F486171
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 473 | 895 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300046681|Ga0495647_0269454|Ga0495647_0269454_119_727 |
| Length | 202 |
| Sequence | MPSMNPESRDSGYALARALSDKRDALARGMTSIESMPDTKPYRPNVGIALFNAAGRVLIGRRFRDDGPEIILPGLEWQMPQGGIDAEENPREAVMRELWEETGVASAVYLGETDWLTYEFPPYAGPSSHRLAKFRGQRQKWFALRFTGADAEIDPLTPRNGQPAEFDQWRWERLDRVADLVVPFRREVYRTVALRFAEFAKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 3 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 6 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 7 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 8 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 9 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 10 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 11 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 12 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 13 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 14 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 15 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 16 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 17 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 18 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 19 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 20 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 21 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 22 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 23 | 2906610324 | |||
| 24 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 25 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 26 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 27 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 28 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 29 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 30 | 2922425934 | |||
| 31 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 32 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 33 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 34 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 35 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 36 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 37 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 38 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 39 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 117 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 118 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 151 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 152 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 153 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 154 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 155 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 156 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 157 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 158 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 246 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 280 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 281 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 284 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 285 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 291 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 292 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 295 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 296 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 383 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 384 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 385 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 388 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 391 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 392 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 393 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 394 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 395 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 396 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 397 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 398 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 399 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 400 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 401 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 402 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 403 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 404 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 405 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 406 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 407 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 424 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 425 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 426 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 427 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 428 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 432 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 435 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 440 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 441 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 442 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 443 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 444 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 445 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 446 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 447 | 3300053112 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere | Metagenome | Endosphere |
| 448 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 449 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 450 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 451 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 452 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 453 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 454 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 456 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 457 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 458 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 459 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 460 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 462 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 463 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 465 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 467 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 468 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 469 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 470 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 471 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 472 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 473 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.93 |
| Metatranscriptomes | 0 |
| Isolates | 4.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.24 |
| Nodule | 3.53 |
| Rhizoplane | 7.38 |
| Rhizosphere | 72.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000635 | 3300001979 | Bacteria | 15165 |
| 2 | JGI24739J22299_10002357 | 3300001989 | Bacteria | 7276 |
| 3 | JGI24737J22298_10003086 | 3300001990 | Bacteria | 5902 |
| 4 | JGI25406J46586_10000364 | 3300003203 | Bacteria | 20635 |
| 5 | JGI25406J46586_10005263 | 3300003203 | Bacteria | 6004 |
| 6 | JGI25404J52841_10055956 | 3300003659 | Bacteria | 828 |
| 7 | Ga0055524_1047432 | 3300003775 | Bacteria | 1011 |
| 8 | Ga0065165_1000014 | 3300005262 | Bacteria | 292366 |
| 9 | Ga0070658_10009941 | 3300005327 | Bacteria | 7643 |
| 10 | Ga0070658_10463689 | 3300005327 | Bacteria | 1092 |
| 11 | Ga0070658_10579390 | 3300005327 | Bacteria | 972 |
| 12 | Ga0070676_10060232 | 3300005328 | Bacteria | 2254 |
| 13 | Ga0070683_100066945 | 3300005329 | Bacteria | 3345 |
| 14 | Ga0070683_100100543 | 3300005329 | Bacteria | 2722 |
| 15 | Ga0070670_100101013 | 3300005331 | Bacteria | 2484 |
| 16 | Ga0070677_10574785 | 3300005333 | Bacteria | 621 |
| 17 | Ga0068869_100013066 | 3300005334 | Bacteria | 5510 |
| 18 | Ga0070680_100028929 | 3300005336 | Bacteria | 4448 |
| 19 | Ga0070680_100213916 | 3300005336 | Bacteria | 1626 |
| 20 | Ga0070682_100108314 | 3300005337 | Bacteria | 1847 |
| 21 | Ga0068868_100040431 | 3300005338 | Bacteria | 3629 |
| 22 | Ga0068868_100071424 | 3300005338 | Bacteria | 2768 |
| 23 | Ga0070660_100402071 | 3300005339 | Bacteria | 1133 |
| 24 | Ga0070691_10244466 | 3300005341 | Bacteria | 960 |
| 25 | Ga0070661_100011760 | 3300005344 | Bacteria | 6107 |
| 26 | Ga0070661_100177218 | 3300005344 | Bacteria | 1621 |
| 27 | Ga0070668_100046179 | 3300005347 | Bacteria | 3343 |
| 28 | Ga0070668_101214077 | 3300005347 | Bacteria | 683 |
| 29 | Ga0070669_100113184 | 3300005353 | Bacteria | 2061 |
| 30 | Ga0070675_100382549 | 3300005354 | Bacteria | 1253 |
| 31 | Ga0070674_100498464 | 3300005356 | Bacteria | 1014 |
| 32 | Ga0070674_101176733 | 3300005356 | Bacteria | 680 |
| 33 | Ga0070673_100601818 | 3300005364 | Bacteria | 1003 |
| 34 | Ga0070659_100036969 | 3300005366 | Bacteria | 3806 |
| 35 | Ga0070659_100046072 | 3300005366 | Bacteria | 3418 |
| 36 | Ga0070667_101306125 | 3300005367 | Bacteria | 680 |
| 37 | Ga0070709_10011427 | 3300005434 | Bacteria | 4949 |
| 38 | Ga0070709_10040833 | 3300005434 | Bacteria | 2855 |
| 39 | Ga0070709_10097615 | 3300005434 | Bacteria | 1951 |
| 40 | Ga0070709_10285542 | 3300005434 | Bacteria | 1201 |
| 41 | Ga0070714_100029045 | 3300005435 | Bacteria | 4594 |
| 42 | Ga0070714_100217983 | 3300005435 | Bacteria | 1752 |
| 43 | Ga0070713_100056704 | 3300005436 | Bacteria | 3259 |
| 44 | Ga0070713_100140678 | 3300005436 | Bacteria | 2137 |
| 45 | Ga0070710_10051309 | 3300005437 | Bacteria | 2315 |
| 46 | Ga0070710_10440555 | 3300005437 | Bacteria | 881 |
| 47 | Ga0070711_100007751 | 3300005439 | Bacteria | 6541 |
| 48 | Ga0070711_100019491 | 3300005439 | Bacteria | 4352 |
| 49 | Ga0070711_100575956 | 3300005439 | Bacteria | 937 |
| 50 | Ga0070700_100169054 | 3300005441 | Bacteria | 1512 |
| 51 | Ga0070663_100090637 | 3300005455 | Bacteria | 2265 |
| 52 | Ga0070663_100095227 | 3300005455 | Bacteria | 2212 |
| 53 | Ga0070663_100132285 | 3300005455 | Bacteria | 1896 |
| 54 | Ga0070663_100254678 | 3300005455 | Bacteria | 1390 |
| 55 | Ga0070663_100298120 | 3300005455 | Bacteria | 1289 |
| 56 | Ga0070663_100433266 | 3300005455 | Bacteria | 1081 |
| 57 | Ga0070678_100011899 | 3300005456 | Bacteria | 5385 |
| 58 | Ga0070678_100072529 | 3300005456 | Bacteria | 2581 |
| 59 | Ga0070662_100015653 | 3300005457 | Bacteria | 5084 |
| 60 | Ga0070681_10062073 | 3300005458 | Bacteria | 3711 |
| 61 | Ga0070681_10417355 | 3300005458 | Bacteria | 1254 |
| 62 | Ga0070681_10656376 | 3300005458 | Bacteria | 964 |
| 63 | Ga0070685_10345417 | 3300005466 | Bacteria | 1016 |
| 64 | Ga0070699_101176282 | 3300005518 | Bacteria | 703 |
| 65 | Ga0070679_100520827 | 3300005530 | Bacteria | 1133 |
| 66 | Ga0070679_100577136 | 3300005530 | Bacteria | 1068 |
| 67 | Ga0070684_100000950 | 3300005535 | Bacteria | 20658 |
| 68 | Ga0070684_100038404 | 3300005535 | Bacteria | 4112 |
| 69 | Ga0070684_100289754 | 3300005535 | Bacteria | 1501 |
| 70 | Ga0070697_100030494 | 3300005536 | Bacteria | 4332 |
| 71 | Ga0070697_100773699 | 3300005536 | Bacteria | 849 |
| 72 | Ga0068853_100007151 | 3300005539 | Bacteria | 8929 |
| 73 | Ga0068853_100039602 | 3300005539 | Bacteria | 4020 |
| 74 | Ga0068853_100046015 | 3300005539 | Bacteria | 3740 |
| 75 | Ga0068853_100110950 | 3300005539 | Bacteria | 2436 |
| 76 | Ga0068853_100137951 | 3300005539 | Bacteria | 2188 |
| 77 | Ga0068853_100779797 | 3300005539 | Bacteria | 914 |
| 78 | Ga0068853_101241844 | 3300005539 | Bacteria | 720 |
| 79 | Ga0070672_100130481 | 3300005543 | Bacteria | 2065 |
| 80 | Ga0070686_100091644 | 3300005544 | Bacteria | 2034 |
| 81 | Ga0070693_100067784 | 3300005547 | Bacteria | 2093 |
| 82 | Ga0070693_100125039 | 3300005547 | Bacteria | 1600 |
| 83 | Ga0070665_100050356 | 3300005548 | Bacteria | 4179 |
| 84 | Ga0070665_100067075 | 3300005548 | Bacteria | 3599 |
| 85 | Ga0070665_101624430 | 3300005548 | Bacteria | 654 |
| 86 | Ga0068855_100067225 | 3300005563 | Bacteria | 4177 |
| 87 | Ga0068855_100106438 | 3300005563 | Bacteria | 3223 |
| 88 | Ga0068855_100106967 | 3300005563 | Bacteria | 3214 |
| 89 | Ga0068855_100664039 | 3300005563 | Bacteria | 1118 |
| 90 | Ga0068855_100692404 | 3300005563 | Bacteria | 1091 |
| 91 | Ga0068855_101468970 | 3300005563 | Bacteria | 701 |
| 92 | Ga0070664_100028305 | 3300005564 | Bacteria | 4661 |
| 93 | Ga0070664_100098691 | 3300005564 | Bacteria | 2537 |
| 94 | Ga0068857_100028342 | 3300005577 | Bacteria | 4942 |
| 95 | Ga0068857_100058005 | 3300005577 | Bacteria | 3437 |
| 96 | Ga0068857_100128105 | 3300005577 | Bacteria | 2288 |
| 97 | Ga0068854_100020662 | 3300005578 | Bacteria | 4460 |
| 98 | Ga0068854_100042861 | 3300005578 | Bacteria | 3205 |
| 99 | Ga0068854_100093481 | 3300005578 | Bacteria | 2241 |
| 100 | Ga0068854_100682541 | 3300005578 | Bacteria | 885 |
| 101 | Ga0068854_101114932 | 3300005578 | Bacteria | 704 |
| 102 | Ga0068856_100003724 | 3300005614 | Bacteria | 15294 |
| 103 | Ga0068856_100031694 | 3300005614 | Bacteria | 5173 |
| 104 | Ga0068856_100053445 | 3300005614 | Bacteria | 3982 |
| 105 | Ga0068856_100111325 | 3300005614 | Bacteria | 2735 |
| 106 | Ga0070702_100058977 | 3300005615 | Bacteria | 2225 |
| 107 | Ga0070702_100464687 | 3300005615 | Bacteria | 921 |
| 108 | Ga0068852_100066422 | 3300005616 | Bacteria | 3149 |
| 109 | Ga0068852_100081048 | 3300005616 | Bacteria | 2880 |
| 110 | Ga0068852_100287592 | 3300005616 | Bacteria | 1587 |
| 111 | Ga0068852_100530004 | 3300005616 | Bacteria | 1176 |
| 112 | Ga0068859_100182698 | 3300005617 | Bacteria | 2180 |
| 113 | Ga0068859_100249204 | 3300005617 | Bacteria | 1866 |
| 114 | Ga0068864_100024535 | 3300005618 | Bacteria | 5073 |
| 115 | Ga0068864_100618363 | 3300005618 | Bacteria | 1052 |
| 116 | Ga0068864_100658846 | 3300005618 | Bacteria | 1020 |
| 117 | Ga0068861_100385428 | 3300005719 | Bacteria | 1239 |
| 118 | Ga0068861_100456186 | 3300005719 | Bacteria | 1146 |
| 119 | Ga0068851_10001194 | 3300005834 | Bacteria | 11281 |
| 120 | Ga0068863_100108690 | 3300005841 | Bacteria | 2639 |
| 121 | Ga0068863_102005528 | 3300005841 | Bacteria | 589 |
| 122 | Ga0068858_100095727 | 3300005842 | Bacteria | 2766 |
| 123 | Ga0068860_100004778 | 3300005843 | Bacteria | 13804 |
| 124 | Ga0068860_100058722 | 3300005843 | Bacteria | 3657 |
| 125 | Ga0068860_100152141 | 3300005843 | Bacteria | 2228 |
| 126 | Ga0068860_100368300 | 3300005843 | Bacteria | 1417 |
| 127 | Ga0068860_101738495 | 3300005843 | Bacteria | 646 |
| 128 | Ga0068862_100151650 | 3300005844 | Bacteria | 2063 |
| 129 | Ga0081455_10010497 | 3300005937 | Bacteria | 9390 |
| 130 | Ga0081455_10145426 | 3300005937 | Bacteria | 1835 |
| 131 | Ga0081540_1000191 | 3300005983 | Bacteria | 63533 |
| 132 | Ga0081540_1003921 | 3300005983 | Bacteria | 11587 |
| 133 | Ga0081540_1017710 | 3300005983 | Bacteria | 4399 |
| 134 | Ga0081540_1070729 | 3300005983 | Bacteria | 1615 |
| 135 | Ga0081540_1085243 | 3300005983 | Bacteria | 1408 |
| 136 | Ga0081540_1103057 | 3300005983 | Bacteria | 1224 |
| 137 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 138 | Ga0081539_10013194 | 3300005985 | Bacteria | 6253 |
| 139 | Ga0081539_10211928 | 3300005985 | Bacteria | 887 |
| 140 | Ga0070717_10098767 | 3300006028 | Bacteria | 2475 |
| 141 | Ga0070717_10338637 | 3300006028 | Bacteria | 1343 |
| 142 | Ga0075365_10144138 | 3300006038 | Bacteria | 1654 |
| 143 | Ga0075365_10183266 | 3300006038 | Bacteria | 1464 |
| 144 | Ga0075368_10020138 | 3300006042 | Bacteria | 2523 |
| 145 | Ga0075363_100046611 | 3300006048 | Bacteria | 2300 |
| 146 | Ga0075363_100378395 | 3300006048 | Bacteria | 830 |
| 147 | Ga0075364_10022257 | 3300006051 | Bacteria | 4000 |
| 148 | Ga0075364_10068069 | 3300006051 | Bacteria | 2341 |
| 149 | Ga0075364_10266019 | 3300006051 | Bacteria | 1166 |
| 150 | Ga0075432_10013182 | 3300006058 | Bacteria | 2808 |
| 151 | Ga0070715_10008592 | 3300006163 | Bacteria | 3564 |
| 152 | Ga0070716_100399754 | 3300006173 | Bacteria | 988 |
| 153 | Ga0070712_100041741 | 3300006175 | Bacteria | 3151 |
| 154 | Ga0075367_10034512 | 3300006178 | Bacteria | 2923 |
| 155 | Ga0075369_10004251 | 3300006186 | Bacteria | 5276 |
| 156 | Ga0075369_10072463 | 3300006186 | Bacteria | 1518 |
| 157 | Ga0075366_10309841 | 3300006195 | Bacteria | 966 |
| 158 | Ga0075370_10027487 | 3300006353 | Bacteria | 3156 |
| 159 | Ga0068871_100044698 | 3300006358 | Bacteria | 3563 |
| 160 | Ga0068871_100053846 | 3300006358 | Bacteria | 3263 |
| 161 | Ga0075434_100147299 | 3300006871 | Bacteria | 2375 |
| 162 | Ga0075434_100282056 | 3300006871 | Bacteria | 1681 |
| 163 | Ga0097620_100182694 | 3300006931 | Bacteria | 2180 |
| 164 | Ga0097620_100249207 | 3300006931 | Bacteria | 1866 |
| 165 | Ga0099825_1045942 | 3300006941 | Bacteria | 1080 |
| 166 | Ga0099824_1009785 | 3300006942 | Bacteria | 11635 |
| 167 | Ga0099822_1005813 | 3300006943 | Bacteria | 16112 |
| 168 | Ga0075435_100139336 | 3300007076 | Bacteria | 2034 |
| 169 | Ga0105244_10428597 | 3300009036 | Bacteria | 608 |
| 170 | Ga0105250_10229886 | 3300009092 | Bacteria | 788 |
| 171 | Ga0105240_10036366 | 3300009093 | Bacteria | 6336 |
| 172 | Ga0105240_10039683 | 3300009093 | Bacteria | 6027 |
| 173 | Ga0105240_10096341 | 3300009093 | Bacteria | 3606 |
| 174 | Ga0105240_10131211 | 3300009093 | Bacteria | 3005 |
| 175 | Ga0105240_11849552 | 3300009093 | Bacteria | 629 |
| 176 | Ga0111539_10059723 | 3300009094 | Bacteria | 4521 |
| 177 | Ga0105245_10033417 | 3300009098 | Bacteria | 4559 |
| 178 | Ga0105245_10128432 | 3300009098 | Bacteria | 2375 |
| 179 | Ga0105245_10342331 | 3300009098 | Bacteria | 1479 |
| 180 | Ga0105245_10475447 | 3300009098 | Bacteria | 1262 |
| 181 | Ga0105247_10068652 | 3300009101 | Bacteria | 2210 |
| 182 | Ga0105247_10310357 | 3300009101 | Bacteria | 1097 |
| 183 | Ga0105247_10561726 | 3300009101 | Bacteria | 840 |
| 184 | Ga0105243_10289444 | 3300009148 | Bacteria | 1479 |
| 185 | Ga0105243_10602698 | 3300009148 | Bacteria | 1058 |
| 186 | Ga0105241_10037198 | 3300009174 | Bacteria | 3666 |
| 187 | Ga0105241_11830538 | 3300009174 | Bacteria | 593 |
| 188 | Ga0105242_10125235 | 3300009176 | Bacteria | 2211 |
| 189 | Ga0105242_11594257 | 3300009176 | Bacteria | 686 |
| 190 | Ga0105242_12177174 | 3300009176 | Bacteria | 599 |
| 191 | Ga0105248_10170027 | 3300009177 | Bacteria | 2456 |
| 192 | Ga0105248_11104022 | 3300009177 | Bacteria | 897 |
| 193 | Ga0105237_10019216 | 3300009545 | Bacteria | 7060 |
| 194 | Ga0105237_10044051 | 3300009545 | Bacteria | 4494 |
| 195 | Ga0105237_10109815 | 3300009545 | Bacteria | 2750 |
| 196 | Ga0105238_10012578 | 3300009551 | Bacteria | 8543 |
| 197 | Ga0105238_10015975 | 3300009551 | Bacteria | 7595 |
| 198 | Ga0105238_10020486 | 3300009551 | Bacteria | 6733 |
| 199 | Ga0105238_10104490 | 3300009551 | Bacteria | 2813 |
| 200 | Ga0105249_10053869 | 3300009553 | Bacteria | 3677 |
| 201 | Ga0105249_12604298 | 3300009553 | Bacteria | 578 |
| 202 | Ga0099796_10096529 | 3300010159 | Bacteria | 1106 |
| 203 | Ga0105239_10010073 | 3300010375 | Bacteria | 10596 |
| 204 | Ga0105239_10036146 | 3300010375 | Bacteria | 5424 |
| 205 | Ga0105239_10052959 | 3300010375 | Bacteria | 4452 |
| 206 | Ga0105239_10082887 | 3300010375 | Bacteria | 3531 |
| 207 | Ga0105239_10126168 | 3300010375 | Bacteria | 2844 |
| 208 | Ga0105239_10128415 | 3300010375 | Bacteria | 2818 |
| 209 | Ga0105246_10077783 | 3300011119 | Bacteria | 2354 |
| 210 | Ga0105246_10458278 | 3300011119 | Bacteria | 1073 |
| 211 | Ga0105246_10932987 | 3300011119 | Bacteria | 781 |
| 212 | Ga0157373_10016212 | 3300013100 | Bacteria | 5437 |
| 213 | Ga0157371_10028952 | 3300013102 | Bacteria | 4010 |
| 214 | Ga0157370_10298450 | 3300013104 | Bacteria | 1488 |
| 215 | Ga0157369_10044218 | 3300013105 | Bacteria | 4849 |
| 216 | Ga0157369_10945911 | 3300013105 | Bacteria | 883 |
| 217 | Ga0157374_10844124 | 3300013296 | Bacteria | 933 |
| 218 | Ga0157374_11013257 | 3300013296 | Bacteria | 850 |
| 219 | Ga0157378_10019963 | 3300013297 | Bacteria | 5893 |
| 220 | Ga0157378_10171908 | 3300013297 | Bacteria | 2032 |
| 221 | Ga0163162_10690270 | 3300013306 | Bacteria | 1143 |
| 222 | Ga0157372_10200919 | 3300013307 | Bacteria | 2309 |
| 223 | Ga0157372_11520180 | 3300013307 | Bacteria | 771 |
| 224 | Ga0157375_10313632 | 3300013308 | Bacteria | 1733 |
| 225 | Ga0163163_10517113 | 3300014325 | Bacteria | 1256 |
| 226 | Ga0163163_11719558 | 3300014325 | Bacteria | 688 |
| 227 | Ga0157380_10271255 | 3300014326 | Bacteria | 1547 |
| 228 | Ga0157379_10496075 | 3300014968 | Bacteria | 1131 |
| 229 | Ga0157376_10094852 | 3300014969 | Bacteria | 2593 |
| 230 | Ga0157376_10939329 | 3300014969 | Bacteria | 885 |
| 231 | Ga0157376_11157383 | 3300014969 | Bacteria | 801 |
| 232 | Ga0157376_12306530 | 3300014969 | Bacteria | 577 |
| 233 | Ga0163161_11544872 | 3300017792 | Bacteria | 584 |
| 234 | Ga0214544_1000665 | 3300021320 | Bacteria | 65630 |
| 235 | Ga0214542_1000486 | 3300021321 | Bacteria | 71884 |
| 236 | Ga0214545_1000307 | 3300021324 | Bacteria | 71884 |
| 237 | Ga0214543_1003627 | 3300021327 | Bacteria | 29806 |
| 238 | Ga0213873_10013788 | 3300021358 | Bacteria | 1779 |
| 239 | Ga0213872_10204540 | 3300021361 | Bacteria | 845 |
| 240 | Ga0213874_10001916 | 3300021377 | Bacteria | 4376 |
| 241 | Ga0213874_10143035 | 3300021377 | Bacteria | 829 |
| 242 | Ga0213876_10003463 | 3300021384 | Bacteria | 9019 |
| 243 | Ga0213876_10299065 | 3300021384 | Bacteria | 855 |
| 244 | Ga0209233_1007434 | 3300025261 | Bacteria | 3473 |
| 245 | Ga0209673_1035517 | 3300025273 | Bacteria | 1491 |
| 246 | Ga0209130_1000024 | 3300025284 | Bacteria | 354212 |
| 247 | Ga0209564_1001079 | 3300025295 | Bacteria | 32728 |
| 248 | Ga0209564_1010374 | 3300025295 | Bacteria | 4298 |
| 249 | Ga0209758_1009335 | 3300025297 | Bacteria | 6121 |
| 250 | Ga0209758_1009523 | 3300025297 | Bacteria | 6015 |
| 251 | Ga0209256_1001059 | 3300025299 | Bacteria | 31924 |
| 252 | Ga0207426_1024685 | 3300025302 | Bacteria | 2037 |
| 253 | Ga0207656_10003104 | 3300025321 | Bacteria | 5689 |
| 254 | Ga0207656_10024798 | 3300025321 | Bacteria | 2429 |
| 255 | Ga0207696_1019485 | 3300025711 | Bacteria | 2207 |
| 256 | Ga0207692_10292941 | 3300025898 | Bacteria | 988 |
| 257 | Ga0207642_10069573 | 3300025899 | Bacteria | 1670 |
| 258 | Ga0207710_10023365 | 3300025900 | Bacteria | 2656 |
| 259 | Ga0207688_10036584 | 3300025901 | Bacteria | 2721 |
| 260 | Ga0207647_10008467 | 3300025904 | Bacteria | 7372 |
| 261 | Ga0207647_10155432 | 3300025904 | Bacteria | 1336 |
| 262 | Ga0207699_10033812 | 3300025906 | Bacteria | 2893 |
| 263 | Ga0207699_10088646 | 3300025906 | Bacteria | 1937 |
| 264 | Ga0207705_10308646 | 3300025909 | Bacteria | 1214 |
| 265 | Ga0207654_10000210 | 3300025911 | Bacteria | 35799 |
| 266 | Ga0207707_10004329 | 3300025912 | Bacteria | 12571 |
| 267 | Ga0207707_10025404 | 3300025912 | Bacteria | 5182 |
| 268 | Ga0207707_10031430 | 3300025912 | Bacteria | 4645 |
| 269 | Ga0207695_10001435 | 3300025913 | Bacteria | 40061 |
| 270 | Ga0207695_10010844 | 3300025913 | Bacteria | 11100 |
| 271 | Ga0207695_10116136 | 3300025913 | Bacteria | 2650 |
| 272 | Ga0207695_10128886 | 3300025913 | Bacteria | 2489 |
| 273 | Ga0207695_10205887 | 3300025913 | Bacteria | 1880 |
| 274 | Ga0207671_10028767 | 3300025914 | Bacteria | 4152 |
| 275 | Ga0207671_10094407 | 3300025914 | Bacteria | 2258 |
| 276 | Ga0207671_10211982 | 3300025914 | Bacteria | 1515 |
| 277 | Ga0207671_10404952 | 3300025914 | Bacteria | 1085 |
| 278 | Ga0207693_10060098 | 3300025915 | Bacteria | 2977 |
| 279 | Ga0207693_10121333 | 3300025915 | Bacteria | 2053 |
| 280 | Ga0207663_10007390 | 3300025916 | Bacteria | 5694 |
| 281 | Ga0207663_10028537 | 3300025916 | Bacteria | 3267 |
| 282 | Ga0207660_10001470 | 3300025917 | Bacteria | 15854 |
| 283 | Ga0207660_10185729 | 3300025917 | Bacteria | 1617 |
| 284 | Ga0207662_10198699 | 3300025918 | Bacteria | 1297 |
| 285 | Ga0207657_10000700 | 3300025919 | Bacteria | 35601 |
| 286 | Ga0207657_10119742 | 3300025919 | Bacteria | 2166 |
| 287 | Ga0207649_10085619 | 3300025920 | Bacteria | 2051 |
| 288 | Ga0207652_10007361 | 3300025921 | Bacteria | 8875 |
| 289 | Ga0207652_10046543 | 3300025921 | Bacteria | 3701 |
| 290 | Ga0207652_10163006 | 3300025921 | Bacteria | 1999 |
| 291 | Ga0207694_10000106 | 3300025924 | Bacteria | 88467 |
| 292 | Ga0207694_10014114 | 3300025924 | Bacteria | 6023 |
| 293 | Ga0207694_10046065 | 3300025924 | Bacteria | 3370 |
| 294 | Ga0207694_10055078 | 3300025924 | Bacteria | 3087 |
| 295 | Ga0207694_10617111 | 3300025924 | Bacteria | 912 |
| 296 | Ga0207659_10927912 | 3300025926 | Bacteria | 749 |
| 297 | Ga0207687_10012071 | 3300025927 | Bacteria | 5649 |
| 298 | Ga0207687_10601211 | 3300025927 | Bacteria | 927 |
| 299 | Ga0207700_10049272 | 3300025928 | Bacteria | 3133 |
| 300 | Ga0207700_10105138 | 3300025928 | Bacteria | 2260 |
| 301 | Ga0207700_10155038 | 3300025928 | Bacteria | 1897 |
| 302 | Ga0207664_10150552 | 3300025929 | Bacteria | 1976 |
| 303 | Ga0207664_10237603 | 3300025929 | Bacteria | 1586 |
| 304 | Ga0207644_10337051 | 3300025931 | Bacteria | 1222 |
| 305 | Ga0207690_10023344 | 3300025932 | Bacteria | 3859 |
| 306 | Ga0207690_10535097 | 3300025932 | Bacteria | 951 |
| 307 | Ga0207706_10039352 | 3300025933 | Bacteria | 4192 |
| 308 | Ga0207709_10315181 | 3300025935 | Bacteria | 1168 |
| 309 | Ga0207709_10758431 | 3300025935 | Bacteria | 780 |
| 310 | Ga0207669_10936564 | 3300025937 | Bacteria | 725 |
| 311 | Ga0207669_11473601 | 3300025937 | Bacteria | 580 |
| 312 | Ga0207665_10028607 | 3300025939 | Bacteria | 3682 |
| 313 | Ga0207665_10106396 | 3300025939 | Bacteria | 1966 |
| 314 | Ga0207711_10030008 | 3300025941 | Bacteria | 4587 |
| 315 | Ga0207711_10408596 | 3300025941 | Bacteria | 1262 |
| 316 | Ga0207711_10421302 | 3300025941 | Bacteria | 1242 |
| 317 | Ga0207689_10054944 | 3300025942 | Bacteria | 3278 |
| 318 | Ga0207689_10054996 | 3300025942 | Bacteria | 3277 |
| 319 | Ga0207689_10310825 | 3300025942 | Bacteria | 1307 |
| 320 | Ga0207661_10015572 | 3300025944 | Bacteria | 5600 |
| 321 | Ga0207661_10133258 | 3300025944 | Bacteria | 2131 |
| 322 | Ga0207679_11018658 | 3300025945 | Bacteria | 759 |
| 323 | Ga0207667_10001909 | 3300025949 | Bacteria | 26170 |
| 324 | Ga0207667_10010685 | 3300025949 | Bacteria | 10714 |
| 325 | Ga0207667_10948055 | 3300025949 | Bacteria | 850 |
| 326 | Ga0207667_10973523 | 3300025949 | Bacteria | 837 |
| 327 | Ga0207667_11011183 | 3300025949 | Bacteria | 818 |
| 328 | Ga0207651_10602871 | 3300025960 | Bacteria | 960 |
| 329 | Ga0207712_10308204 | 3300025961 | Bacteria | 1302 |
| 330 | Ga0207712_10750324 | 3300025961 | Bacteria | 855 |
| 331 | Ga0207668_10038150 | 3300025972 | Bacteria | 3221 |
| 332 | Ga0207668_10195017 | 3300025972 | Bacteria | 1608 |
| 333 | Ga0207668_10946307 | 3300025972 | Bacteria | 768 |
| 334 | Ga0207640_10018761 | 3300025981 | Bacteria | 4071 |
| 335 | Ga0207640_10049905 | 3300025981 | Bacteria | 2712 |
| 336 | Ga0207677_10044189 | 3300026023 | Bacteria | 2966 |
| 337 | Ga0207677_10057193 | 3300026023 | Bacteria | 2676 |
| 338 | Ga0207677_11018871 | 3300026023 | Bacteria | 751 |
| 339 | Ga0207703_10121267 | 3300026035 | Bacteria | 2245 |
| 340 | Ga0207703_10164191 | 3300026035 | Bacteria | 1947 |
| 341 | Ga0207703_10749745 | 3300026035 | Bacteria | 930 |
| 342 | Ga0207639_10002676 | 3300026041 | Bacteria | 11963 |
| 343 | Ga0207639_10017628 | 3300026041 | Bacteria | 5063 |
| 344 | Ga0207639_10304515 | 3300026041 | Bacteria | 1410 |
| 345 | Ga0207639_10978510 | 3300026041 | Bacteria | 792 |
| 346 | Ga0207639_11150404 | 3300026041 | Bacteria | 728 |
| 347 | Ga0207678_10008508 | 3300026067 | Bacteria | 9045 |
| 348 | Ga0207678_10041532 | 3300026067 | Bacteria | 3988 |
| 349 | Ga0207678_10105285 | 3300026067 | Bacteria | 2407 |
| 350 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 351 | Ga0207702_10000546 | 3300026078 | Bacteria | 42023 |
| 352 | Ga0207702_10229417 | 3300026078 | Bacteria | 1734 |
| 353 | Ga0207702_10244823 | 3300026078 | Bacteria | 1681 |
| 354 | Ga0207702_10702857 | 3300026078 | Bacteria | 996 |
| 355 | Ga0207648_10740127 | 3300026089 | Bacteria | 913 |
| 356 | Ga0207676_10038875 | 3300026095 | Bacteria | 3635 |
| 357 | Ga0207676_10177444 | 3300026095 | Bacteria | 1862 |
| 358 | Ga0207674_10018238 | 3300026116 | Bacteria | 7634 |
| 359 | Ga0207674_10066904 | 3300026116 | Bacteria | 3618 |
| 360 | Ga0207674_10074915 | 3300026116 | Bacteria | 3395 |
| 361 | Ga0207674_10150152 | 3300026116 | Bacteria | 2288 |
| 362 | Ga0207675_100506365 | 3300026118 | Bacteria | 1202 |
| 363 | Ga0207683_10032853 | 3300026121 | Bacteria | 4508 |
| 364 | Ga0207683_10070748 | 3300026121 | Bacteria | 3083 |
| 365 | Ga0207683_10127400 | 3300026121 | Bacteria | 2289 |
| 366 | Ga0207683_10205373 | 3300026121 | Bacteria | 1792 |
| 367 | Ga0207698_10013935 | 3300026142 | Bacteria | 5325 |
| 368 | Ga0207698_10062239 | 3300026142 | Bacteria | 2913 |
| 369 | Ga0207698_10069148 | 3300026142 | Bacteria | 2791 |
| 370 | Ga0207698_10289035 | 3300026142 | Bacteria | 1520 |
| 371 | Ga0209589_1000035 | 3300027357 | Bacteria | 134091 |
| 372 | Ga0209489_100079 | 3300027361 | Bacteria | 134091 |
| 373 | Ga0209700_100077 | 3300027363 | Bacteria | 134091 |
| 374 | Ga0209588_1002870 | 3300027671 | Bacteria | 4731 |
| 375 | Ga0268266_10062908 | 3300028379 | Bacteria | 3203 |
| 376 | Ga0268266_10115856 | 3300028379 | Bacteria | 2379 |
| 377 | Ga0268266_10269427 | 3300028379 | Bacteria | 1580 |
| 378 | Ga0268265_10061099 | 3300028380 | Bacteria | 2890 |
| 379 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 380 | Ga0268264_10078139 | 3300028381 | Bacteria | 2821 |
| 381 | Ga0268264_10308314 | 3300028381 | Bacteria | 1492 |
| 382 | Ga0265334_10005996 | 3300028573 | Bacteria | 5279 |
| 383 | Ga0307515_10030422 | 3300028794 | Bacteria | 9065 |
| 384 | Ga0307515_10137546 | 3300028794 | Bacteria | 2644 |
| 385 | Ga0265338_10761647 | 3300028800 | Bacteria | 665 |
| 386 | Ga0265330_10015040 | 3300031235 | Bacteria | 3583 |
| 387 | Ga0265330_10033136 | 3300031235 | Bacteria | 2312 |
| 388 | Ga0265330_10077895 | 3300031235 | Bacteria | 1430 |
| 389 | Ga0265330_10098097 | 3300031235 | Bacteria | 1255 |
| 390 | Ga0265332_10002500 | 3300031238 | Bacteria | 9344 |
| 391 | Ga0265332_10127201 | 3300031238 | Bacteria | 1069 |
| 392 | Ga0265325_10008179 | 3300031241 | Bacteria | 6196 |
| 393 | Ga0265340_10059885 | 3300031247 | Bacteria | 1825 |
| 394 | Ga0265340_10085252 | 3300031247 | Bacteria | 1482 |
| 395 | Ga0265340_10250690 | 3300031247 | Bacteria | 789 |
| 396 | Ga0265339_10032253 | 3300031249 | Bacteria | 2955 |
| 397 | Ga0265339_10048152 | 3300031249 | Bacteria | 2338 |
| 398 | Ga0265339_10085392 | 3300031249 | Bacteria | 1662 |
| 399 | Ga0265331_10012649 | 3300031250 | Bacteria | 4564 |
| 400 | Ga0265316_10100653 | 3300031344 | Bacteria | 2197 |
| 401 | Ga0265316_10218705 | 3300031344 | Bacteria | 1406 |
| 402 | Ga0307513_10154517 | 3300031456 | Bacteria | 2197 |
| 403 | Ga0307509_10606463 | 3300031507 | Bacteria | 767 |
| 404 | Ga0307408_100413760 | 3300031548 | Bacteria | 1161 |
| 405 | Ga0307408_100749340 | 3300031548 | Bacteria | 882 |
| 406 | Ga0307408_101145569 | 3300031548 | Bacteria | 723 |
| 407 | Ga0307508_10152484 | 3300031616 | Bacteria | 1915 |
| 408 | Ga0307508_10166436 | 3300031616 | Bacteria | 1808 |
| 409 | Ga0307508_10169246 | 3300031616 | Bacteria | 1789 |
| 410 | Ga0265314_10026988 | 3300031711 | Bacteria | 4306 |
| 411 | Ga0265314_10049337 | 3300031711 | Bacteria | 2948 |
| 412 | Ga0265314_10117320 | 3300031711 | Bacteria | 1682 |
| 413 | Ga0265314_10137687 | 3300031711 | Bacteria | 1514 |
| 414 | Ga0265314_10460891 | 3300031711 | Bacteria | 675 |
| 415 | Ga0265342_10007969 | 3300031712 | Bacteria | 7669 |
| 416 | Ga0265342_10026156 | 3300031712 | Bacteria | 3660 |
| 417 | Ga0265342_10326251 | 3300031712 | Bacteria | 803 |
| 418 | Ga0265342_10348656 | 3300031712 | Bacteria | 771 |
| 419 | Ga0307516_10164027 | 3300031730 | Bacteria | 1969 |
| 420 | Ga0307406_10115655 | 3300031901 | Bacteria | 1855 |
| 421 | Ga0307406_10522409 | 3300031901 | Bacteria | 966 |
| 422 | Ga0307412_10027981 | 3300031911 | Bacteria | 3522 |
| 423 | Ga0307412_10381740 | 3300031911 | Bacteria | 1141 |
| 424 | Ga0307409_101098149 | 3300031995 | Bacteria | 816 |
| 425 | Ga0307416_100325612 | 3300032002 | Bacteria | 1541 |
| 426 | Ga0307416_100492732 | 3300032002 | Bacteria | 1288 |
| 427 | Ga0307416_101335066 | 3300032002 | Bacteria | 823 |
| 428 | Ga0307411_10360605 | 3300032005 | Bacteria | 1188 |
| 429 | Ga0307510_10014100 | 3300033180 | Bacteria | 9465 |
| 430 | Ga0307510_10097348 | 3300033180 | Bacteria | 2753 |
| 431 | Ga0373930_0008048 | 3300034816 | Bacteria | 1835 |
| 432 | Ga0373958_0109169 | 3300034819 | Bacteria | 658 |
| 433 | Ga0373929_0051418 | 3300035085 | Bacteria | 943 |
| 434 | Ga0373934_0078402 | 3300035086 | Bacteria | 1325 |
| 435 | Ga0373934_0107241 | 3300035086 | Bacteria | 1131 |
| 436 | Ga0373944_0029669 | 3300035089 | Bacteria | 1637 |
| 437 | Ga0373944_0173504 | 3300035089 | Bacteria | 770 |
| 438 | Ga0373923_0002456 | 3300035111 | Bacteria | 5712 |
| 439 | Ga0373923_0124871 | 3300035111 | Bacteria | 1152 |
| 440 | Ga0373932_0025204 | 3300035112 | Bacteria | 1608 |
| 441 | Ga0373936_0098217 | 3300035113 | Bacteria | 1234 |
| 442 | Ga0373936_0425131 | 3300035113 | Bacteria | 612 |
| 443 | Ga0373939_0118602 | 3300035114 | Bacteria | 931 |
| 444 | Ga0373941_0242371 | 3300035115 | Bacteria | 701 |
| 445 | Ga0373953_0006029 | 3300035117 | Bacteria | 3971 |
| 446 | Ga0373953_0015403 | 3300035117 | Bacteria | 2770 |
| 447 | Ga0373954_0006064 | 3300035118 | Bacteria | 5257 |
| 448 | Ga0373954_0041778 | 3300035118 | Bacteria | 2138 |
| 449 | Ga0373956_0000581 | 3300035119 | Bacteria | 14992 |
| 450 | Ga0373956_0213345 | 3300035119 | Bacteria | 916 |
| 451 | Ga0373957_0001140 | 3300035120 | Bacteria | 7044 |
| 452 | Ga0373957_0034748 | 3300035120 | Bacteria | 1869 |
| 453 | Ga0373957_0226591 | 3300035120 | Bacteria | 783 |
| 454 | Ga0373943_0004960 | 3300035170 | Bacteria | 6009 |
| 455 | Ga0373946_0005215 | 3300035171 | Bacteria | 4685 |
| 456 | Ga0373946_0135029 | 3300035171 | Bacteria | 1139 |
| 457 | Ga0373946_0139685 | 3300035171 | Bacteria | 1122 |
| 458 | Ga0373955_0005025 | 3300035172 | Bacteria | 5912 |
| 459 | Ga0373955_0018188 | 3300035172 | Bacteria | 3491 |
| 460 | Ga0373942_0140426 | 3300035207 | Bacteria | 769 |
| 461 | Ga0373924_0003746 | 3300035410 | Bacteria | 5257 |
| 462 | Ga0373924_0031077 | 3300035410 | Bacteria | 2145 |
| 463 | Ga0373931_0429106 | 3300035691 | Bacteria | 842 |
| 464 | Ga0373935_0000595 | 3300035692 | Bacteria | 18877 |
| 465 | Ga0373935_0104255 | 3300035692 | Bacteria | 1874 |
| 466 | Ga0373935_0373992 | 3300035692 | Bacteria | 1019 |
| 467 | Ga0373927_0001021 | 3300035695 | Bacteria | 21303 |
| 468 | Ga0373927_0012902 | 3300035695 | Bacteria | 5557 |
| 469 | Ga0373927_0312382 | 3300035695 | Bacteria | 1035 |
| 470 | Ga0373927_0343719 | 3300035695 | Bacteria | 983 |
| 471 | Ga0373933_0000218 | 3300035724 | Bacteria | 37928 |
| 472 | Ga0373933_0001113 | 3300035724 | Bacteria | 16004 |
| 473 | Ga0373933_0068376 | 3300035724 | Bacteria | 2157 |
| 474 | Ga0373947_0000970 | 3300035725 | Bacteria | 17506 |
| 475 | Ga0373947_0082864 | 3300035725 | Bacteria | 1988 |
| 476 | Ga0373947_0392519 | 3300035725 | Bacteria | 935 |
| 477 | Ga0373937_0015997 | 3300036401 | Bacteria | 6653 |
| 478 | Ga0373937_0104647 | 3300036401 | Bacteria | 2629 |
| 479 | Ga0373937_0236799 | 3300036401 | Bacteria | 1719 |
| 480 | Ga0373925_0022227 | 3300037068 | Bacteria | 4625 |
| 481 | Ga0373925_0047991 | 3300037068 | Bacteria | 3180 |
| 482 | Ga0395900_0068610 | 3300037418 | Bacteria | 3644 |
| 483 | Ga0395900_0169303 | 3300037418 | Bacteria | 2225 |
| 484 | Ga0395900_0190863 | 3300037418 | Bacteria | 2078 |
| 485 | Ga0395898_0233063 | 3300037466 | Bacteria | 1756 |
| 486 | Ga0395898_0389877 | 3300037466 | Bacteria | 1328 |
| 487 | Ga0395905_0150031 | 3300037471 | Bacteria | 2193 |
| 488 | Ga0395905_0587127 | 3300037471 | Bacteria | 1016 |
| 489 | Ga0395901_0258192 | 3300038443 | Bacteria | 1814 |
| 490 | Ga0395901_0528410 | 3300038443 | Bacteria | 1198 |
| 491 | Ga0237819_04025 | 3300038705 | Bacteria | 2489 |
| 492 | Ga0436365_0345621 | 3300039437 | Bacteria | 1210 |
| 493 | Ga0436365_0364359 | 3300039437 | Bacteria | 2347 |
| 494 | Ga0436365_0747851 | 3300039437 | Bacteria | 599 |
| 495 | Ga0436360_0339772 | 3300039438 | Bacteria | 4887 |
| 496 | Ga0436360_0859761 | 3300039438 | Bacteria | 704 |
| 497 | Ga0436360_1157986 | 3300039438 | Bacteria | 1032 |
| 498 | Ga0436363_0784614 | 3300039450 | Bacteria | 4330 |
| 499 | Ga0436363_1136180 | 3300039450 | Bacteria | 1688 |
| 500 | Ga0436363_1514540 | 3300039450 | Bacteria | 637 |
| 501 | Ga0436362_1002335 | 3300039453 | Bacteria | 7981 |
| 502 | Ga0451793_0905474 | 3300041452 | Bacteria | 1312 |
| 503 | Ga0451797_0420178 | 3300041453 | Bacteria | 1249 |
| 504 | Ga0451847_0677595 | 3300041503 | Bacteria | 1000 |
| 505 | Ga0466969_0056131 | 3300044656 | Bacteria | 1924 |
| 506 | Ga0466972_0000804 | 3300044658 | Bacteria | 14929 |
| 507 | Ga0466965_0027670 | 3300044683 | Bacteria | 2753 |
| 508 | Ga0466965_0265746 | 3300044683 | Bacteria | 923 |
| 509 | Ga0466966_0352077 | 3300044684 | Bacteria | 885 |
| 510 | Ga0466966_0551757 | 3300044684 | Bacteria | 693 |
| 511 | Ga0466961_0477019 | 3300044693 | Bacteria | 754 |
| 512 | Ga0466963_0373793 | 3300044694 | Bacteria | 1004 |
| 513 | Ga0466964_0054111 | 3300044706 | Bacteria | 1654 |
| 514 | Ga0466971_0109001 | 3300044719 | Bacteria | 1277 |
| 515 | Ga0466968_0200919 | 3300044735 | Bacteria | 934 |
| 516 | Ga0466970_0052790 | 3300044765 | Bacteria | 2170 |
| 517 | Ga0466959_0092328 | 3300045049 | Bacteria | 2173 |
| 518 | Ga0466967_0133246 | 3300045976 | Bacteria | 2309 |
| 519 | Ga0466967_0171920 | 3300045976 | Bacteria | 2039 |
| 520 | Ga0466967_0708093 | 3300045976 | Bacteria | 997 |
| 521 | Ga0495592_0004267 | 3300046454 | Bacteria | 10446 |
| 522 | Ga0495592_0044642 | 3300046454 | Bacteria | 3310 |
| 523 | Ga0495592_0334013 | 3300046454 | Bacteria | 976 |
| 524 | Ga0495603_0001390 | 3300046455 | Bacteria | 14060 |
| 525 | Ga0495603_0008445 | 3300046455 | Bacteria | 6221 |
| 526 | Ga0495603_0012891 | 3300046455 | Bacteria | 5055 |
| 527 | Ga0495603_0057866 | 3300046455 | Bacteria | 2293 |
| 528 | Ga0495603_0064921 | 3300046455 | Bacteria | 2151 |
| 529 | Ga0495603_0240265 | 3300046455 | Bacteria | 1043 |
| 530 | Ga0495629_0000915 | 3300046459 | Bacteria | 23696 |
| 531 | Ga0495629_0004437 | 3300046459 | Bacteria | 10512 |
| 532 | Ga0495629_0049476 | 3300046459 | Bacteria | 2946 |
| 533 | Ga0495629_0068873 | 3300046459 | Bacteria | 2469 |
| 534 | Ga0495629_0314289 | 3300046459 | Bacteria | 1071 |
| 535 | Ga0495638_0046132 | 3300046460 | Bacteria | 2738 |
| 536 | Ga0495641_0007969 | 3300046461 | Bacteria | 6530 |
| 537 | Ga0495641_0035619 | 3300046461 | Bacteria | 2344 |
| 538 | Ga0495651_0021120 | 3300046462 | Bacteria | 5056 |
| 539 | Ga0495651_0425836 | 3300046462 | Bacteria | 862 |
| 540 | Ga0495651_0510912 | 3300046462 | Bacteria | 768 |
| 541 | Ga0495653_0020185 | 3300046463 | Bacteria | 5401 |
| 542 | Ga0495653_0054414 | 3300046463 | Bacteria | 3058 |
| 543 | Ga0495580_0009685 | 3300046472 | Bacteria | 7560 |
| 544 | Ga0495580_0250141 | 3300046472 | Bacteria | 1214 |
| 545 | Ga0495582_0000302 | 3300046473 | Bacteria | 27218 |
| 546 | Ga0495582_0345079 | 3300046473 | Bacteria | 857 |
| 547 | Ga0495639_0016344 | 3300046475 | Bacteria | 3221 |
| 548 | Ga0495639_0019607 | 3300046475 | Bacteria | 2953 |
| 549 | Ga0495639_0022697 | 3300046475 | Bacteria | 2753 |
| 550 | Ga0495662_0001985 | 3300046476 | Bacteria | 10261 |
| 551 | Ga0495662_0047542 | 3300046476 | Bacteria | 2071 |
| 552 | Ga0495664_0019091 | 3300046477 | Bacteria | 3937 |
| 553 | Ga0495664_0029125 | 3300046477 | Bacteria | 3227 |
| 554 | Ga0495664_0054710 | 3300046477 | Bacteria | 2373 |
| 555 | Ga0495664_0347623 | 3300046477 | Bacteria | 893 |
| 556 | Ga0495585_0192538 | 3300046492 | Bacteria | 1042 |
| 557 | Ga0495594_0000046 | 3300046499 | Bacteria | 53822 |
| 558 | Ga0495594_0006637 | 3300046499 | Bacteria | 5956 |
| 559 | Ga0495596_0075852 | 3300046500 | Bacteria | 1306 |
| 560 | Ga0495607_0252083 | 3300046501 | Bacteria | 849 |
| 561 | Ga0495583_0130589 | 3300046506 | Bacteria | 1051 |
| 562 | Ga0495583_0219465 | 3300046506 | Bacteria | 769 |
| 563 | Ga0495606_0001471 | 3300046507 | Bacteria | 31450 |
| 564 | Ga0495606_0270629 | 3300046507 | Bacteria | 933 |
| 565 | Ga0495606_0401374 | 3300046507 | Bacteria | 714 |
| 566 | Ga0495608_0040877 | 3300046511 | Bacteria | 3105 |
| 567 | Ga0495608_0160446 | 3300046511 | Bacteria | 1430 |
| 568 | Ga0495610_0121130 | 3300046512 | Bacteria | 1146 |
| 569 | Ga0495616_0045646 | 3300046513 | Bacteria | 2216 |
| 570 | Ga0495616_0059586 | 3300046513 | Bacteria | 1877 |
| 571 | Ga0495618_0023457 | 3300046514 | Bacteria | 3816 |
| 572 | Ga0495618_0029523 | 3300046514 | Bacteria | 3422 |
| 573 | Ga0495620_0013237 | 3300046515 | Bacteria | 4230 |
| 574 | Ga0495628_0032224 | 3300046516 | Bacteria | 4232 |
| 575 | Ga0495628_0049222 | 3300046516 | Bacteria | 3337 |
| 576 | Ga0495628_0187605 | 3300046516 | Bacteria | 1562 |
| 577 | Ga0495628_0333812 | 3300046516 | Bacteria | 1117 |
| 578 | Ga0495630_0004933 | 3300046517 | Bacteria | 9381 |
| 579 | Ga0495631_0097076 | 3300046518 | Bacteria | 1268 |
| 580 | Ga0495631_0098219 | 3300046518 | Bacteria | 1260 |
| 581 | Ga0495631_0188122 | 3300046518 | Bacteria | 884 |
| 582 | Ga0495632_0035025 | 3300046519 | Bacteria | 2565 |
| 583 | Ga0495632_0293119 | 3300046519 | Bacteria | 723 |
| 584 | Ga0495637_0081247 | 3300046520 | Bacteria | 1292 |
| 585 | Ga0495643_0018786 | 3300046522 | Bacteria | 4007 |
| 586 | Ga0495663_0207400 | 3300046525 | Bacteria | 685 |
| 587 | Ga0495666_0094326 | 3300046526 | Bacteria | 1411 |
| 588 | Ga0495652_0006987 | 3300046529 | Bacteria | 10432 |
| 589 | Ga0495652_0056662 | 3300046529 | Bacteria | 3327 |
| 590 | Ga0495652_0097330 | 3300046529 | Bacteria | 2394 |
| 591 | Ga0495654_0062998 | 3300046530 | Bacteria | 1776 |
| 592 | Ga0495665_0000335 | 3300046531 | Bacteria | 23811 |
| 593 | Ga0495665_0495924 | 3300046531 | Bacteria | 615 |
| 594 | Ga0495640_0011568 | 3300046533 | Bacteria | 6783 |
| 595 | Ga0495640_0021072 | 3300046533 | Bacteria | 4791 |
| 596 | Ga0495640_0209295 | 3300046533 | Bacteria | 1233 |
| 597 | Ga0495586_0101878 | 3300046535 | Bacteria | 1594 |
| 598 | Ga0495587_0297084 | 3300046536 | Bacteria | 903 |
| 599 | Ga0495598_0013615 | 3300046537 | Bacteria | 2020 |
| 600 | Ga0495609_0065976 | 3300046538 | Bacteria | 1595 |
| 601 | Ga0495609_0148817 | 3300046538 | Bacteria | 996 |
| 602 | Ga0495621_0051417 | 3300046539 | Bacteria | 1474 |
| 603 | Ga0495645_0072915 | 3300046543 | Bacteria | 2473 |
| 604 | Ga0495645_0143727 | 3300046543 | Bacteria | 1662 |
| 605 | Ga0495645_0182261 | 3300046543 | Bacteria | 1438 |
| 606 | Ga0495622_0001947 | 3300046557 | Bacteria | 10142 |
| 607 | Ga0495622_0181910 | 3300046557 | Bacteria | 942 |
| 608 | Ga0495633_0107148 | 3300046558 | Bacteria | 1296 |
| 609 | Ga0495667_0038370 | 3300046559 | Bacteria | 3189 |
| 610 | Ga0495667_0076968 | 3300046559 | Bacteria | 2170 |
| 611 | Ga0495667_0212371 | 3300046559 | Bacteria | 1236 |
| 612 | Ga0495656_0043366 | 3300046615 | Bacteria | 1888 |
| 613 | Ga0495656_0103260 | 3300046615 | Bacteria | 1321 |
| 614 | Ga0495656_0235570 | 3300046615 | Bacteria | 920 |
| 615 | Ga0495668_0066637 | 3300046616 | Bacteria | 1981 |
| 616 | Ga0495668_0183741 | 3300046616 | Bacteria | 1145 |
| 617 | Ga0495634_0001329 | 3300046642 | Bacteria | 22513 |
| 618 | Ga0495634_0009349 | 3300046642 | Bacteria | 7232 |
| 619 | Ga0495611_0174808 | 3300046648 | Bacteria | 1003 |
| 620 | Ga0495611_0237727 | 3300046648 | Bacteria | 846 |
| 621 | Ga0495625_0124818 | 3300046660 | Bacteria | 1748 |
| 622 | Ga0495625_0181728 | 3300046660 | Bacteria | 1398 |
| 623 | Ga0495635_0011167 | 3300046663 | Bacteria | 6297 |
| 624 | Ga0495635_0016673 | 3300046663 | Bacteria | 5131 |
| 625 | Ga0495635_0032609 | 3300046663 | Bacteria | 3613 |
| 626 | Ga0495635_0093692 | 3300046663 | Bacteria | 2054 |
| 627 | Ga0495661_0074186 | 3300046665 | Bacteria | 1980 |
| 628 | Ga0495588_0002250 | 3300046674 | Bacteria | 8263 |
| 629 | Ga0495588_0005736 | 3300046674 | Bacteria | 5541 |
| 630 | Ga0495657_0028680 | 3300046675 | Bacteria | 3911 |
| 631 | Ga0495657_0046286 | 3300046675 | Bacteria | 2946 |
| 632 | Ga0495657_0157955 | 3300046675 | Bacteria | 1404 |
| 633 | Ga0495599_0007907 | 3300046678 | Bacteria | 6449 |
| 634 | Ga0495599_0028351 | 3300046678 | Bacteria | 3509 |
| 635 | Ga0495599_0358416 | 3300046678 | Bacteria | 873 |
| 636 | Ga0495623_0020395 | 3300046679 | Bacteria | 4283 |
| 637 | Ga0495623_0277154 | 3300046679 | Bacteria | 934 |
| 638 | Ga0495623_0666656 | 3300046679 | Bacteria | 535 |
| 639 | Ga0495646_0017629 | 3300046680 | Bacteria | 4528 |
| 640 | Ga0495646_0039700 | 3300046680 | Bacteria | 2901 |
| 641 | Ga0495646_0254534 | 3300046680 | Bacteria | 939 |
| 642 | Ga0495647_0000898 | 3300046681 | Bacteria | 8925 |
| 643 | Ga0495647_0032228 | 3300046681 | Bacteria | 1952 |
| 644 | Ga0495647_0269454 | 3300046681 | Bacteria | 762 |
| 645 | Ga0495658_0000201 | 3300046683 | Bacteria | 34784 |
| 646 | Ga0495669_0028232 | 3300046684 | Bacteria | 2456 |
| 647 | Ga0495613_0004521 | 3300046689 | Bacteria | 10429 |
| 648 | Ga0495613_0013945 | 3300046689 | Bacteria | 5964 |
| 649 | Ga0495613_0107083 | 3300046689 | Bacteria | 2017 |
| 650 | Ga0495624_0004061 | 3300046690 | Bacteria | 10771 |
| 651 | Ga0495624_0231555 | 3300046690 | Bacteria | 1119 |
| 652 | Ga0495624_0779064 | 3300046690 | Bacteria | 566 |
| 653 | Ga0495670_0063775 | 3300046691 | Bacteria | 1855 |
| 654 | Ga0495649_0434866 | 3300046694 | Bacteria | 656 |
| 655 | Ga0495589_0105225 | 3300046794 | Bacteria | 1364 |
| 656 | Ga0495600_0078269 | 3300046809 | Bacteria | 2159 |
| 657 | Ga0495600_0099016 | 3300046809 | Bacteria | 1900 |
| 658 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 659 | Ga0495581_0019419 | 3300047315 | Bacteria | 3945 |
| 660 | Ga0495581_0162600 | 3300047315 | Bacteria | 1305 |
| 661 | Ga0495581_0262381 | 3300047315 | Bacteria | 1010 |
| 662 | Ga0495604_0013451 | 3300047317 | Bacteria | 6520 |
| 663 | Ga0495604_0404292 | 3300047317 | Bacteria | 899 |
| 664 | Ga0495604_0776886 | 3300047317 | Bacteria | 604 |
| 665 | Ga0495674_0002494 | 3300047319 | Bacteria | 17944 |
| 666 | Ga0495674_0022918 | 3300047319 | Bacteria | 5753 |
| 667 | Ga0495674_0117626 | 3300047319 | Bacteria | 2248 |
| 668 | Ga0495672_0011216 | 3300047320 | Bacteria | 6335 |
| 669 | Ga0495672_0033255 | 3300047320 | Bacteria | 3196 |
| 670 | Ga0495676_0005339 | 3300047321 | Bacteria | 11767 |
| 671 | Ga0495680_0008534 | 3300047322 | Bacteria | 9307 |
| 672 | Ga0495680_0028090 | 3300047322 | Bacteria | 4615 |
| 673 | Ga0495680_0097180 | 3300047322 | Bacteria | 2199 |
| 674 | Ga0495680_0791809 | 3300047322 | Bacteria | 620 |
| 675 | Ga0495683_0289019 | 3300047323 | Bacteria | 707 |
| 676 | Ga0495675_0010421 | 3300047444 | Bacteria | 5811 |
| 677 | Ga0495675_0017447 | 3300047444 | Bacteria | 4549 |
| 678 | Ga0495677_0135314 | 3300047445 | Bacteria | 944 |
| 679 | Ga0495685_021155 | 3300047447 | Bacteria | 2237 |
| 680 | Ga0495673_0115066 | 3300047469 | Bacteria | 1071 |
| 681 | Ga0495673_0181708 | 3300047469 | Bacteria | 796 |
| 682 | Ga0495681_0090192 | 3300047470 | Bacteria | 1355 |
| 683 | Ga0495684_0013438 | 3300047471 | Bacteria | 6301 |
| 684 | Ga0495684_0014274 | 3300047471 | Bacteria | 6112 |
| 685 | Ga0495684_0099383 | 3300047471 | Bacteria | 2200 |
| 686 | Ga0495686_0012793 | 3300047472 | Bacteria | 5855 |
| 687 | Ga0495686_0139005 | 3300047472 | Bacteria | 1434 |
| 688 | Ga0495686_0498469 | 3300047472 | Bacteria | 641 |
| 689 | Ga0495593_0000100 | 3300047673 | Bacteria | 39337 |
| 690 | Ga0495593_0000740 | 3300047673 | Bacteria | 18976 |
| 691 | Ga0495593_0068818 | 3300047673 | Bacteria | 1842 |
| 692 | Ga0495602_0045053 | 3300048088 | Bacteria | 3994 |
| 693 | Ga0495602_0091663 | 3300048088 | Bacteria | 2519 |
| 694 | Ga0495602_0272624 | 3300048088 | Bacteria | 1250 |
| 695 | Ga0495602_0515858 | 3300048088 | Bacteria | 833 |
| 696 | Ga0495614_0007180 | 3300048089 | Bacteria | 4968 |
| 697 | Ga0495615_0060674 | 3300048090 | Bacteria | 997 |
| 698 | Ga0495626_0060081 | 3300048091 | Bacteria | 1733 |
| 699 | Ga0496100_0003200 | 3300048903 | Bacteria | 8504 |
| 700 | Ga0496100_0108403 | 3300048903 | Bacteria | 1926 |
| 701 | Ga0496101_0021912 | 3300048904 | Bacteria | 4391 |
| 702 | Ga0496101_0157719 | 3300048904 | Bacteria | 1739 |
| 703 | Ga0496101_0315228 | 3300048904 | Bacteria | 1227 |
| 704 | Ga0496102_0025407 | 3300048905 | Bacteria | 5272 |
| 705 | Ga0496102_0098842 | 3300048905 | Bacteria | 2708 |
| 706 | Ga0496102_0112985 | 3300048905 | Bacteria | 2534 |
| 707 | Ga0496102_0253625 | 3300048905 | Bacteria | 1659 |
| 708 | Ga0496102_0265482 | 3300048905 | Bacteria | 1618 |
| 709 | Ga0496102_0369963 | 3300048905 | Bacteria | 1349 |
| 710 | Ga0496102_0596015 | 3300048905 | Bacteria | 1028 |
| 711 | Ga0496102_0918503 | 3300048905 | Bacteria | 797 |
| 712 | Ga0496102_1188152 | 3300048905 | Bacteria | 682 |
| 713 | Ga0496103_0031134 | 3300048906 | Bacteria | 3250 |
| 714 | Ga0496103_0193606 | 3300048906 | Bacteria | 1307 |
| 715 | Ga0496104_0012106 | 3300048907 | Bacteria | 7744 |
| 716 | Ga0496104_0133370 | 3300048907 | Bacteria | 2386 |
| 717 | Ga0496104_1257594 | 3300048907 | Bacteria | 643 |
| 718 | Ga0496105_0081851 | 3300048908 | Bacteria | 2666 |
| 719 | Ga0496105_0136497 | 3300048908 | Bacteria | 2021 |
| 720 | Ga0496106_0013334 | 3300048909 | Bacteria | 6067 |
| 721 | Ga0496106_0031809 | 3300048909 | Bacteria | 3932 |
| 722 | Ga0496106_0886439 | 3300048909 | Bacteria | 705 |
| 723 | Ga0496106_1383308 | 3300048909 | Bacteria | 544 |
| 724 | Ga0496107_0006358 | 3300048910 | Bacteria | 8120 |
| 725 | Ga0496107_0029342 | 3300048910 | Bacteria | 3912 |
| 726 | Ga0496107_0050760 | 3300048910 | Bacteria | 2991 |
| 727 | Ga0496107_0165818 | 3300048910 | Bacteria | 1638 |
| 728 | Ga0496108_0000160 | 3300048911 | Bacteria | 64120 |
| 729 | Ga0496108_0019419 | 3300048911 | Bacteria | 5581 |
| 730 | Ga0496108_0166431 | 3300048911 | Bacteria | 1906 |
| 731 | Ga0496108_1285607 | 3300048911 | Bacteria | 616 |
| 732 | Ga0496109_0000245 | 3300048912 | Bacteria | 52201 |
| 733 | Ga0496109_0092517 | 3300048912 | Bacteria | 2797 |
| 734 | Ga0496109_0105058 | 3300048912 | Bacteria | 2623 |
| 735 | Ga0496109_0863893 | 3300048912 | Bacteria | 842 |
| 736 | Ga0496109_0967809 | 3300048912 | Bacteria | 789 |
| 737 | Ga0496109_1175280 | 3300048912 | Bacteria | 704 |
| 738 | Ga0496110_0112856 | 3300048913 | Bacteria | 2443 |
| 739 | Ga0496110_0196580 | 3300048913 | Bacteria | 1832 |
| 740 | Ga0496110_0293506 | 3300048913 | Bacteria | 1481 |
| 741 | Ga0496110_0293709 | 3300048913 | Bacteria | 1480 |
| 742 | Ga0496110_0486920 | 3300048913 | Bacteria | 1123 |
| 743 | Ga0496111_0109796 | 3300048914 | Bacteria | 2031 |
| 744 | Ga0496111_0197788 | 3300048914 | Bacteria | 1494 |
| 745 | Ga0496111_0211141 | 3300048914 | Bacteria | 1442 |
| 746 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 747 | Ga0496112_0004529 | 3300048915 | Bacteria | 11807 |
| 748 | Ga0496112_0074784 | 3300048915 | Bacteria | 3350 |
| 749 | Ga0496112_0084168 | 3300048915 | Bacteria | 3146 |
| 750 | Ga0496112_0168495 | 3300048915 | Bacteria | 2156 |
| 751 | Ga0496112_0174060 | 3300048915 | Bacteria | 2117 |
| 752 | Ga0496112_0390338 | 3300048915 | Bacteria | 1332 |
| 753 | Ga0496112_0607322 | 3300048915 | Bacteria | 1025 |
| 754 | Ga0496113_0008153 | 3300048916 | Bacteria | 6804 |
| 755 | Ga0496113_0110348 | 3300048916 | Bacteria | 2140 |
| 756 | Ga0496113_0239520 | 3300048916 | Bacteria | 1447 |
| 757 | Ga0496113_0419898 | 3300048916 | Bacteria | 1074 |
| 758 | Ga0496114_0037094 | 3300048917 | Bacteria | 4031 |
| 759 | Ga0496114_0090327 | 3300048917 | Bacteria | 2600 |
| 760 | Ga0496114_0199892 | 3300048917 | Bacteria | 1750 |
| 761 | Ga0496115_0000743 | 3300048918 | Bacteria | 24064 |
| 762 | Ga0496115_0025011 | 3300048918 | Bacteria | 4645 |
| 763 | Ga0496115_0047980 | 3300048918 | Bacteria | 3416 |
| 764 | Ga0496116_0001672 | 3300048919 | Bacteria | 24354 |
| 765 | Ga0496116_0235183 | 3300048919 | Bacteria | 925 |
| 766 | Ga0496117_0040333 | 3300048920 | Bacteria | 3434 |
| 767 | Ga0496117_0225219 | 3300048920 | Bacteria | 1040 |
| 768 | Ga0496117_0451247 | 3300048920 | Bacteria | 636 |
| 769 | Ga0496118_0050095 | 3300048921 | Bacteria | 3209 |
| 770 | Ga0496118_0198075 | 3300048921 | Bacteria | 1193 |
| 771 | Ga0496119_0178993 | 3300048922 | Bacteria | 1113 |
| 772 | Ga0496120_0149386 | 3300048923 | Bacteria | 1176 |
| 773 | Ga0496120_0158380 | 3300048923 | Bacteria | 1131 |
| 774 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 775 | Ga0496121_0013765 | 3300048924 | Bacteria | 8661 |
| 776 | Ga0496121_0023451 | 3300048924 | Bacteria | 5942 |
| 777 | Ga0496121_0042659 | 3300048924 | Bacteria | 3941 |
| 778 | Ga0496121_0153022 | 3300048924 | Bacteria | 1695 |
| 779 | Ga0496121_0231365 | 3300048924 | Bacteria | 1294 |
| 780 | Ga0496121_0267658 | 3300048924 | Bacteria | 1176 |
| 781 | Ga0496121_0306078 | 3300048924 | Bacteria | 1076 |
| 782 | Ga0496122_0016548 | 3300048925 | Bacteria | 6964 |
| 783 | Ga0496122_0129185 | 3300048925 | Bacteria | 1610 |
| 784 | Ga0496123_0010686 | 3300048926 | Bacteria | 8075 |
| 785 | Ga0496123_0017895 | 3300048926 | Bacteria | 5674 |
| 786 | Ga0496124_0075956 | 3300048927 | Bacteria | 2775 |
| 787 | Ga0496125_0000207 | 3300048928 | Bacteria | 122897 |
| 788 | Ga0496125_0012675 | 3300048928 | Bacteria | 8344 |
| 789 | Ga0496125_0013674 | 3300048928 | Bacteria | 7963 |
| 790 | Ga0496125_0084547 | 3300048928 | Bacteria | 2409 |
| 791 | Ga0496125_0180656 | 3300048928 | Bacteria | 1406 |
| 792 | Ga0496126_0010955 | 3300048929 | Bacteria | 9444 |
| 793 | Ga0496126_0062920 | 3300048929 | Bacteria | 3327 |
| 794 | Ga0496126_0083916 | 3300048929 | Bacteria | 2811 |
| 795 | Ga0496126_0120165 | 3300048929 | Bacteria | 2280 |
| 796 | Ga0496126_0145205 | 3300048929 | Bacteria | 2038 |
| 797 | Ga0496126_0163328 | 3300048929 | Bacteria | 1902 |
| 798 | Ga0496126_0203863 | 3300048929 | Bacteria | 1668 |
| 799 | Ga0496126_0567270 | 3300048929 | Bacteria | 898 |
| 800 | Ga0496126_0670628 | 3300048929 | Bacteria | 809 |
| 801 | Ga0496126_0736918 | 3300048929 | Bacteria | 762 |
| 802 | Ga0501031_0265138 | 3300049568 | Bacteria | 1116 |
| 803 | Ga0501032_0042579 | 3300049569 | Bacteria | 3079 |
| 804 | Ga0501032_0494254 | 3300049569 | Bacteria | 782 |
| 805 | Ga0501033_0078391 | 3300049570 | Bacteria | 2424 |
| 806 | Ga0501033_0396207 | 3300049570 | Bacteria | 963 |
| 807 | Ga0501034_0231621 | 3300049571 | Bacteria | 1796 |
| 808 | Ga0501036_0270262 | 3300049572 | Bacteria | 1423 |
| 809 | Ga0501038_0111039 | 3300049574 | Bacteria | 2271 |
| 810 | Ga0501038_0171120 | 3300049574 | Bacteria | 1758 |
| 811 | Ga0501038_0540309 | 3300049574 | Bacteria | 887 |
| 812 | Ga0501039_0321447 | 3300049575 | Bacteria | 1216 |
| 813 | Ga0501041_0656203 | 3300049577 | Bacteria | 671 |
| 814 | Ga0501046_0122826 | 3300049580 | Bacteria | 1975 |
| 815 | Ga0501047_0236061 | 3300049581 | Bacteria | 1680 |
| 816 | Ga0501067_0071550 | 3300049583 | Bacteria | 1921 |
| 817 | Ga0501067_0193270 | 3300049583 | Bacteria | 1134 |
| 818 | Ga0501070_0203155 | 3300049586 | Bacteria | 1627 |
| 819 | Ga0501070_0446170 | 3300049586 | Bacteria | 1043 |
| 820 | Ga0501070_0879100 | 3300049586 | Bacteria | 700 |
| 821 | Ga0501070_0887744 | 3300049586 | Bacteria | 696 |
| 822 | Ga0501072_0001175 | 3300049588 | Bacteria | 19481 |
| 823 | Ga0501074_0196720 | 3300049590 | Bacteria | 1437 |
| 824 | Ga0501035_0091906 | 3300049822 | Bacteria | 2670 |
| 825 | Ga0501035_0452299 | 3300049822 | Bacteria | 1062 |
| 826 | Ga0501035_0770734 | 3300049822 | Bacteria | 770 |
| 827 | Ga0501044_0312536 | 3300049823 | Bacteria | 1497 |
| 828 | Ga0501044_0543391 | 3300049823 | Bacteria | 1060 |
| 829 | nmdc:mga03n38_107709_c1 | 3300050490 | Bacteria | 1353 |
| 830 | nmdc:mga00v17_2666_c1 | 3300050491 | Bacteria | 9152 |
| 831 | nmdc:mga00v17_39990_c1 | 3300050491 | Bacteria | 2811 |
| 832 | nmdc:mga0yw44_174945_c1 | 3300050492 | Bacteria | 1411 |
| 833 | nmdc:mga0yw44_57766_c1 | 3300050492 | Bacteria | 2368 |
| 834 | nmdc:mga0yw44_91064_c1 | 3300050492 | Bacteria | 1927 |
| 835 | nmdc:mga0k408_16783_c1 | 3300050493 | Bacteria | 4069 |
| 836 | nmdc:mga07m45_339041_c1 | 3300050496 | Bacteria | 874 |
| 837 | nmdc:mga07m45_83022_c1 | 3300050496 | Bacteria | 1830 |
| 838 | nmdc:mga08y16_264528_c1 | 3300050511 | Bacteria | 1776 |
| 839 | nmdc:mga0rr50_160535_c1 | 3300050513 | Bacteria | 1824 |
| 840 | nmdc:mga08x19_111942_c1 | 3300050514 | Bacteria | 1821 |
| 841 | nmdc:mga0sz30_1770_c1 | 3300050516 | Bacteria | 7671 |
| 842 | Ga0495601_0020279 | 3300053077 | Bacteria | 4059 |
| 843 | Ga0495612_0008112 | 3300053078 | Bacteria | 4274 |
| 844 | Ga0495612_0212665 | 3300053078 | Bacteria | 855 |
| 845 | Ga0500635_0019445 | 3300053080 | Bacteria | 2064 |
| 846 | Ga0495595_0001985 | 3300053084 | Bacteria | 7953 |
| 847 | Ga0495595_0003331 | 3300053084 | Bacteria | 6376 |
| 848 | Ga0495595_0403992 | 3300053084 | Bacteria | 692 |
| 849 | Ga0495619_0013161 | 3300053085 | Bacteria | 5213 |
| 850 | Ga0495619_0076187 | 3300053085 | Bacteria | 2251 |
| 851 | Ga0495619_0087435 | 3300053085 | Bacteria | 2107 |
| 852 | Ga0495619_0280022 | 3300053085 | Bacteria | 1156 |
| 853 | Ga0495619_0738122 | 3300053085 | Bacteria | 668 |
| 854 | Ga0500643_011603 | 3300053087 | Bacteria | 3202 |
| 855 | Ga0500644_0017901 | 3300053088 | Bacteria | 2065 |
| 856 | Ga0500581_079515 | 3300053089 | Bacteria | 1638 |
| 857 | Ga0500646_0033732 | 3300053090 | Bacteria | 1417 |
| 858 | Ga0500646_0075827 | 3300053090 | Bacteria | 1017 |
| 859 | Ga0500583_0127484 | 3300053092 | Bacteria | 1261 |
| 860 | Ga0500641_0018452 | 3300053096 | Bacteria | 2624 |
| 861 | Ga0500554_004441 | 3300053102 | Bacteria | 2974 |
| 862 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 863 | Ga0500556_0059496 | 3300053104 | Bacteria | 1404 |
| 864 | Ga0500562_005909 | 3300053108 | Bacteria | 3081 |
| 865 | Ga0500562_055931 | 3300053108 | Bacteria | 1057 |
| 866 | Ga0500569_001412 | 3300053109 | Bacteria | 4521 |
| 867 | Ga0500575_172801 | 3300053112 | Bacteria | 693 |
| 868 | Ga0500592_000600 | 3300053116 | Bacteria | 5910 |
| 869 | Ga0500595_003189 | 3300053119 | Bacteria | 7758 |
| 870 | Ga0500607_113450 | 3300053121 | Bacteria | 1324 |
| 871 | Ga0500617_156877 | 3300053124 | Bacteria | 893 |
| 872 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 873 | Ga0500652_000160 | 3300053131 | Bacteria | 25768 |
| 874 | Ga0500658_0085972 | 3300053134 | Bacteria | 1352 |
| 875 | Ga0500658_0090933 | 3300053134 | Bacteria | 1319 |
| 876 | Ga0500568_0002888 | 3300053139 | Bacteria | 9874 |
| 877 | Ga0500568_0007069 | 3300053139 | Bacteria | 5546 |
| 878 | Ga0500577_0032763 | 3300053142 | Bacteria | 1830 |
| 879 | Ga0500586_000112 | 3300053145 | Bacteria | 14466 |
| 880 | Ga0500588_0124971 | 3300053146 | Bacteria | 911 |
| 881 | Ga0500588_0178200 | 3300053146 | Bacteria | 780 |
| 882 | Ga0500590_135322 | 3300053148 | Bacteria | 1134 |
| 883 | Ga0500603_001369 | 3300053150 | Bacteria | 5560 |
| 884 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 885 | Ga0500616_0214824 | 3300053153 | Bacteria | 843 |
| 886 | Ga0500622_0003300 | 3300053156 | Bacteria | 10912 |
| 887 | Ga0500627_0365214 | 3300053158 | Bacteria | 621 |
| 888 | Ga0500634_0124148 | 3300053161 | Bacteria | 1251 |
| 889 | Ga0500634_0292049 | 3300053161 | Bacteria | 651 |
| 890 | Ga0500638_305919 | 3300053162 | Bacteria | 611 |
| 891 | Ga0500637_0003374 | 3300053178 | Bacteria | 7365 |
| 892 | Ga0500637_0198966 | 3300053178 | Bacteria | 1142 |
| 893 | Ga0500611_005120 | 3300053727 | Bacteria | 1822 |
| 894 | Ga0500611_169508 | 3300053727 | Bacteria | 607 |
| 895 | Ga0500645_026788 | 3300053730 | Bacteria | 1752 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053727 | Ga0500611_169508 | Ga0500611_169508_23_487 | 154 |
| 2 | 3300041452 | Ga0451793_0905474 | Ga0451793_0905474_770_1240 | 155 |
| 3 | 3300048924 | Ga0496121_0153022 | Ga0496121_0153022_408_878 | 155 |
| 4 | 3300048926 | Ga0496123_0017895 | Ga0496123_0017895_4647_5117 | 155 |
| 5 | 3300046543 | Ga0495645_0182261 | Ga0495645_0182261_97_612 | 158 |
| 6 | iso_pu_bacteria | 2643221734 | 2644737830 | 158 |
| 7 | 3300046559 | Ga0495667_0212371 | Ga0495667_0212371_640_1146 | 159 |
| 8 | 3300046675 | Ga0495657_0157955 | Ga0495657_0157955_613_1119 | 159 |
| 9 | 3300053084 | Ga0495595_0403992 | Ga0495595_0403992_47_553 | 159 |
| 10 | iso_pu_bacteria | 2602042107 | 2603858599 | 160 |
| 11 | iso_pu_bacteria | 2857524615 | 2857526276 | 160 |
| 12 | iso_pu_bacteria | 2919073203 | 2919073871 | 160 |
| 13 | iso_pu_bacteria | 8056681323 | 8056682960 | 161 |
| 14 | 3300005548 | Ga0070665_101624430 | Ga0070665_1016244301 | 162 |
| 15 | iso_pu_bacteria | 2513237092 | 2513623909 | 162 |
| 16 | iso_pu_bacteria | 2513237096 | 2513659527 | 162 |
| 17 | iso_pu_bacteria | 2513237145 | 2513921540 | 162 |
| 18 | iso_pu_bacteria | 2524023228 | 2524537503 | 162 |
| 19 | iso_pu_bacteria | 2617270741 | 2617373513 | 162 |
| 20 | iso_pu_bacteria | 2667528175 | 2671124057 | 162 |
| 21 | iso_pu_bacteria | 2728368998 | 2728755268 | 162 |
| 22 | iso_pu_bacteria | 2791355196 | 2793062254 | 162 |
| 23 | iso_pu_bacteria | 2791355197 | 2793072693 | 162 |
| 24 | iso_pu_bacteria | 2824679649 | 2824684820 | 162 |
| 25 | iso_pu_bacteria | 2824732956 | 2824739294 | 162 |
| 26 | iso_pu_bacteria | 2824746037 | 2824751156 | 162 |
| 27 | iso_pu_bacteria | 2849076700 | 2849083230 | 162 |
| 28 | iso_pu_bacteria | 2874620515 | 2874621185 | 162 |
| 29 | iso_pu_bacteria | 2885374607 | 2885377574 | 162 |
| 30 | iso_pu_bacteria | 2903748898 | 2903758779 | 162 |
| 31 | iso_pu_bacteria | 2904666416 | 2904667730 | 162 |
| 32 | iso_pu_bacteria | 2904690495 | 2904690988 | 162 |
| 33 | iso_pu_bacteria | 2906610324 | 2906613553 | 162 |
| 34 | iso_pu_bacteria | 2906635258 | 2906636588 | 162 |
| 35 | iso_pu_bacteria | 2906660503 | 2906668090 | 162 |
| 36 | iso_pu_bacteria | 2908739725 | 2908747671 | 162 |
| 37 | iso_pu_bacteria | 2908756301 | 2908757046 | 162 |
| 38 | iso_pu_bacteria | 2908775508 | 2908775984 | 162 |
| 39 | iso_pu_bacteria | 2922425934 | 2922433994 | 162 |
| 40 | iso_pu_bacteria | 2935630451 | 2935636022 | 162 |
| 41 | iso_pu_bacteria | 2941507105 | 2941512674 | 162 |
| 42 | iso_pu_bacteria | 2941515067 | 2941520488 | 162 |
| 43 | iso_pu_bacteria | 2941523033 | 2941528502 | 162 |
| 44 | iso_pu_bacteria | 3005474847 | 3005475292 | 162 |
| 45 | iso_pu_bacteria | 8006933436 | 8006935985 | 162 |
| 46 | iso_pu_bacteria | 8006973647 | 8006975891 | 162 |
| 47 | iso_pu_bacteria | 8019555841 | 8019562672 | 162 |
| 48 | iso_pu_bacteria | 8056689827 | 8056693797 | 162 |
| 49 | 3300003775 | Ga0055524_1047432 | Ga0055524_10474322 | 163 |
| 50 | 3300005262 | Ga0065165_1000014 | Ga0065165_1000014253 | 163 |
| 51 | 3300005437 | Ga0070710_10440555 | Ga0070710_104405551 | 163 |
| 52 | 3300025284 | Ga0209130_1000024 | Ga0209130_100002423 | 163 |
| 53 | 3300025299 | Ga0209256_1001059 | Ga0209256_10010594 | 163 |
| 54 | 3300025302 | Ga0207426_1024685 | Ga0207426_10246852 | 163 |
| 55 | 3300038705 | Ga0237819_04025 | Ga0237819_04025_1138_1644 | 163 |
| 56 | 3300005327 | Ga0070658_10463689 | Ga0070658_104636892 | 164 |
| 57 | 3300005353 | Ga0070669_100113184 | Ga0070669_1001131843 | 164 |
| 58 | 3300005366 | Ga0070659_100046072 | Ga0070659_1000460723 | 164 |
| 59 | 3300005367 | Ga0070667_101306125 | Ga0070667_1013061251 | 164 |
| 60 | 3300005434 | Ga0070709_10097615 | Ga0070709_100976151 | 164 |
| 61 | 3300005437 | Ga0070710_10051309 | Ga0070710_100513093 | 164 |
| 62 | 3300005455 | Ga0070663_100095227 | Ga0070663_1000952273 | 164 |
| 63 | 3300005458 | Ga0070681_10417355 | Ga0070681_104173551 | 164 |
| 64 | 3300005518 | Ga0070699_101176282 | Ga0070699_1011762821 | 164 |
| 65 | 3300005563 | Ga0068855_100664039 | Ga0068855_1006640392 | 164 |
| 66 | 3300006038 | Ga0075365_10144138 | Ga0075365_101441383 | 164 |
| 67 | 3300006038 | Ga0075365_10183266 | Ga0075365_101832662 | 164 |
| 68 | 3300006051 | Ga0075364_10068069 | Ga0075364_100680693 | 164 |
| 69 | 3300006163 | Ga0070715_10008592 | Ga0070715_100085923 | 164 |
| 70 | 3300006186 | Ga0075369_10004251 | Ga0075369_100042512 | 164 |
| 71 | 3300006353 | Ga0075370_10027487 | Ga0075370_100274873 | 164 |
| 72 | 3300009092 | Ga0105250_10229886 | Ga0105250_102298861 | 164 |
| 73 | 3300009551 | Ga0105238_10104490 | Ga0105238_101044903 | 164 |
| 74 | 3300009553 | Ga0105249_10053869 | Ga0105249_100538693 | 164 |
| 75 | 3300009553 | Ga0105249_12604298 | Ga0105249_126042981 | 164 |
| 76 | 3300013100 | Ga0157373_10016212 | Ga0157373_100162124 | 164 |
| 77 | 3300013104 | Ga0157370_10298450 | Ga0157370_102984502 | 164 |
| 78 | 3300014969 | Ga0157376_12306530 | Ga0157376_123065301 | 164 |
| 79 | 3300025295 | Ga0209564_1010374 | Ga0209564_10103743 | 164 |
| 80 | 3300025904 | Ga0207647_10155432 | Ga0207647_101554322 | 164 |
| 81 | 3300025909 | Ga0207705_10308646 | Ga0207705_103086462 | 164 |
| 82 | 3300025919 | Ga0207657_10000700 | Ga0207657_1000070029 | 164 |
| 83 | 3300025921 | Ga0207652_10163006 | Ga0207652_101630063 | 164 |
| 84 | 3300025942 | Ga0207689_10054944 | Ga0207689_100549443 | 164 |
| 85 | 3300025949 | Ga0207667_11011183 | Ga0207667_110111831 | 164 |
| 86 | 3300025961 | Ga0207712_10750324 | Ga0207712_107503241 | 164 |
| 87 | 3300026041 | Ga0207639_11150404 | Ga0207639_111504041 | 164 |
| 88 | 3300026067 | Ga0207678_10008508 | Ga0207678_100085088 | 164 |
| 89 | 3300028380 | Ga0268265_10061099 | Ga0268265_100610993 | 164 |
| 90 | 3300028794 | Ga0307515_10137546 | Ga0307515_101375462 | 164 |
| 91 | 3300031247 | Ga0265340_10085252 | Ga0265340_100852522 | 164 |
| 92 | 3300031249 | Ga0265339_10048152 | Ga0265339_100481522 | 164 |
| 93 | 3300031250 | Ga0265331_10012649 | Ga0265331_100126494 | 164 |
| 94 | 3300031344 | Ga0265316_10218705 | Ga0265316_102187053 | 164 |
| 95 | 3300031711 | Ga0265314_10049337 | Ga0265314_100493373 | 164 |
| 96 | 3300031712 | Ga0265342_10007969 | Ga0265342_100079699 | 164 |
| 97 | 3300031712 | Ga0265342_10026156 | Ga0265342_100261563 | 164 |
| 98 | 3300031911 | Ga0307412_10027981 | Ga0307412_100279813 | 164 |
| 99 | 3300033180 | Ga0307510_10097348 | Ga0307510_100973483 | 164 |
| 100 | 3300035086 | Ga0373934_0078402 | Ga0373934_0078402_466_960 | 164 |
| 101 | 3300035111 | Ga0373923_0002456 | Ga0373923_0002456_1616_2110 | 164 |
| 102 | 3300035113 | Ga0373936_0098217 | Ga0373936_0098217_491_985 | 164 |
| 103 | 3300035114 | Ga0373939_0118602 | Ga0373939_0118602_357_851 | 164 |
| 104 | 3300035117 | Ga0373953_0015403 | Ga0373953_0015403_102_596 | 164 |
| 105 | 3300035118 | Ga0373954_0006064 | Ga0373954_0006064_2246_2740 | 164 |
| 106 | 3300035120 | Ga0373957_0001140 | Ga0373957_0001140_436_930 | 164 |
| 107 | 3300035120 | Ga0373957_0226591 | Ga0373957_0226591_61_564 | 164 |
| 108 | 3300035171 | Ga0373946_0135029 | Ga0373946_0135029_359_853 | 164 |
| 109 | 3300035172 | Ga0373955_0018188 | Ga0373955_0018188_2533_3027 | 164 |
| 110 | 3300035410 | Ga0373924_0003746 | Ga0373924_0003746_2164_2658 | 164 |
| 111 | 3300035692 | Ga0373935_0104255 | Ga0373935_0104255_413_907 | 164 |
| 112 | 3300035724 | Ga0373933_0068376 | Ga0373933_0068376_685_1179 | 164 |
| 113 | 3300036401 | Ga0373937_0236799 | Ga0373937_0236799_1203_1706 | 164 |
| 114 | 3300038443 | Ga0395901_0528410 | Ga0395901_0528410_20_517 | 164 |
| 115 | 3300039438 | Ga0436360_0859761 | Ga0436360_0859761_88_585 | 164 |
| 116 | 3300044656 | Ga0466969_0056131 | Ga0466969_0056131_825_1328 | 164 |
| 117 | 3300045049 | Ga0466959_0092328 | Ga0466959_0092328_593_1096 | 164 |
| 118 | 3300046454 | Ga0495592_0044642 | Ga0495592_0044642_1846_2340 | 164 |
| 119 | 3300046455 | Ga0495603_0008445 | Ga0495603_0008445_2993_3490 | 164 |
| 120 | 3300046459 | Ga0495629_0068873 | Ga0495629_0068873_888_1382 | 164 |
| 121 | 3300046460 | Ga0495638_0046132 | Ga0495638_0046132_2201_2695 | 164 |
| 122 | 3300046462 | Ga0495651_0021120 | Ga0495651_0021120_2641_3135 | 164 |
| 123 | 3300046473 | Ga0495582_0345079 | Ga0495582_0345079_287_781 | 164 |
| 124 | 3300046476 | Ga0495662_0047542 | Ga0495662_0047542_1204_1698 | 164 |
| 125 | 3300046477 | Ga0495664_0029125 | Ga0495664_0029125_1075_1569 | 164 |
| 126 | 3300046500 | Ga0495596_0075852 | Ga0495596_0075852_33_527 | 164 |
| 127 | 3300046506 | Ga0495583_0130589 | Ga0495583_0130589_285_779 | 164 |
| 128 | 3300046512 | Ga0495610_0121130 | Ga0495610_0121130_384_878 | 164 |
| 129 | 3300046513 | Ga0495616_0045646 | Ga0495616_0045646_1286_1780 | 164 |
| 130 | 3300046514 | Ga0495618_0029523 | Ga0495618_0029523_1385_1879 | 164 |
| 131 | 3300046516 | Ga0495628_0032224 | Ga0495628_0032224_2455_2949 | 164 |
| 132 | 3300046518 | Ga0495631_0097076 | Ga0495631_0097076_134_628 | 164 |
| 133 | 3300046522 | Ga0495643_0018786 | Ga0495643_0018786_3017_3511 | 164 |
| 134 | 3300046529 | Ga0495652_0056662 | Ga0495652_0056662_1270_1764 | 164 |
| 135 | 3300046530 | Ga0495654_0062998 | Ga0495654_0062998_793_1287 | 164 |
| 136 | 3300046533 | Ga0495640_0011568 | Ga0495640_0011568_1938_2432 | 164 |
| 137 | 3300046538 | Ga0495609_0065976 | Ga0495609_0065976_957_1451 | 164 |
| 138 | 3300046543 | Ga0495645_0072915 | Ga0495645_0072915_82_576 | 164 |
| 139 | 3300046559 | Ga0495667_0038370 | Ga0495667_0038370_1086_1580 | 164 |
| 140 | 3300046660 | Ga0495625_0124818 | Ga0495625_0124818_462_956 | 164 |
| 141 | 3300046663 | Ga0495635_0032609 | Ga0495635_0032609_1384_1878 | 164 |
| 142 | 3300046665 | Ga0495661_0074186 | Ga0495661_0074186_705_1199 | 164 |
| 143 | 3300046675 | Ga0495657_0028680 | Ga0495657_0028680_1650_2144 | 164 |
| 144 | 3300046678 | Ga0495599_0028351 | Ga0495599_0028351_1664_2158 | 164 |
| 145 | 3300046679 | Ga0495623_0020395 | Ga0495623_0020395_943_1437 | 164 |
| 146 | 3300046680 | Ga0495646_0039700 | Ga0495646_0039700_334_828 | 164 |
| 147 | 3300046794 | Ga0495589_0105225 | Ga0495589_0105225_619_1113 | 164 |
| 148 | 3300046809 | Ga0495600_0078269 | Ga0495600_0078269_814_1308 | 164 |
| 149 | 3300047317 | Ga0495604_0013451 | Ga0495604_0013451_4163_4657 | 164 |
| 150 | 3300047319 | Ga0495674_0022918 | Ga0495674_0022918_2386_2880 | 164 |
| 151 | 3300047322 | Ga0495680_0008534 | Ga0495680_0008534_5812_6306 | 164 |
| 152 | 3300047444 | Ga0495675_0017447 | Ga0495675_0017447_1282_1776 | 164 |
| 153 | 3300047447 | Ga0495685_021155 | Ga0495685_021155_219_719 | 164 |
| 154 | 3300047471 | Ga0495684_0014274 | Ga0495684_0014274_1628_2122 | 164 |
| 155 | 3300047472 | Ga0495686_0012793 | Ga0495686_0012793_4292_4822 | 164 |
| 156 | 3300047472 | Ga0495686_0498469 | Ga0495686_0498469_43_537 | 164 |
| 157 | 3300047673 | Ga0495593_0068818 | Ga0495593_0068818_1025_1519 | 164 |
| 158 | 3300048088 | Ga0495602_0045053 | Ga0495602_0045053_1745_2239 | 164 |
| 159 | 3300048088 | Ga0495602_0272624 | Ga0495602_0272624_123_626 | 164 |
| 160 | 3300048090 | Ga0495615_0060674 | Ga0495615_0060674_469_978 | 164 |
| 161 | 3300048091 | Ga0495626_0060081 | Ga0495626_0060081_918_1412 | 164 |
| 162 | 3300048905 | Ga0496102_0253625 | Ga0496102_0253625_299_793 | 164 |
| 163 | 3300048907 | Ga0496104_1257594 | Ga0496104_1257594_74_586 | 164 |
| 164 | 3300048909 | Ga0496106_1383308 | Ga0496106_1383308_38_532 | 164 |
| 165 | 3300048911 | Ga0496108_1285607 | Ga0496108_1285607_24_536 | 164 |
| 166 | 3300048915 | Ga0496112_0004529 | Ga0496112_0004529_1315_1827 | 164 |
| 167 | 3300048915 | Ga0496112_0084168 | Ga0496112_0084168_2514_3008 | 164 |
| 168 | 3300048916 | Ga0496113_0419898 | Ga0496113_0419898_132_659 | 164 |
| 169 | 3300048918 | Ga0496115_0047980 | Ga0496115_0047980_761_1264 | 164 |
| 170 | 3300048919 | Ga0496116_0001672 | Ga0496116_0001672_13719_14213 | 164 |
| 171 | 3300048919 | Ga0496116_0235183 | Ga0496116_0235183_261_755 | 164 |
| 172 | 3300048920 | Ga0496117_0040333 | Ga0496117_0040333_1808_2302 | 164 |
| 173 | 3300048920 | Ga0496117_0225219 | Ga0496117_0225219_440_934 | 164 |
| 174 | 3300048921 | Ga0496118_0050095 | Ga0496118_0050095_1116_1610 | 164 |
| 175 | 3300048922 | Ga0496119_0178993 | Ga0496119_0178993_577_1071 | 164 |
| 176 | 3300048923 | Ga0496120_0149386 | Ga0496120_0149386_312_806 | 164 |
| 177 | 3300048923 | Ga0496120_0158380 | Ga0496120_0158380_386_880 | 164 |
| 178 | 3300048924 | Ga0496121_0013765 | Ga0496121_0013765_4569_5063 | 164 |
| 179 | 3300048924 | Ga0496121_0042659 | Ga0496121_0042659_2701_3195 | 164 |
| 180 | 3300048925 | Ga0496122_0016548 | Ga0496122_0016548_3005_3499 | 164 |
| 181 | 3300048925 | Ga0496122_0129185 | Ga0496122_0129185_542_1036 | 164 |
| 182 | 3300048926 | Ga0496123_0010686 | Ga0496123_0010686_3356_3850 | 164 |
| 183 | 3300048927 | Ga0496124_0075956 | Ga0496124_0075956_1121_1615 | 164 |
| 184 | 3300048928 | Ga0496125_0000207 | Ga0496125_0000207_36902_37396 | 164 |
| 185 | 3300048928 | Ga0496125_0012675 | Ga0496125_0012675_1357_1851 | 164 |
| 186 | 3300048928 | Ga0496125_0013674 | Ga0496125_0013674_1732_2226 | 164 |
| 187 | 3300048929 | Ga0496126_0062920 | Ga0496126_0062920_172_675 | 164 |
| 188 | 3300048929 | Ga0496126_0145205 | Ga0496126_0145205_44_538 | 164 |
| 189 | 3300048929 | Ga0496126_0163328 | Ga0496126_0163328_288_788 | 164 |
| 190 | 3300048929 | Ga0496126_0203863 | Ga0496126_0203863_266_769 | 164 |
| 191 | 3300048929 | Ga0496126_0567270 | Ga0496126_0567270_44_538 | 164 |
| 192 | 3300049568 | Ga0501031_0265138 | Ga0501031_0265138_134_631 | 164 |
| 193 | 3300049569 | Ga0501032_0042579 | Ga0501032_0042579_185_682 | 164 |
| 194 | 3300049569 | Ga0501032_0494254 | Ga0501032_0494254_205_702 | 164 |
| 195 | 3300049570 | Ga0501033_0078391 | Ga0501033_0078391_1336_1833 | 164 |
| 196 | 3300049570 | Ga0501033_0396207 | Ga0501033_0396207_103_600 | 164 |
| 197 | 3300049571 | Ga0501034_0231621 | Ga0501034_0231621_1203_1700 | 164 |
| 198 | 3300049572 | Ga0501036_0270262 | Ga0501036_0270262_463_960 | 164 |
| 199 | 3300049574 | Ga0501038_0111039 | Ga0501038_0111039_1573_2070 | 164 |
| 200 | 3300049574 | Ga0501038_0171120 | Ga0501038_0171120_423_920 | 164 |
| 201 | 3300049575 | Ga0501039_0321447 | Ga0501039_0321447_356_853 | 164 |
| 202 | 3300049580 | Ga0501046_0122826 | Ga0501046_0122826_732_1229 | 164 |
| 203 | 3300049581 | Ga0501047_0236061 | Ga0501047_0236061_574_1071 | 164 |
| 204 | 3300049583 | Ga0501067_0193270 | Ga0501067_0193270_574_1071 | 164 |
| 205 | 3300049586 | Ga0501070_0203155 | Ga0501070_0203155_304_801 | 164 |
| 206 | 3300049586 | Ga0501070_0446170 | Ga0501070_0446170_377_874 | 164 |
| 207 | 3300049588 | Ga0501072_0001175 | Ga0501072_0001175_1814_2317 | 164 |
| 208 | 3300049590 | Ga0501074_0196720 | Ga0501074_0196720_79_576 | 164 |
| 209 | 3300049822 | Ga0501035_0091906 | Ga0501035_0091906_1963_2460 | 164 |
| 210 | 3300049822 | Ga0501035_0452299 | Ga0501035_0452299_144_641 | 164 |
| 211 | 3300049822 | Ga0501035_0770734 | Ga0501035_0770734_185_682 | 164 |
| 212 | 3300049823 | Ga0501044_0312536 | Ga0501044_0312536_126_623 | 164 |
| 213 | 3300050491 | nmdc:mga00v17_2666_c1 | nmdc:mga00v17_2666_c1_5971_6465 | 164 |
| 214 | 3300050492 | nmdc:mga0yw44_174945_c1 | nmdc:mga0yw44_174945_c1_444_938 | 164 |
| 215 | 3300050492 | nmdc:mga0yw44_57766_c1 | nmdc:mga0yw44_57766_c1_1055_1549 | 164 |
| 216 | 3300050496 | nmdc:mga07m45_83022_c1 | nmdc:mga07m45_83022_c1_1148_1642 | 164 |
| 217 | 3300050516 | nmdc:mga0sz30_1770_c1 | nmdc:mga0sz30_1770_c1_6783_7277 | 164 |
| 218 | 3300053078 | Ga0495612_0008112 | Ga0495612_0008112_2033_2527 | 164 |
| 219 | 3300053080 | Ga0500635_0019445 | Ga0500635_0019445_922_1419 | 164 |
| 220 | 3300053085 | Ga0495619_0076187 | Ga0495619_0076187_944_1438 | 164 |
| 221 | 3300053087 | Ga0500643_011603 | Ga0500643_011603_2653_3147 | 164 |
| 222 | 3300053088 | Ga0500644_0017901 | Ga0500644_0017901_860_1354 | 164 |
| 223 | 3300053089 | Ga0500581_079515 | Ga0500581_079515_644_1138 | 164 |
| 224 | 3300053090 | Ga0500646_0033732 | Ga0500646_0033732_751_1245 | 164 |
| 225 | 3300053096 | Ga0500641_0018452 | Ga0500641_0018452_1468_1962 | 164 |
| 226 | 3300053102 | Ga0500554_004441 | Ga0500554_004441_2092_2589 | 164 |
| 227 | 3300053104 | Ga0500556_0000006 | Ga0500556_0000006_258326_258820 | 164 |
| 228 | 3300053108 | Ga0500562_005909 | Ga0500562_005909_225_719 | 164 |
| 229 | 3300053108 | Ga0500562_055931 | Ga0500562_055931_499_993 | 164 |
| 230 | 3300053109 | Ga0500569_001412 | Ga0500569_001412_2563_3057 | 164 |
| 231 | 3300053112 | Ga0500575_172801 | Ga0500575_172801_61_558 | 164 |
| 232 | 3300053116 | Ga0500592_000600 | Ga0500592_000600_4558_5052 | 164 |
| 233 | 3300053121 | Ga0500607_113450 | Ga0500607_113450_121_615 | 164 |
| 234 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_224441_224935 | 164 |
| 235 | 3300053131 | Ga0500652_000160 | Ga0500652_000160_9655_10149 | 164 |
| 236 | 3300053134 | Ga0500658_0085972 | Ga0500658_0085972_571_1065 | 164 |
| 237 | 3300053134 | Ga0500658_0090933 | Ga0500658_0090933_44_538 | 164 |
| 238 | 3300053139 | Ga0500568_0007069 | Ga0500568_0007069_282_776 | 164 |
| 239 | 3300053142 | Ga0500577_0032763 | Ga0500577_0032763_478_972 | 164 |
| 240 | 3300053145 | Ga0500586_000112 | Ga0500586_000112_13173_13667 | 164 |
| 241 | 3300053146 | Ga0500588_0124971 | Ga0500588_0124971_47_541 | 164 |
| 242 | 3300053150 | Ga0500603_001369 | Ga0500603_001369_2239_2736 | 164 |
| 243 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_256507_257001 | 164 |
| 244 | 3300053156 | Ga0500622_0003300 | Ga0500622_0003300_6711_7205 | 164 |
| 245 | 3300053161 | Ga0500634_0124148 | Ga0500634_0124148_491_985 | 164 |
| 246 | 3300053178 | Ga0500637_0003374 | Ga0500637_0003374_2533_3030 | 164 |
| 247 | 3300053730 | Ga0500645_026788 | Ga0500645_026788_555_1049 | 164 |
| 248 | 3300003203 | JGI25406J46586_10000364 | JGI25406J46586_1000036413 | 165 |
| 249 | 3300003659 | JGI25404J52841_10055956 | JGI25404J52841_100559561 | 165 |
| 250 | 3300005327 | Ga0070658_10009941 | Ga0070658_100099416 | 165 |
| 251 | 3300005327 | Ga0070658_10579390 | Ga0070658_105793901 | 165 |
| 252 | 3300005328 | Ga0070676_10060232 | Ga0070676_100602322 | 165 |
| 253 | 3300005329 | Ga0070683_100066945 | Ga0070683_1000669453 | 165 |
| 254 | 3300005329 | Ga0070683_100100543 | Ga0070683_1001005432 | 165 |
| 255 | 3300005331 | Ga0070670_100101013 | Ga0070670_1001010133 | 165 |
| 256 | 3300005333 | Ga0070677_10574785 | Ga0070677_105747851 | 165 |
| 257 | 3300005334 | Ga0068869_100013066 | Ga0068869_1000130664 | 165 |
| 258 | 3300005336 | Ga0070680_100028929 | Ga0070680_1000289296 | 165 |
| 259 | 3300005336 | Ga0070680_100213916 | Ga0070680_1002139162 | 165 |
| 260 | 3300005337 | Ga0070682_100108314 | Ga0070682_1001083142 | 165 |
| 261 | 3300005338 | Ga0068868_100040431 | Ga0068868_1000404313 | 165 |
| 262 | 3300005338 | Ga0068868_100071424 | Ga0068868_1000714243 | 165 |
| 263 | 3300005339 | Ga0070660_100402071 | Ga0070660_1004020711 | 165 |
| 264 | 3300005341 | Ga0070691_10244466 | Ga0070691_102444662 | 165 |
| 265 | 3300005344 | Ga0070661_100011760 | Ga0070661_1000117603 | 165 |
| 266 | 3300005344 | Ga0070661_100177218 | Ga0070661_1001772182 | 165 |
| 267 | 3300005347 | Ga0070668_100046179 | Ga0070668_1000461792 | 165 |
| 268 | 3300005347 | Ga0070668_101214077 | Ga0070668_1012140771 | 165 |
| 269 | 3300005354 | Ga0070675_100382549 | Ga0070675_1003825492 | 165 |
| 270 | 3300005356 | Ga0070674_101176733 | Ga0070674_1011767332 | 165 |
| 271 | 3300005364 | Ga0070673_100601818 | Ga0070673_1006018182 | 165 |
| 272 | 3300005366 | Ga0070659_100036969 | Ga0070659_1000369694 | 165 |
| 273 | 3300005434 | Ga0070709_10011427 | Ga0070709_100114272 | 165 |
| 274 | 3300005436 | Ga0070713_100056704 | Ga0070713_1000567043 | 165 |
| 275 | 3300005439 | Ga0070711_100019491 | Ga0070711_1000194912 | 165 |
| 276 | 3300005441 | Ga0070700_100169054 | Ga0070700_1001690543 | 165 |
| 277 | 3300005455 | Ga0070663_100090637 | Ga0070663_1000906372 | 165 |
| 278 | 3300005455 | Ga0070663_100132285 | Ga0070663_1001322853 | 165 |
| 279 | 3300005455 | Ga0070663_100254678 | Ga0070663_1002546782 | 165 |
| 280 | 3300005455 | Ga0070663_100298120 | Ga0070663_1002981202 | 165 |
| 281 | 3300005455 | Ga0070663_100433266 | Ga0070663_1004332662 | 165 |
| 282 | 3300005456 | Ga0070678_100011899 | Ga0070678_1000118992 | 165 |
| 283 | 3300005458 | Ga0070681_10062073 | Ga0070681_100620734 | 165 |
| 284 | 3300005466 | Ga0070685_10345417 | Ga0070685_103454172 | 165 |
| 285 | 3300005530 | Ga0070679_100520827 | Ga0070679_1005208272 | 165 |
| 286 | 3300005530 | Ga0070679_100577136 | Ga0070679_1005771362 | 165 |
| 287 | 3300005535 | Ga0070684_100000950 | Ga0070684_10000095017 | 165 |
| 288 | 3300005535 | Ga0070684_100038404 | Ga0070684_1000384042 | 165 |
| 289 | 3300005535 | Ga0070684_100289754 | Ga0070684_1002897542 | 165 |
| 290 | 3300005536 | Ga0070697_100773699 | Ga0070697_1007736992 | 165 |
| 291 | 3300005539 | Ga0068853_100007151 | Ga0068853_1000071517 | 165 |
| 292 | 3300005539 | Ga0068853_100110950 | Ga0068853_1001109502 | 165 |
| 293 | 3300005539 | Ga0068853_100137951 | Ga0068853_1001379513 | 165 |
| 294 | 3300005539 | Ga0068853_100779797 | Ga0068853_1007797972 | 165 |
| 295 | 3300005543 | Ga0070672_100130481 | Ga0070672_1001304812 | 165 |
| 296 | 3300005544 | Ga0070686_100091644 | Ga0070686_1000916443 | 165 |
| 297 | 3300005547 | Ga0070693_100067784 | Ga0070693_1000677843 | 165 |
| 298 | 3300005547 | Ga0070693_100125039 | Ga0070693_1001250392 | 165 |
| 299 | 3300005548 | Ga0070665_100050356 | Ga0070665_1000503564 | 165 |
| 300 | 3300005548 | Ga0070665_100067075 | Ga0070665_1000670753 | 165 |
| 301 | 3300005563 | Ga0068855_100106438 | Ga0068855_1001064383 | 165 |
| 302 | 3300005563 | Ga0068855_100692404 | Ga0068855_1006924042 | 165 |
| 303 | 3300005564 | Ga0070664_100028305 | Ga0070664_1000283055 | 165 |
| 304 | 3300005564 | Ga0070664_100098691 | Ga0070664_1000986913 | 165 |
| 305 | 3300005577 | Ga0068857_100128105 | Ga0068857_1001281053 | 165 |
| 306 | 3300005578 | Ga0068854_100682541 | Ga0068854_1006825411 | 165 |
| 307 | 3300005578 | Ga0068854_101114932 | Ga0068854_1011149322 | 165 |
| 308 | 3300005614 | Ga0068856_100053445 | Ga0068856_1000534453 | 165 |
| 309 | 3300005615 | Ga0070702_100058977 | Ga0070702_1000589773 | 165 |
| 310 | 3300005616 | Ga0068852_100081048 | Ga0068852_1000810482 | 165 |
| 311 | 3300005616 | Ga0068852_100287592 | Ga0068852_1002875922 | 165 |
| 312 | 3300005617 | Ga0068859_100182698 | Ga0068859_1001826983 | 165 |
| 313 | 3300005617 | Ga0068859_100249204 | Ga0068859_1002492042 | 165 |
| 314 | 3300005618 | Ga0068864_100024535 | Ga0068864_1000245353 | 165 |
| 315 | 3300005618 | Ga0068864_100618363 | Ga0068864_1006183632 | 165 |
| 316 | 3300005618 | Ga0068864_100658846 | Ga0068864_1006588462 | 165 |
| 317 | 3300005719 | Ga0068861_100385428 | Ga0068861_1003854281 | 165 |
| 318 | 3300005719 | Ga0068861_100456186 | Ga0068861_1004561862 | 165 |
| 319 | 3300005841 | Ga0068863_100108690 | Ga0068863_1001086903 | 165 |
| 320 | 3300005842 | Ga0068858_100095727 | Ga0068858_1000957273 | 165 |
| 321 | 3300005843 | Ga0068860_100058722 | Ga0068860_1000587223 | 165 |
| 322 | 3300005843 | Ga0068860_100152141 | Ga0068860_1001521412 | 165 |
| 323 | 3300005843 | Ga0068860_101738495 | Ga0068860_1017384951 | 165 |
| 324 | 3300005844 | Ga0068862_100151650 | Ga0068862_1001516502 | 165 |
| 325 | 3300005937 | Ga0081455_10010497 | Ga0081455_100104972 | 165 |
| 326 | 3300005983 | Ga0081540_1000191 | Ga0081540_10001913 | 165 |
| 327 | 3300005983 | Ga0081540_1003921 | Ga0081540_10039216 | 165 |
| 328 | 3300005983 | Ga0081540_1017710 | Ga0081540_10177103 | 165 |
| 329 | 3300005983 | Ga0081540_1070729 | Ga0081540_10707292 | 165 |
| 330 | 3300005985 | Ga0081539_10000048 | Ga0081539_10000048217 | 165 |
| 331 | 3300006028 | Ga0070717_10338637 | Ga0070717_103386371 | 165 |
| 332 | 3300006042 | Ga0075368_10020138 | Ga0075368_100201383 | 165 |
| 333 | 3300006048 | Ga0075363_100046611 | Ga0075363_1000466113 | 165 |
| 334 | 3300006051 | Ga0075364_10022257 | Ga0075364_100222573 | 165 |
| 335 | 3300006051 | Ga0075364_10266019 | Ga0075364_102660192 | 165 |
| 336 | 3300006058 | Ga0075432_10013182 | Ga0075432_100131823 | 165 |
| 337 | 3300006178 | Ga0075367_10034512 | Ga0075367_100345123 | 165 |
| 338 | 3300006186 | Ga0075369_10072463 | Ga0075369_100724633 | 165 |
| 339 | 3300006195 | Ga0075366_10309841 | Ga0075366_103098412 | 165 |
| 340 | 3300006358 | Ga0068871_100044698 | Ga0068871_1000446983 | 165 |
| 341 | 3300006358 | Ga0068871_100053846 | Ga0068871_1000538462 | 165 |
| 342 | 3300006871 | Ga0075434_100147299 | Ga0075434_1001472993 | 165 |
| 343 | 3300006871 | Ga0075434_100282056 | Ga0075434_1002820562 | 165 |
| 344 | 3300006931 | Ga0097620_100182694 | Ga0097620_1001826943 | 165 |
| 345 | 3300006931 | Ga0097620_100249207 | Ga0097620_1002492072 | 165 |
| 346 | 3300007076 | Ga0075435_100139336 | Ga0075435_1001393363 | 165 |
| 347 | 3300009036 | Ga0105244_10428597 | Ga0105244_104285971 | 165 |
| 348 | 3300009093 | Ga0105240_10039683 | Ga0105240_100396835 | 165 |
| 349 | 3300009094 | Ga0111539_10059723 | Ga0111539_100597234 | 165 |
| 350 | 3300009098 | Ga0105245_10033417 | Ga0105245_100334174 | 165 |
| 351 | 3300009098 | Ga0105245_10128432 | Ga0105245_101284321 | 165 |
| 352 | 3300009098 | Ga0105245_10342331 | Ga0105245_103423313 | 165 |
| 353 | 3300009101 | Ga0105247_10068652 | Ga0105247_100686522 | 165 |
| 354 | 3300009101 | Ga0105247_10310357 | Ga0105247_103103571 | 165 |
| 355 | 3300009101 | Ga0105247_10561726 | Ga0105247_105617262 | 165 |
| 356 | 3300009174 | Ga0105241_10037198 | Ga0105241_100371983 | 165 |
| 357 | 3300009176 | Ga0105242_10125235 | Ga0105242_101252352 | 165 |
| 358 | 3300009176 | Ga0105242_11594257 | Ga0105242_115942571 | 165 |
| 359 | 3300009545 | Ga0105237_10019216 | Ga0105237_100192167 | 165 |
| 360 | 3300009545 | Ga0105237_10044051 | Ga0105237_100440512 | 165 |
| 361 | 3300009551 | Ga0105238_10020486 | Ga0105238_100204864 | 165 |
| 362 | 3300010375 | Ga0105239_10052959 | Ga0105239_100529595 | 165 |
| 363 | 3300010375 | Ga0105239_10082887 | Ga0105239_100828874 | 165 |
| 364 | 3300010375 | Ga0105239_10126168 | Ga0105239_101261682 | 165 |
| 365 | 3300010375 | Ga0105239_10128415 | Ga0105239_101284153 | 165 |
| 366 | 3300011119 | Ga0105246_10077783 | Ga0105246_100777833 | 165 |
| 367 | 3300011119 | Ga0105246_10458278 | Ga0105246_104582783 | 165 |
| 368 | 3300011119 | Ga0105246_10932987 | Ga0105246_109329871 | 165 |
| 369 | 3300013102 | Ga0157371_10028952 | Ga0157371_100289523 | 165 |
| 370 | 3300013105 | Ga0157369_10044218 | Ga0157369_100442183 | 165 |
| 371 | 3300013105 | Ga0157369_10945911 | Ga0157369_109459111 | 165 |
| 372 | 3300013296 | Ga0157374_10844124 | Ga0157374_108441242 | 165 |
| 373 | 3300013296 | Ga0157374_11013257 | Ga0157374_110132571 | 165 |
| 374 | 3300013297 | Ga0157378_10019963 | Ga0157378_100199634 | 165 |
| 375 | 3300013297 | Ga0157378_10171908 | Ga0157378_101719082 | 165 |
| 376 | 3300013306 | Ga0163162_10690270 | Ga0163162_106902702 | 165 |
| 377 | 3300013307 | Ga0157372_10200919 | Ga0157372_102009192 | 165 |
| 378 | 3300013308 | Ga0157375_10313632 | Ga0157375_103136323 | 165 |
| 379 | 3300014325 | Ga0163163_10517113 | Ga0163163_105171132 | 165 |
| 380 | 3300014326 | Ga0157380_10271255 | Ga0157380_102712552 | 165 |
| 381 | 3300014968 | Ga0157379_10496075 | Ga0157379_104960751 | 165 |
| 382 | 3300014969 | Ga0157376_10094852 | Ga0157376_100948522 | 165 |
| 383 | 3300014969 | Ga0157376_10939329 | Ga0157376_109393291 | 165 |
| 384 | 3300017792 | Ga0163161_11544872 | Ga0163161_115448721 | 165 |
| 385 | 3300021358 | Ga0213873_10013788 | Ga0213873_100137883 | 165 |
| 386 | 3300021361 | Ga0213872_10204540 | Ga0213872_102045402 | 165 |
| 387 | 3300021377 | Ga0213874_10001916 | Ga0213874_100019164 | 165 |
| 388 | 3300021377 | Ga0213874_10143035 | Ga0213874_101430352 | 165 |
| 389 | 3300021384 | Ga0213876_10003463 | Ga0213876_100034634 | 165 |
| 390 | 3300025295 | Ga0209564_1001079 | Ga0209564_100107921 | 165 |
| 391 | 3300025321 | Ga0207656_10024798 | Ga0207656_100247982 | 165 |
| 392 | 3300025711 | Ga0207696_1019485 | Ga0207696_10194852 | 165 |
| 393 | 3300025899 | Ga0207642_10069573 | Ga0207642_100695731 | 165 |
| 394 | 3300025900 | Ga0207710_10023365 | Ga0207710_100233652 | 165 |
| 395 | 3300025901 | Ga0207688_10036584 | Ga0207688_100365843 | 165 |
| 396 | 3300025906 | Ga0207699_10088646 | Ga0207699_100886462 | 165 |
| 397 | 3300025912 | Ga0207707_10004329 | Ga0207707_100043296 | 165 |
| 398 | 3300025912 | Ga0207707_10025404 | Ga0207707_100254044 | 165 |
| 399 | 3300025912 | Ga0207707_10031430 | Ga0207707_100314304 | 165 |
| 400 | 3300025913 | Ga0207695_10010844 | Ga0207695_100108449 | 165 |
| 401 | 3300025913 | Ga0207695_10205887 | Ga0207695_102058871 | 165 |
| 402 | 3300025914 | Ga0207671_10028767 | Ga0207671_100287673 | 165 |
| 403 | 3300025914 | Ga0207671_10211982 | Ga0207671_102119822 | 165 |
| 404 | 3300025914 | Ga0207671_10404952 | Ga0207671_104049521 | 165 |
| 405 | 3300025915 | Ga0207693_10060098 | Ga0207693_100600982 | 165 |
| 406 | 3300025916 | Ga0207663_10028537 | Ga0207663_100285374 | 165 |
| 407 | 3300025917 | Ga0207660_10001470 | Ga0207660_100014709 | 165 |
| 408 | 3300025917 | Ga0207660_10185729 | Ga0207660_101857292 | 165 |
| 409 | 3300025918 | Ga0207662_10198699 | Ga0207662_101986992 | 165 |
| 410 | 3300025919 | Ga0207657_10119742 | Ga0207657_101197421 | 165 |
| 411 | 3300025920 | Ga0207649_10085619 | Ga0207649_100856193 | 165 |
| 412 | 3300025921 | Ga0207652_10007361 | Ga0207652_100073615 | 165 |
| 413 | 3300025921 | Ga0207652_10046543 | Ga0207652_100465434 | 165 |
| 414 | 3300025924 | Ga0207694_10046065 | Ga0207694_100460653 | 165 |
| 415 | 3300025924 | Ga0207694_10055078 | Ga0207694_100550782 | 165 |
| 416 | 3300025927 | Ga0207687_10012071 | Ga0207687_100120712 | 165 |
| 417 | 3300025927 | Ga0207687_10601211 | Ga0207687_106012112 | 165 |
| 418 | 3300025928 | Ga0207700_10049272 | Ga0207700_100492724 | 165 |
| 419 | 3300025931 | Ga0207644_10337051 | Ga0207644_103370512 | 165 |
| 420 | 3300025932 | Ga0207690_10023344 | Ga0207690_100233443 | 165 |
| 421 | 3300025932 | Ga0207690_10535097 | Ga0207690_105350972 | 165 |
| 422 | 3300025935 | Ga0207709_10315181 | Ga0207709_103151812 | 165 |
| 423 | 3300025937 | Ga0207669_10936564 | Ga0207669_109365641 | 165 |
| 424 | 3300025941 | Ga0207711_10030008 | Ga0207711_100300085 | 165 |
| 425 | 3300025941 | Ga0207711_10408596 | Ga0207711_104085962 | 165 |
| 426 | 3300025941 | Ga0207711_10421302 | Ga0207711_104213021 | 165 |
| 427 | 3300025942 | Ga0207689_10054996 | Ga0207689_100549962 | 165 |
| 428 | 3300025942 | Ga0207689_10310825 | Ga0207689_103108253 | 165 |
| 429 | 3300025944 | Ga0207661_10015572 | Ga0207661_100155723 | 165 |
| 430 | 3300025944 | Ga0207661_10133258 | Ga0207661_101332583 | 165 |
| 431 | 3300025945 | Ga0207679_11018658 | Ga0207679_110186581 | 165 |
| 432 | 3300025949 | Ga0207667_10001909 | Ga0207667_1000190923 | 165 |
| 433 | 3300025949 | Ga0207667_10948055 | Ga0207667_109480552 | 165 |
| 434 | 3300025960 | Ga0207651_10602871 | Ga0207651_106028712 | 165 |
| 435 | 3300025961 | Ga0207712_10308204 | Ga0207712_103082042 | 165 |
| 436 | 3300025972 | Ga0207668_10038150 | Ga0207668_100381503 | 165 |
| 437 | 3300025972 | Ga0207668_10195017 | Ga0207668_101950172 | 165 |
| 438 | 3300025972 | Ga0207668_10946307 | Ga0207668_109463071 | 165 |
| 439 | 3300026023 | Ga0207677_10044189 | Ga0207677_100441893 | 165 |
| 440 | 3300026023 | Ga0207677_10057193 | Ga0207677_100571932 | 165 |
| 441 | 3300026023 | Ga0207677_11018871 | Ga0207677_110188711 | 165 |
| 442 | 3300026035 | Ga0207703_10164191 | Ga0207703_101641912 | 165 |
| 443 | 3300026035 | Ga0207703_10749745 | Ga0207703_107497452 | 165 |
| 444 | 3300026041 | Ga0207639_10002676 | Ga0207639_1000267612 | 165 |
| 445 | 3300026041 | Ga0207639_10304515 | Ga0207639_103045152 | 165 |
| 446 | 3300026041 | Ga0207639_10978510 | Ga0207639_109785102 | 165 |
| 447 | 3300026067 | Ga0207678_10041532 | Ga0207678_100415322 | 165 |
| 448 | 3300026078 | Ga0207702_10244823 | Ga0207702_102448232 | 165 |
| 449 | 3300026089 | Ga0207648_10740127 | Ga0207648_107401271 | 165 |
| 450 | 3300026095 | Ga0207676_10038875 | Ga0207676_100388753 | 165 |
| 451 | 3300026095 | Ga0207676_10177444 | Ga0207676_101774443 | 165 |
| 452 | 3300026116 | Ga0207674_10074915 | Ga0207674_100749153 | 165 |
| 453 | 3300026116 | Ga0207674_10150152 | Ga0207674_101501523 | 165 |
| 454 | 3300026118 | Ga0207675_100506365 | Ga0207675_1005063652 | 165 |
| 455 | 3300026121 | Ga0207683_10032853 | Ga0207683_100328533 | 165 |
| 456 | 3300026121 | Ga0207683_10070748 | Ga0207683_100707483 | 165 |
| 457 | 3300026121 | Ga0207683_10205373 | Ga0207683_102053732 | 165 |
| 458 | 3300026142 | Ga0207698_10062239 | Ga0207698_100622392 | 165 |
| 459 | 3300026142 | Ga0207698_10289035 | Ga0207698_102890352 | 165 |
| 460 | 3300027671 | Ga0209588_1002870 | Ga0209588_10028704 | 165 |
| 461 | 3300028379 | Ga0268266_10062908 | Ga0268266_100629083 | 165 |
| 462 | 3300028379 | Ga0268266_10115856 | Ga0268266_101158561 | 165 |
| 463 | 3300028379 | Ga0268266_10269427 | Ga0268266_102694272 | 165 |
| 464 | 3300028381 | Ga0268264_10078139 | Ga0268264_100781393 | 165 |
| 465 | 3300028381 | Ga0268264_10308314 | Ga0268264_103083142 | 165 |
| 466 | 3300031456 | Ga0307513_10154517 | Ga0307513_101545172 | 165 |
| 467 | 3300031548 | Ga0307408_100413760 | Ga0307408_1004137601 | 165 |
| 468 | 3300031616 | Ga0307508_10169246 | Ga0307508_101692463 | 165 |
| 469 | 3300031901 | Ga0307406_10522409 | Ga0307406_105224092 | 165 |
| 470 | 3300031911 | Ga0307412_10381740 | Ga0307412_103817402 | 165 |
| 471 | 3300031995 | Ga0307409_101098149 | Ga0307409_1010981492 | 165 |
| 472 | 3300032002 | Ga0307416_100325612 | Ga0307416_1003256122 | 165 |
| 473 | 3300032002 | Ga0307416_100492732 | Ga0307416_1004927322 | 165 |
| 474 | 3300032002 | Ga0307416_101335066 | Ga0307416_1013350661 | 165 |
| 475 | 3300032005 | Ga0307411_10360605 | Ga0307411_103606052 | 165 |
| 476 | 3300034816 | Ga0373930_0008048 | Ga0373930_0008048_921_1427 | 165 |
| 477 | 3300034819 | Ga0373958_0109169 | Ga0373958_0109169_111_608 | 165 |
| 478 | 3300035085 | Ga0373929_0051418 | Ga0373929_0051418_56_553 | 165 |
| 479 | 3300035089 | Ga0373944_0173504 | Ga0373944_0173504_148_645 | 165 |
| 480 | 3300035112 | Ga0373932_0025204 | Ga0373932_0025204_782_1288 | 165 |
| 481 | 3300035115 | Ga0373941_0242371 | Ga0373941_0242371_39_569 | 165 |
| 482 | 3300035207 | Ga0373942_0140426 | Ga0373942_0140426_168_698 | 165 |
| 483 | 3300035695 | Ga0373927_0312382 | Ga0373927_0312382_450_947 | 165 |
| 484 | 3300035695 | Ga0373927_0343719 | Ga0373927_0343719_71_568 | 165 |
| 485 | 3300037418 | Ga0395900_0169303 | Ga0395900_0169303_147_665 | 165 |
| 486 | 3300037418 | Ga0395900_0190863 | Ga0395900_0190863_383_880 | 165 |
| 487 | 3300037466 | Ga0395898_0389877 | Ga0395898_0389877_123_620 | 165 |
| 488 | 3300037471 | Ga0395905_0587127 | Ga0395905_0587127_393_893 | 165 |
| 489 | 3300038443 | Ga0395901_0258192 | Ga0395901_0258192_394_912 | 165 |
| 490 | 3300039437 | Ga0436365_0364359 | Ga0436365_0364359_240_740 | 165 |
| 491 | 3300039438 | Ga0436360_0339772 | Ga0436360_0339772_1543_2040 | 165 |
| 492 | 3300039438 | Ga0436360_1157986 | Ga0436360_1157986_76_582 | 165 |
| 493 | 3300039450 | Ga0436363_0784614 | Ga0436363_0784614_445_942 | 165 |
| 494 | 3300039450 | Ga0436363_1136180 | Ga0436363_1136180_600_1100 | 165 |
| 495 | 3300039450 | Ga0436363_1514540 | Ga0436363_1514540_43_543 | 165 |
| 496 | 3300039453 | Ga0436362_1002335 | Ga0436362_1002335_3482_3982 | 165 |
| 497 | 3300041453 | Ga0451797_0420178 | Ga0451797_0420178_669_1166 | 165 |
| 498 | 3300041503 | Ga0451847_0677595 | Ga0451847_0677595_79_603 | 165 |
| 499 | 3300044684 | Ga0466966_0352077 | Ga0466966_0352077_174_677 | 165 |
| 500 | 3300044684 | Ga0466966_0551757 | Ga0466966_0551757_137_637 | 165 |
| 501 | 3300044694 | Ga0466963_0373793 | Ga0466963_0373793_85_603 | 165 |
| 502 | 3300044706 | Ga0466964_0054111 | Ga0466964_0054111_966_1466 | 165 |
| 503 | 3300044719 | Ga0466971_0109001 | Ga0466971_0109001_71_574 | 165 |
| 504 | 3300045976 | Ga0466967_0133246 | Ga0466967_0133246_720_1238 | 165 |
| 505 | 3300045976 | Ga0466967_0708093 | Ga0466967_0708093_274_774 | 165 |
| 506 | 3300046454 | Ga0495592_0334013 | Ga0495592_0334013_62_559 | 165 |
| 507 | 3300046455 | Ga0495603_0057866 | Ga0495603_0057866_513_1019 | 165 |
| 508 | 3300046455 | Ga0495603_0064921 | Ga0495603_0064921_1581_2078 | 165 |
| 509 | 3300046459 | Ga0495629_0049476 | Ga0495629_0049476_160_660 | 165 |
| 510 | 3300046459 | Ga0495629_0314289 | Ga0495629_0314289_79_576 | 165 |
| 511 | 3300046461 | Ga0495641_0035619 | Ga0495641_0035619_56_553 | 165 |
| 512 | 3300046462 | Ga0495651_0425836 | Ga0495651_0425836_251_748 | 165 |
| 513 | 3300046462 | Ga0495651_0510912 | Ga0495651_0510912_47_544 | 165 |
| 514 | 3300046475 | Ga0495639_0022697 | Ga0495639_0022697_148_645 | 165 |
| 515 | 3300046477 | Ga0495664_0054710 | Ga0495664_0054710_602_1123 | 165 |
| 516 | 3300046492 | Ga0495585_0192538 | Ga0495585_0192538_314_811 | 165 |
| 517 | 3300046499 | Ga0495594_0006637 | Ga0495594_0006637_4256_4753 | 165 |
| 518 | 3300046501 | Ga0495607_0252083 | Ga0495607_0252083_81_578 | 165 |
| 519 | 3300046506 | Ga0495583_0219465 | Ga0495583_0219465_181_678 | 165 |
| 520 | 3300046507 | Ga0495606_0270629 | Ga0495606_0270629_201_698 | 165 |
| 521 | 3300046507 | Ga0495606_0401374 | Ga0495606_0401374_126_623 | 165 |
| 522 | 3300046513 | Ga0495616_0059586 | Ga0495616_0059586_1234_1731 | 165 |
| 523 | 3300046515 | Ga0495620_0013237 | Ga0495620_0013237_3631_4128 | 165 |
| 524 | 3300046516 | Ga0495628_0333812 | Ga0495628_0333812_150_671 | 165 |
| 525 | 3300046518 | Ga0495631_0098219 | Ga0495631_0098219_59_556 | 165 |
| 526 | 3300046519 | Ga0495632_0035025 | Ga0495632_0035025_1105_1602 | 165 |
| 527 | 3300046520 | Ga0495637_0081247 | Ga0495637_0081247_179_676 | 165 |
| 528 | 3300046525 | Ga0495663_0207400 | Ga0495663_0207400_147_644 | 165 |
| 529 | 3300046529 | Ga0495652_0097330 | Ga0495652_0097330_45_542 | 165 |
| 530 | 3300046531 | Ga0495665_0495924 | Ga0495665_0495924_11_508 | 165 |
| 531 | 3300046533 | Ga0495640_0209295 | Ga0495640_0209295_344_844 | 165 |
| 532 | 3300046537 | Ga0495598_0013615 | Ga0495598_0013615_1165_1662 | 165 |
| 533 | 3300046538 | Ga0495609_0148817 | Ga0495609_0148817_35_532 | 165 |
| 534 | 3300046539 | Ga0495621_0051417 | Ga0495621_0051417_717_1214 | 165 |
| 535 | 3300046557 | Ga0495622_0181910 | Ga0495622_0181910_265_762 | 165 |
| 536 | 3300046558 | Ga0495633_0107148 | Ga0495633_0107148_632_1129 | 165 |
| 537 | 3300046615 | Ga0495656_0043366 | Ga0495656_0043366_295_792 | 165 |
| 538 | 3300046615 | Ga0495656_0103260 | Ga0495656_0103260_272_769 | 165 |
| 539 | 3300046615 | Ga0495656_0235570 | Ga0495656_0235570_356_853 | 165 |
| 540 | 3300046616 | Ga0495668_0183741 | Ga0495668_0183741_40_546 | 165 |
| 541 | 3300046648 | Ga0495611_0174808 | Ga0495611_0174808_311_808 | 165 |
| 542 | 3300046648 | Ga0495611_0237727 | Ga0495611_0237727_315_812 | 165 |
| 543 | 3300046663 | Ga0495635_0093692 | Ga0495635_0093692_659_1156 | 165 |
| 544 | 3300046674 | Ga0495588_0005736 | Ga0495588_0005736_3143_3640 | 165 |
| 545 | 3300046678 | Ga0495599_0007907 | Ga0495599_0007907_456_956 | 165 |
| 546 | 3300046679 | Ga0495623_0666656 | Ga0495623_0666656_18_515 | 165 |
| 547 | 3300046684 | Ga0495669_0028232 | Ga0495669_0028232_1151_1648 | 165 |
| 548 | 3300046691 | Ga0495670_0063775 | Ga0495670_0063775_442_939 | 165 |
| 549 | 3300046694 | Ga0495649_0434866 | Ga0495649_0434866_35_532 | 165 |
| 550 | 3300047315 | Ga0495581_0162600 | Ga0495581_0162600_756_1253 | 165 |
| 551 | 3300047317 | Ga0495604_0404292 | Ga0495604_0404292_247_747 | 165 |
| 552 | 3300047320 | Ga0495672_0033255 | Ga0495672_0033255_150_650 | 165 |
| 553 | 3300047323 | Ga0495683_0289019 | Ga0495683_0289019_53_550 | 165 |
| 554 | 3300047445 | Ga0495677_0135314 | Ga0495677_0135314_61_558 | 165 |
| 555 | 3300047469 | Ga0495673_0115066 | Ga0495673_0115066_335_844 | 165 |
| 556 | 3300047469 | Ga0495673_0181708 | Ga0495673_0181708_237_746 | 165 |
| 557 | 3300047470 | Ga0495681_0090192 | Ga0495681_0090192_529_1026 | 165 |
| 558 | 3300048088 | Ga0495602_0515858 | Ga0495602_0515858_12_509 | 165 |
| 559 | 3300048903 | Ga0496100_0003200 | Ga0496100_0003200_3214_3711 | 165 |
| 560 | 3300048903 | Ga0496100_0108403 | Ga0496100_0108403_693_1199 | 165 |
| 561 | 3300048904 | Ga0496101_0021912 | Ga0496101_0021912_2927_3424 | 165 |
| 562 | 3300048904 | Ga0496101_0315228 | Ga0496101_0315228_137_634 | 165 |
| 563 | 3300048905 | Ga0496102_0025407 | Ga0496102_0025407_3102_3599 | 165 |
| 564 | 3300048905 | Ga0496102_0098842 | Ga0496102_0098842_312_809 | 165 |
| 565 | 3300048905 | Ga0496102_0265482 | Ga0496102_0265482_107_637 | 165 |
| 566 | 3300048905 | Ga0496102_0596015 | Ga0496102_0596015_288_806 | 165 |
| 567 | 3300048905 | Ga0496102_1188152 | Ga0496102_1188152_65_583 | 165 |
| 568 | 3300048906 | Ga0496103_0031134 | Ga0496103_0031134_520_1017 | 165 |
| 569 | 3300048906 | Ga0496103_0193606 | Ga0496103_0193606_445_975 | 165 |
| 570 | 3300048907 | Ga0496104_0012106 | Ga0496104_0012106_3506_4003 | 165 |
| 571 | 3300048908 | Ga0496105_0081851 | Ga0496105_0081851_903_1400 | 165 |
| 572 | 3300048908 | Ga0496105_0136497 | Ga0496105_0136497_1467_1964 | 165 |
| 573 | 3300048909 | Ga0496106_0031809 | Ga0496106_0031809_1425_1922 | 165 |
| 574 | 3300048909 | Ga0496106_0886439 | Ga0496106_0886439_54_551 | 165 |
| 575 | 3300048910 | Ga0496107_0006358 | Ga0496107_0006358_1167_1664 | 165 |
| 576 | 3300048910 | Ga0496107_0050760 | Ga0496107_0050760_318_815 | 165 |
| 577 | 3300048910 | Ga0496107_0165818 | Ga0496107_0165818_828_1325 | 165 |
| 578 | 3300048911 | Ga0496108_0019419 | Ga0496108_0019419_2128_2625 | 165 |
| 579 | 3300048911 | Ga0496108_0166431 | Ga0496108_0166431_450_947 | 165 |
| 580 | 3300048912 | Ga0496109_0092517 | Ga0496109_0092517_964_1461 | 165 |
| 581 | 3300048912 | Ga0496109_0105058 | Ga0496109_0105058_593_1090 | 165 |
| 582 | 3300048912 | Ga0496109_0863893 | Ga0496109_0863893_240_737 | 165 |
| 583 | 3300048912 | Ga0496109_0967809 | Ga0496109_0967809_18_515 | 165 |
| 584 | 3300048912 | Ga0496109_1175280 | Ga0496109_1175280_129_635 | 165 |
| 585 | 3300048913 | Ga0496110_0112856 | Ga0496110_0112856_1010_1507 | 165 |
| 586 | 3300048913 | Ga0496110_0196580 | Ga0496110_0196580_26_523 | 165 |
| 587 | 3300048913 | Ga0496110_0293506 | Ga0496110_0293506_761_1267 | 165 |
| 588 | 3300048913 | Ga0496110_0293709 | Ga0496110_0293709_642_1139 | 165 |
| 589 | 3300048913 | Ga0496110_0486920 | Ga0496110_0486920_543_1049 | 165 |
| 590 | 3300048914 | Ga0496111_0197788 | Ga0496111_0197788_892_1389 | 165 |
| 591 | 3300048914 | Ga0496111_0211141 | Ga0496111_0211141_16_549 | 165 |
| 592 | 3300048915 | Ga0496112_0000018 | Ga0496112_0000018_131194_131691 | 165 |
| 593 | 3300048915 | Ga0496112_0074784 | Ga0496112_0074784_1872_2369 | 165 |
| 594 | 3300048915 | Ga0496112_0168495 | Ga0496112_0168495_439_972 | 165 |
| 595 | 3300048915 | Ga0496112_0174060 | Ga0496112_0174060_352_849 | 165 |
| 596 | 3300048915 | Ga0496112_0607322 | Ga0496112_0607322_506_1012 | 165 |
| 597 | 3300048916 | Ga0496113_0110348 | Ga0496113_0110348_1509_2006 | 165 |
| 598 | 3300048917 | Ga0496114_0037094 | Ga0496114_0037094_2971_3468 | 165 |
| 599 | 3300048917 | Ga0496114_0199892 | Ga0496114_0199892_70_600 | 165 |
| 600 | 3300048918 | Ga0496115_0000743 | Ga0496115_0000743_7050_7547 | 165 |
| 601 | 3300048918 | Ga0496115_0025011 | Ga0496115_0025011_3444_3950 | 165 |
| 602 | 3300048920 | Ga0496117_0451247 | Ga0496117_0451247_51_548 | 165 |
| 603 | 3300048921 | Ga0496118_0198075 | Ga0496118_0198075_686_1183 | 165 |
| 604 | 3300048924 | Ga0496121_0000278 | Ga0496121_0000278_73038_73538 | 165 |
| 605 | 3300048924 | Ga0496121_0023451 | Ga0496121_0023451_3701_4198 | 165 |
| 606 | 3300048924 | Ga0496121_0267658 | Ga0496121_0267658_476_973 | 165 |
| 607 | 3300048924 | Ga0496121_0306078 | Ga0496121_0306078_117_623 | 165 |
| 608 | 3300048928 | Ga0496125_0084547 | Ga0496125_0084547_1860_2357 | 165 |
| 609 | 3300048928 | Ga0496125_0180656 | Ga0496125_0180656_746_1243 | 165 |
| 610 | 3300048929 | Ga0496126_0010955 | Ga0496126_0010955_3038_3535 | 165 |
| 611 | 3300048929 | Ga0496126_0083916 | Ga0496126_0083916_442_945 | 165 |
| 612 | 3300048929 | Ga0496126_0120165 | Ga0496126_0120165_775_1278 | 165 |
| 613 | 3300049574 | Ga0501038_0540309 | Ga0501038_0540309_35_535 | 165 |
| 614 | 3300049577 | Ga0501041_0656203 | Ga0501041_0656203_68_568 | 165 |
| 615 | 3300049583 | Ga0501067_0071550 | Ga0501067_0071550_1387_1884 | 165 |
| 616 | 3300049586 | Ga0501070_0879100 | Ga0501070_0879100_149_658 | 165 |
| 617 | 3300049586 | Ga0501070_0887744 | Ga0501070_0887744_139_636 | 165 |
| 618 | 3300049823 | Ga0501044_0543391 | Ga0501044_0543391_25_525 | 165 |
| 619 | 3300050490 | nmdc:mga03n38_107709_c1 | nmdc:mga03n38_107709_c1_17_514 | 165 |
| 620 | 3300050491 | nmdc:mga00v17_39990_c1 | nmdc:mga00v17_39990_c1_1296_1793 | 165 |
| 621 | 3300050492 | nmdc:mga0yw44_91064_c1 | nmdc:mga0yw44_91064_c1_699_1196 | 165 |
| 622 | 3300050493 | nmdc:mga0k408_16783_c1 | nmdc:mga0k408_16783_c1_458_955 | 165 |
| 623 | 3300050496 | nmdc:mga07m45_339041_c1 | nmdc:mga07m45_339041_c1_360_857 | 165 |
| 624 | 3300050511 | nmdc:mga08y16_264528_c1 | nmdc:mga08y16_264528_c1_900_1400 | 165 |
| 625 | 3300050513 | nmdc:mga0rr50_160535_c1 | nmdc:mga0rr50_160535_c1_212_709 | 165 |
| 626 | 3300050514 | nmdc:mga08x19_111942_c1 | nmdc:mga08x19_111942_c1_131_628 | 165 |
| 627 | 3300053084 | Ga0495595_0003331 | Ga0495595_0003331_2278_2775 | 165 |
| 628 | 3300053085 | Ga0495619_0087435 | Ga0495619_0087435_1343_1840 | 165 |
| 629 | 3300053090 | Ga0500646_0075827 | Ga0500646_0075827_11_508 | 165 |
| 630 | 3300053092 | Ga0500583_0127484 | Ga0500583_0127484_28_525 | 165 |
| 631 | 3300053104 | Ga0500556_0059496 | Ga0500556_0059496_839_1339 | 165 |
| 632 | 3300053119 | Ga0500595_003189 | Ga0500595_003189_4008_4505 | 165 |
| 633 | 3300053124 | Ga0500617_156877 | Ga0500617_156877_370_867 | 165 |
| 634 | 3300053139 | Ga0500568_0002888 | Ga0500568_0002888_7996_8496 | 165 |
| 635 | 3300053146 | Ga0500588_0178200 | Ga0500588_0178200_34_531 | 165 |
| 636 | 3300053148 | Ga0500590_135322 | Ga0500590_135322_90_587 | 165 |
| 637 | 3300053153 | Ga0500616_0214824 | Ga0500616_0214824_128_628 | 165 |
| 638 | 3300053161 | Ga0500634_0292049 | Ga0500634_0292049_17_514 | 165 |
| 639 | 3300053162 | Ga0500638_305919 | Ga0500638_305919_84_581 | 165 |
| 640 | 3300053178 | Ga0500637_0198966 | Ga0500637_0198966_382_879 | 165 |
| 641 | 3300053727 | Ga0500611_005120 | Ga0500611_005120_849_1355 | 165 |
| 642 | iso_pu_bacteria | 2508501128 | 2509152196 | 165 |
| 643 | 3300001979 | JGI24740J21852_10000635 | JGI24740J21852_1000063510 | 166 |
| 644 | 3300001989 | JGI24739J22299_10002357 | JGI24739J22299_100023575 | 166 |
| 645 | 3300001990 | JGI24737J22298_10003086 | JGI24737J22298_100030864 | 166 |
| 646 | 3300003203 | JGI25406J46586_10005263 | JGI25406J46586_100052636 | 166 |
| 647 | 3300005356 | Ga0070674_100498464 | Ga0070674_1004984642 | 166 |
| 648 | 3300005434 | Ga0070709_10040833 | Ga0070709_100408333 | 166 |
| 649 | 3300005434 | Ga0070709_10285542 | Ga0070709_102855422 | 166 |
| 650 | 3300005435 | Ga0070714_100029045 | Ga0070714_1000290454 | 166 |
| 651 | 3300005435 | Ga0070714_100217983 | Ga0070714_1002179833 | 166 |
| 652 | 3300005436 | Ga0070713_100140678 | Ga0070713_1001406783 | 166 |
| 653 | 3300005439 | Ga0070711_100007751 | Ga0070711_1000077513 | 166 |
| 654 | 3300005439 | Ga0070711_100575956 | Ga0070711_1005759562 | 166 |
| 655 | 3300005456 | Ga0070678_100072529 | Ga0070678_1000725291 | 166 |
| 656 | 3300005457 | Ga0070662_100015653 | Ga0070662_1000156534 | 166 |
| 657 | 3300005458 | Ga0070681_10656376 | Ga0070681_106563761 | 166 |
| 658 | 3300005536 | Ga0070697_100030494 | Ga0070697_1000304942 | 166 |
| 659 | 3300005539 | Ga0068853_100039602 | Ga0068853_1000396023 | 166 |
| 660 | 3300005539 | Ga0068853_100046015 | Ga0068853_1000460153 | 166 |
| 661 | 3300005539 | Ga0068853_101241844 | Ga0068853_1012418441 | 166 |
| 662 | 3300005563 | Ga0068855_100067225 | Ga0068855_1000672253 | 166 |
| 663 | 3300005563 | Ga0068855_100106967 | Ga0068855_1001069673 | 166 |
| 664 | 3300005563 | Ga0068855_101468970 | Ga0068855_1014689702 | 166 |
| 665 | 3300005577 | Ga0068857_100028342 | Ga0068857_1000283424 | 166 |
| 666 | 3300005577 | Ga0068857_100058005 | Ga0068857_1000580053 | 166 |
| 667 | 3300005578 | Ga0068854_100020662 | Ga0068854_1000206623 | 166 |
| 668 | 3300005578 | Ga0068854_100042861 | Ga0068854_1000428614 | 166 |
| 669 | 3300005578 | Ga0068854_100093481 | Ga0068854_1000934813 | 166 |
| 670 | 3300005614 | Ga0068856_100003724 | Ga0068856_10000372415 | 166 |
| 671 | 3300005614 | Ga0068856_100031694 | Ga0068856_1000316943 | 166 |
| 672 | 3300005614 | Ga0068856_100111325 | Ga0068856_1001113254 | 166 |
| 673 | 3300005615 | Ga0070702_100464687 | Ga0070702_1004646871 | 166 |
| 674 | 3300005616 | Ga0068852_100066422 | Ga0068852_1000664223 | 166 |
| 675 | 3300005616 | Ga0068852_100530004 | Ga0068852_1005300041 | 166 |
| 676 | 3300005834 | Ga0068851_10001194 | Ga0068851_100011943 | 166 |
| 677 | 3300005841 | Ga0068863_102005528 | Ga0068863_1020055281 | 166 |
| 678 | 3300005843 | Ga0068860_100004778 | Ga0068860_10000477811 | 166 |
| 679 | 3300005843 | Ga0068860_100368300 | Ga0068860_1003683002 | 166 |
| 680 | 3300005937 | Ga0081455_10145426 | Ga0081455_101454262 | 166 |
| 681 | 3300005983 | Ga0081540_1085243 | Ga0081540_10852432 | 166 |
| 682 | 3300005983 | Ga0081540_1103057 | Ga0081540_11030572 | 166 |
| 683 | 3300005985 | Ga0081539_10013194 | Ga0081539_100131941 | 166 |
| 684 | 3300005985 | Ga0081539_10211928 | Ga0081539_102119281 | 166 |
| 685 | 3300006028 | Ga0070717_10098767 | Ga0070717_100987673 | 166 |
| 686 | 3300006048 | Ga0075363_100378395 | Ga0075363_1003783952 | 166 |
| 687 | 3300006173 | Ga0070716_100399754 | Ga0070716_1003997542 | 166 |
| 688 | 3300006175 | Ga0070712_100041741 | Ga0070712_1000417413 | 166 |
| 689 | 3300006941 | Ga0099825_1045942 | Ga0099825_10459422 | 166 |
| 690 | 3300006942 | Ga0099824_1009785 | Ga0099824_10097856 | 166 |
| 691 | 3300006943 | Ga0099822_1005813 | Ga0099822_10058133 | 166 |
| 692 | 3300009093 | Ga0105240_10036366 | Ga0105240_100363667 | 166 |
| 693 | 3300009093 | Ga0105240_10096341 | Ga0105240_100963414 | 166 |
| 694 | 3300009093 | Ga0105240_10131211 | Ga0105240_101312112 | 166 |
| 695 | 3300009093 | Ga0105240_11849552 | Ga0105240_118495521 | 166 |
| 696 | 3300009098 | Ga0105245_10475447 | Ga0105245_104754472 | 166 |
| 697 | 3300009148 | Ga0105243_10289444 | Ga0105243_102894441 | 166 |
| 698 | 3300009148 | Ga0105243_10602698 | Ga0105243_106026981 | 166 |
| 699 | 3300009174 | Ga0105241_11830538 | Ga0105241_118305381 | 166 |
| 700 | 3300009176 | Ga0105242_12177174 | Ga0105242_121771741 | 166 |
| 701 | 3300009177 | Ga0105248_10170027 | Ga0105248_101700272 | 166 |
| 702 | 3300009177 | Ga0105248_11104022 | Ga0105248_111040222 | 166 |
| 703 | 3300009545 | Ga0105237_10109815 | Ga0105237_101098153 | 166 |
| 704 | 3300009551 | Ga0105238_10012578 | Ga0105238_100125784 | 166 |
| 705 | 3300009551 | Ga0105238_10015975 | Ga0105238_100159753 | 166 |
| 706 | 3300010159 | Ga0099796_10096529 | Ga0099796_100965292 | 166 |
| 707 | 3300010375 | Ga0105239_10010073 | Ga0105239_100100737 | 166 |
| 708 | 3300010375 | Ga0105239_10036146 | Ga0105239_100361463 | 166 |
| 709 | 3300013307 | Ga0157372_11520180 | Ga0157372_115201802 | 166 |
| 710 | 3300014325 | Ga0163163_11719558 | Ga0163163_117195582 | 166 |
| 711 | 3300014969 | Ga0157376_11157383 | Ga0157376_111573831 | 166 |
| 712 | 3300021320 | Ga0214544_1000665 | Ga0214544_100066526 | 166 |
| 713 | 3300021321 | Ga0214542_1000486 | Ga0214542_100048626 | 166 |
| 714 | 3300021324 | Ga0214545_1000307 | Ga0214545_100030726 | 166 |
| 715 | 3300021327 | Ga0214543_1003627 | Ga0214543_100362710 | 166 |
| 716 | 3300021384 | Ga0213876_10299065 | Ga0213876_102990652 | 166 |
| 717 | 3300025261 | Ga0209233_1007434 | Ga0209233_10074342 | 166 |
| 718 | 3300025273 | Ga0209673_1035517 | Ga0209673_10355171 | 166 |
| 719 | 3300025297 | Ga0209758_1009335 | Ga0209758_10093354 | 166 |
| 720 | 3300025297 | Ga0209758_1009523 | Ga0209758_10095234 | 166 |
| 721 | 3300025321 | Ga0207656_10003104 | Ga0207656_100031043 | 166 |
| 722 | 3300025898 | Ga0207692_10292941 | Ga0207692_102929412 | 166 |
| 723 | 3300025904 | Ga0207647_10008467 | Ga0207647_100084673 | 166 |
| 724 | 3300025906 | Ga0207699_10033812 | Ga0207699_100338123 | 166 |
| 725 | 3300025911 | Ga0207654_10000210 | Ga0207654_1000021024 | 166 |
| 726 | 3300025913 | Ga0207695_10001435 | Ga0207695_1000143518 | 166 |
| 727 | 3300025913 | Ga0207695_10116136 | Ga0207695_101161362 | 166 |
| 728 | 3300025913 | Ga0207695_10128886 | Ga0207695_101288863 | 166 |
| 729 | 3300025914 | Ga0207671_10094407 | Ga0207671_100944073 | 166 |
| 730 | 3300025915 | Ga0207693_10121333 | Ga0207693_101213333 | 166 |
| 731 | 3300025916 | Ga0207663_10007390 | Ga0207663_100073902 | 166 |
| 732 | 3300025924 | Ga0207694_10000106 | Ga0207694_1000010675 | 166 |
| 733 | 3300025924 | Ga0207694_10014114 | Ga0207694_100141145 | 166 |
| 734 | 3300025924 | Ga0207694_10617111 | Ga0207694_106171111 | 166 |
| 735 | 3300025926 | Ga0207659_10927912 | Ga0207659_109279121 | 166 |
| 736 | 3300025928 | Ga0207700_10105138 | Ga0207700_101051381 | 166 |
| 737 | 3300025928 | Ga0207700_10155038 | Ga0207700_101550383 | 166 |
| 738 | 3300025929 | Ga0207664_10150552 | Ga0207664_101505523 | 166 |
| 739 | 3300025929 | Ga0207664_10237603 | Ga0207664_102376031 | 166 |
| 740 | 3300025933 | Ga0207706_10039352 | Ga0207706_100393523 | 166 |
| 741 | 3300025935 | Ga0207709_10758431 | Ga0207709_107584312 | 166 |
| 742 | 3300025937 | Ga0207669_11473601 | Ga0207669_114736011 | 166 |
| 743 | 3300025939 | Ga0207665_10028607 | Ga0207665_100286073 | 166 |
| 744 | 3300025939 | Ga0207665_10106396 | Ga0207665_101063963 | 166 |
| 745 | 3300025949 | Ga0207667_10010685 | Ga0207667_1001068510 | 166 |
| 746 | 3300025949 | Ga0207667_10973523 | Ga0207667_109735232 | 166 |
| 747 | 3300025981 | Ga0207640_10018761 | Ga0207640_100187615 | 166 |
| 748 | 3300025981 | Ga0207640_10049905 | Ga0207640_100499054 | 166 |
| 749 | 3300026035 | Ga0207703_10121267 | Ga0207703_101212672 | 166 |
| 750 | 3300026041 | Ga0207639_10017628 | Ga0207639_100176285 | 166 |
| 751 | 3300026067 | Ga0207678_10105285 | Ga0207678_101052852 | 166 |
| 752 | 3300026078 | Ga0207702_10000004 | Ga0207702_1000000475 | 166 |
| 753 | 3300026078 | Ga0207702_10000546 | Ga0207702_1000054650 | 166 |
| 754 | 3300026078 | Ga0207702_10229417 | Ga0207702_102294173 | 166 |
| 755 | 3300026078 | Ga0207702_10702857 | Ga0207702_107028571 | 166 |
| 756 | 3300026116 | Ga0207674_10018238 | Ga0207674_100182386 | 166 |
| 757 | 3300026116 | Ga0207674_10066904 | Ga0207674_100669043 | 166 |
| 758 | 3300026121 | Ga0207683_10127400 | Ga0207683_101274002 | 166 |
| 759 | 3300026142 | Ga0207698_10013935 | Ga0207698_100139353 | 166 |
| 760 | 3300026142 | Ga0207698_10069148 | Ga0207698_100691483 | 166 |
| 761 | 3300027357 | Ga0209589_1000035 | Ga0209589_100003542 | 166 |
| 762 | 3300027361 | Ga0209489_100079 | Ga0209489_10007942 | 166 |
| 763 | 3300027363 | Ga0209700_100077 | Ga0209700_10007742 | 166 |
| 764 | 3300028381 | Ga0268264_10000062 | Ga0268264_10000062282 | 166 |
| 765 | 3300028573 | Ga0265334_10005996 | Ga0265334_100059963 | 166 |
| 766 | 3300028794 | Ga0307515_10030422 | Ga0307515_100304227 | 166 |
| 767 | 3300028800 | Ga0265338_10761647 | Ga0265338_107616471 | 166 |
| 768 | 3300031235 | Ga0265330_10015040 | Ga0265330_100150401 | 166 |
| 769 | 3300031235 | Ga0265330_10033136 | Ga0265330_100331362 | 166 |
| 770 | 3300031235 | Ga0265330_10077895 | Ga0265330_100778952 | 166 |
| 771 | 3300031235 | Ga0265330_10098097 | Ga0265330_100980971 | 166 |
| 772 | 3300031238 | Ga0265332_10002500 | Ga0265332_100025006 | 166 |
| 773 | 3300031238 | Ga0265332_10127201 | Ga0265332_101272012 | 166 |
| 774 | 3300031241 | Ga0265325_10008179 | Ga0265325_100081792 | 166 |
| 775 | 3300031247 | Ga0265340_10059885 | Ga0265340_100598852 | 166 |
| 776 | 3300031247 | Ga0265340_10250690 | Ga0265340_102506902 | 166 |
| 777 | 3300031249 | Ga0265339_10032253 | Ga0265339_100322532 | 166 |
| 778 | 3300031249 | Ga0265339_10085392 | Ga0265339_100853922 | 166 |
| 779 | 3300031344 | Ga0265316_10100653 | Ga0265316_101006532 | 166 |
| 780 | 3300031507 | Ga0307509_10606463 | Ga0307509_106064632 | 166 |
| 781 | 3300031548 | Ga0307408_100749340 | Ga0307408_1007493402 | 166 |
| 782 | 3300031548 | Ga0307408_101145569 | Ga0307408_1011455691 | 166 |
| 783 | 3300031616 | Ga0307508_10152484 | Ga0307508_101524843 | 166 |
| 784 | 3300031616 | Ga0307508_10166436 | Ga0307508_101664362 | 166 |
| 785 | 3300031711 | Ga0265314_10026988 | Ga0265314_100269884 | 166 |
| 786 | 3300031711 | Ga0265314_10117320 | Ga0265314_101173202 | 166 |
| 787 | 3300031711 | Ga0265314_10137687 | Ga0265314_101376872 | 166 |
| 788 | 3300031711 | Ga0265314_10460891 | Ga0265314_104608911 | 166 |
| 789 | 3300031712 | Ga0265342_10326251 | Ga0265342_103262511 | 166 |
| 790 | 3300031712 | Ga0265342_10348656 | Ga0265342_103486561 | 166 |
| 791 | 3300031730 | Ga0307516_10164027 | Ga0307516_101640272 | 166 |
| 792 | 3300031901 | Ga0307406_10115655 | Ga0307406_101156553 | 166 |
| 793 | 3300033180 | Ga0307510_10014100 | Ga0307510_100141005 | 166 |
| 794 | 3300035086 | Ga0373934_0107241 | Ga0373934_0107241_485_997 | 166 |
| 795 | 3300035089 | Ga0373944_0029669 | Ga0373944_0029669_971_1477 | 166 |
| 796 | 3300035111 | Ga0373923_0124871 | Ga0373923_0124871_618_1130 | 166 |
| 797 | 3300035113 | Ga0373936_0425131 | Ga0373936_0425131_25_534 | 166 |
| 798 | 3300035117 | Ga0373953_0006029 | Ga0373953_0006029_3437_3949 | 166 |
| 799 | 3300035118 | Ga0373954_0041778 | Ga0373954_0041778_242_754 | 166 |
| 800 | 3300035119 | Ga0373956_0000581 | Ga0373956_0000581_157_669 | 166 |
| 801 | 3300035119 | Ga0373956_0213345 | Ga0373956_0213345_253_753 | 166 |
| 802 | 3300035120 | Ga0373957_0034748 | Ga0373957_0034748_25_537 | 166 |
| 803 | 3300035170 | Ga0373943_0004960 | Ga0373943_0004960_5436_5936 | 166 |
| 804 | 3300035171 | Ga0373946_0005215 | Ga0373946_0005215_2380_2880 | 166 |
| 805 | 3300035171 | Ga0373946_0139685 | Ga0373946_0139685_364_870 | 166 |
| 806 | 3300035172 | Ga0373955_0005025 | Ga0373955_0005025_133_645 | 166 |
| 807 | 3300035410 | Ga0373924_0031077 | Ga0373924_0031077_489_989 | 166 |
| 808 | 3300035691 | Ga0373931_0429106 | Ga0373931_0429106_77_589 | 166 |
| 809 | 3300035692 | Ga0373935_0000595 | Ga0373935_0000595_6339_6839 | 166 |
| 810 | 3300035692 | Ga0373935_0373992 | Ga0373935_0373992_306_812 | 166 |
| 811 | 3300035695 | Ga0373927_0001021 | Ga0373927_0001021_6218_6718 | 166 |
| 812 | 3300035695 | Ga0373927_0012902 | Ga0373927_0012902_2634_3140 | 166 |
| 813 | 3300035724 | Ga0373933_0000218 | Ga0373933_0000218_36342_36860 | 166 |
| 814 | 3300035724 | Ga0373933_0001113 | Ga0373933_0001113_14770_15282 | 166 |
| 815 | 3300035725 | Ga0373947_0000970 | Ga0373947_0000970_11368_11868 | 166 |
| 816 | 3300035725 | Ga0373947_0082864 | Ga0373947_0082864_1031_1537 | 166 |
| 817 | 3300035725 | Ga0373947_0392519 | Ga0373947_0392519_61_561 | 166 |
| 818 | 3300036401 | Ga0373937_0015997 | Ga0373937_0015997_149_649 | 166 |
| 819 | 3300036401 | Ga0373937_0104647 | Ga0373937_0104647_1995_2507 | 166 |
| 820 | 3300037068 | Ga0373925_0022227 | Ga0373925_0022227_2984_3484 | 166 |
| 821 | 3300037068 | Ga0373925_0047991 | Ga0373925_0047991_176_676 | 166 |
| 822 | 3300037418 | Ga0395900_0068610 | Ga0395900_0068610_2893_3393 | 166 |
| 823 | 3300037466 | Ga0395898_0233063 | Ga0395898_0233063_17_517 | 166 |
| 824 | 3300037471 | Ga0395905_0150031 | Ga0395905_0150031_154_654 | 166 |
| 825 | 3300039437 | Ga0436365_0345621 | Ga0436365_0345621_339_842 | 166 |
| 826 | 3300039437 | Ga0436365_0747851 | Ga0436365_0747851_44_553 | 166 |
| 827 | 3300044658 | Ga0466972_0000804 | Ga0466972_0000804_8301_8801 | 166 |
| 828 | 3300044683 | Ga0466965_0027670 | Ga0466965_0027670_310_810 | 166 |
| 829 | 3300044683 | Ga0466965_0265746 | Ga0466965_0265746_348_848 | 166 |
| 830 | 3300044693 | Ga0466961_0477019 | Ga0466961_0477019_147_647 | 166 |
| 831 | 3300044735 | Ga0466968_0200919 | Ga0466968_0200919_247_750 | 166 |
| 832 | 3300044765 | Ga0466970_0052790 | Ga0466970_0052790_117_620 | 166 |
| 833 | 3300045976 | Ga0466967_0171920 | Ga0466967_0171920_1138_1641 | 166 |
| 834 | 3300046454 | Ga0495592_0004267 | Ga0495592_0004267_9921_10433 | 166 |
| 835 | 3300046455 | Ga0495603_0001390 | Ga0495603_0001390_6371_6871 | 166 |
| 836 | 3300046455 | Ga0495603_0012891 | Ga0495603_0012891_2792_3295 | 166 |
| 837 | 3300046455 | Ga0495603_0240265 | Ga0495603_0240265_371_871 | 166 |
| 838 | 3300046459 | Ga0495629_0000915 | Ga0495629_0000915_16822_17322 | 166 |
| 839 | 3300046459 | Ga0495629_0004437 | Ga0495629_0004437_3824_4336 | 166 |
| 840 | 3300046461 | Ga0495641_0007969 | Ga0495641_0007969_128_628 | 166 |
| 841 | 3300046463 | Ga0495653_0020185 | Ga0495653_0020185_3658_4170 | 166 |
| 842 | 3300046463 | Ga0495653_0054414 | Ga0495653_0054414_1043_1543 | 166 |
| 843 | 3300046472 | Ga0495580_0009685 | Ga0495580_0009685_4247_4747 | 166 |
| 844 | 3300046472 | Ga0495580_0250141 | Ga0495580_0250141_675_1181 | 166 |
| 845 | 3300046473 | Ga0495582_0000302 | Ga0495582_0000302_19529_20029 | 166 |
| 846 | 3300046475 | Ga0495639_0016344 | Ga0495639_0016344_668_1168 | 166 |
| 847 | 3300046475 | Ga0495639_0019607 | Ga0495639_0019607_1504_2007 | 166 |
| 848 | 3300046476 | Ga0495662_0001985 | Ga0495662_0001985_3597_4097 | 166 |
| 849 | 3300046477 | Ga0495664_0019091 | Ga0495664_0019091_1900_2400 | 166 |
| 850 | 3300046477 | Ga0495664_0347623 | Ga0495664_0347623_49_579 | 166 |
| 851 | 3300046499 | Ga0495594_0000046 | Ga0495594_0000046_9536_10036 | 166 |
| 852 | 3300046507 | Ga0495606_0001471 | Ga0495606_0001471_3369_3878 | 166 |
| 853 | 3300046511 | Ga0495608_0040877 | Ga0495608_0040877_1239_1751 | 166 |
| 854 | 3300046511 | Ga0495608_0160446 | Ga0495608_0160446_686_1186 | 166 |
| 855 | 3300046514 | Ga0495618_0023457 | Ga0495618_0023457_2655_3155 | 166 |
| 856 | 3300046516 | Ga0495628_0049222 | Ga0495628_0049222_2669_3181 | 166 |
| 857 | 3300046516 | Ga0495628_0187605 | Ga0495628_0187605_362_862 | 166 |
| 858 | 3300046517 | Ga0495630_0004933 | Ga0495630_0004933_3469_3969 | 166 |
| 859 | 3300046518 | Ga0495631_0188122 | Ga0495631_0188122_133_636 | 166 |
| 860 | 3300046519 | Ga0495632_0293119 | Ga0495632_0293119_181_684 | 166 |
| 861 | 3300046526 | Ga0495666_0094326 | Ga0495666_0094326_244_744 | 166 |
| 862 | 3300046529 | Ga0495652_0006987 | Ga0495652_0006987_387_899 | 166 |
| 863 | 3300046531 | Ga0495665_0000335 | Ga0495665_0000335_22333_22833 | 166 |
| 864 | 3300046533 | Ga0495640_0021072 | Ga0495640_0021072_3616_4116 | 166 |
| 865 | 3300046535 | Ga0495586_0101878 | Ga0495586_0101878_627_1127 | 166 |
| 866 | 3300046536 | Ga0495587_0297084 | Ga0495587_0297084_150_662 | 166 |
| 867 | 3300046543 | Ga0495645_0143727 | Ga0495645_0143727_87_599 | 166 |
| 868 | 3300046557 | Ga0495622_0001947 | Ga0495622_0001947_7323_7823 | 166 |
| 869 | 3300046559 | Ga0495667_0076968 | Ga0495667_0076968_687_1187 | 166 |
| 870 | 3300046616 | Ga0495668_0066637 | Ga0495668_0066637_267_770 | 166 |
| 871 | 3300046642 | Ga0495634_0001329 | Ga0495634_0001329_16045_16545 | 166 |
| 872 | 3300046642 | Ga0495634_0009349 | Ga0495634_0009349_5698_6210 | 166 |
| 873 | 3300046660 | Ga0495625_0181728 | Ga0495625_0181728_422_931 | 166 |
| 874 | 3300046663 | Ga0495635_0011167 | Ga0495635_0011167_3008_3508 | 166 |
| 875 | 3300046663 | Ga0495635_0016673 | Ga0495635_0016673_96_608 | 166 |
| 876 | 3300046674 | Ga0495588_0002250 | Ga0495588_0002250_1348_1848 | 166 |
| 877 | 3300046675 | Ga0495657_0046286 | Ga0495657_0046286_1239_1751 | 166 |
| 878 | 3300046678 | Ga0495599_0358416 | Ga0495599_0358416_134_646 | 166 |
| 879 | 3300046679 | Ga0495623_0277154 | Ga0495623_0277154_133_633 | 166 |
| 880 | 3300046680 | Ga0495646_0017629 | Ga0495646_0017629_2294_2806 | 166 |
| 881 | 3300046680 | Ga0495646_0254534 | Ga0495646_0254534_134_634 | 166 |
| 882 | 3300046681 | Ga0495647_0000898 | Ga0495647_0000898_2100_2600 | 166 |
| 883 | 3300046681 | Ga0495647_0032228 | Ga0495647_0032228_909_1412 | 166 |
| 884 | 3300046681 | Ga0495647_0269454 | Ga0495647_0269454_119_727 | 166 |
| 885 | 3300046683 | Ga0495658_0000201 | Ga0495658_0000201_5904_6404 | 166 |
| 886 | 3300046689 | Ga0495613_0004521 | Ga0495613_0004521_481_981 | 166 |
| 887 | 3300046689 | Ga0495613_0013945 | Ga0495613_0013945_4743_5255 | 166 |
| 888 | 3300046689 | Ga0495613_0107083 | Ga0495613_0107083_967_1566 | 166 |
| 889 | 3300046690 | Ga0495624_0004061 | Ga0495624_0004061_7155_7655 | 166 |
| 890 | 3300046690 | Ga0495624_0231555 | Ga0495624_0231555_318_821 | 166 |
| 891 | 3300046690 | Ga0495624_0779064 | Ga0495624_0779064_40_546 | 166 |
| 892 | 3300046809 | Ga0495600_0099016 | Ga0495600_0099016_1239_1751 | 166 |
| 893 | 3300047315 | Ga0495581_0000030 | Ga0495581_0000030_1086_1586 | 166 |
| 894 | 3300047315 | Ga0495581_0019419 | Ga0495581_0019419_1121_1624 | 166 |
| 895 | 3300047315 | Ga0495581_0262381 | Ga0495581_0262381_32_544 | 166 |
| 896 | 3300047317 | Ga0495604_0776886 | Ga0495604_0776886_23_532 | 166 |
| 897 | 3300047319 | Ga0495674_0002494 | Ga0495674_0002494_15173_15673 | 166 |
| 898 | 3300047319 | Ga0495674_0117626 | Ga0495674_0117626_135_647 | 166 |
| 899 | 3300047320 | Ga0495672_0011216 | Ga0495672_0011216_735_1253 | 166 |
| 900 | 3300047321 | Ga0495676_0005339 | Ga0495676_0005339_5972_6472 | 166 |
| 901 | 3300047322 | Ga0495680_0028090 | Ga0495680_0028090_2539_3051 | 166 |
| 902 | 3300047322 | Ga0495680_0097180 | Ga0495680_0097180_187_687 | 166 |
| 903 | 3300047322 | Ga0495680_0791809 | Ga0495680_0791809_86_586 | 166 |
| 904 | 3300047444 | Ga0495675_0010421 | Ga0495675_0010421_3825_4337 | 166 |
| 905 | 3300047471 | Ga0495684_0013438 | Ga0495684_0013438_1874_2386 | 166 |
| 906 | 3300047471 | Ga0495684_0099383 | Ga0495684_0099383_478_978 | 166 |
| 907 | 3300047472 | Ga0495686_0139005 | Ga0495686_0139005_376_879 | 166 |
| 908 | 3300047673 | Ga0495593_0000100 | Ga0495593_0000100_795_1295 | 166 |
| 909 | 3300047673 | Ga0495593_0000740 | Ga0495593_0000740_14379_14891 | 166 |
| 910 | 3300048088 | Ga0495602_0091663 | Ga0495602_0091663_576_1088 | 166 |
| 911 | 3300048089 | Ga0495614_0007180 | Ga0495614_0007180_2472_2972 | 166 |
| 912 | 3300048904 | Ga0496101_0157719 | Ga0496101_0157719_162_677 | 166 |
| 913 | 3300048905 | Ga0496102_0112985 | Ga0496102_0112985_1065_1565 | 166 |
| 914 | 3300048905 | Ga0496102_0369963 | Ga0496102_0369963_469_984 | 166 |
| 915 | 3300048905 | Ga0496102_0918503 | Ga0496102_0918503_121_624 | 166 |
| 916 | 3300048907 | Ga0496104_0133370 | Ga0496104_0133370_826_1326 | 166 |
| 917 | 3300048909 | Ga0496106_0013334 | Ga0496106_0013334_1827_2327 | 166 |
| 918 | 3300048910 | Ga0496107_0029342 | Ga0496107_0029342_1577_2077 | 166 |
| 919 | 3300048911 | Ga0496108_0000160 | Ga0496108_0000160_33055_33555 | 166 |
| 920 | 3300048912 | Ga0496109_0000245 | Ga0496109_0000245_19582_20082 | 166 |
| 921 | 3300048914 | Ga0496111_0109796 | Ga0496111_0109796_21_521 | 166 |
| 922 | 3300048915 | Ga0496112_0390338 | Ga0496112_0390338_668_1171 | 166 |
| 923 | 3300048916 | Ga0496113_0008153 | Ga0496113_0008153_6084_6584 | 166 |
| 924 | 3300048916 | Ga0496113_0239520 | Ga0496113_0239520_670_1218 | 166 |
| 925 | 3300048917 | Ga0496114_0090327 | Ga0496114_0090327_2030_2539 | 166 |
| 926 | 3300048924 | Ga0496121_0231365 | Ga0496121_0231365_266_772 | 166 |
| 927 | 3300048929 | Ga0496126_0670628 | Ga0496126_0670628_236_736 | 166 |
| 928 | 3300048929 | Ga0496126_0736918 | Ga0496126_0736918_184_684 | 166 |
| 929 | 3300053077 | Ga0495601_0020279 | Ga0495601_0020279_1385_1897 | 166 |
| 930 | 3300053078 | Ga0495612_0212665 | Ga0495612_0212665_336_836 | 166 |
| 931 | 3300053084 | Ga0495595_0001985 | Ga0495595_0001985_2290_2802 | 166 |
| 932 | 3300053085 | Ga0495619_0013161 | Ga0495619_0013161_2611_3123 | 166 |
| 933 | 3300053085 | Ga0495619_0280022 | Ga0495619_0280022_515_1015 | 166 |
| 934 | 3300053085 | Ga0495619_0738122 | Ga0495619_0738122_52_555 | 166 |
| 935 | 3300053158 | Ga0500627_0365214 | Ga0500627_0365214_91_594 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sp3-assembly1.cif.gz_A | e. coli rpph bound to ap4a | 0.8691 | 1 | 165 |
| 4s2y-assembly1.cif.gz_A | structure of e. coli rpph bound to rna and three magnesium ions | 0.8636 | 1 | 165 |
| 6d1v-assembly1.cif.gz_B | crystal structure of e. coli rpph-dapf complex, monomer bound to rna | 0.8601 | 1 | 165 |
| 1jkn-assembly1.cif.gz_A | solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp | 0.8579 | 5 | 163 |
| 6vcn-assembly1.cif.gz_A | crystal structure of e.coli rpph in complex with ppcpg | 0.8486 | 2 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6SXU5_1_159_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8712 | 1 | 164 | 3.90.79.10 |
| 4s2yA00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8636 | 1 | 165 | 3.90.79.10 |
| af_C6SXU5_1_159_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8608 | 1 | 164 | 3.90.79.10 |
| af_A0A0R0I796_20_164_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8449 | 21 | 164 | 3.90.79.10 |
| 4s2yA00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8317 | 1 | 165 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M7TT42-F1-model_v4 | Putative (Di)nucleoside polyphosphate hydrolase | 0.9883 | 4 | 166 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A2T7U4S9-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) | 0.9757 | 5 | 165 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A5B2VQP9-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) | 0.971 | 2 | 165 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A4Q0MIE2-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) | 0.9649 | 2 | 166 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A1M7TT42-F1-model_v4 | Putative (Di)nucleoside polyphosphate hydrolase | 0.9648 | 4 | 166 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar