 Ga0500569_001412_2563_3057 164
231 3300053112 Ga0500575_172801 Ga0500575_172801_61_558 164
232 3300053116 Ga0500592_000600 Ga0500592_000600_4558_5052 164
233 3300053121 Ga0500607_113450 Ga0500607_113450_121_615 164
234 3300053130 Ga0500642_0000004 Ga0500642_0000004_224441_224935 164
235 3300053131 Ga0500652_000160 Ga0500652_000160_9655_10149 164
236 3300053134 Ga0500658_0085972 Ga0500658_0085972_571_1065 164
237 3300053134 Ga0500658_0090933 Ga0500658_0090933_44_538 164
238 3300053139 Ga0500568_0007069 Ga0500568_0007069_282_776 164
239 3300053142 Ga0500577_0032763 Ga0500577_0032763_478_972 164
240 3300053145 Ga0500586_000112 Ga0500586_000112_13173_13667 164
241 3300053146 Ga0500588_0124971 Ga0500588_0124971_47_541 164
242 3300053150 Ga0500603_001369 Ga0500603_001369_2239_2736 164
243 3300053153 Ga0500616_0000022 Ga0500616_0000022_256507_257001 164
244 3300053156 Ga0500622_0003300 Ga0500622_0003300_6711_7205 164
245 3300053161 Ga0500634_0124148 Ga0500634_0124148_491_985 164
246 3300053178 Ga0500637_0003374 Ga0500637_0003374_2533_3030 164
247 3300053730 Ga0500645_026788 Ga0500645_026788_555_1049 164
248 3300003203 JGI25406J46586_10000364 JGI25406J46586_1000036413 165
249 3300003659 JGI25404J52841_10055956 JGI25404J52841_100559561 165
250 3300005327 Ga0070658_10009941 Ga0070658_100099416 165
251 3300005327 Ga0070658_10579390 Ga0070658_105793901 165
252 3300005328 Ga0070676_10060232 Ga0070676_100602322 165
253 3300005329 Ga0070683_100066945 Ga0070683_1000669453 165
254 3300005329 Ga0070683_100100543 Ga0070683_1001005432 165
255 3300005331 Ga0070670_100101013 Ga0070670_1001010133 165
256 3300005333 Ga0070677_10574785 Ga0070677_105747851 165
257 3300005334 Ga0068869_100013066 Ga0068869_1000130664 165
258 3300005336 Ga0070680_100028929 Ga0070680_1000289296 165
259 3300005336 Ga0070680_100213916 Ga0070680_1002139162 165
260 3300005337 Ga0070682_100108314 Ga0070682_1001083142 165
261 3300005338 Ga0068868_100040431 Ga0068868_1000404313 165
262 3300005338 Ga0068868_100071424 Ga0068868_1000714243 165
263 3300005339 Ga0070660_100402071 Ga0070660_1004020711 165
264 3300005341 Ga0070691_10244466 Ga0070691_102444662 165
265 3300005344 Ga0070661_100011760 Ga0070661_1000117603 165
266 3300005344 Ga0070661_100177218 Ga0070661_1001772182 165
267 3300005347 Ga0070668_100046179 Ga0070668_1000461792 165
268 3300005347 Ga0070668_101214077 Ga0070668_1012140771 165
269 3300005354 Ga0070675_100382549 Ga0070675_1003825492 165
270 3300005356 Ga0070674_101176733 Ga0070674_1011767332 165
271 3300005364 Ga0070673_100601818 Ga0070673_1006018182 165
272 3300005366 Ga0070659_100036969 Ga0070659_1000369694 165
273 3300005434 Ga0070709_10011427 Ga0070709_100114272 165
274 3300005436 Ga0070713_100056704 Ga0070713_1000567043 165
275 3300005439 Ga0070711_100019491 Ga0070711_1000194912 165
276 3300005441 Ga0070700_100169054 Ga0070700_1001690543 165
277 3300005455 Ga0070663_100090637 Ga0070663_1000906372 165
278 3300005455 Ga0070663_100132285 Ga0070663_1001322853 165
279 3300005455 Ga0070663_100254678 Ga0070663_1002546782 165
280 3300005455 Ga0070663_100298120 Ga0070663_1002981202 165
281 3300005455 Ga0070663_100433266 Ga0070663_1004332662 165
282 3300005456 Ga0070678_100011899 Ga0070678_1000118992 165
283 3300005458 Ga0070681_10062073 Ga0070681_100620734 165
284 3300005466 Ga0070685_10345417 Ga0070685_103454172 165
285 3300005530 Ga0070679_100520827 Ga0070679_1005208272 165
286 3300005530 Ga0070679_100577136 Ga0070679_1005771362 165
287 3300005535 Ga0070684_100000950 Ga0070684_10000095017 165
288 3300005535 Ga0070684_100038404 Ga0070684_1000384042 165
289 3300005535 Ga0070684_100289754 Ga0070684_1002897542 165
290 3300005536 Ga0070697_100773699 Ga0070697_1007736992 165
291 3300005539 Ga0068853_100007151 Ga0068853_1000071517 165
292 3300005539 Ga0068853_100110950 Ga0068853_1001109502 165
293 3300005539 Ga0068853_100137951 Ga0068853_1001379513 165
294 3300005539 Ga0068853_100779797 Ga0068853_1007797972 165
295 3300005543 Ga0070672_100130481 Ga0070672_1001304812 165
296 3300005544 Ga0070686_100091644 Ga0070686_1000916443 165
297 3300005547 Ga0070693_100067784 Ga0070693_1000677843 165
298 3300005547 Ga0070693_100125039 Ga0070693_1001250392 165
299 3300005548 Ga0070665_100050356 Ga0070665_1000503564 165
300 3300005548 Ga0070665_100067075 Ga0070665_1000670753 165
301 3300005563 Ga0068855_100106438 Ga0068855_1001064383 165
302 3300005563 Ga0068855_100692404 Ga0068855_1006924042 165
303 3300005564 Ga0070664_100028305 Ga0070664_1000283055 165
304 3300005564 Ga0070664_100098691 Ga0070664_1000986913 165
305 3300005577 Ga0068857_100128105 Ga0068857_1001281053 165
306 3300005578 Ga0068854_100682541 Ga0068854_1006825411 165
307 3300005578 Ga0068854_101114932 Ga0068854_1011149322 165
308 3300005614 Ga0068856_100053445 Ga0068856_1000534453 165
309 3300005615 Ga0070702_100058977 Ga0070702_1000589773 165
310 3300005616 Ga0068852_100081048 Ga0068852_1000810482 165
311 3300005616 Ga0068852_100287592 Ga0068852_1002875922 165
312 3300005617 Ga0068859_100182698 Ga0068859_1001826983 165
313 3300005617 Ga0068859_100249204 Ga0068859_1002492042 165
314 3300005618 Ga0068864_100024535 Ga0068864_1000245353 165
315 3300005618 Ga0068864_100618363 Ga0068864_1006183632 165
316 3300005618 Ga0068864_100658846 Ga0068864_1006588462 165
317 3300005719 Ga0068861_100385428 Ga0068861_1003854281 165
318 3300005719 Ga0068861_100456186 Ga0068861_1004561862 165
319 3300005841 Ga0068863_100108690 Ga0068863_1001086903 165
320 3300005842 Ga0068858_100095727 Ga0068858_1000957273 165
321 3300005843 Ga0068860_100058722 Ga0068860_1000587223 165
322 3300005843 Ga0068860_100152141 Ga0068860_1001521412 165
323 3300005843 Ga0068860_101738495 Ga0068860_1017384951 165
324 3300005844 Ga0068862_100151650 Ga0068862_1001516502 165
325 3300005937 Ga0081455_10010497 Ga0081455_100104972 165
326 3300005983 Ga0081540_1000191 Ga0081540_10001913 165
327 3300005983 Ga0081540_1003921 Ga0081540_10039216 165
328 3300005983 Ga0081540_1017710 Ga0081540_10177103 165
329 3300005983 Ga0081540_1070729 Ga0081540_10707292 165
330 3300005985 Ga0081539_10000048 Ga0081539_10000048217 165
331 3300006028 Ga0070717_10338637 Ga0070717_103386371 165
332 3300006042 Ga0075368_10020138 Ga0075368_100201383 165
333 3300006048 Ga0075363_100046611 Ga0075363_1000466113 165
334 3300006051 Ga0075364_10022257 Ga0075364_100222573 165
335 3300006051 Ga0075364_10266019 Ga0075364_102660192 165
336 3300006058 Ga0075432_10013182 Ga0075432_100131823 165
337 3300006178 Ga0075367_10034512 Ga0075367_100345123 165
338 3300006186 Ga0075369_10072463 Ga0075369_100724633 165
339 3300006195 Ga0075366_10309841 Ga0075366_103098412 165
340 3300006358 Ga0068871_100044698 Ga0068871_1000446983 165
341 3300006358 Ga0068871_100053846 Ga0068871_1000538462 165
342 3300006871 Ga0075434_100147299 Ga0075434_1001472993 165
343 3300006871 Ga0075434_100282056 Ga0075434_1002820562 165
344 3300006931 Ga0097620_100182694 Ga0097620_1001826943 165
345 3300006931 Ga0097620_100249207 Ga0097620_1002492072 165
346 3300007076 Ga0075435_100139336 Ga0075435_1001393363 165
347 3300009036 Ga0105244_10428597 Ga0105244_104285971 165
348 3300009093 Ga0105240_10039683 Ga0105240_100396835 165
349 3300009094 Ga0111539_10059723 Ga0111539_100597234 165
350 3300009098 Ga0105245_10033417 Ga0105245_100334174 165
351 3300009098 Ga0105245_10128432 Ga0105245_101284321 165
352 3300009098 Ga0105245_10342331 Ga0105245_103423313 165
353 3300009101 Ga0105247_10068652 Ga0105247_100686522 165
354 3300009101 Ga0105247_10310357 Ga0105247_103103571 165
355 3300009101 Ga0105247_10561726 Ga0105247_105617262 165
356 3300009174 Ga0105241_10037198 Ga0105241_100371983 165
357 3300009176 Ga0105242_10125235 Ga0105242_101252352 165
358 3300009176 Ga0105242_11594257 Ga0105242_115942571 165
359 3300009545 Ga0105237_10019216 Ga0105237_100192167 165
360 3300009545 Ga0105237_10044051 Ga0105237_100440512 165
361 3300009551 Ga0105238_10020486 Ga0105238_100204864 165
362 3300010375 Ga0105239_10052959 Ga0105239_100529595 165
363 3300010375 Ga0105239_10082887 Ga0105239_100828874 165
364 3300010375 Ga0105239_10126168 Ga0105239_101261682 165
365 3300010375 Ga0105239_10128415 Ga0105239_101284153 165
366 3300011119 Ga0105246_10077783 Ga0105246_100777833 165
367 3300011119 Ga0105246_10458278 Ga0105246_104582783 165
368 3300011119 Ga0105246_10932987 Ga0105246_109329871 165
369 3300013102 Ga0157371_10028952 Ga0157371_100289523 165
370 3300013105 Ga0157369_10044218 Ga0157369_100442183 165
371 3300013105 Ga0157369_10945911 Ga0157369_109459111 165
372 3300013296 Ga0157374_10844124 Ga0157374_108441242 165
373 3300013296 Ga0157374_11013257 Ga0157374_110132571 165
374 3300013297 Ga0157378_10019963 Ga0157378_100199634 165
375 3300013297 Ga0157378_10171908 Ga0157378_101719082 165
376 3300013306 Ga0163162_10690270 Ga0163162_106902702 165
377 3300013307 Ga0157372_10200919 Ga0157372_102009192 165
378 3300013308 Ga0157375_10313632 Ga0157375_103136323 165
379 3300014325 Ga0163163_10517113 Ga0163163_105171132 165
380 3300014326 Ga0157380_10271255 Ga0157380_102712552 165
381 3300014968 Ga0157379_10496075 Ga0157379_104960751 165
382 3300014969 Ga0157376_10094852 Ga0157376_100948522 165
383 3300014969 Ga0157376_10939329 Ga0157376_109393291 165
384 3300017792 Ga0163161_11544872 Ga0163161_115448721 165
385 3300021358 Ga0213873_10013788 Ga0213873_100137883 165
386 3300021361 Ga0213872_10204540 Ga0213872_102045402 165
387 3300021377 Ga0213874_10001916 Ga0213874_100019164 165
388 3300021377 Ga0213874_10143035 Ga0213874_101430352 165
389 3300021384 Ga0213876_10003463 Ga0213876_100034634 165
390 3300025295 Ga0209564_1001079 Ga0209564_100107921 165
391 3300025321 Ga0207656_10024798 Ga0207656_100247982 165
392 3300025711 Ga0207696_1019485 Ga0207696_10194852 165
393 3300025899 Ga0207642_10069573 Ga0207642_100695731 165
394 3300025900 Ga0207710_10023365 Ga0207710_100233652 165
395 3300025901 Ga0207688_10036584 Ga0207688_100365843 165
396 3300025906 Ga0207699_10088646 Ga0207699_100886462 165
397 3300025912 Ga0207707_10004329 Ga0207707_100043296 165
398 3300025912 Ga0207707_10025404 Ga0207707_100254044 165
399 3300025912 Ga0207707_10031430 Ga0207707_100314304 165
400 3300025913 Ga0207695_10010844 Ga0207695_100108449 165
401 3300025913 Ga0207695_10205887 Ga0207695_102058871 165
402 3300025914 Ga0207671_10028767 Ga0207671_100287673 165
403 3300025914 Ga0207671_10211982 Ga0207671_102119822 165
404 3300025914 Ga0207671_10404952 Ga0207671_104049521 165
405 3300025915 Ga0207693_10060098 Ga0207693_100600982 165
406 3300025916 Ga0207663_10028537 Ga0207663_100285374 165
407 3300025917 Ga0207660_10001470 Ga0207660_100014709 165
408 3300025917 Ga0207660_10185729 Ga0207660_101857292 165
409 3300025918 Ga0207662_10198699 Ga0207662_101986992 165
410 3300025919 Ga0207657_10119742 Ga0207657_101197421 165
411 3300025920 Ga0207649_10085619 Ga0207649_100856193 165
412 3300025921 Ga0207652_10007361 Ga0207652_100073615 165
413 3300025921 Ga0207652_10046543 Ga0207652_100465434 165
414 3300025924 Ga0207694_10046065 Ga0207694_100460653 165
415 3300025924 Ga0207694_10055078 Ga0207694_100550782 165
416 3300025927 Ga0207687_10012071 Ga0207687_100120712 165
417 3300025927 Ga0207687_10601211 Ga0207687_106012112 165
418 3300025928 Ga0207700_10049272 Ga0207700_100492724 165
419 3300025931 Ga0207644_10337051 Ga0207644_103370512 165
420 3300025932 Ga0207690_10023344 Ga0207690_100233443 165
421 3300025932 Ga0207690_10535097 Ga0207690_105350972 165
422 3300025935 Ga0207709_10315181 Ga0207709_103151812 165
423 3300025937 Ga0207669_10936564 Ga0207669_109365641 165
424 3300025941 Ga0207711_10030008 Ga0207711_100300085 165
425 3300025941 Ga0207711_10408596 Ga0207711_104085962 165
426 3300025941 Ga0207711_10421302 Ga0207711_104213021 165
427 3300025942 Ga0207689_10054996 Ga0207689_100549962 165
428 3300025942 Ga0207689_10310825 Ga0207689_103108253 165
429 3300025944 Ga0207661_10015572 Ga0207661_100155723 165
430 3300025944 Ga0207661_10133258 Ga0207661_101332583 165
431 3300025945 Ga0207679_11018658 Ga0207679_110186581 165
432 3300025949 Ga0207667_10001909 Ga0207667_1000190923 165
433 3300025949 Ga0207667_10948055 Ga0207667_109480552 165
434 3300025960 Ga0207651_10602871 Ga0207651_106028712 165
435 3300025961 Ga0207712_10308204 Ga0207712_103082042 165
436 3300025972 Ga0207668_10038150 Ga0207668_100381503 165
437 3300025972 Ga0207668_10195017 Ga0207668_101950172 165
438 3300025972 Ga0207668_10946307 Ga0207668_109463071 165
439 3300026023 Ga0207677_10044189 Ga0207677_100441893 165
440 3300026023 Ga0207677_10057193 Ga0207677_100571932 165
441 3300026023 Ga0207677_11018871 Ga0207677_110188711 165
442 3300026035 Ga0207703_10164191 Ga0207703_101641912 165
443 3300026035 Ga0207703_10749745 Ga0207703_107497452 165
444 3300026041 Ga0207639_10002676 Ga0207639_1000267612 165
445 3300026041 Ga0207639_10304515 Ga0207639_103045152 165
446 3300026041 Ga0207639_10978510 Ga0207639_109785102 165
447 3300026067 Ga0207678_10041532 Ga0207678_100415322 165
448 3300026078 Ga0207702_10244823 Ga0207702_102448232 165
449 3300026089 Ga0207648_10740127 Ga0207648_107401271 165
450 3300026095 Ga0207676_10038875 Ga0207676_100388753 165
451 3300026095 Ga0207676_10177444 Ga0207676_101774443 165
452 3300026116 Ga0207674_10074915 Ga0207674_100749153 165
453 3300026116 Ga0207674_10150152 Ga0207674_101501523 165
454 3300026118 Ga0207675_100506365 Ga0207675_1005063652 165
455 3300026121 Ga0207683_10032853 Ga0207683_100328533 165
456 3300026121 Ga0207683_10070748 Ga0207683_100707483 165
457 3300026121 Ga0207683_10205373 Ga0207683_102053732 165
458 3300026142 Ga0207698_10062239 Ga0207698_100622392 165
459 3300026142 Ga0207698_10289035 Ga0207698_102890352 165
460 3300027671 Ga0209588_1002870 Ga0209588_10028704 165
461 3300028379 Ga0268266_10062908 Ga0268266_100629083 165
462 3300028379 Ga0268266_10115856 Ga0268266_101158561 165
463 3300028379 Ga0268266_10269427 Ga0268266_102694272 165
464 3300028381 Ga0268264_10078139 Ga0268264_100781393 165
465 3300028381 Ga0268264_10308314 Ga0268264_103083142 165
466 3300031456 Ga0307513_10154517 Ga0307513_101545172 165
467 3300031548 Ga0307408_100413760 Ga0307408_1004137601 165
468 3300031616 Ga0307508_10169246 Ga0307508_101692463 165
469 3300031901 Ga0307406_10522409 Ga0307406_105224092 165
470 3300031911 Ga0307412_10381740 Ga0307412_103817402 165
471 3300031995 Ga0307409_101098149 Ga0307409_1010981492 165
472 3300032002 Ga0307416_100325612 Ga0307416_1003256122 165
473 3300032002 Ga0307416_100492732 Ga0307416_1004927322 165
474 3300032002 Ga0307416_101335066 Ga0307416_1013350661 165
475 3300032005 Ga0307411_10360605 Ga0307411_103606052 165
476 3300034816 Ga0373930_0008048 Ga0373930_0008048_921_1427 165
477 3300034819 Ga0373958_0109169 Ga0373958_0109169_111_608 165
478 3300035085 Ga0373929_0051418 Ga0373929_0051418_56_553 165
479 3300035089 Ga0373944_0173504 Ga0373944_0173504_148_645 165
480 3300035112 Ga0373932_0025204 Ga0373932_0025204_782_1288 165
481 3300035115 Ga0373941_0242371 Ga0373941_0242371_39_569 165
482 3300035207 Ga0373942_0140426 Ga0373942_0140426_168_698 165
483 3300035695 Ga0373927_0312382 Ga0373927_0312382_450_947 165
484 3300035695 Ga0373927_0343719 Ga0373927_0343719_71_568 165
485 3300037418 Ga0395900_0169303 Ga0395900_0169303_147_665 165
486 3300037418 Ga0395900_0190863 Ga0395900_0190863_383_880 165
487 3300037466 Ga0395898_0389877 Ga0395898_0389877_123_620 165
488 3300037471 Ga0395905_0587127 Ga0395905_0587127_393_893 165
489 3300038443 Ga0395901_0258192 Ga0395901_0258192_394_912 165
490 3300039437 Ga0436365_0364359 Ga0436365_0364359_240_740 165
491 3300039438 Ga0436360_0339772 Ga0436360_0339772_1543_2040 165
492 3300039438 Ga0436360_1157986 Ga0436360_1157986_76_582 165
493 3300039450 Ga0436363_0784614 Ga0436363_0784614_445_942 165
494 3300039450 Ga0436363_1136180 Ga0436363_1136180_600_1100 165
495 3300039450 Ga0436363_1514540 Ga0436363_1514540_43_543 165
496 3300039453 Ga0436362_1002335 Ga0436362_1002335_3482_3982 165
497 3300041453 Ga0451797_0420178 Ga0451797_0420178_669_1166 165
498 3300041503 Ga0451847_0677595 Ga0451847_0677595_79_603 165
499 3300044684 Ga0466966_0352077 Ga0466966_0352077_174_677 165
500 3300044684 Ga0466966_0551757 Ga0466966_0551757_137_637 165
501 3300044694 Ga0466963_0373793 Ga0466963_0373793_85_603 165
502 3300044706 Ga0466964_0054111 Ga0466964_0054111_966_1466 165
503 3300044719 Ga0466971_0109001 Ga0466971_0109001_71_574 165
504 3300045976 Ga0466967_0133246 Ga0466967_0133246_720_1238 165
505 3300045976 Ga0466967_0708093 Ga0466967_0708093_274_774 165
506 3300046454 Ga0495592_0334013 Ga0495592_0334013_62_559 165
507 3300046455 Ga0495603_0057866 Ga0495603_0057866_513_1019 165
508 3300046455 Ga0495603_0064921 Ga0495603_0064921_1581_2078 165
509 3300046459 Ga0495629_0049476 Ga0495629_0049476_160_660 165
510 3300046459 Ga0495629_0314289 Ga0495629_0314289_79_576 165
511 3300046461 Ga0495641_0035619 Ga0495641_0035619_56_553 165
512 3300046462 Ga0495651_0425836 Ga0495651_0425836_251_748 165
513 3300046462 Ga0495651_0510912 Ga0495651_0510912_47_544 165
514 3300046475 Ga0495639_0022697 Ga0495639_0022697_148_645 165
515 3300046477 Ga0495664_0054710 Ga0495664_0054710_602_1123 165
516 3300046492 Ga0495585_0192538 Ga0495585_0192538_314_811 165
517 3300046499 Ga0495594_0006637 Ga0495594_0006637_4256_4753 165
518 3300046501 Ga0495607_0252083 Ga0495607_0252083_81_578 165
519 3300046506 Ga0495583_0219465 Ga0495583_0219465_181_678 165
520 3300046507 Ga0495606_0270629 Ga0495606_0270629_201_698 165
521 3300046507 Ga0495606_0401374 Ga0495606_0401374_126_623 165
522 3300046513 Ga0495616_0059586 Ga0495616_0059586_1234_1731 165
523 3300046515 Ga0495620_0013237 Ga0495620_0013237_3631_4128 165
524 3300046516 Ga0495628_0333812 Ga0495628_0333812_150_671 165
525 3300046518 Ga0495631_0098219 Ga0495631_0098219_59_556 165
526 3300046519 Ga0495632_0035025 Ga0495632_0035025_1105_1602 165
527 3300046520 Ga0495637_0081247 Ga0495637_0081247_179_676 165
528 3300046525 Ga0495663_0207400 Ga0495663_0207400_147_644 165
529 3300046529 Ga0495652_0097330 Ga0495652_0097330_45_542 165
530 3300046531 Ga0495665_0495924 Ga0495665_0495924_11_508 165
531 3300046533 Ga0495640_0209295 Ga0495640_0209295_344_844 165
532 3300046537 Ga0495598_0013615 Ga0495598_0013615_1165_1662 165
533 3300046538 Ga0495609_0148817 Ga0495609_0148817_35_532 165
534 3300046539 Ga0495621_0051417 Ga0495621_0051417_717_1214 165
535 3300046557 Ga0495622_0181910 Ga0495622_0181910_265_762 165
536 3300046558 Ga0495633_0107148 Ga0495633_0107148_632_1129 165
537 3300046615 Ga0495656_0043366 Ga0495656_0043366_295_792 165
538 3300046615 Ga0495656_0103260 Ga0495656_0103260_272_769 165
539 3300046615 Ga0495656_0235570 Ga0495656_0235570_356_853 165
540 3300046616 Ga0495668_0183741 Ga0495668_0183741_40_546 165
541 3300046648 Ga0495611_0174808 Ga0495611_0174808_311_808 165
542 3300046648 Ga0495611_0237727 Ga0495611_0237727_315_812 165
543 3300046663 Ga0495635_0093692 Ga0495635_0093692_659_1156 165
544 3300046674 Ga0495588_0005736 Ga0495588_0005736_3143_3640 165
545 3300046678 Ga0495599_0007907 Ga0495599_0007907_456_956 165
546 3300046679 Ga0495623_0666656 Ga0495623_0666656_18_515 165
547 3300046684 Ga0495669_0028232 Ga0495669_0028232_1151_1648 165
548 3300046691 Ga0495670_0063775 Ga0495670_0063775_442_939 165
549 3300046694 Ga0495649_0434866 Ga0495649_0434866_35_532 165
550 3300047315 Ga0495581_0162600 Ga0495581_0162600_756_1253 165
551 3300047317 Ga0495604_0404292 Ga0495604_0404292_247_747 165
552 3300047320 Ga0495672_0033255 Ga0495672_0033255_150_650 165
553 3300047323 Ga0495683_0289019 Ga0495683_0289019_53_550 165
554 3300047445 Ga0495677_0135314 Ga0495677_0135314_61_558 165
555 3300047469 Ga0495673_0115066 Ga0495673_0115066_335_844 165
556 3300047469 Ga0495673_0181708 Ga0495673_0181708_237_746 165
557 3300047470 Ga0495681_0090192 Ga0495681_0090192_529_1026 165
558 3300048088 Ga0495602_0515858 Ga0495602_0515858_12_509 165
559 3300048903 Ga0496100_0003200 Ga0496100_0003200_3214_3711 165
560 3300048903 Ga0496100_0108403 Ga0496100_0108403_693_1199 165
561 3300048904 Ga0496101_0021912 Ga0496101_0021912_2927_3424 165
562 3300048904 Ga0496101_0315228 Ga0496101_0315228_137_634 165
563 3300048905 Ga0496102_0025407 Ga0496102_0025407_3102_3599 165
564 3300048905 Ga0496102_0098842 Ga0496102_0098842_312_809 165
565 3300048905 Ga0496102_0265482 Ga0496102_0265482_107_637 165
566 3300048905 Ga0496102_0596015 Ga0496102_0596015_288_806 165
567 3300048905 Ga0496102_1188152 Ga0496102_1188152_65_583 165
568 3300048906 Ga0496103_0031134 Ga0496103_0031134_520_1017 165
569 3300048906 Ga0496103_0193606 Ga0496103_0193606_445_975 165
570 3300048907 Ga0496104_0012106 Ga0496104_0012106_3506_4003 165
571 3300048908 Ga0496105_0081851 Ga0496105_0081851_903_1400 165
572 3300048908 Ga0496105_0136497 Ga0496105_0136497_1467_1964 165
573 3300048909 Ga0496106_0031809 Ga0496106_0031809_1425_1922 165
574 3300048909 Ga0496106_0886439 Ga0496106_0886439_54_551 165
575 3300048910 Ga0496107_0006358 Ga0496107_0006358_1167_1664 165
576 3300048910 Ga0496107_0050760 Ga0496107_0050760_318_815 165
577 3300048910 Ga0496107_0165818 Ga0496107_0165818_828_1325 165
578 3300048911 Ga0496108_0019419 Ga0496108_0019419_2128_2625 165
579 3300048911 Ga0496108_0166431 Ga0496108_0166431_450_947 165
580 3300048912 Ga0496109_0092517 Ga0496109_0092517_964_1461 165
581 3300048912 Ga0496109_0105058 Ga0496109_0105058_593_1090 165
582 3300048912 Ga0496109_0863893 Ga0496109_0863893_240_737 165
583 3300048912 Ga0496109_0967809 Ga0496109_0967809_18_515 165
584 3300048912 Ga0496109_1175280 Ga0496109_1175280_129_635 165
585 3300048913 Ga0496110_0112856 Ga0496110_0112856_1010_1507 165
586 3300048913 Ga0496110_0196580 Ga0496110_0196580_26_523 165
587 3300048913 Ga0496110_0293506 Ga0496110_0293506_761_1267 165
588 3300048913 Ga0496110_0293709 Ga0496110_0293709_642_1139 165
589 3300048913 Ga0496110_0486920 Ga0496110_0486920_543_1049 165
590 3300048914 Ga0496111_0197788 Ga0496111_0197788_892_1389 165
591 3300048914 Ga0496111_0211141 Ga0496111_0211141_16_549 165
592 3300048915 Ga0496112_0000018 Ga0496112_0000018_131194_131691 165
593 3300048915 Ga0496112_0074784 Ga0496112_0074784_1872_2369 165
594 3300048915 Ga0496112_0168495 Ga0496112_0168495_439_972 165
595 3300048915 Ga0496112_0174060 Ga0496112_0174060_352_849 165
596 3300048915 Ga0496112_0607322 Ga0496112_0607322_506_1012 165
597 3300048916 Ga0496113_0110348 Ga0496113_0110348_1509_2006 165
598 3300048917 Ga0496114_0037094 Ga0496114_0037094_2971_3468 165
599 3300048917 Ga0496114_0199892 Ga0496114_0199892_70_600 165
600 3300048918 Ga0496115_0000743 Ga0496115_0000743_7050_7547 165
601 3300048918 Ga0496115_0025011 Ga0496115_0025011_3444_3950 165
602 3300048920 Ga0496117_0451247 Ga0496117_0451247_51_548 165
603 3300048921 Ga0496118_0198075 Ga0496118_0198075_686_1183 165
604 3300048924 Ga0496121_0000278 Ga0496121_0000278_73038_73538 165
605 3300048924 Ga0496121_0023451 Ga0496121_0023451_3701_4198 165
606 3300048924 Ga0496121_0267658 Ga0496121_0267658_476_973 165
607 3300048924 Ga0496121_0306078 Ga0496121_0306078_117_623 165
608 3300048928 Ga0496125_0084547 Ga0496125_0084547_1860_2357 165
609 3300048928 Ga0496125_0180656 Ga0496125_0180656_746_1243 165
610 3300048929 Ga0496126_0010955 Ga0496126_0010955_3038_3535 165
611 3300048929 Ga0496126_0083916 Ga0496126_0083916_442_945 165
612 3300048929 Ga0496126_0120165 Ga0496126_0120165_775_1278 165
613 3300049574 Ga0501038_0540309 Ga0501038_0540309_35_535 165
614 3300049577 Ga0501041_0656203 Ga0501041_0656203_68_568 165
615 3300049583 Ga0501067_0071550 Ga0501067_0071550_1387_1884 165
616 3300049586 Ga0501070_0879100 Ga0501070_0879100_149_658 165
617 3300049586 Ga0501070_0887744 Ga0501070_0887744_139_636 165
618 3300049823 Ga0501044_0543391 Ga0501044_0543391_25_525 165
619 3300050490 nmdc:mga03n38_107709_c1 nmdc:mga03n38_107709_c1_17_514 165
620 3300050491 nmdc:mga00v17_39990_c1 nmdc:mga00v17_39990_c1_1296_1793 165
621 3300050492 nmdc:mga0yw44_91064_c1 nmdc:mga0yw44_91064_c1_699_1196 165
622 3300050493 nmdc:mga0k408_16783_c1 nmdc:mga0k408_16783_c1_458_955 165
623 3300050496 nmdc:mga07m45_339041_c1 nmdc:mga07m45_339041_c1_360_857 165
624 3300050511 nmdc:mga08y16_264528_c1 nmdc:mga08y16_264528_c1_900_1400 165
625 3300050513 nmdc:mga0rr50_160535_c1 nmdc:mga0rr50_160535_c1_212_709 165
626 3300050514 nmdc:mga08x19_111942_c1 nmdc:mga08x19_111942_c1_131_628 165
627 3300053084 Ga0495595_0003331 Ga0495595_0003331_2278_2775 165
628 3300053085 Ga0495619_0087435 Ga0495619_0087435_1343_1840 165
629 3300053090 Ga0500646_0075827 Ga0500646_0075827_11_508 165
630 3300053092 Ga0500583_0127484 Ga0500583_0127484_28_525 165
631 3300053104 Ga0500556_0059496 Ga0500556_0059496_839_1339 165
632 3300053119 Ga0500595_003189 Ga0500595_003189_4008_4505 165
633 3300053124 Ga0500617_156877 Ga0500617_156877_370_867 165
634 3300053139 Ga0500568_0002888 Ga0500568_0002888_7996_8496 165
635 3300053146 Ga0500588_0178200 Ga0500588_0178200_34_531 165
636 3300053148 Ga0500590_135322 Ga0500590_135322_90_587 165
637 3300053153 Ga0500616_0214824 Ga0500616_0214824_128_628 165
638 3300053161 Ga0500634_0292049 Ga0500634_0292049_17_514 165
639 3300053162 Ga0500638_305919 Ga0500638_305919_84_581 165
640 3300053178 Ga0500637_0198966 Ga0500637_0198966_382_879 165
641 3300053727 Ga0500611_005120 Ga0500611_005120_849_1355 165
642 iso_pu_bacteria 2508501128 2509152196 165
643 3300001979 JGI24740J21852_10000635 JGI24740J21852_1000063510 166
644 3300001989 JGI24739J22299_10002357 JGI24739J22299_100023575 166
645 3300001990 JGI24737J22298_10003086 JGI24737J22298_100030864 166
646 3300003203 JGI25406J46586_10005263 JGI25406J46586_100052636 166
647 3300005356 Ga0070674_100498464 Ga0070674_1004984642 166
648 3300005434 Ga0070709_10040833 Ga0070709_100408333 166
649 3300005434 Ga0070709_10285542 Ga0070709_102855422 166
650 3300005435 Ga0070714_100029045 Ga0070714_1000290454 166
651 3300005435 Ga0070714_100217983 Ga0070714_1002179833 166
652 3300005436 Ga0070713_100140678 Ga0070713_1001406783 166
653 3300005439 Ga0070711_100007751 Ga0070711_1000077513 166
654 3300005439 Ga0070711_100575956 Ga0070711_1005759562 166
655 3300005456 Ga0070678_100072529 Ga0070678_1000725291 166
656 3300005457 Ga0070662_100015653 Ga0070662_1000156534 166
657 3300005458 Ga0070681_10656376 Ga0070681_106563761 166
658 3300005536 Ga0070697_100030494 Ga0070697_1000304942 166
659 3300005539 Ga0068853_100039602 Ga0068853_1000396023 166
660 3300005539 Ga0068853_100046015 Ga0068853_1000460153 166
661 3300005539 Ga0068853_101241844 Ga0068853_1012418441 166
662 3300005563 Ga0068855_100067225 Ga0068855_1000672253 166
663 3300005563 Ga0068855_100106967 Ga0068855_1001069673 166
664 3300005563 Ga0068855_101468970 Ga0068855_1014689702 166
665 3300005577 Ga0068857_100028342 Ga0068857_1000283424 166
666 3300005577 Ga0068857_100058005 Ga0068857_1000580053 166
667 3300005578 Ga0068854_100020662 Ga0068854_1000206623 166
668 3300005578 Ga0068854_100042861 Ga0068854_1000428614 166
669 3300005578 Ga0068854_100093481 Ga0068854_1000934813 166
670 3300005614 Ga0068856_100003724 Ga0068856_10000372415 166
671 3300005614 Ga0068856_100031694 Ga0068856_1000316943 166
672 3300005614 Ga0068856_100111325 Ga0068856_1001113254 166
673 3300005615 Ga0070702_100464687 Ga0070702_1004646871 166
674 3300005616 Ga0068852_100066422 Ga0068852_1000664223 166
675 3300005616 Ga0068852_100530004 Ga0068852_1005300041 166
676 3300005834 Ga0068851_10001194 Ga0068851_100011943 166
677 3300005841 Ga0068863_102005528 Ga0068863_1020055281 166
678 3300005843 Ga0068860_100004778 Ga0068860_10000477811 166
679 3300005843 Ga0068860_100368300 Ga0068860_1003683002 166
680 3300005937 Ga0081455_10145426 Ga0081455_101454262 166
681 3300005983 Ga0081540_1085243 Ga0081540_10852432 166
682 3300005983 Ga0081540_1103057 Ga0081540_11030572 166
683 3300005985 Ga0081539_10013194 Ga0081539_100131941 166
684 3300005985 Ga0081539_10211928 Ga0081539_102119281 166
685 3300006028 Ga0070717_10098767 Ga0070717_100987673 166
686 3300006048 Ga0075363_100378395 Ga0075363_1003783952 166
687 3300006173 Ga0070716_100399754 Ga0070716_1003997542 166
688 3300006175 Ga0070712_100041741 Ga0070712_1000417413 166
689 3300006941 Ga0099825_1045942 Ga0099825_10459422 166
690 3300006942 Ga0099824_1009785 Ga0099824_10097856 166
691 3300006943 Ga0099822_1005813 Ga0099822_10058133 166
692 3300009093 Ga0105240_10036366 Ga0105240_100363667 166
693 3300009093 Ga0105240_10096341 Ga0105240_100963414 166
694 3300009093 Ga0105240_10131211 Ga0105240_101312112 166
695 3300009093 Ga0105240_11849552 Ga0105240_118495521 166
696 3300009098 Ga0105245_10475447 Ga0105245_104754472 166
697 3300009148 Ga0105243_10289444 Ga0105243_102894441 166
698 3300009148 Ga0105243_10602698 Ga0105243_106026981 166
699 3300009174 Ga0105241_11830538 Ga0105241_118305381 166
700 3300009176 Ga0105242_12177174 Ga0105242_121771741 166
701 3300009177 Ga0105248_10170027 Ga0105248_101700272 166
702 3300009177 Ga0105248_11104022 Ga0105248_111040222 166
703 3300009545 Ga0105237_10109815 Ga0105237_101098153 166
704 3300009551 Ga0105238_10012578 Ga0105238_100125784 166
705 3300009551 Ga0105238_10015975 Ga0105238_100159753 166
706 3300010159 Ga0099796_10096529 Ga0099796_100965292 166
707 3300010375 Ga0105239_10010073 Ga0105239_100100737 166
708 3300010375 Ga0105239_10036146 Ga0105239_100361463 166
709 3300013307 Ga0157372_11520180 Ga0157372_115201802 166
710 3300014325 Ga0163163_11719558 Ga0163163_117195582 166
711 3300014969 Ga0157376_11157383 Ga0157376_111573831 166
712 3300021320 Ga0214544_1000665 Ga0214544_100066526 166
713 3300021321 Ga0214542_1000486 Ga0214542_100048626 166
714 3300021324 Ga0214545_1000307 Ga0214545_100030726 166
715 3300021327 Ga0214543_1003627 Ga0214543_100362710 166
716 3300021384 Ga0213876_10299065 Ga0213876_102990652 166
717 3300025261 Ga0209233_1007434 Ga0209233_10074342 166
718 3300025273 Ga0209673_1035517 Ga0209673_10355171 166
719 3300025297 Ga0209758_1009335 Ga0209758_10093354 166
720 3300025297 Ga0209758_1009523 Ga0209758_10095234 166
721 3300025321 Ga0207656_10003104 Ga0207656_100031043 166
722 3300025898 Ga0207692_10292941 Ga0207692_102929412 166
723 3300025904 Ga0207647_10008467 Ga0207647_100084673 166
724 3300025906 Ga0207699_10033812 Ga0207699_100338123 166
725 3300025911 Ga0207654_10000210 Ga0207654_1000021024 166
726 3300025913 Ga0207695_10001435 Ga0207695_1000143518 166
727 3300025913 Ga0207695_10116136 Ga0207695_101161362 166
728 3300025913 Ga0207695_10128886 Ga0207695_101288863 166
729 3300025914 Ga0207671_10094407 Ga0207671_100944073 166
730 3300025915 Ga0207693_10121333 Ga0207693_101213333 166
731 3300025916 Ga0207663_10007390 Ga0207663_100073902 166
732 3300025924 Ga0207694_10000106 Ga0207694_1000010675 166
733 3300025924 Ga0207694_10014114 Ga0207694_100141145 166
734 3300025924 Ga0207694_10617111 Ga0207694_106171111 166
735 3300025926 Ga0207659_10927912 Ga0207659_109279121 166
736 3300025928 Ga0207700_10105138 Ga0207700_101051381 166
737 3300025928 Ga0207700_10155038 Ga0207700_101550383 166
738 3300025929 Ga0207664_10150552 Ga0207664_101505523 166
739 3300025929 Ga0207664_10237603 Ga0207664_102376031 166
740 3300025933 Ga0207706_10039352 Ga0207706_100393523 166
741 3300025935 Ga0207709_10758431 Ga0207709_107584312 166
742 3300025937 Ga0207669_11473601 Ga0207669_114736011 166
743 3300025939 Ga0207665_10028607 Ga0207665_100286073 166
744 3300025939 Ga0207665_10106396 Ga0207665_101063963 166
745 3300025949 Ga0207667_10010685 Ga0207667_1001068510 166
746 3300025949 Ga0207667_10973523 Ga0207667_109735232 166
747 3300025981 Ga0207640_10018761 Ga0207640_100187615 166
748 3300025981 Ga0207640_10049905 Ga0207640_100499054 166
749 3300026035 Ga0207703_10121267 Ga0207703_101212672 166
750 3300026041 Ga0207639_10017628 Ga0207639_100176285 166
751 3300026067 Ga0207678_10105285 Ga0207678_101052852 166
752 3300026078 Ga0207702_10000004 Ga0207702_1000000475 166
753 3300026078 Ga0207702_10000546 Ga0207702_1000054650 166
754 3300026078 Ga0207702_10229417 Ga0207702_102294173 166
755 3300026078 Ga0207702_10702857 Ga0207702_107028571 166
756 3300026116 Ga0207674_10018238 Ga0207674_100182386 166
757 3300026116 Ga0207674_10066904 Ga0207674_100669043 166
758 3300026121 Ga0207683_10127400 Ga0207683_101274002 166
759 3300026142 Ga0207698_10013935 Ga0207698_100139353 166
760 3300026142 Ga0207698_10069148 Ga0207698_100691483 166
761 3300027357 Ga0209589_1000035 Ga0209589_100003542 166
762 3300027361 Ga0209489_100079 Ga0209489_10007942 166
763 3300027363 Ga0209700_100077 Ga0209700_10007742 166
764 3300028381 Ga0268264_10000062 Ga0268264_10000062282 166
765 3300028573 Ga0265334_10005996 Ga0265334_100059963 166
766 3300028794 Ga0307515_10030422 Ga0307515_100304227 166
767 3300028800 Ga0265338_10761647 Ga0265338_107616471 166
768 3300031235 Ga0265330_10015040 Ga0265330_100150401 166
769 3300031235 Ga0265330_10033136 Ga0265330_100331362 166
770 3300031235 Ga0265330_10077895 Ga0265330_100778952 166
771 3300031235 Ga0265330_10098097 Ga0265330_100980971 166
772 3300031238 Ga0265332_10002500 Ga0265332_100025006 166
773 3300031238 Ga0265332_10127201 Ga0265332_101272012 166
774 3300031241 Ga0265325_10008179 Ga0265325_100081792 166
775 3300031247 Ga0265340_10059885 Ga0265340_100598852 166
776 3300031247 Ga0265340_10250690 Ga0265340_102506902 166
777 3300031249 Ga0265339_10032253 Ga0265339_100322532 166
778 3300031249 Ga0265339_10085392 Ga0265339_100853922 166
779 3300031344 Ga0265316_10100653 Ga0265316_101006532 166
780 3300031507 Ga0307509_10606463 Ga0307509_106064632 166
781 3300031548 Ga0307408_100749340 Ga0307408_1007493402 166
782 3300031548 Ga0307408_101145569 Ga0307408_1011455691 166
783 3300031616 Ga0307508_10152484 Ga0307508_101524843 166
784 3300031616 Ga0307508_10166436 Ga0307508_101664362 166
785 3300031711 Ga0265314_10026988 Ga0265314_100269884 166
786 3300031711 Ga0265314_10117320 Ga0265314_101173202 166
787 3300031711 Ga0265314_10137687 Ga0265314_101376872 166
788 3300031711 Ga0265314_10460891 Ga0265314_104608911 166
789 3300031712 Ga0265342_10326251 Ga0265342_103262511 166
790 3300031712 Ga0265342_10348656 Ga0265342_103486561 166
791 3300031730 Ga0307516_10164027 Ga0307516_101640272 166
792 3300031901 Ga0307406_10115655 Ga0307406_101156553 166
793 3300033180 Ga0307510_10014100 Ga0307510_100141005 166
794 3300035086 Ga0373934_0107241 Ga0373934_0107241_485_997 166
795 3300035089 Ga0373944_0029669 Ga0373944_0029669_971_1477 166
796 3300035111 Ga0373923_0124871 Ga0373923_0124871_618_1130 166
797 3300035113 Ga0373936_0425131 Ga0373936_0425131_25_534 166
798 3300035117 Ga0373953_0006029 Ga0373953_0006029_3437_3949 166
799 3300035118 Ga0373954_0041778 Ga0373954_0041778_242_754 166
800 3300035119 Ga0373956_0000581 Ga0373956_0000581_157_669 166
801 3300035119 Ga0373956_0213345 Ga0373956_0213345_253_753 166
802 3300035120 Ga0373957_0034748 Ga0373957_0034748_25_537 166
803 3300035170 Ga0373943_0004960 Ga0373943_0004960_5436_5936 166
804 3300035171 Ga0373946_0005215 Ga0373946_0005215_2380_2880 166
805 3300035171 Ga0373946_0139685 Ga0373946_0139685_364_870 166
806 3300035172 Ga0373955_0005025 Ga0373955_0005025_133_645 166
807 3300035410 Ga0373924_0031077 Ga0373924_0031077_489_989 166
808 3300035691 Ga0373931_0429106 Ga0373931_0429106_77_589 166
809 3300035692 Ga0373935_0000595 Ga0373935_0000595_6339_6839 166
810 3300035692 Ga0373935_0373992 Ga0373935_0373992_306_812 166
811 3300035695 Ga0373927_0001021 Ga0373927_0001021_6218_6718 166
812 3300035695 Ga0373927_0012902 Ga0373927_0012902_2634_3140 166
813 3300035724 Ga0373933_0000218 Ga0373933_0000218_36342_36860 166
814 3300035724 Ga0373933_0001113 Ga0373933_0001113_14770_15282 166
815 3300035725 Ga0373947_0000970 Ga0373947_0000970_11368_11868 166
816 3300035725 Ga0373947_0082864 Ga0373947_0082864_1031_1537 166
817 3300035725 Ga0373947_0392519 Ga0373947_0392519_61_561 166
818 3300036401 Ga0373937_0015997 Ga0373937_0015997_149_649 166
819 3300036401 Ga0373937_0104647 Ga0373937_0104647_1995_2507 166
820 3300037068 Ga0373925_0022227 Ga0373925_0022227_2984_3484 166
821 3300037068 Ga0373925_0047991 Ga0373925_0047991_176_676 166
822 3300037418 Ga0395900_0068610 Ga0395900_0068610_2893_3393 166
823 3300037466 Ga0395898_0233063 Ga0395898_0233063_17_517 166
824 3300037471 Ga0395905_0150031 Ga0395905_0150031_154_654 166
825 3300039437 Ga0436365_0345621 Ga0436365_0345621_339_842 166
826 3300039437 Ga0436365_0747851 Ga0436365_0747851_44_553 166
827 3300044658 Ga0466972_0000804 Ga0466972_0000804_8301_8801 166
828 3300044683 Ga0466965_0027670 Ga0466965_0027670_310_810 166
829 3300044683 Ga0466965_0265746 Ga0466965_0265746_348_848 166
830 3300044693 Ga0466961_0477019 Ga0466961_0477019_147_647 166
831 3300044735 Ga0466968_0200919 Ga0466968_0200919_247_750 166
832 3300044765 Ga0466970_0052790 Ga0466970_0052790_117_620 166
833 3300045976 Ga0466967_0171920 Ga0466967_0171920_1138_1641 166
834 3300046454 Ga0495592_0004267 Ga0495592_0004267_9921_10433 166
835 3300046455 Ga0495603_0001390 Ga0495603_0001390_6371_6871 166
836 3300046455 Ga0495603_0012891 Ga0495603_0012891_2792_3295 166
837 3300046455 Ga0495603_0240265 Ga0495603_0240265_371_871 166
838 3300046459 Ga0495629_0000915 Ga0495629_0000915_16822_17322 166
839 3300046459 Ga0495629_0004437 Ga0495629_0004437_3824_4336 166
840 3300046461 Ga0495641_0007969 Ga0495641_0007969_128_628 166
841 3300046463 Ga0495653_0020185 Ga0495653_0020185_3658_4170 166
842 3300046463 Ga0495653_0054414 Ga0495653_0054414_1043_1543 166
843 3300046472 Ga0495580_0009685 Ga0495580_0009685_4247_4747 166
844 3300046472 Ga0495580_0250141 Ga0495580_0250141_675_1181 166
845 3300046473 Ga0495582_0000302 Ga0495582_0000302_19529_20029 166
846 3300046475 Ga0495639_0016344 Ga0495639_0016344_668_1168 166
847 3300046475 Ga0495639_0019607 Ga0495639_0019607_1504_2007 166
848 3300046476 Ga0495662_0001985 Ga0495662_0001985_3597_4097 166
849 3300046477 Ga0495664_0019091 Ga0495664_0019091_1900_2400 166
850 3300046477 Ga0495664_0347623 Ga0495664_0347623_49_579 166
851 3300046499 Ga0495594_0000046 Ga0495594_0000046_9536_10036 166
852 3300046507 Ga0495606_0001471 Ga0495606_0001471_3369_3878 166
853 3300046511 Ga0495608_0040877 Ga0495608_0040877_1239_1751 166
854 3300046511 Ga0495608_0160446 Ga0495608_0160446_686_1186 166
855 3300046514 Ga0495618_0023457 Ga0495618_0023457_2655_3155 166
856 3300046516 Ga0495628_0049222 Ga0495628_0049222_2669_3181 166
857 3300046516 Ga0495628_0187605 Ga0495628_0187605_362_862 166
858 3300046517 Ga0495630_0004933 Ga0495630_0004933_3469_3969 166
859 3300046518 Ga0495631_0188122 Ga0495631_0188122_133_636 166
860 3300046519 Ga0495632_0293119 Ga0495632_0293119_181_684 166
861 3300046526 Ga0495666_0094326 Ga0495666_0094326_244_744 166
862 3300046529 Ga0495652_0006987 Ga0495652_0006987_387_899 166
863 3300046531 Ga0495665_0000335 Ga0495665_0000335_22333_22833 166
864 3300046533 Ga0495640_0021072 Ga0495640_0021072_3616_4116 166
865 3300046535 Ga0495586_0101878 Ga0495586_0101878_627_1127 166
866 3300046536 Ga0495587_0297084 Ga0495587_0297084_150_662 166
867 3300046543 Ga0495645_0143727 Ga0495645_0143727_87_599 166
868 3300046557 Ga0495622_0001947 Ga0495622_0001947_7323_7823 166
869 3300046559 Ga0495667_0076968 Ga0495667_0076968_687_1187 166
870 3300046616 Ga0495668_0066637 Ga0495668_0066637_267_770 166
871 3300046642 Ga0495634_0001329 Ga0495634_0001329_16045_16545 166
872 3300046642 Ga0495634_0009349 Ga0495634_0009349_5698_6210 166
873 3300046660 Ga0495625_0181728 Ga0495625_0181728_422_931 166
874 3300046663 Ga0495635_0011167 Ga0495635_0011167_3008_3508 166
875 3300046663 Ga0495635_0016673 Ga0495635_0016673_96_608 166
876 3300046674 Ga0495588_0002250 Ga0495588_0002250_1348_1848 166
877 3300046675 Ga0495657_0046286 Ga0495657_0046286_1239_1751 166
878 3300046678 Ga0495599_0358416 Ga0495599_0358416_134_646 166
879 3300046679 Ga0495623_0277154 Ga0495623_0277154_133_633 166
880 3300046680 Ga0495646_0017629 Ga0495646_0017629_2294_2806 166
881 3300046680 Ga0495646_0254534 Ga0495646_0254534_134_634 166
882 3300046681 Ga0495647_0000898 Ga0495647_0000898_2100_2600 166
883 3300046681 Ga0495647_0032228 Ga0495647_0032228_909_1412 166
884 3300046681 Ga0495647_0269454 Ga0495647_0269454_119_727 166
885 3300046683 Ga0495658_0000201 Ga0495658_0000201_5904_6404 166
886 3300046689 Ga0495613_0004521 Ga0495613_0004521_481_981 166
887 3300046689 Ga0495613_0013945 Ga0495613_0013945_4743_5255 166
888 3300046689 Ga0495613_0107083 Ga0495613_0107083_967_1566 166
889 3300046690 Ga0495624_0004061 Ga0495624_0004061_7155_7655 166
890 3300046690 Ga0495624_0231555 Ga0495624_0231555_318_821 166
891 3300046690 Ga0495624_0779064 Ga0495624_0779064_40_546 166
892 3300046809 Ga0495600_0099016 Ga0495600_0099016_1239_1751 166
893 3300047315 Ga0495581_0000030 Ga0495581_0000030_1086_1586 166
894 3300047315 Ga0495581_0019419 Ga0495581_0019419_1121_1624 166
895 3300047315 Ga0495581_0262381 Ga0495581_0262381_32_544 166
896 3300047317 Ga0495604_0776886 Ga0495604_0776886_23_532 166
897 3300047319 Ga0495674_0002494 Ga0495674_0002494_15173_15673 166
898 3300047319 Ga0495674_0117626 Ga0495674_0117626_135_647 166
899 3300047320 Ga0495672_0011216 Ga0495672_0011216_735_1253 166
900 3300047321 Ga0495676_0005339 Ga0495676_0005339_5972_6472 166
901 3300047322 Ga0495680_0028090 Ga0495680_0028090_2539_3051 166
902 3300047322 Ga0495680_0097180 Ga0495680_0097180_187_687 166
903 3300047322 Ga0495680_0791809 Ga0495680_0791809_86_586 166
904 3300047444 Ga0495675_0010421 Ga0495675_0010421_3825_4337 166
905 3300047471 Ga0495684_0013438 Ga0495684_0013438_1874_2386 166
906 3300047471 Ga0495684_0099383 Ga0495684_0099383_478_978 166
907 3300047472 Ga0495686_0139005 Ga0495686_0139005_376_879 166
908 3300047673 Ga0495593_0000100 Ga0495593_0000100_795_1295 166
909 3300047673 Ga0495593_0000740 Ga0495593_0000740_14379_14891 166
910 3300048088 Ga0495602_0091663 Ga0495602_0091663_576_1088 166
911 3300048089 Ga0495614_0007180 Ga0495614_0007180_2472_2972 166
912 3300048904 Ga0496101_0157719 Ga0496101_0157719_162_677 166
913 3300048905 Ga0496102_0112985 Ga0496102_0112985_1065_1565 166
914 3300048905 Ga0496102_0369963 Ga0496102_0369963_469_984 166
915 3300048905 Ga0496102_0918503 Ga0496102_0918503_121_624 166
916 3300048907 Ga0496104_0133370 Ga0496104_0133370_826_1326 166
917 3300048909 Ga0496106_0013334 Ga0496106_0013334_1827_2327 166
918 3300048910 Ga0496107_0029342 Ga0496107_0029342_1577_2077 166
919 3300048911 Ga0496108_0000160 Ga0496108_0000160_33055_33555 166
920 3300048912 Ga0496109_0000245 Ga0496109_0000245_19582_20082 166
921 3300048914 Ga0496111_0109796 Ga0496111_0109796_21_521 166
922 3300048915 Ga0496112_0390338 Ga0496112_0390338_668_1171 166
923 3300048916 Ga0496113_0008153 Ga0496113_0008153_6084_6584 166
924 3300048916 Ga0496113_0239520 Ga0496113_0239520_670_1218 166
925 3300048917 Ga0496114_0090327 Ga0496114_0090327_2030_2539 166
926 3300048924 Ga0496121_0231365 Ga0496121_0231365_266_772 166
927 3300048929 Ga0496126_0670628 Ga0496126_0670628_236_736 166
928 3300048929 Ga0496126_0736918 Ga0496126_0736918_184_684 166
929 3300053077 Ga0495601_0020279 Ga0495601_0020279_1385_1897 166
930 3300053078 Ga0495612_0212665 Ga0495612_0212665_336_836 166
931 3300053084 Ga0495595_0001985 Ga0495595_0001985_2290_2802 166
932 3300053085 Ga0495619_0013161 Ga0495619_0013161_2611_3123 166
933 3300053085 Ga0495619_0280022 Ga0495619_0280022_515_1015 166
934 3300053085 Ga0495619_0738122 Ga0495619_0738122_52_555 166
935 3300053158 Ga0500627_0365214 Ga0500627_0365214_91_594 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

41

192

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.8691 1 165
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.8636 1 165
6d1v-assembly1.cif.gz_B crystal structure of e. coli rpph-dapf complex, monomer bound to rna 0.8601 1 165
1jkn-assembly1.cif.gz_A solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp 0.8579 5 163
6vcn-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with ppcpg 0.8486 2 165
ID Description Score Start End Superfamily
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8712 1 164 3.90.79.10
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8636 1 165 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8608 1 164 3.90.79.10
af_A0A0R0I796_20_164_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8449 21 164 3.90.79.10
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8317 1 165 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A1M7TT42-F1-model_v4 Putative (Di)nucleoside polyphosphate hydrolase 0.9883 4 166 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A2T7U4S9-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9757 5 165 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A5B2VQP9-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.971 2 165 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A4Q0MIE2-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9649 2 166 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A1M7TT42-F1-model_v4 Putative (Di)nucleoside polyphosphate hydrolase 0.9648 4 166 GO:0006753
GO:0008893
GO:0019693
GO:0034432

Feature Viewer

pLDDT pTM Quality
94.2 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map