F486166

General Info

Members Datasets Scaffolds Average Seq Length
935 343 893 316

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0004773|Ga0466972_0004773_5349_6422
Length 357
Sequence MDCSESLNNPPGIRKATMDKLQAMEVFVQVVDAGSFTRAADNMKLPKATVSTLISNLEAALTVKLLNRTTRALSVTADGAAYYERCRAILADVQDAEDSLSKTRSSASGRLRVDVPSAIGRDLLVPALPDFFKRYPDITLELGCSDRPVDLIEEGVDCVVRGGSLADSSVLVARRIGALHFMTCAAPSYLAVHGRPTHPEDLLRHLCVNYFSAKTGKVYEWDFFRDGERIQLQVPGYLAVNDSTAYHAAALSGIGIVQMPLYTARPHLDAGTLEAVLEDWCSEPVALHVMYPQNRHLSAKVRAFVEWVAELFAGHPSLQLDAVRCKDVQAAEPGTSSKEVKSKRGQRDAEAVRARAP

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
5 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
6 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
7 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
8 2643221556 Massilia sp. Root1485 Isolate Unclassified
9 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
10 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
11 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
12 2643221638 Duganella sp. Root336D2 Isolate Unclassified
13 2643221645 Massilia sp. Root351 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221664 Massilia sp. Root418 Isolate Unclassified
16 2643221684 Massilia sp. Root133 Isolate Unclassified
17 2738541280 Massilia sp. GV090 Isolate Unclassified
18 2738541297 Duganella sp. GV083 Isolate Unclassified
19 2738541300 Massilia sp. GV016 Isolate Unclassified
20 2738541357 Duganella sp. GV053 Isolate Unclassified
21 2738543003 Duganella sp. GV066 Isolate Unclassified
22 2738543018 Massilia sp. GV045 Isolate Unclassified
23 2738543026 Duganella sp. GV089 Isolate Unclassified
24 2738543029 Duganella sp. GV039 Isolate Unclassified
25 2738543030 Massilia sp. GV097 Isolate Unclassified
26 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
27 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
28 2821131069 Duganella sp. 1224 Isolate Unclassified
29 2842711865 Duganella sp. R-73148 Isolate Unclassified
30 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
31 2857553236 Duganella sp. R-74557 Isolate Unclassified
32 2857558681 Duganella sp. R-74565 Isolate Unclassified
33 2857564685 Duganella sp. R-74599 Isolate Unclassified
34 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
35 2904424332 Duganella sp. 1411 Isolate Rhizosphere
36 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
37 2919476304 Duganella sp. 3397 Isolate Unclassified
38 2928058823 Ralstonia sp. 1138 Isolate Unclassified
39 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
40 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
41 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
42 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
43 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
52 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
53 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
54 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
55 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
56 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
68 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
167 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
168 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
169 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
170 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
186 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
191 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
210 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
274 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
311 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
312 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
321 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
322 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
323 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
324 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
325 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
326 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
327 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
328 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
329 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
330 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
331 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
332 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
333 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
334 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
335 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
336 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
337 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
338 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
339 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
343 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.97
Metatranscriptomes 0.53
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.43
Nodule 0.53
Rhizoplane 3.96
Rhizosphere 70.7
Stem 0
Stem Tuber 0
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000908 3300001979 Bacteria 13122
2 JGI24740J21852_10005306 3300001979 Bacteria 5468
3 JGI25156J39149_1009127 3300002705 Bacteria 2437
4 JGI25154J39366_1000317 3300002738 Bacteria 27993
5 JGI25154J39366_1001547 3300002738 Bacteria 7974
6 JGI25152J39213_1005631 3300002773 Bacteria 3596
7 JGI25150J39212_1000956 3300002774 Bacteria 9182
8 JGI25150J39212_1005653 3300002774 Plasmid 2651
9 JGI25159J45721_1001022 3300002987 Bacteria 12014
10 JGI25159J45721_1001312 3300002987 Bacteria 10492
11 JGI25159J45721_1019022 3300002987 Unclassified 1365
12 JGI25151J46595_10000616 3300003187 Bacteria 31174
13 JGI25153J46596_10002329 3300003215 Bacteria 11017
14 JGI25153J46596_10006454 3300003215 Bacteria 5919
15 JGI25153J46596_10008710 3300003215 Bacteria 4810
16 rootL2_10031388 3300003322 Unclassified 1894
17 rootL2_10056599 3300003322 Bacteria 1613
18 JGI25160J50197_1013594 3300003354 Unclassified 2766
19 JGI25161J50226_1000930 3300003374 Bacteria 10500
20 JGI25161J50226_1009594 3300003374 Unclassified 1365
21 Ga0055539_1000079 3300003752 Bacteria 126504
22 Ga0055533_1000470 3300003756 Bacteria 15223
23 Ga0055532_1000075 3300003758 Bacteria 124604
24 Ga0055532_1000112 3300003758 Bacteria 86782
25 Ga0055525_1000009 3300003759 Bacteria 596899
26 Ga0055525_1000581 3300003759 Bacteria 15994
27 Ga0055527_1000733 3300003760 Bacteria 9280
28 Ga0055535_1000013 3300003761 Bacteria 299614
29 Ga0055529_1000068 3300003763 Bacteria 163911
30 Ga0055529_1000085 3300003763 Bacteria 140832
31 Ga0055526_1000050 3300003771 Bacteria 117283
32 Ga0055526_1000266 3300003771 Bacteria 44005
33 Ga0055526_1000416 3300003771 Bacteria 34343
34 Ga0055526_1001745 3300003771 Bacteria 15109
35 Ga0055526_1010244 3300003771 Bacteria 4385
36 Ga0055537_1000039 3300003773 Bacteria 92151
37 Ga0055524_1000008 3300003775 Bacteria 297761
38 Ga0055524_1000148 3300003775 Bacteria 83128
39 Ga0055524_1001481 3300003775 Bacteria 13408
40 Ga0055524_1001704 3300003775 Bacteria 12256
41 Ga0055524_1001922 3300003775 Bacteria 11208
42 Ga0055524_1002138 3300003775 Bacteria 10395
43 Ga0055534_1000174 3300003784 Bacteria 47983
44 Ga0055534_1011729 3300003784 Unclassified 1766
45 Ga0055528_1000119 3300003790 Bacteria 62428
46 Ga0055530_10001765 3300003791 Bacteria 15111
47 Ga0055530_10005235 3300003791 Bacteria 6266
48 Ga0055530_10007483 3300003791 Unclassified 4587
49 Ga0055530_10007706 3300003791 Unclassified 4480
50 Ga0055530_10013932 3300003791 Bacteria 2712
51 Ga0055540_1000018 3300003792 Bacteria 218360
52 Ga0055531_10007672 3300003794 Bacteria 5834
53 Ga0055531_10009270 3300003794 Bacteria 5055
54 Ga0055541_1000476 3300003841 Bacteria 11492
55 Ga0055543_1001067 3300004625 Bacteria 12099
56 Ga0055543_1001373 3300004625 Bacteria 9792
57 Ga0065165_1000005 3300005262 Bacteria 370361
58 Ga0065165_1003335 3300005262 Bacteria 11451
59 Ga0065165_1006284 3300005262 Bacteria 6299
60 Ga0065165_1019452 3300005262 Bacteria 2423
61 Ga0065715_10158456 3300005293 Bacteria 1653
62 Ga0070658_10049875 3300005327 Bacteria 3392
63 Ga0070670_100245772 3300005331 Bacteria 1558
64 Ga0070680_100250438 3300005336 Bacteria 1498
65 Ga0070660_100151901 3300005339 Bacteria 1862
66 Ga0070661_100000007 3300005344 Bacteria 202433
67 Ga0070661_100035543 3300005344 Bacteria 3618
68 Ga0070661_100210153 3300005344 Bacteria 1489
69 Ga0070659_100002470 3300005366 Bacteria 13123
70 Ga0070659_100045745 3300005366 Bacteria 3429
71 Ga0070711_100059058 3300005439 Bacteria 2661
72 Ga0070663_100000002 3300005455 Bacteria 298075
73 Ga0068855_100125378 3300005563 Bacteria 2936
74 Ga0070664_100000004 3300005564 Bacteria 298075
75 Ga0068857_100004834 3300005577 Bacteria 11416
76 Ga0068854_100000034 3300005578 Bacteria 102389
77 Ga0068856_100000051 3300005614 Bacteria 107551
78 Ga0081539_10005567 3300005985 Bacteria 12752
79 Ga0081539_10062725 3300005985 Bacteria 2030
80 Ga0070717_10158188 3300006028 Bacteria 1964
81 Ga0075363_100079316 3300006048 Bacteria 1793
82 Ga0075364_10069062 3300006051 Bacteria 2325
83 Ga0070716_100069902 3300006173 Bacteria 2059
84 Ga0070716_100076877 3300006173 Unclassified 1980
85 Ga0075362_10015690 3300006177 Bacteria 3086
86 Ga0075369_10028666 3300006186 Bacteria 2335
87 Ga0075366_10030880 3300006195 Bacteria 3151
88 Ga0075370_10010558 3300006353 Bacteria 4833
89 Ga0068865_100078895 3300006881 Bacteria 2357
90 Ga0079104_1000012 3300006946 Bacteria 355143
91 Ga0079104_1007845 3300006946 Bacteria 3808
92 Ga0099826_10000001 3300006948 Bacteria 1155201
93 Ga0105244_10003629 3300009036 Bacteria 10935
94 Ga0105244_10007709 3300009036 Bacteria 6818
95 Ga0105244_10097393 3300009036 Bacteria 1442
96 Ga0105240_10018967 3300009093 Bacteria 9211
97 Ga0105240_10230511 3300009093 Bacteria 2153
98 Ga0105245_10160701 3300009098 Bacteria 2132
99 Ga0114129_10032299 3300009147 Bacteria 7398
100 Ga0105243_10020972 3300009148 Bacteria 4958
101 Ga0105242_10118988 3300009176 Bacteria 2263
102 Ga0105249_10335597 3300009553 Unclassified 1527
103 Ga0099796_10004632 3300010159 Bacteria 3351
104 Ga0157373_10006916 3300013100 Bacteria 8444
105 Ga0157371_10000001 3300013102 Bacteria 1162285
106 Ga0157371_10000270 3300013102 Bacteria 70773
107 Ga0157370_10000014 3300013104 Bacteria 194894
108 Ga0157369_10005917 3300013105 Bacteria 14202
109 Ga0157372_10000032 3300013307 Bacteria 178666
110 Ga0182008_10000245 3300014497 Bacteria 42026
111 Ga0182008_10013723 3300014497 Bacteria 4256
112 Ga0182006_1000002 3300015261 Bacteria 887990
113 Ga0182006_1000029 3300015261 Bacteria 247579
114 Ga0182006_1001626 3300015261 Bacteria 13287
115 Ga0182006_1003399 3300015261 Bacteria 8145
116 Ga0182007_10000085 3300015262 Bacteria 70105
117 Ga0182005_1000002 3300015265 Bacteria 908499
118 Ga0182005_1000012 3300015265 Bacteria 396944
119 Ga0206351_10676099 3300020077 Bacteria 2045
120 Ga0154015_1662132 3300020610 Bacteria 7083
121 Ga0213872_10000032 3300021361 Bacteria 138939
122 Ga0213872_10003325 3300021361 Bacteria 8961
123 Ga0213872_10006281 3300021361 Bacteria 5994
124 Ga0224712_10049331 3300022467 Bacteria 1630
125 Ga0209436_100559 3300025208 Bacteria 16062
126 Ga0209784_100008 3300025224 Bacteria 740293
127 Ga0209784_100398 3300025224 Bacteria 19803
128 Ga0209784_100604 3300025224 Bacteria 11602
129 Ga0209566_100006 3300025225 Bacteria 789272
130 Ga0209566_100383 3300025225 Bacteria 35898
131 Ga0209566_101077 3300025225 Bacteria 10725
132 Ga0209674_100083 3300025226 Bacteria 197744
133 Ga0209674_100142 3300025226 Bacteria 107750
134 Ga0209672_100419 3300025228 Bacteria 24911
135 Ga0209147_100005 3300025229 Bacteria 1036530
136 Ga0209563_100015 3300025230 Bacteria 879901
137 Ga0209563_100016 3300025230 Bacteria 802091
138 Ga0209563_111169 3300025230 Bacteria 1277
139 Ga0209258_100007 3300025242 Bacteria 1036530
140 Ga0207425_1000001 3300025245 Bacteria 2525432
141 Ga0207425_1000130 3300025245 Bacteria 70791
142 Ga0207425_1000158 3300025245 Bacteria 57310
143 Ga0207425_1017058 3300025245 Bacteria 1602
144 Ga0209646_1000007 3300025246 Bacteria 670994
145 Ga0209646_1000016 3300025246 Bacteria 501688
146 Ga0209026_1002022 3300025250 Bacteria 8038
147 Ga0209026_1012928 3300025250 Bacteria 1436
148 Ga0209677_100008 3300025253 Bacteria 802091
149 Ga0209677_105001 3300025253 Bacteria 3605
150 Ga0209148_1000051 3300025254 Bacteria 401000
151 Ga0209759_1003975 3300025256 Bacteria 5672
152 Ga0209759_1006274 3300025256 Bacteria 4021
153 Ga0209129_1000003 3300025258 Bacteria 903689
154 Ga0209129_1000169 3300025258 Bacteria 96253
155 Ga0209565_1000003 3300025263 Bacteria 1099648
156 Ga0209565_1000162 3300025263 Bacteria 89049
157 Ga0209565_1000383 3300025263 Bacteria 37599
158 Ga0209565_1003444 3300025263 Bacteria 5110
159 Ga0209565_1009939 3300025263 Bacteria 2382
160 Ga0209455_1000011 3300025272 Bacteria 947242
161 Ga0209455_1000026 3300025272 Bacteria 653778
162 Ga0209673_1000003 3300025273 Bacteria 980859
163 Ga0209673_1005650 3300025273 Bacteria 6242
164 Ga0209673_1015149 3300025273 Bacteria 2945
165 Ga0209673_1016237 3300025273 Bacteria 2793
166 Ga0209130_1000084 3300025284 Bacteria 160070
167 Ga0209130_1000438 3300025284 Bacteria 44389
168 Ga0209130_1006830 3300025284 Bacteria 3634
169 Ga0209675_1000003 3300025291 Bacteria 1003982
170 Ga0209675_1000621 3300025291 Bacteria 25338
171 Ga0209675_1004929 3300025291 Bacteria 5760
172 Ga0209025_1000029 3300025294 Bacteria 488571
173 Ga0209025_1011738 3300025294 Bacteria 5718
174 Ga0209564_1000002 3300025295 Bacteria 1636803
175 Ga0209564_1000007 3300025295 Bacteria 1028582
176 Ga0209564_1000012 3300025295 Bacteria 792078
177 Ga0209564_1000057 3300025295 Bacteria 340400
178 Ga0209564_1000311 3300025295 Bacteria 95587
179 Ga0209564_1002802 3300025295 Bacteria 12975
180 Ga0209564_1003059 3300025295 Bacteria 11886
181 Ga0209758_1000041 3300025297 Bacteria 410328
182 Ga0209758_1000214 3300025297 Bacteria 126364
183 Ga0209758_1000232 3300025297 Bacteria 117382
184 Ga0209758_1000950 3300025297 Bacteria 39087
185 Ga0209050_1000011 3300025298 Bacteria 914037
186 Ga0209050_1000138 3300025298 Bacteria 173923
187 Ga0209050_1000248 3300025298 Bacteria 116319
188 Ga0209050_1001215 3300025298 Bacteria 30104
189 Ga0209050_1004162 3300025298 Bacteria 10019
190 Ga0209050_1009360 3300025298 Bacteria 5024
191 Ga0209256_1000005 3300025299 Bacteria 1315082
192 Ga0209256_1000068 3300025299 Bacteria 246064
193 Ga0209256_1000255 3300025299 Bacteria 94783
194 Ga0209256_1000271 3300025299 Bacteria 90540
195 Ga0209256_1000295 3300025299 Bacteria 87239
196 Ga0209256_1000957 3300025299 Bacteria 34943
197 Ga0207426_1006138 3300025302 Bacteria 5291
198 Ga0209051_1000004 3300025303 Bacteria 1155596
199 Ga0209051_1013404 3300025303 Bacteria 3903
200 Ga0209257_1000003 3300025304 Bacteria 1702593
201 Ga0209257_1000360 3300025304 Bacteria 92894
202 Ga0209257_1005836 3300025304 Bacteria 8348
203 Ga0207655_1014025 3300025728 Bacteria 4560
204 Ga0207655_1030673 3300025728 Bacteria 2495
205 Ga0207705_10005829 3300025909 Bacteria 9176
206 Ga0207654_10004484 3300025911 Bacteria 7049
207 Ga0207654_10236255 3300025911 Bacteria 1219
208 Ga0207695_10003419 3300025913 Bacteria 22406
209 Ga0207695_10041245 3300025913 Bacteria 4941
210 Ga0207657_10010492 3300025919 Bacteria 9240
211 Ga0207657_10043211 3300025919 Bacteria 3972
212 Ga0207657_10155165 3300025919 Bacteria 1862
213 Ga0207649_10000131 3300025920 Bacteria 63801
214 Ga0207690_10020173 3300025932 Bacteria 4114
215 Ga0207706_10238402 3300025933 Bacteria 1590
216 Ga0207686_10084299 3300025934 Bacteria 2082
217 Ga0207709_10009729 3300025935 Bacteria 5297
218 Ga0207704_10124672 3300025938 Bacteria 1771
219 Ga0207665_10040684 3300025939 Bacteria 3102
220 Ga0207665_10188651 3300025939 Unclassified 1497
221 Ga0207679_10000002 3300025945 Bacteria 634491
222 Ga0207679_10010718 3300025945 Bacteria 5912
223 Ga0207679_10048717 3300025945 Bacteria 3086
224 Ga0207679_10085841 3300025945 Bacteria 2419
225 Ga0207667_10059113 3300025949 Bacteria 4017
226 Ga0207667_10112262 3300025949 Bacteria 2811
227 Ga0207640_10000121 3300025981 Bacteria 59308
228 Ga0207640_10206926 3300025981 Bacteria 1491
229 Ga0207678_10000003 3300026067 Bacteria 282716
230 Ga0207702_10000010 3300026078 Bacteria 292789
231 Ga0207674_10017674 3300026116 Bacteria 7774
232 Ga0209281_1000039 3300027111 Bacteria 355150
233 Ga0209281_1008607 3300027111 Bacteria 2461
234 Ga0209179_1013680 3300027512 Bacteria 1478
235 Ga0209974_10003986 3300027876 Bacteria 5281
236 Ga0265323_10011065 3300028653 Bacteria 3647
237 Ga0316177_1166234 3300030731 Bacteria 3330
238 Ga0316177_1182650 3300030731 Bacteria 1209
239 Ga0316180_1007102 3300030736 Bacteria 1842
240 Ga0316181_1223875 3300030744 Bacteria 1573
241 Ga0265760_10022582 3300031090 Bacteria 1823
242 Ga0265328_10026794 3300031239 Bacteria 2165
243 Ga0265327_10000056 3300031251 Bacteria 243974
244 Ga0307513_10054483 3300031456 Bacteria 4288
245 Ga0307408_100001935 3300031548 Bacteria 15022
246 Ga0307408_100002737 3300031548 Bacteria 12237
247 Ga0307408_100025215 3300031548 Bacteria 4071
248 Ga0307416_100122759 3300032002 Bacteria 2319
249 Ga0307411_10218573 3300032005 Bacteria 1477
250 Ga0373939_0051271 3300035114 Bacteria 1282
251 Ga0395899_0000581 3300037312 Bacteria 38482
252 Ga0395899_0001454 3300037312 Bacteria 20187
253 Ga0395899_0004791 3300037312 Bacteria 10544
254 Ga0395899_0117705 3300037312 Bacteria 1906
255 Ga0395899_0196432 3300037312 Bacteria 1409
256 Ga0395899_0219252 3300037312 Bacteria 1318
257 Ga0395900_0000484 3300037418 Bacteria 56481
258 Ga0395900_0002244 3300037418 Bacteria 21506
259 Ga0395900_0003719 3300037418 Bacteria 16391
260 Ga0395900_0014843 3300037418 Bacteria 7938
261 Ga0395900_0016378 3300037418 Bacteria 7557
262 Ga0395900_0048346 3300037418 Bacteria 4382
263 Ga0395900_0132620 3300037418 Bacteria 2552
264 Ga0395900_0171483 3300037418 Bacteria 2208
265 Ga0395900_0251514 3300037418 Bacteria 1768
266 Ga0395900_0314438 3300037418 Bacteria 1548
267 Ga0395900_0320813 3300037418 Bacteria 1529
268 Ga0395900_0364622 3300037418 Bacteria 1415
269 Ga0395900_0382854 3300037418 Bacteria 1374
270 Ga0395898_0031471 3300037466 Bacteria 5300
271 Ga0395898_0170026 3300037466 Bacteria 2083
272 Ga0395898_0241073 3300037466 Bacteria 1724
273 Ga0395898_0274951 3300037466 Bacteria 1606
274 Ga0395898_0398923 3300037466 Bacteria 1311
275 Ga0395905_0000111 3300037471 Bacteria 136345
276 Ga0395905_0036606 3300037471 Bacteria 4609
277 Ga0395905_0086248 3300037471 Bacteria 2942
278 Ga0395905_0121640 3300037471 Bacteria 2454
279 Ga0395905_0214715 3300037471 Bacteria 1802
280 Ga0395905_0366561 3300037471 Bacteria 1333
281 Ga0395905_0514437 3300037471 Bacteria 1097
282 Ga0395901_0182347 3300038443 Bacteria 2202
283 Ga0395901_0308645 3300038443 Bacteria 1639
284 Ga0395901_0397330 3300038443 Bacteria 1416
285 Ga0395901_0519091 3300038443 Bacteria 1210
286 Ga0436361_0377150 3300039447 Bacteria 4975
287 Ga0436361_0482460 3300039447 Bacteria 27559
288 Ga0436361_0604829 3300039447 Bacteria 7063
289 Ga0451795_0749222 3300041456 Bacteria 1335
290 Ga0451798_0885868 3300041458 Bacteria 2018
291 Ga0451804_0963191 3300041463 Bacteria 2161
292 Ga0451807_1511311 3300041486 Bacteria 2532
293 Ga0439448_0000681 3300042005 Bacteria 8114
294 Ga0439455_0010427 3300042012 Bacteria 2043
295 Ga0450919_000532 3300042121 Bacteria 4782
296 Ga0450904_000226 3300042139 Bacteria 12285
297 Ga0439458_0009509 3300042157 Bacteria 2164
298 Ga0450918_000948 3300042531 Bacteria 6063
299 Ga0466969_0013941 3300044656 Bacteria 4232
300 Ga0466969_0025166 3300044656 Bacteria 3062
301 Ga0466972_0000018 3300044658 Bacteria 199161
302 Ga0466972_0004773 3300044658 Bacteria 6791
303 Ga0466972_0029272 3300044658 Bacteria 2711
304 Ga0466972_0048500 3300044658 Bacteria 2051
305 Ga0466978_0039971 3300044671 Bacteria 2901
306 Ga0466965_0008358 3300044683 Bacteria 4787
307 Ga0466965_0015432 3300044683 Bacteria 3629
308 Ga0466965_0021746 3300044683 Bacteria 3090
309 Ga0466966_0004557 3300044684 Bacteria 9131
310 Ga0466966_0033361 3300044684 Bacteria 3333
311 Ga0466966_0074032 3300044684 Bacteria 2129
312 Ga0466961_0000035 3300044693 Bacteria 82931
313 Ga0466961_0057316 3300044693 Bacteria 2480
314 Ga0466963_0010873 3300044694 Bacteria 5526
315 Ga0466964_0000193 3300044706 Bacteria 16911
316 Ga0466964_0002262 3300044706 Bacteria 6822
317 Ga0466964_0015269 3300044706 Bacteria 2922
318 Ga0466964_0021363 3300044706 Bacteria 2503
319 Ga0466964_0103584 3300044706 Bacteria 1258
320 Ga0453684_0040621 3300044712 Bacteria 6312
321 Ga0466968_0001597 3300044735 Bacteria 8177
322 Ga0466968_0016900 3300044735 Bacteria 2909
323 Ga0466970_0021182 3300044765 Bacteria 3385
324 Ga0466970_0023409 3300044765 Bacteria 3225
325 Ga0466957_0006525 3300044842 Bacteria 6589
326 Ga0466957_0009421 3300044842 Bacteria 5577
327 Ga0466957_0037607 3300044842 Bacteria 2914
328 Ga0466967_0018036 3300045976 Bacteria 5628
329 Ga0466967_0148083 3300045976 Bacteria 2191
330 Ga0495617_002808 3300046452 Bacteria 6712
331 Ga0495627_000007 3300046453 Bacteria 575915
332 Ga0495627_001166 3300046453 Bacteria 16847
333 Ga0495627_005942 3300046453 Bacteria 4850
334 Ga0495590_0000010 3300046457 Bacteria 317890
335 Ga0495590_0000215 3300046457 Bacteria 31491
336 Ga0495590_0038070 3300046457 Bacteria 1676
337 Ga0495591_003250 3300046458 Bacteria 8536
338 Ga0495591_040443 3300046458 Bacteria 1329
339 Ga0495638_0000027 3300046460 Bacteria 337569
340 Ga0495638_0000035 3300046460 Bacteria 276385
341 Ga0495638_0007617 3300046460 Bacteria 7740
342 Ga0495638_0018090 3300046460 Bacteria 4686
343 Ga0495638_0018384 3300046460 Bacteria 4642
344 Ga0495638_0200143 3300046460 Bacteria 1128
345 Ga0495638_0242980 3300046460 Bacteria 996
346 Ga0495653_0006487 3300046463 Bacteria 9593
347 Ga0495653_0130992 3300046463 Bacteria 1775
348 Ga0495653_0148055 3300046463 Bacteria 1643
349 Ga0495650_0000044 3300046471 Bacteria 355139
350 Ga0495650_0000066 3300046471 Bacteria 272883
351 Ga0495650_0000159 3300046471 Bacteria 152501
352 Ga0495650_0000299 3300046471 Bacteria 90064
353 Ga0495650_0000376 3300046471 Bacteria 77893
354 Ga0495650_0000762 3300046471 Bacteria 39837
355 Ga0495650_0002387 3300046471 Bacteria 15378
356 Ga0495650_0008054 3300046471 Bacteria 6222
357 Ga0495650_0011738 3300046471 Bacteria 4767
358 Ga0495580_0071871 3300046472 Bacteria 2417
359 Ga0495582_0012187 3300046473 Bacteria 4736
360 Ga0495605_0000027 3300046474 Bacteria 220680
361 Ga0495605_0000081 3300046474 Bacteria 125302
362 Ga0495605_0000087 3300046474 Bacteria 120256
363 Ga0495605_0006810 3300046474 Bacteria 6529
364 Ga0495605_0012102 3300046474 Bacteria 4795
365 Ga0495605_0012366 3300046474 Bacteria 4738
366 Ga0495605_0021237 3300046474 Bacteria 3441
367 Ga0495605_0022354 3300046474 Bacteria 3340
368 Ga0495605_0053317 3300046474 Bacteria 1962
369 Ga0495639_0064868 3300046475 Bacteria 1679
370 Ga0495584_0000284 3300046491 Bacteria 35747
371 Ga0495584_0000656 3300046491 Bacteria 23083
372 Ga0495584_0001086 3300046491 Bacteria 16890
373 Ga0495584_0002251 3300046491 Bacteria 11006
374 Ga0495584_0008430 3300046491 Bacteria 5340
375 Ga0495584_0018670 3300046491 Bacteria 3525
376 Ga0495584_0026465 3300046491 Bacteria 2938
377 Ga0495584_0061937 3300046491 Bacteria 1880
378 Ga0495585_0002659 3300046492 Bacteria 12544
379 Ga0495585_0004022 3300046492 Bacteria 9681
380 Ga0495585_0005099 3300046492 Bacteria 8357
381 Ga0495585_0005608 3300046492 Bacteria 7883
382 Ga0495585_0006411 3300046492 Bacteria 7307
383 Ga0495585_0009675 3300046492 Bacteria 5771
384 Ga0495585_0017246 3300046492 Bacteria 4174
385 Ga0495585_0062429 3300046492 Bacteria 2046
386 Ga0495585_0097775 3300046492 Bacteria 1574
387 Ga0495585_0124613 3300046492 Bacteria 1360
388 Ga0495594_0013361 3300046499 Bacteria 4286
389 Ga0495594_0017430 3300046499 Bacteria 3795
390 Ga0495594_0020311 3300046499 Bacteria 3537
391 Ga0495594_0020960 3300046499 Bacteria 3486
392 Ga0495596_0001025 3300046500 Bacteria 16597
393 Ga0495596_0001303 3300046500 Bacteria 14388
394 Ga0495596_0005349 3300046500 Bacteria 6078
395 Ga0495596_0006643 3300046500 Bacteria 5299
396 Ga0495596_0018016 3300046500 Bacteria 2915
397 Ga0495596_0028655 3300046500 Bacteria 2234
398 Ga0495596_0031312 3300046500 Bacteria 2125
399 Ga0495607_0002642 3300046501 Bacteria 14388
400 Ga0495607_0003259 3300046501 Bacteria 12483
401 Ga0495607_0005410 3300046501 Bacteria 9144
402 Ga0495607_0006251 3300046501 Bacteria 8401
403 Ga0495607_0011211 3300046501 Bacteria 5979
404 Ga0495607_0012494 3300046501 Bacteria 5602
405 Ga0495607_0020085 3300046501 Bacteria 4229
406 Ga0495607_0023228 3300046501 Bacteria 3882
407 Ga0495607_0024157 3300046501 Bacteria 3793
408 Ga0495607_0073202 3300046501 Bacteria 1905
409 Ga0495607_0093533 3300046501 Bacteria 1623
410 Ga0495607_0133937 3300046501 Bacteria 1285
411 Ga0495583_0000006 3300046506 Bacteria 436893
412 Ga0495583_0000008 3300046506 Bacteria 411092
413 Ga0495583_0000021 3300046506 Bacteria 287046
414 Ga0495583_0000241 3300046506 Bacteria 90735
415 Ga0495583_0000889 3300046506 Bacteria 35812
416 Ga0495583_0002552 3300046506 Bacteria 15377
417 Ga0495583_0003576 3300046506 Bacteria 11685
418 Ga0495583_0005082 3300046506 Bacteria 9078
419 Ga0495583_0018529 3300046506 Bacteria 3661
420 Ga0495583_0042030 3300046506 Bacteria 2137
421 Ga0495583_0049299 3300046506 Bacteria 1929
422 Ga0495583_0102905 3300046506 Bacteria 1217
423 Ga0495583_0108587 3300046506 Bacteria 1177
424 Ga0495606_0000015 3300046507 Bacteria 288808
425 Ga0495606_0000103 3300046507 Bacteria 145893
426 Ga0495606_0000132 3300046507 Bacteria 126919
427 Ga0495606_0001376 3300046507 Bacteria 32882
428 Ga0495606_0002672 3300046507 Bacteria 20226
429 Ga0495606_0003996 3300046507 Bacteria 15065
430 Ga0495606_0011112 3300046507 Bacteria 7383
431 Ga0495606_0020832 3300046507 Bacteria 4819
432 Ga0495606_0032198 3300046507 Bacteria 3635
433 Ga0495606_0042741 3300046507 Bacteria 3028
434 Ga0495606_0048860 3300046507 Bacteria 2779
435 Ga0495606_0097559 3300046507 Bacteria 1795
436 Ga0495606_0115159 3300046507 Bacteria 1616
437 Ga0495606_0170628 3300046507 Bacteria 1262
438 Ga0495610_0000008 3300046512 Bacteria 622732
439 Ga0495610_0001892 3300046512 Bacteria 18088
440 Ga0495610_0002550 3300046512 Bacteria 15164
441 Ga0495610_0011619 3300046512 Bacteria 5367
442 Ga0495610_0019698 3300046512 Bacteria 3765
443 Ga0495610_0020090 3300046512 Bacteria 3716
444 Ga0495610_0023194 3300046512 Bacteria 3378
445 Ga0495610_0090544 3300046512 Bacteria 1387
446 Ga0495616_0000262 3300046513 Bacteria 42459
447 Ga0495616_0000814 3300046513 Bacteria 22764
448 Ga0495616_0005469 3300046513 Bacteria 7814
449 Ga0495616_0011598 3300046513 Bacteria 5042
450 Ga0495616_0012089 3300046513 Bacteria 4913
451 Ga0495616_0019243 3300046513 Bacteria 3728
452 Ga0495616_0063574 3300046513 Bacteria 1803
453 Ga0495616_0095234 3300046513 Bacteria 1403
454 Ga0495630_0041577 3300046517 Bacteria 3433
455 Ga0495631_0000612 3300046518 Bacteria 23546
456 Ga0495631_0002259 3300046518 Bacteria 11041
457 Ga0495631_0007858 3300046518 Bacteria 5407
458 Ga0495631_0010695 3300046518 Bacteria 4535
459 Ga0495631_0014433 3300046518 Bacteria 3814
460 Ga0495631_0028193 3300046518 Bacteria 2562
461 Ga0495631_0029324 3300046518 Bacteria 2503
462 Ga0495632_0000040 3300046519 Bacteria 149644
463 Ga0495632_0002350 3300046519 Bacteria 14503
464 Ga0495632_0002654 3300046519 Bacteria 13424
465 Ga0495632_0003323 3300046519 Bacteria 11470
466 Ga0495632_0009849 3300046519 Bacteria 5716
467 Ga0495632_0022738 3300046519 Bacteria 3356
468 Ga0495632_0025628 3300046519 Bacteria 3117
469 Ga0495637_0000006 3300046520 Bacteria 435763
470 Ga0495637_0000524 3300046520 Bacteria 27917
471 Ga0495637_0002085 3300046520 Bacteria 11246
472 Ga0495637_0083141 3300046520 Bacteria 1273
473 Ga0495643_0000022 3300046522 Bacteria 289691
474 Ga0495643_0000117 3300046522 Bacteria 129698
475 Ga0495643_0000192 3300046522 Bacteria 96511
476 Ga0495643_0001148 3300046522 Bacteria 25919
477 Ga0495643_0004686 3300046522 Bacteria 9495
478 Ga0495643_0007442 3300046522 Bacteria 7057
479 Ga0495643_0009654 3300046522 Bacteria 5978
480 Ga0495643_0014817 3300046522 Bacteria 4629
481 Ga0495643_0014957 3300046522 Bacteria 4601
482 Ga0495643_0037964 3300046522 Bacteria 2640
483 Ga0495643_0088116 3300046522 Bacteria 1605
484 Ga0495643_0112784 3300046522 Bacteria 1380
485 Ga0495644_0001210 3300046523 Bacteria 10561
486 Ga0495644_0002559 3300046523 Bacteria 7231
487 Ga0495644_0003758 3300046523 Bacteria 5974
488 Ga0495644_0007894 3300046523 Bacteria 4098
489 Ga0495644_0008115 3300046523 Bacteria 4039
490 Ga0495644_0010949 3300046523 Bacteria 3495
491 Ga0495644_0012012 3300046523 Bacteria 3327
492 Ga0495648_0000571 3300046524 Bacteria 39432
493 Ga0495648_0000719 3300046524 Bacteria 35255
494 Ga0495648_0000875 3300046524 Bacteria 31749
495 Ga0495648_0002832 3300046524 Bacteria 15609
496 Ga0495648_0005134 3300046524 Bacteria 10958
497 Ga0495648_0011418 3300046524 Bacteria 6691
498 Ga0495648_0025099 3300046524 Bacteria 4042
499 Ga0495648_0039003 3300046524 Bacteria 3029
500 Ga0495648_0042043 3300046524 Bacteria 2879
501 Ga0495648_0067721 3300046524 Bacteria 2086
502 Ga0495648_0074753 3300046524 Bacteria 1951
503 Ga0495663_0041722 3300046525 Bacteria 1396
504 Ga0495666_0000268 3300046526 Bacteria 22520
505 Ga0495666_0023693 3300046526 Bacteria 3035
506 Ga0495666_0037333 3300046526 Bacteria 2363
507 Ga0495666_0050727 3300046526 Bacteria 1994
508 Ga0495642_0000057 3300046528 Bacteria 66980
509 Ga0495642_0001072 3300046528 Bacteria 12654
510 Ga0495642_0001279 3300046528 Bacteria 11358
511 Ga0495642_0003386 3300046528 Bacteria 6295
512 Ga0495642_0005390 3300046528 Bacteria 4908
513 Ga0495642_0012173 3300046528 Bacteria 3314
514 Ga0495642_0012459 3300046528 Bacteria 3278
515 Ga0495642_0017136 3300046528 Bacteria 2829
516 Ga0495642_0018026 3300046528 Bacteria 2760
517 Ga0495642_0019849 3300046528 Bacteria 2635
518 Ga0495642_0022708 3300046528 Bacteria 2473
519 Ga0495642_0028351 3300046528 Bacteria 2230
520 Ga0495642_0033201 3300046528 Bacteria 2074
521 Ga0495642_0053633 3300046528 Bacteria 1662
522 Ga0495652_0013194 3300046529 Bacteria 7438
523 Ga0495654_0000002 3300046530 Bacteria 1021205
524 Ga0495654_0012228 3300046530 Bacteria 4616
525 Ga0495654_0013859 3300046530 Bacteria 4303
526 Ga0495654_0026607 3300046530 Bacteria 2972
527 Ga0495654_0050495 3300046530 Bacteria 2032
528 Ga0495654_0058003 3300046530 Bacteria 1869
529 Ga0495665_0002647 3300046531 Bacteria 9661
530 Ga0495665_0005143 3300046531 Bacteria 7055
531 Ga0495665_0030522 3300046531 Bacteria 2885
532 Ga0495640_0017995 3300046533 Bacteria 5254
533 Ga0495640_0108935 3300046533 Bacteria 1812
534 Ga0495586_0019673 3300046535 Bacteria 3596
535 Ga0495586_0049651 3300046535 Bacteria 2268
536 Ga0495586_0110386 3300046535 Bacteria 1530
537 Ga0495587_0041172 3300046536 Bacteria 2757
538 Ga0495609_0000096 3300046538 Bacteria 104135
539 Ga0495609_0000607 3300046538 Bacteria 28034
540 Ga0495609_0001057 3300046538 Bacteria 19309
541 Ga0495609_0001889 3300046538 Bacteria 13364
542 Ga0495609_0002159 3300046538 Bacteria 12358
543 Ga0495609_0003723 3300046538 Bacteria 8611
544 Ga0495609_0005033 3300046538 Bacteria 7068
545 Ga0495609_0008527 3300046538 Bacteria 5018
546 Ga0495609_0009819 3300046538 Bacteria 4615
547 Ga0495609_0019233 3300046538 Bacteria 3162
548 Ga0495609_0028945 3300046538 Bacteria 2525
549 Ga0495609_0036056 3300046538 Bacteria 2235
550 Ga0495609_0043056 3300046538 Bacteria 2027
551 Ga0495597_0000146 3300046542 Bacteria 62336
552 Ga0495597_0000357 3300046542 Bacteria 40721
553 Ga0495597_0000447 3300046542 Bacteria 35347
554 Ga0495597_0001332 3300046542 Bacteria 18000
555 Ga0495597_0002318 3300046542 Bacteria 12345
556 Ga0495597_0013016 3300046542 Bacteria 3995
557 Ga0495597_0023419 3300046542 Bacteria 2855
558 Ga0495597_0063989 3300046542 Bacteria 1598
559 Ga0495622_0000012 3300046557 Bacteria 189011
560 Ga0495622_0000281 3300046557 Bacteria 38709
561 Ga0495622_0008632 3300046557 Bacteria 4723
562 Ga0495622_0126300 3300046557 Bacteria 1166
563 Ga0495633_0000375 3300046558 Bacteria 47710
564 Ga0495633_0000377 3300046558 Bacteria 47490
565 Ga0495633_0002006 3300046558 Bacteria 14734
566 Ga0495633_0002910 3300046558 Bacteria 11743
567 Ga0495633_0003466 3300046558 Bacteria 10490
568 Ga0495633_0004824 3300046558 Bacteria 8453
569 Ga0495633_0006501 3300046558 Bacteria 6918
570 Ga0495633_0006512 3300046558 Bacteria 6904
571 Ga0495633_0017132 3300046558 Bacteria 3713
572 Ga0495633_0046218 3300046558 Bacteria 2060
573 Ga0495633_0078927 3300046558 Bacteria 1532
574 Ga0495656_0003512 3300046615 Bacteria 5304
575 Ga0495656_0014365 3300046615 Bacteria 2968
576 Ga0495656_0031351 3300046615 Bacteria 2156
577 Ga0495656_0126376 3300046615 Bacteria 1212
578 Ga0495668_0000006 3300046616 Bacteria 553404
579 Ga0495668_0000038 3300046616 Bacteria 232122
580 Ga0495668_0000394 3300046616 Bacteria 57677
581 Ga0495668_0000606 3300046616 Bacteria 43443
582 Ga0495668_0001536 3300046616 Bacteria 21899
583 Ga0495668_0001656 3300046616 Bacteria 20772
584 Ga0495668_0002352 3300046616 Bacteria 15728
585 Ga0495668_0004518 3300046616 Bacteria 9844
586 Ga0495668_0006974 3300046616 Bacteria 7302
587 Ga0495668_0015959 3300046616 Bacteria 4374
588 Ga0495668_0016325 3300046616 Bacteria 4315
589 Ga0495668_0073873 3300046616 Bacteria 1872
590 Ga0495668_0079666 3300046616 Bacteria 1797
591 Ga0495668_0086846 3300046616 Bacteria 1715
592 Ga0495668_0115725 3300046616 Bacteria 1466
593 Ga0495634_0055594 3300046642 Bacteria 2646
594 Ga0495611_0004070 3300046648 Bacteria 6361
595 Ga0495611_0004871 3300046648 Bacteria 5762
596 Ga0495611_0006178 3300046648 Bacteria 5111
597 Ga0495611_0007082 3300046648 Bacteria 4762
598 Ga0495611_0020589 3300046648 Bacteria 2840
599 Ga0495611_0084447 3300046648 Bacteria 1463
600 Ga0495625_0000488 3300046660 Bacteria 59464
601 Ga0495625_0000516 3300046660 Bacteria 56935
602 Ga0495625_0001664 3300046660 Bacteria 26021
603 Ga0495625_0007421 3300046660 Bacteria 9544
604 Ga0495625_0013188 3300046660 Bacteria 6655
605 Ga0495625_0019224 3300046660 Bacteria 5306
606 Ga0495625_0027778 3300046660 Bacteria 4253
607 Ga0495625_0039967 3300046660 Bacteria 3424
608 Ga0495625_0108500 3300046660 Bacteria 1899
609 Ga0495625_0150652 3300046660 Bacteria 1564
610 Ga0495625_0183528 3300046660 Bacteria 1390
611 Ga0495659_0000008 3300046664 Bacteria 102082
612 Ga0495659_0001397 3300046664 Bacteria 8231
613 Ga0495659_0002919 3300046664 Bacteria 5491
614 Ga0495659_0031699 3300046664 Bacteria 1846
615 Ga0495661_0000252 3300046665 Bacteria 61493
616 Ga0495661_0001204 3300046665 Bacteria 22455
617 Ga0495661_0001940 3300046665 Bacteria 16437
618 Ga0495661_0001951 3300046665 Bacteria 16359
619 Ga0495661_0009650 3300046665 Bacteria 6613
620 Ga0495661_0011326 3300046665 Bacteria 6051
621 Ga0495661_0017639 3300046665 Bacteria 4710
622 Ga0495661_0041429 3300046665 Bacteria 2849
623 Ga0495661_0044131 3300046665 Bacteria 2735
624 Ga0495661_0046118 3300046665 Bacteria 2662
625 Ga0495661_0057901 3300046665 Bacteria 2311
626 Ga0495661_0058159 3300046665 Bacteria 2305
627 Ga0495661_0060729 3300046665 Bacteria 2245
628 Ga0495661_0085590 3300046665 Bacteria 1806
629 Ga0495588_0000070 3300046674 Bacteria 227611
630 Ga0495588_0009321 3300046674 Bacteria 4533
631 Ga0495588_0011957 3300046674 Bacteria 4088
632 Ga0495588_0018467 3300046674 Bacteria 3401
633 Ga0495588_0093430 3300046674 Bacteria 1576
634 Ga0495588_0117422 3300046674 Bacteria 1402
635 Ga0495623_0006925 3300046679 Bacteria 7368
636 Ga0495623_0043564 3300046679 Bacteria 2855
637 Ga0495623_0058165 3300046679 Bacteria 2431
638 Ga0495669_0000117 3300046684 Bacteria 51712
639 Ga0495669_0003025 3300046684 Bacteria 6911
640 Ga0495669_0005350 3300046684 Bacteria 5349
641 Ga0495669_0024815 3300046684 Bacteria 2611
642 Ga0495669_0031443 3300046684 Bacteria 2331
643 Ga0495669_0036339 3300046684 Bacteria 2177
644 Ga0495669_0079492 3300046684 Bacteria 1503
645 Ga0495613_0015998 3300046689 Bacteria 5584
646 Ga0495670_0007099 3300046691 Bacteria 5515
647 Ga0495670_0012121 3300046691 Bacteria 4240
648 Ga0495670_0012732 3300046691 Bacteria 4136
649 Ga0495670_0023725 3300046691 Bacteria 3028
650 Ga0495670_0030116 3300046691 Bacteria 2696
651 Ga0495670_0039099 3300046691 Bacteria 2366
652 Ga0495670_0059741 3300046691 Bacteria 1914
653 Ga0495671_0000002 3300046692 Bacteria 1136189
654 Ga0495671_0000080 3300046692 Bacteria 92649
655 Ga0495671_0000181 3300046692 Bacteria 56009
656 Ga0495671_0014707 3300046692 Bacteria 4205
657 Ga0495671_0018306 3300046692 Bacteria 3719
658 Ga0495671_0044539 3300046692 Bacteria 2224
659 Ga0495671_0058739 3300046692 Bacteria 1902
660 Ga0495671_0077783 3300046692 Bacteria 1626
661 Ga0495671_0090874 3300046692 Bacteria 1494
662 Ga0495649_0000236 3300046694 Bacteria 48689
663 Ga0495649_0000427 3300046694 Bacteria 36486
664 Ga0495649_0010742 3300046694 Bacteria 5393
665 Ga0495649_0013362 3300046694 Bacteria 4737
666 Ga0495649_0036911 3300046694 Bacteria 2684
667 Ga0495649_0074611 3300046694 Bacteria 1817
668 Ga0495589_0000036 3300046794 Bacteria 153299
669 Ga0495589_0000216 3300046794 Bacteria 48762
670 Ga0495589_0001075 3300046794 Bacteria 16343
671 Ga0495589_0006669 3300046794 Bacteria 6081
672 Ga0495589_0022474 3300046794 Bacteria 3218
673 Ga0495589_0023668 3300046794 Bacteria 3127
674 Ga0495589_0082011 3300046794 Bacteria 1568
675 Ga0495660_0000816 3300046810 Bacteria 23275
676 Ga0495660_0001684 3300046810 Bacteria 14806
677 Ga0495660_0002482 3300046810 Bacteria 11760
678 Ga0495660_0003435 3300046810 Bacteria 9796
679 Ga0495660_0004868 3300046810 Bacteria 8085
680 Ga0495660_0007317 3300046810 Bacteria 6488
681 Ga0495660_0009142 3300046810 Bacteria 5786
682 Ga0495660_0010489 3300046810 Bacteria 5389
683 Ga0495660_0015568 3300046810 Bacteria 4393
684 Ga0495660_0078012 3300046810 Bacteria 1742
685 Ga0495660_0150918 3300046810 Bacteria 1147
686 Ga0495581_0034275 3300047315 Bacteria 2937
687 Ga0495604_0050480 3300047317 Bacteria 3229
688 Ga0495604_0075673 3300047317 Bacteria 2534
689 Ga0495604_0189388 3300047317 Bacteria 1434
690 Ga0495636_0000238 3300047318 Bacteria 21775
691 Ga0495636_0006514 3300047318 Bacteria 4590
692 Ga0495636_0016569 3300047318 Bacteria 2945
693 Ga0495636_0098264 3300047318 Bacteria 1277
694 Ga0495672_0000022 3300047320 Bacteria 420632
695 Ga0495672_0000095 3300047320 Bacteria 143883
696 Ga0495672_0000337 3300047320 Bacteria 60563
697 Ga0495672_0000602 3300047320 Bacteria 40520
698 Ga0495672_0000621 3300047320 Bacteria 39604
699 Ga0495672_0001813 3300047320 Bacteria 20439
700 Ga0495672_0006978 3300047320 Bacteria 8584
701 Ga0495672_0008498 3300047320 Bacteria 7562
702 Ga0495672_0035785 3300047320 Bacteria 3055
703 Ga0495672_0080746 3300047320 Bacteria 1813
704 Ga0495676_0000035 3300047321 Bacteria 120519
705 Ga0495676_0068685 3300047321 Bacteria 2737
706 Ga0495680_0003304 3300047322 Bacteria 15971
707 Ga0495680_0030531 3300047322 Bacteria 4400
708 Ga0495683_0000758 3300047323 Bacteria 23276
709 Ga0495683_0004529 3300047323 Bacteria 7873
710 Ga0495683_0006758 3300047323 Bacteria 6241
711 Ga0495683_0007411 3300047323 Bacteria 5939
712 Ga0495683_0013472 3300047323 Bacteria 4276
713 Ga0495683_0024659 3300047323 Bacteria 3086
714 Ga0495683_0067578 3300047323 Bacteria 1759
715 Ga0495683_0067963 3300047323 Bacteria 1754
716 Ga0495683_0126914 3300047323 Bacteria 1206
717 Ga0495687_000074 3300047443 Bacteria 153464
718 Ga0495687_000154 3300047443 Bacteria 104740
719 Ga0495687_000245 3300047443 Bacteria 73990
720 Ga0495687_003388 3300047443 Bacteria 11611
721 Ga0495687_023322 3300047443 Bacteria 2956
722 Ga0495687_077333 3300047443 Bacteria 1314
723 Ga0495675_0007255 3300047444 Bacteria 6828
724 Ga0495675_0010943 3300047444 Bacteria 5684
725 Ga0495677_0000042 3300047445 Bacteria 75189
726 Ga0495677_0000815 3300047445 Bacteria 12607
727 Ga0495677_0000891 3300047445 Bacteria 12019
728 Ga0495677_0005914 3300047445 Bacteria 4634
729 Ga0495677_0007524 3300047445 Bacteria 4066
730 Ga0495677_0015431 3300047445 Bacteria 2774
731 Ga0495677_0030097 3300047445 Bacteria 1975
732 Ga0495677_0046929 3300047445 Bacteria 1585
733 Ga0495679_009956 3300047446 Bacteria 3766
734 Ga0495679_010228 3300047446 Bacteria 3696
735 Ga0495679_011386 3300047446 Bacteria 3435
736 Ga0495679_029590 3300047446 Bacteria 1785
737 Ga0495685_000069 3300047447 Bacteria 38803
738 Ga0495685_002279 3300047447 Bacteria 5984
739 Ga0495685_006837 3300047447 Bacteria 3753
740 Ga0495673_0000005 3300047469 Bacteria 943364
741 Ga0495673_0000012 3300047469 Bacteria 656908
742 Ga0495673_0000064 3300047469 Bacteria 225793
743 Ga0495673_0000109 3300047469 Bacteria 166877
744 Ga0495673_0007915 3300047469 Bacteria 6035
745 Ga0495673_0010826 3300047469 Bacteria 4937
746 Ga0495681_0001793 3300047470 Bacteria 15822
747 Ga0495681_0002624 3300047470 Bacteria 12773
748 Ga0495681_0004966 3300047470 Bacteria 8975
749 Ga0495681_0009395 3300047470 Bacteria 6030
750 Ga0495681_0011083 3300047470 Bacteria 5402
751 Ga0495681_0022579 3300047470 Bacteria 3363
752 Ga0495681_0025803 3300047470 Bacteria 3070
753 Ga0495681_0026586 3300047470 Bacteria 3008
754 Ga0495681_0038437 3300047470 Bacteria 2346
755 Ga0495681_0066821 3300047470 Bacteria 1640
756 Ga0495686_0000462 3300047472 Bacteria 61070
757 Ga0495686_0000573 3300047472 Bacteria 52364
758 Ga0495686_0000651 3300047472 Bacteria 47444
759 Ga0495686_0001478 3300047472 Bacteria 25551
760 Ga0495686_0005039 3300047472 Bacteria 10601
761 Ga0495686_0051664 3300047472 Bacteria 2579
762 Ga0495686_0115000 3300047472 Bacteria 1609
763 Ga0495593_0020091 3300047673 Bacteria 3740
764 Ga0495602_0004054 3300048088 Bacteria 15255
765 Ga0495602_0196278 3300048088 Bacteria 1543
766 Ga0495614_0027849 3300048089 Bacteria 2436
767 Ga0495626_0000006 3300048091 Bacteria 284977
768 Ga0495626_0000030 3300048091 Bacteria 202562
769 Ga0495626_0003060 3300048091 Bacteria 10978
770 Ga0495626_0007164 3300048091 Bacteria 6236
771 Ga0495626_0009545 3300048091 Bacteria 5241
772 Ga0495626_0012157 3300048091 Bacteria 4525
773 Ga0495626_0012405 3300048091 Bacteria 4468
774 Ga0495626_0015090 3300048091 Bacteria 3960
775 Ga0495626_0026006 3300048091 Bacteria 2856
776 Ga0495626_0030871 3300048091 Bacteria 2582
777 Ga0495626_0085933 3300048091 Bacteria 1390
778 Ga0496100_0055428 3300048903 Bacteria 2590
779 Ga0496100_0115200 3300048903 Bacteria 1874
780 Ga0496101_0171985 3300048904 Bacteria 1665
781 Ga0496101_0283550 3300048904 Bacteria 1295
782 Ga0496102_0002947 3300048905 Bacteria 14439
783 Ga0496102_0009747 3300048905 Bacteria 8260
784 Ga0496102_0022369 3300048905 Bacteria 5601
785 Ga0496102_0059217 3300048905 Bacteria 3502
786 Ga0496102_0075042 3300048905 Bacteria 3108
787 Ga0496102_0075874 3300048905 Bacteria 3091
788 Ga0496102_0164950 3300048905 Bacteria 2084
789 Ga0496103_0000716 3300048906 Bacteria 24534
790 Ga0496103_0010783 3300048906 Bacteria 5407
791 Ga0496104_0047124 3300048907 Bacteria 4062
792 Ga0496105_0112297 3300048908 Bacteria 2249
793 Ga0496105_0159699 3300048908 Bacteria 1851
794 Ga0496106_0007989 3300048909 Bacteria 7817
795 Ga0496107_0018431 3300048910 Bacteria 4915
796 Ga0496107_0049152 3300048910 Bacteria 3039
797 Ga0496108_0064868 3300048911 Bacteria 3077
798 Ga0496109_0008975 3300048912 Bacteria 8515
799 Ga0496110_0000137 3300048913 Bacteria 42167
800 Ga0496110_0032962 3300048913 Bacteria 4478
801 Ga0496111_0060893 3300048914 Bacteria 2736
802 Ga0496111_0111824 3300048914 Bacteria 2012
803 Ga0496112_0543379 3300048915 Bacteria 1096
804 Ga0496113_0007534 3300048916 Bacteria 7015
805 Ga0496113_0040210 3300048916 Bacteria 3445
806 Ga0496114_0001264 3300048917 Bacteria 19117
807 Ga0496114_0054488 3300048917 Bacteria 3335
808 Ga0496115_0067787 3300048918 Bacteria 2887
809 Ga0496116_0013163 3300048919 Bacteria 6694
810 Ga0496117_0000001 3300048920 Bacteria 2526244
811 Ga0496117_0089849 3300048920 Bacteria 1982
812 Ga0496118_0000002 3300048921 Bacteria 1690764
813 Ga0496121_0001968 3300048924 Bacteria 32687
814 Ga0496121_0007789 3300048924 Bacteria 12827
815 Ga0496121_0154528 3300048924 Bacteria 1685
816 Ga0496122_0000942 3300048925 Bacteria 52834
817 Ga0496122_0008838 3300048925 Bacteria 10753
818 Ga0496122_0012563 3300048925 Bacteria 8408
819 Ga0496122_0013411 3300048925 Bacteria 8024
820 Ga0496122_0018115 3300048925 Bacteria 6525
821 Ga0496122_0033660 3300048925 Bacteria 4210
822 Ga0496123_0001138 3300048926 Bacteria 39752
823 Ga0496123_0001815 3300048926 Bacteria 28098
824 Ga0496123_0002145 3300048926 Bacteria 25215
825 Ga0496123_0004199 3300048926 Bacteria 15390
826 Ga0496123_0004633 3300048926 Bacteria 14287
827 Ga0496124_0025513 3300048927 Bacteria 5353
828 Ga0496124_0049672 3300048927 Bacteria 3577
829 Ga0496124_0054203 3300048927 Bacteria 3395
830 Ga0496124_0105848 3300048927 Bacteria 2272
831 Ga0496125_0000911 3300048928 Bacteria 46657
832 Ga0496125_0105057 3300048928 Bacteria 2066
833 Ga0496126_0021538 3300048929 Bacteria 6294
834 Ga0496126_0207547 3300048929 Bacteria 1651
835 Ga0495678_000004 3300049459 Bacteria 532920
836 Ga0495678_000064 3300049459 Bacteria 138380
837 Ga0495678_000450 3300049459 Bacteria 40797
838 Ga0495678_000467 3300049459 Bacteria 40162
839 Ga0495678_000497 3300049459 Bacteria 38848
840 Ga0495678_000748 3300049459 Bacteria 29493
841 Ga0495678_000980 3300049459 Bacteria 24522
842 Ga0495678_001036 3300049459 Bacteria 23573
843 Ga0495678_011129 3300049459 Bacteria 4323
844 Ga0495682_0001180 3300049460 Bacteria 14899
845 Ga0495682_0001711 3300049460 Bacteria 11145
846 Ga0495682_0003180 3300049460 Bacteria 7382
847 Ga0495682_0010773 3300049460 Bacteria 3528
848 Ga0495682_0011989 3300049460 Bacteria 3331
849 Ga0495682_0025948 3300049460 Bacteria 2178
850 Ga0495682_0029887 3300049460 Bacteria 2018
851 Ga0495682_0039942 3300049460 Bacteria 1721
852 Ga0501034_0087899 3300049571 Bacteria 3107
853 Ga0501034_0134402 3300049571 Bacteria 2455
854 Ga0501249_001271 3300049679 Bacteria 5282
855 Ga0501252_001330 3300049682 Bacteria 2248
856 Ga0501269_000239 3300049766 Bacteria 16053
857 Ga0501035_0001227 3300049822 Bacteria 26707
858 nmdc:mga03n38_27215_c1 3300050490 Bacteria 2370
859 nmdc:mga0k408_101832_c1 3300050493 Bacteria 1694
860 nmdc:mga07m45_10132_c1 3300050496 Bacteria 4913
861 nmdc:mga05p37_161714_c1 3300050507 Bacteria 2734
862 Ga0500578_0002290 3300053086 Bacteria 16436
863 Ga0500643_019787 3300053087 Bacteria 2211
864 Ga0500644_0013727 3300053088 Bacteria 2268
865 Ga0500646_0001741 3300053090 Bacteria 5719
866 Ga0500646_0004847 3300053090 Bacteria 3407
867 Ga0500583_0173880 3300053092 Bacteria 1072
868 Ga0500651_0035082 3300053093 Bacteria 3161
869 Ga0500651_0047912 3300053093 Bacteria 2686
870 Ga0500650_0119029 3300053098 Bacteria 1231
871 Ga0500555_014048 3300053103 Bacteria 2309
872 Ga0500569_026107 3300053109 Bacteria 1597
873 Ga0500594_0001255 3300053118 Bacteria 5497
874 Ga0500618_000032 3300053125 Bacteria 126990
875 Ga0500618_000889 3300053125 Bacteria 15807
876 Ga0500642_0012981 3300053130 Bacteria 3043
877 Ga0500642_0115290 3300053130 Bacteria 1255
878 Ga0500652_001359 3300053131 Bacteria 7657
879 Ga0500655_001143 3300053133 Bacteria 5056
880 Ga0500658_0073117 3300053134 Bacteria 1451
881 Ga0500568_0053703 3300053139 Bacteria 1578
882 Ga0500586_000758 3300053145 Bacteria 6627
883 Ga0500586_020582 3300053145 Bacteria 2068
884 Ga0500588_0032352 3300053146 Bacteria 1516
885 Ga0500604_0000804 3300053151 Bacteria 8664
886 Ga0500604_0006863 3300053151 Bacteria 3012
887 Ga0500622_0001393 3300053156 Bacteria 19473
888 Ga0500584_083664 3300053726 Bacteria 1359
889 Ga0500625_035098 3300053729 Bacteria 2376
890 Ga0500645_015144 3300053730 Bacteria 2447
891 Ga0587072_000288 3300059643 Bacteria 4696
892 Ga0466962_0012603 3300061719 Bacteria 4067
893 Ga0466962_0014302 3300061719 Bacteria 3824

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021361 Ga0213872_10003325 Ga0213872_100033255 291
2 3300039447 Ga0436361_0377150 Ga0436361_0377150_3922_4800 291
3 3300047469 Ga0495673_0000012 Ga0495673_0000012_274964_275857 293
4 3300025245 Ga0207425_1017058 Ga0207425_10170582 295
5 3300046518 Ga0495631_0029324 Ga0495631_0029324_325_1293 295
6 3300046528 Ga0495642_0012459 Ga0495642_0012459_2142_3110 295
7 3300046542 Ga0495597_0023419 Ga0495597_0023419_989_1957 295
8 3300046648 Ga0495611_0020589 Ga0495611_0020589_1305_2273 295
9 3300046660 Ga0495625_0108500 Ga0495625_0108500_294_1262 295
10 3300046664 Ga0495659_0031699 Ga0495659_0031699_821_1789 295
11 3300046794 Ga0495589_0023668 Ga0495589_0023668_1495_2463 295
12 3300047323 Ga0495683_0024659 Ga0495683_0024659_1197_2165 295
13 3300047445 Ga0495677_0007524 Ga0495677_0007524_1495_2463 295
14 3300047447 Ga0495685_006837 Ga0495685_006837_2408_3376 295
15 3300047470 Ga0495681_0026586 Ga0495681_0026586_1401_2369 295
16 3300049460 Ga0495682_0029887 Ga0495682_0029887_704_1672 295
17 3300005439 Ga0070711_100059058 Ga0070711_1000590581 297
18 3300006173 Ga0070716_100069902 Ga0070716_1000699022 297
19 3300006173 Ga0070716_100076877 Ga0070716_1000768772 297
20 3300009176 Ga0105242_10118988 Ga0105242_101189882 297
21 3300009553 Ga0105249_10335597 Ga0105249_103355971 297
22 3300025939 Ga0207665_10040684 Ga0207665_100406842 297
23 3300025939 Ga0207665_10188651 Ga0207665_101886512 297
24 3300046460 Ga0495638_0000035 Ga0495638_0000035_32694_33599 297
25 3300053125 Ga0500618_000889 Ga0500618_000889_892_1800 297
26 3300002774 JGI25150J39212_1005653 JGI25150J39212_10056532 298
27 3300002987 JGI25159J45721_1001312 JGI25159J45721_100131212 298
28 3300002987 JGI25159J45721_1019022 JGI25159J45721_10190221 298
29 3300003322 rootL2_10056599 rootL2_100565992 298
30 3300003354 JGI25160J50197_1013594 JGI25160J50197_10135942 298
31 3300003374 JGI25161J50226_1000930 JGI25161J50226_100093012 298
32 3300003374 JGI25161J50226_1009594 JGI25161J50226_10095942 298
33 3300003775 Ga0055524_1001922 Ga0055524_10019223 298
34 3300003784 Ga0055534_1011729 Ga0055534_10117293 298
35 3300003791 Ga0055530_10007483 Ga0055530_100074834 298
36 3300003791 Ga0055530_10007706 Ga0055530_100077064 298
37 3300003794 Ga0055531_10007672 Ga0055531_100076723 298
38 3300004625 Ga0055543_1001067 Ga0055543_10010673 298
39 3300005262 Ga0065165_1003335 Ga0065165_10033353 298
40 3300025208 Ga0209436_100559 Ga0209436_1005596 298
41 3300025245 Ga0207425_1000130 Ga0207425_100013057 298
42 3300025263 Ga0209565_1000162 Ga0209565_10001626 298
43 3300025263 Ga0209565_1000383 Ga0209565_100038342 298
44 3300025263 Ga0209565_1009939 Ga0209565_10099393 298
45 3300025273 Ga0209673_1016237 Ga0209673_10162373 298
46 3300025284 Ga0209130_1000438 Ga0209130_100043847 298
47 3300025284 Ga0209130_1006830 Ga0209130_10068303 298
48 3300025291 Ga0209675_1000621 Ga0209675_100062117 298
49 3300025291 Ga0209675_1004929 Ga0209675_10049295 298
50 3300025295 Ga0209564_1002802 Ga0209564_10028025 298
51 3300025295 Ga0209564_1003059 Ga0209564_100305910 298
52 3300025298 Ga0209050_1000011 Ga0209050_1000011258 298
53 3300025298 Ga0209050_1004162 Ga0209050_10041621 298
54 3300025299 Ga0209256_1000255 Ga0209256_100025513 298
55 3300025302 Ga0207426_1006138 Ga0207426_10061383 298
56 3300025303 Ga0209051_1013404 Ga0209051_10134043 298
57 3300025304 Ga0209257_1000003 Ga0209257_10000031030 298
58 3300025304 Ga0209257_1005836 Ga0209257_10058361 298
59 3300031548 Ga0307408_100001935 Ga0307408_10000193518 298
60 3300031548 Ga0307408_100025215 Ga0307408_1000252153 298
61 3300046506 Ga0495583_0102905 Ga0495583_0102905_232_1200 299
62 3300046542 Ga0495597_0000146 Ga0495597_0000146_46165_47160 299
63 3300046794 Ga0495589_0001075 Ga0495589_0001075_4650_5645 299
64 3300047472 Ga0495686_0005039 Ga0495686_0005039_3121_4032 299
65 3300048907 Ga0496104_0047124 Ga0496104_0047124_2871_3782 299
66 3300048915 Ga0496112_0543379 Ga0496112_0543379_139_1050 299
67 3300048920 Ga0496117_0089849 Ga0496117_0089849_74_985 299
68 3300053090 Ga0500646_0001741 Ga0500646_0001741_2466_3377 299
69 3300053092 Ga0500583_0173880 Ga0500583_0173880_54_965 299
70 3300053103 Ga0500555_014048 Ga0500555_014048_1222_2133 299
71 3300053133 Ga0500655_001143 Ga0500655_001143_3165_4076 299
72 3300053151 Ga0500604_0000804 Ga0500604_0000804_5925_6836 299
73 3300053726 Ga0500584_083664 Ga0500584_083664_142_1053 299
74 3300053730 Ga0500645_015144 Ga0500645_015144_1285_2196 299
75 iso_pu_bacteria 2821131069 2821135077 299
76 iso_pu_bacteria 2904541872 2904542716 299
77 3300046538 Ga0495609_0008527 Ga0495609_0008527_2647_3633 300
78 3300031239 Ga0265328_10026794 Ga0265328_100267942 301
79 3300031251 Ga0265327_10000056 Ga0265327_10000056158 301
80 iso_pu_bacteria 2765235838 2765571170 301
81 3300003322 rootL2_10031388 rootL2_100313882 302
82 3300003187 JGI25151J46595_10000616 JGI25151J46595_1000061620 303
83 3300025294 Ga0209025_1000029 Ga0209025_1000029441 303
84 3300030731 Ga0316177_1166234 Ga0316177_11662341 303
85 3300030731 Ga0316177_1182650 Ga0316177_11826501 303
86 3300030736 Ga0316180_1007102 Ga0316180_10071023 303
87 3300046471 Ga0495650_0000762 Ga0495650_0000762_7496_8407 303
88 3300046528 Ga0495642_0053633 Ga0495642_0053633_575_1585 303
89 3300047321 Ga0495676_0068685 Ga0495676_0068685_1731_2642 303
90 3300047323 Ga0495683_0013472 Ga0495683_0013472_1289_2203 303
91 3300048925 Ga0496122_0033660 Ga0496122_0033660_225_1154 303
92 3300048926 Ga0496123_0004633 Ga0496123_0004633_5692_6621 303
93 3300049459 Ga0495678_000980 Ga0495678_000980_7317_8237 303
94 3300005331 Ga0070670_100245772 Ga0070670_1002457723 304
95 3300046528 Ga0495642_0022708 Ga0495642_0022708_176_1138 304
96 3300046665 Ga0495661_0060729 Ga0495661_0060729_304_1218 304
97 3300046492 Ga0495585_0005099 Ga0495585_0005099_6723_7712 305
98 3300046507 Ga0495606_0048860 Ga0495606_0048860_713_1642 305
99 3300046507 Ga0495606_0115159 Ga0495606_0115159_390_1319 305
100 3300046522 Ga0495643_0014957 Ga0495643_0014957_3523_4518 305
101 3300046522 Ga0495643_0112784 Ga0495643_0112784_185_1174 305
102 3300046525 Ga0495663_0041722 Ga0495663_0041722_458_1384 305
103 3300046660 Ga0495625_0001664 Ga0495625_0001664_20620_21549 305
104 3300046664 Ga0495659_0000008 Ga0495659_0000008_56862_57791 305
105 3300046692 Ga0495671_0000080 Ga0495671_0000080_91595_92524 305
106 3300046692 Ga0495671_0044539 Ga0495671_0044539_150_1070 305
107 3300046694 Ga0495649_0074611 Ga0495649_0074611_883_1803 305
108 3300047318 Ga0495636_0098264 Ga0495636_0098264_338_1264 305
109 3300049459 Ga0495678_000064 Ga0495678_000064_53008_54003 305
110 3300005985 Ga0081539_10062725 Ga0081539_100627251 306
111 3300044693 Ga0466961_0057316 Ga0466961_0057316_438_1370 306
112 3300046453 Ga0495627_001166 Ga0495627_001166_10640_11605 306
113 3300046453 Ga0495627_005942 Ga0495627_005942_3352_4275 306
114 3300046471 Ga0495650_0008054 Ga0495650_0008054_4025_4954 306
115 3300046472 Ga0495580_0071871 Ga0495580_0071871_1372_2298 306
116 3300046474 Ga0495605_0000081 Ga0495605_0000081_41545_42510 306
117 3300046491 Ga0495584_0002251 Ga0495584_0002251_1069_1989 306
118 3300046492 Ga0495585_0004022 Ga0495585_0004022_4252_5217 306
119 3300046499 Ga0495594_0013361 Ga0495594_0013361_3193_4119 306
120 3300046499 Ga0495594_0017430 Ga0495594_0017430_1654_2580 306
121 3300046499 Ga0495594_0020311 Ga0495594_0020311_720_1649 306
122 3300046500 Ga0495596_0006643 Ga0495596_0006643_1354_2319 306
123 3300046501 Ga0495607_0011211 Ga0495607_0011211_4391_5356 306
124 3300046501 Ga0495607_0133937 Ga0495607_0133937_18_938 306
125 3300046506 Ga0495583_0000241 Ga0495583_0000241_78866_79786 306
126 3300046506 Ga0495583_0003576 Ga0495583_0003576_2836_3759 306
127 3300046513 Ga0495616_0095234 Ga0495616_0095234_289_1212 306
128 3300046518 Ga0495631_0002259 Ga0495631_0002259_2615_3580 306
129 3300046518 Ga0495631_0028193 Ga0495631_0028193_681_1601 306
130 3300046519 Ga0495632_0002350 Ga0495632_0002350_10545_11468 306
131 3300046519 Ga0495632_0002654 Ga0495632_0002654_2746_3666 306
132 3300046519 Ga0495632_0022738 Ga0495632_0022738_1457_2377 306
133 3300046522 Ga0495643_0014817 Ga0495643_0014817_1044_1964 306
134 3300046523 Ga0495644_0001210 Ga0495644_0001210_4535_5455 306
135 3300046523 Ga0495644_0012012 Ga0495644_0012012_348_1271 306
136 3300046524 Ga0495648_0000719 Ga0495648_0000719_17783_18748 306
137 3300046526 Ga0495666_0037333 Ga0495666_0037333_170_1096 306
138 3300046528 Ga0495642_0000057 Ga0495642_0000057_17914_18879 306
139 3300046528 Ga0495642_0028351 Ga0495642_0028351_465_1385 306
140 3300046530 Ga0495654_0050495 Ga0495654_0050495_158_1123 306
141 3300046531 Ga0495665_0005143 Ga0495665_0005143_1911_2837 306
142 3300046535 Ga0495586_0019673 Ga0495586_0019673_73_999 306
143 3300046538 Ga0495609_0009819 Ga0495609_0009819_3468_4388 306
144 3300046538 Ga0495609_0028945 Ga0495609_0028945_1038_2003 306
145 3300046542 Ga0495597_0063989 Ga0495597_0063989_310_1230 306
146 3300046557 Ga0495622_0126300 Ga0495622_0126300_214_1140 306
147 3300046558 Ga0495633_0017132 Ga0495633_0017132_1847_2770 306
148 3300046615 Ga0495656_0003512 Ga0495656_0003512_2473_3438 306
149 3300046615 Ga0495656_0014365 Ga0495656_0014365_2013_2933 306
150 3300046616 Ga0495668_0002352 Ga0495668_0002352_4433_5398 306
151 3300046616 Ga0495668_0086846 Ga0495668_0086846_673_1596 306
152 3300046660 Ga0495625_0183528 Ga0495625_0183528_449_1375 306
153 3300046665 Ga0495661_0011326 Ga0495661_0011326_4843_5763 306
154 3300046665 Ga0495661_0017639 Ga0495661_0017639_232_1197 306
155 3300046674 Ga0495588_0009321 Ga0495588_0009321_2623_3549 306
156 3300046674 Ga0495588_0093430 Ga0495588_0093430_578_1504 306
157 3300046684 Ga0495669_0031443 Ga0495669_0031443_1092_2057 306
158 3300046692 Ga0495671_0000181 Ga0495671_0000181_44502_45467 306
159 3300046692 Ga0495671_0014707 Ga0495671_0014707_2845_3768 306
160 3300046694 Ga0495649_0000427 Ga0495649_0000427_10466_11386 306
161 3300046694 Ga0495649_0036911 Ga0495649_0036911_1299_2219 306
162 3300046794 Ga0495589_0082011 Ga0495589_0082011_240_1205 306
163 3300046810 Ga0495660_0003435 Ga0495660_0003435_8478_9398 306
164 3300046810 Ga0495660_0004868 Ga0495660_0004868_4155_5078 306
165 3300047315 Ga0495581_0034275 Ga0495581_0034275_133_1059 306
166 3300047317 Ga0495604_0075673 Ga0495604_0075673_1460_2386 306
167 3300047320 Ga0495672_0080746 Ga0495672_0080746_404_1324 306
168 3300047446 Ga0495679_011386 Ga0495679_011386_1401_2321 306
169 3300047470 Ga0495681_0004966 Ga0495681_0004966_550_1473 306
170 3300047470 Ga0495681_0009395 Ga0495681_0009395_4690_5610 306
171 3300048091 Ga0495626_0007164 Ga0495626_0007164_4623_5543 306
172 3300048091 Ga0495626_0012157 Ga0495626_0012157_1285_2205 306
173 3300048905 Ga0496102_0002947 Ga0496102_0002947_11258_12223 306
174 3300048918 Ga0496115_0067787 Ga0496115_0067787_1280_2206 306
175 3300048929 Ga0496126_0207547 Ga0496126_0207547_375_1337 306
176 3300049459 Ga0495678_011129 Ga0495678_011129_3038_3958 306
177 iso_pu_bacteria 2600255292 2601667822 306
178 iso_pu_bacteria 2643221554 2643787952 306
179 iso_pu_bacteria 2643221638 2644212079 306
180 iso_pu_bacteria 2857547612 2857550148 306
181 iso_pu_bacteria 2885080285 2885082507 306
182 iso_pu_bacteria 2932410948 2932411435 306
183 iso_pu_bacteria 2932416698 2932418998 306
184 3300009147 Ga0114129_10032299 Ga0114129_100322994 307
185 3300046529 Ga0495652_0013194 Ga0495652_0013194_18_947 307
186 3300046694 Ga0495649_0013362 Ga0495649_0013362_1119_2108 307
187 3300048091 Ga0495626_0000030 Ga0495626_0000030_100528_101457 307
188 3300048905 Ga0496102_0075874 Ga0496102_0075874_1693_2625 307
189 3300048914 Ga0496111_0111824 Ga0496111_0111824_923_1861 307
190 3300050507 nmdc:mga05p37_161714_c1 nmdc:mga05p37_161714_c1_87_1040 307
191 iso_pu_bacteria 2643221645 2644253242 307
192 iso_pu_bacteria 2643221664 2644355718 307
193 iso_pu_bacteria 2738541280 2738742215 307
194 iso_pu_bacteria 2738541300 2738841387 307
195 iso_pu_bacteria 2738543018 2739272257 307
196 iso_pu_bacteria 2738543030 2739341301 307
197 3300002738 JGI25154J39366_1001547 JGI25154J39366_100154711 308
198 3300003771 Ga0055526_1000266 Ga0055526_10002665 308
199 3300003775 Ga0055524_1000148 Ga0055524_100014832 308
200 3300003791 Ga0055530_10005235 Ga0055530_100052354 308
201 3300003792 Ga0055540_1000018 Ga0055540_1000018105 308
202 3300003794 Ga0055531_10009270 Ga0055531_100092702 308
203 3300006946 Ga0079104_1000012 Ga0079104_1000012227 308
204 3300009036 Ga0105244_10003629 Ga0105244_100036293 308
205 3300009098 Ga0105245_10160701 Ga0105245_101607013 308
206 3300025298 Ga0209050_1000248 Ga0209050_100024892 308
207 3300025298 Ga0209050_1009360 Ga0209050_10093602 308
208 3300025299 Ga0209256_1000271 Ga0209256_100027146 308
209 3300025303 Ga0209051_1000004 Ga0209051_1000004833 308
210 3300025304 Ga0209257_1000360 Ga0209257_10003604 308
211 3300027111 Ga0209281_1000039 Ga0209281_1000039100 308
212 3300032005 Ga0307411_10218573 Ga0307411_102185732 308
213 3300037466 Ga0395898_0241073 Ga0395898_0241073_468_1412 308
214 3300042157 Ga0439458_0009509 Ga0439458_0009509_346_1305 308
215 3300044694 Ga0466963_0010873 Ga0466963_0010873_3154_4098 308
216 3300044706 Ga0466964_0000193 Ga0466964_0000193_11776_12735 308
217 3300045976 Ga0466967_0148083 Ga0466967_0148083_906_1850 308
218 3300046457 Ga0495590_0000215 Ga0495590_0000215_26309_27298 308
219 3300046458 Ga0495591_003250 Ga0495591_003250_1820_2809 308
220 3300046460 Ga0495638_0000027 Ga0495638_0000027_333451_334389 308
221 3300046460 Ga0495638_0242980 Ga0495638_0242980_53_985 308
222 3300046463 Ga0495653_0130992 Ga0495653_0130992_339_1304 308
223 3300046474 Ga0495605_0053317 Ga0495605_0053317_706_1695 308
224 3300046475 Ga0495639_0064868 Ga0495639_0064868_322_1260 308
225 3300046491 Ga0495584_0001086 Ga0495584_0001086_15223_16212 308
226 3300046492 Ga0495585_0009675 Ga0495585_0009675_37_1026 308
227 3300046500 Ga0495596_0005349 Ga0495596_0005349_2679_3668 308
228 3300046501 Ga0495607_0012494 Ga0495607_0012494_2885_3835 308
229 3300046501 Ga0495607_0023228 Ga0495607_0023228_2682_3671 308
230 3300046506 Ga0495583_0000889 Ga0495583_0000889_18173_19162 308
231 3300046507 Ga0495606_0003996 Ga0495606_0003996_197_1156 308
232 3300046507 Ga0495606_0011112 Ga0495606_0011112_1587_2537 308
233 3300046512 Ga0495610_0002550 Ga0495610_0002550_10468_11457 308
234 3300046512 Ga0495610_0020090 Ga0495610_0020090_1362_2303 308
235 3300046512 Ga0495610_0023194 Ga0495610_0023194_1583_2524 308
236 3300046512 Ga0495610_0090544 Ga0495610_0090544_14_955 308
237 3300046513 Ga0495616_0063574 Ga0495616_0063574_126_1115 308
238 3300046518 Ga0495631_0014433 Ga0495631_0014433_119_1108 308
239 3300046519 Ga0495632_0009849 Ga0495632_0009849_707_1696 308
240 3300046520 Ga0495637_0000006 Ga0495637_0000006_82530_83519 308
241 3300046520 Ga0495637_0083141 Ga0495637_0083141_146_1114 308
242 3300046523 Ga0495644_0007894 Ga0495644_0007894_2403_3392 308
243 3300046524 Ga0495648_0002832 Ga0495648_0002832_6834_7829 308
244 3300046528 Ga0495642_0012173 Ga0495642_0012173_998_1987 308
245 3300046528 Ga0495642_0018026 Ga0495642_0018026_396_1355 308
246 3300046542 Ga0495597_0001332 Ga0495597_0001332_5281_6261 308
247 3300046558 Ga0495633_0002006 Ga0495633_0002006_2768_3757 308
248 3300046558 Ga0495633_0003466 Ga0495633_0003466_6665_7606 308
249 3300046558 Ga0495633_0004824 Ga0495633_0004824_3666_4607 308
250 3300046558 Ga0495633_0046218 Ga0495633_0046218_181_1122 308
251 3300046616 Ga0495668_0115725 Ga0495668_0115725_356_1345 308
252 3300046648 Ga0495611_0006178 Ga0495611_0006178_707_1696 308
253 3300046660 Ga0495625_0019224 Ga0495625_0019224_1239_2180 308
254 3300046665 Ga0495661_0046118 Ga0495661_0046118_995_1984 308
255 3300046665 Ga0495661_0057901 Ga0495661_0057901_554_1513 308
256 3300046674 Ga0495588_0018467 Ga0495588_0018467_2361_3362 308
257 3300046691 Ga0495670_0023725 Ga0495670_0023725_1852_2853 308
258 3300046694 Ga0495649_0000236 Ga0495649_0000236_19459_20448 308
259 3300046794 Ga0495589_0006669 Ga0495589_0006669_2411_3400 308
260 3300047320 Ga0495672_0001813 Ga0495672_0001813_743_1732 308
261 3300047322 Ga0495680_0003304 Ga0495680_0003304_4246_5211 308
262 3300047323 Ga0495683_0000758 Ga0495683_0000758_3546_4535 308
263 3300047444 Ga0495675_0007255 Ga0495675_0007255_5464_6429 308
264 3300047445 Ga0495677_0000815 Ga0495677_0000815_7950_8939 308
265 3300047446 Ga0495679_009956 Ga0495679_009956_743_1732 308
266 3300047470 Ga0495681_0022579 Ga0495681_0022579_1158_2147 308
267 3300047470 Ga0495681_0038437 Ga0495681_0038437_1011_1952 308
268 3300047472 Ga0495686_0115000 Ga0495686_0115000_468_1457 308
269 3300047673 Ga0495593_0020091 Ga0495593_0020091_2498_3463 308
270 3300048089 Ga0495614_0027849 Ga0495614_0027849_1063_2028 308
271 3300048091 Ga0495626_0009545 Ga0495626_0009545_2767_3756 308
272 3300048091 Ga0495626_0012405 Ga0495626_0012405_2154_3149 308
273 3300048903 Ga0496100_0055428 Ga0496100_0055428_1236_2165 308
274 3300048904 Ga0496101_0171985 Ga0496101_0171985_523_1452 308
275 3300048906 Ga0496103_0000716 Ga0496103_0000716_20420_21364 308
276 3300048908 Ga0496105_0112297 Ga0496105_0112297_1101_2030 308
277 3300048910 Ga0496107_0018431 Ga0496107_0018431_3414_4343 308
278 3300048911 Ga0496108_0064868 Ga0496108_0064868_891_1820 308
279 3300048913 Ga0496110_0032962 Ga0496110_0032962_261_1190 308
280 3300048914 Ga0496111_0060893 Ga0496111_0060893_1299_2228 308
281 3300048917 Ga0496114_0054488 Ga0496114_0054488_962_1903 308
282 3300048927 Ga0496124_0105848 Ga0496124_0105848_971_1951 308
283 3300049460 Ga0495682_0025948 Ga0495682_0025948_150_1139 308
284 3300049679 Ga0501249_001271 Ga0501249_001271_950_1891 308
285 3300049682 Ga0501252_001330 Ga0501252_001330_570_1547 308
286 3300049766 Ga0501269_000239 Ga0501269_000239_7304_8245 308
287 3300049822 Ga0501035_0001227 Ga0501035_0001227_16858_17805 308
288 3300053145 Ga0500586_000758 Ga0500586_000758_3835_4776 308
289 3300053146 Ga0500588_0032352 Ga0500588_0032352_249_1286 308
290 iso_pu_bacteria 2643221556 2643797661 308
291 iso_pu_bacteria 2643221684 2644470557 308
292 iso_pu_bacteria 2857553236 2857558477 308
293 iso_pu_bacteria 8047673197 8047678965 308
294 3300009093 Ga0105240_10018967 Ga0105240_100189675 309
295 3300010159 Ga0099796_10004632 Ga0099796_100046323 309
296 3300025913 Ga0207695_10041245 Ga0207695_100412454 309
297 3300027512 Ga0209179_1013680 Ga0209179_10136802 309
298 3300028653 Ga0265323_10011065 Ga0265323_100110653 309
299 3300031090 Ga0265760_10022582 Ga0265760_100225822 309
300 3300042121 Ga0450919_000532 Ga0450919_000532_3360_4400 309
301 3300042531 Ga0450918_000948 Ga0450918_000948_4234_5274 309
302 3300044706 Ga0466964_0103584 Ga0466964_0103584_283_1233 309
303 3300044712 Ga0453684_0040621 Ga0453684_0040621_575_1507 309
304 3300044735 Ga0466968_0016900 Ga0466968_0016900_1831_2781 309
305 3300044842 Ga0466957_0006525 Ga0466957_0006525_2932_3867 309
306 3300046474 Ga0495605_0012366 Ga0495605_0012366_581_1543 309
307 3300046501 Ga0495607_0002642 Ga0495607_0002642_10237_11199 309
308 3300046506 Ga0495583_0018529 Ga0495583_0018529_1435_2391 309
309 3300046513 Ga0495616_0000814 Ga0495616_0000814_19914_20876 309
310 3300046538 Ga0495609_0000096 Ga0495609_0000096_18905_19867 309
311 3300046616 Ga0495668_0073873 Ga0495668_0073873_355_1311 309
312 3300046665 Ga0495661_0001204 Ga0495661_0001204_18298_19260 309
313 3300046794 Ga0495589_0000036 Ga0495589_0000036_81768_82730 309
314 3300047323 Ga0495683_0126914 Ga0495683_0126914_22_978 309
315 3300047443 Ga0495687_000074 Ga0495687_000074_81907_82869 309
316 3300047445 Ga0495677_0000042 Ga0495677_0000042_71032_71994 309
317 3300047470 Ga0495681_0025803 Ga0495681_0025803_2013_2969 309
318 3300048904 Ga0496101_0283550 Ga0496101_0283550_245_1174 309
319 3300048905 Ga0496102_0009747 Ga0496102_0009747_3756_4763 309
320 3300048917 Ga0496114_0001264 Ga0496114_0001264_9756_10685 309
321 3300049459 Ga0495678_000450 Ga0495678_000450_18171_19127 309
322 3300049459 Ga0495678_000748 Ga0495678_000748_19689_20645 309
323 3300049460 Ga0495682_0001180 Ga0495682_0001180_10372_11328 309
324 3300053729 Ga0500625_035098 Ga0500625_035098_268_1197 309
325 3300002987 JGI25159J45721_1001022 JGI25159J45721_100102212 310
326 3300003771 Ga0055526_1000416 Ga0055526_100041623 310
327 3300003771 Ga0055526_1001745 Ga0055526_100174518 310
328 3300003773 Ga0055537_1000039 Ga0055537_100003985 310
329 3300003775 Ga0055524_1001704 Ga0055524_100170414 310
330 3300003775 Ga0055524_1002138 Ga0055524_10021388 310
331 3300003784 Ga0055534_1000174 Ga0055534_100017450 310
332 3300003790 Ga0055528_1000119 Ga0055528_10001192 310
333 3300003791 Ga0055530_10001765 Ga0055530_1000176517 310
334 3300004625 Ga0055543_1001373 Ga0055543_10013735 310
335 3300005262 Ga0065165_1000005 Ga0065165_1000005286 310
336 3300013102 Ga0157371_10000001 Ga0157371_10000001998 310
337 3300014497 Ga0182008_10000245 Ga0182008_100002454 310
338 3300014497 Ga0182008_10013723 Ga0182008_100137234 310
339 3300015261 Ga0182006_1000002 Ga0182006_1000002736 310
340 3300015262 Ga0182007_10000085 Ga0182007_100000856 310
341 3300015265 Ga0182005_1000002 Ga0182005_1000002361 310
342 3300025263 Ga0209565_1000003 Ga0209565_1000003280 310
343 3300025263 Ga0209565_1003444 Ga0209565_10034442 310
344 3300025273 Ga0209673_1000003 Ga0209673_1000003166 310
345 3300025284 Ga0209130_1000084 Ga0209130_100008478 310
346 3300025291 Ga0209675_1000003 Ga0209675_1000003758 310
347 3300025295 Ga0209564_1000012 Ga0209564_1000012566 310
348 3300025295 Ga0209564_1000311 Ga0209564_100031185 310
349 3300025298 Ga0209050_1000138 Ga0209050_1000138162 310
350 3300025299 Ga0209256_1000295 Ga0209256_10002953 310
351 3300025299 Ga0209256_1000957 Ga0209256_10009576 310
352 3300027876 Ga0209974_10003986 Ga0209974_100039862 310
353 3300031548 Ga0307408_100002737 Ga0307408_1000027378 310
354 3300032002 Ga0307416_100122759 Ga0307416_1001227593 310
355 3300044765 Ga0466970_0021182 Ga0466970_0021182_907_1848 310
356 3300046460 Ga0495638_0018384 Ga0495638_0018384_2000_2953 310
357 3300046491 Ga0495584_0008430 Ga0495584_0008430_2450_3448 310
358 3300046501 Ga0495607_0003259 Ga0495607_0003259_11379_12332 310
359 3300046501 Ga0495607_0005410 Ga0495607_0005410_6715_7662 310
360 3300046506 Ga0495583_0049299 Ga0495583_0049299_178_1131 310
361 3300046523 Ga0495644_0003758 Ga0495644_0003758_5005_5952 310
362 3300046538 Ga0495609_0001057 Ga0495609_0001057_7501_8454 310
363 3300046558 Ga0495633_0000377 Ga0495633_0000377_35642_36628 310
364 3300046616 Ga0495668_0000006 Ga0495668_0000006_300112_301065 310
365 3300046648 Ga0495611_0007082 Ga0495611_0007082_2611_3558 310
366 3300046665 Ga0495661_0041429 Ga0495661_0041429_177_1130 310
367 3300046684 Ga0495669_0024815 Ga0495669_0024815_1473_2426 310
368 3300046810 Ga0495660_0078012 Ga0495660_0078012_480_1433 310
369 3300047445 Ga0495677_0030097 Ga0495677_0030097_154_1101 310
370 3300047472 Ga0495686_0000462 Ga0495686_0000462_8129_9082 310
371 3300048919 Ga0496116_0013163 Ga0496116_0013163_5090_6049 310
372 3300048920 Ga0496117_0000001 Ga0496117_0000001_1274521_1275480 310
373 3300048921 Ga0496118_0000002 Ga0496118_0000002_1274521_1275480 310
374 3300048924 Ga0496121_0001968 Ga0496121_0001968_2959_3918 310
375 3300048924 Ga0496121_0007789 Ga0496121_0007789_10312_11274 310
376 3300048925 Ga0496122_0012563 Ga0496122_0012563_2372_3331 310
377 3300048926 Ga0496123_0002145 Ga0496123_0002145_8874_9833 310
378 3300048927 Ga0496124_0049672 Ga0496124_0049672_361_1320 310
379 iso_pu_bacteria 2585428057 2587727787 310
380 iso_pu_bacteria 2585428058 2587733897 310
381 iso_pu_bacteria 2588253510 2588292321 310
382 iso_pu_bacteria 2596583598 2597030966 310
383 iso_pu_bacteria 2599185178 2599445957 310
384 iso_pu_bacteria 2643221592 2643972596 310
385 iso_pu_bacteria 2643221603 2644026203 310
386 iso_pu_bacteria 2643221625 2644138396 310
387 iso_pu_bacteria 2643221648 2644273104 310
388 iso_pu_bacteria 2738541297 2738828639 310
389 iso_pu_bacteria 2738541357 2739152435 310
390 iso_pu_bacteria 2738543003 2739194355 310
391 iso_pu_bacteria 2738543026 2739320831 310
392 iso_pu_bacteria 2738543029 2739339072 310
393 iso_pu_bacteria 2808606418 2809144158 310
394 iso_pu_bacteria 2821131069 2821132881 310
395 iso_pu_bacteria 2842711865 2842714555 310
396 iso_pu_bacteria 2857558681 2857563550 310
397 iso_pu_bacteria 2857564685 2857568789 310
398 iso_pu_bacteria 2904424332 2904427070 310
399 iso_pu_bacteria 2919476304 2919480148 310
400 iso_pu_bacteria 2928058823 2928059108 310
401 3300002774 JGI25150J39212_1000956 JGI25150J39212_10009568 311
402 3300003215 JGI25153J46596_10006454 JGI25153J46596_100064545 311
403 3300003775 Ga0055524_1001481 Ga0055524_100148116 311
404 3300005293 Ga0065715_10158456 Ga0065715_101584561 311
405 3300005339 Ga0070660_100151901 Ga0070660_1001519012 311
406 3300005344 Ga0070661_100210153 Ga0070661_1002101531 311
407 3300005366 Ga0070659_100002470 Ga0070659_1000024705 311
408 3300005985 Ga0081539_10005567 Ga0081539_1000556713 311
409 3300025245 Ga0207425_1000001 Ga0207425_1000001166 311
410 3300025258 Ga0209129_1000003 Ga0209129_1000003166 311
411 3300025297 Ga0209758_1000041 Ga0209758_1000041114 311
412 3300025299 Ga0209256_1000068 Ga0209256_100006842 311
413 3300025919 Ga0207657_10155165 Ga0207657_101551652 311
414 3300025932 Ga0207690_10020173 Ga0207690_100201734 311
415 3300025945 Ga0207679_10010718 Ga0207679_100107182 311
416 3300025945 Ga0207679_10085841 Ga0207679_100858412 311
417 3300042139 Ga0450904_000226 Ga0450904_000226_5596_6543 311
418 3300046457 Ga0495590_0038070 Ga0495590_0038070_180_1130 311
419 3300046460 Ga0495638_0007617 Ga0495638_0007617_2535_3485 311
420 3300046474 Ga0495605_0006810 Ga0495605_0006810_1339_2289 311
421 3300046491 Ga0495584_0000284 Ga0495584_0000284_33908_34858 311
422 3300046492 Ga0495585_0017246 Ga0495585_0017246_559_1509 311
423 3300046492 Ga0495585_0097775 Ga0495585_0097775_360_1322 311
424 3300046501 Ga0495607_0020085 Ga0495607_0020085_2075_3025 311
425 3300046501 Ga0495607_0093533 Ga0495607_0093533_585_1535 311
426 3300046506 Ga0495583_0000008 Ga0495583_0000008_393450_394394 311
427 3300046506 Ga0495583_0000021 Ga0495583_0000021_215568_216518 311
428 3300046506 Ga0495583_0002552 Ga0495583_0002552_5281_6231 311
429 3300046506 Ga0495583_0005082 Ga0495583_0005082_3281_4225 311
430 3300046506 Ga0495583_0108587 Ga0495583_0108587_101_1045 311
431 3300046513 Ga0495616_0000262 Ga0495616_0000262_11493_12455 311
432 3300046513 Ga0495616_0005469 Ga0495616_0005469_901_1851 311
433 3300046513 Ga0495616_0012089 Ga0495616_0012089_1856_2806 311
434 3300046519 Ga0495632_0003323 Ga0495632_0003323_29_991 311
435 3300046522 Ga0495643_0000192 Ga0495643_0000192_19769_20719 311
436 3300046522 Ga0495643_0001148 Ga0495643_0001148_3083_4066 311
437 3300046523 Ga0495644_0002559 Ga0495644_0002559_175_1125 311
438 3300046524 Ga0495648_0000571 Ga0495648_0000571_31597_32547 311
439 3300046528 Ga0495642_0001072 Ga0495642_0001072_2725_3687 311
440 3300046528 Ga0495642_0001279 Ga0495642_0001279_240_1184 311
441 3300046528 Ga0495642_0019849 Ga0495642_0019849_528_1472 311
442 3300046530 Ga0495654_0013859 Ga0495654_0013859_1684_2646 311
443 3300046530 Ga0495654_0058003 Ga0495654_0058003_672_1622 311
444 3300046538 Ga0495609_0005033 Ga0495609_0005033_47_997 311
445 3300046538 Ga0495609_0019233 Ga0495609_0019233_740_1687 311
446 3300046538 Ga0495609_0043056 Ga0495609_0043056_47_1009 311
447 3300046558 Ga0495633_0002910 Ga0495633_0002910_1373_2323 311
448 3300046615 Ga0495656_0031351 Ga0495656_0031351_972_1916 311
449 3300046615 Ga0495656_0126376 Ga0495656_0126376_53_1003 311
450 3300046648 Ga0495611_0084447 Ga0495611_0084447_68_1018 311
451 3300046660 Ga0495625_0013188 Ga0495625_0013188_2579_3529 311
452 3300046660 Ga0495625_0150652 Ga0495625_0150652_240_1187 311
453 3300046664 Ga0495659_0001397 Ga0495659_0001397_6404_7354 311
454 3300046664 Ga0495659_0002919 Ga0495659_0002919_523_1467 311
455 3300046665 Ga0495661_0058159 Ga0495661_0058159_661_1611 311
456 3300046665 Ga0495661_0085590 Ga0495661_0085590_159_1109 311
457 3300046674 Ga0495588_0117422 Ga0495588_0117422_200_1144 311
458 3300046684 Ga0495669_0003025 Ga0495669_0003025_3071_4033 311
459 3300046691 Ga0495670_0007099 Ga0495670_0007099_3710_4660 311
460 3300046691 Ga0495670_0030116 Ga0495670_0030116_1193_2143 311
461 3300046692 Ga0495671_0077783 Ga0495671_0077783_32_982 311
462 3300046810 Ga0495660_0002482 Ga0495660_0002482_9826_10773 311
463 3300047318 Ga0495636_0000238 Ga0495636_0000238_6279_7229 311
464 3300047318 Ga0495636_0006514 Ga0495636_0006514_1208_2152 311
465 3300047318 Ga0495636_0016569 Ga0495636_0016569_865_1809 311
466 3300047320 Ga0495672_0000602 Ga0495672_0000602_33105_34052 311
467 3300047323 Ga0495683_0004529 Ga0495683_0004529_1339_2289 311
468 3300047443 Ga0495687_000245 Ga0495687_000245_6101_7051 311
469 3300047445 Ga0495677_0015431 Ga0495677_0015431_1615_2565 311
470 3300047447 Ga0495685_000069 Ga0495685_000069_4809_5759 311
471 3300047469 Ga0495673_0007915 Ga0495673_0007915_3717_4667 311
472 3300048091 Ga0495626_0026006 Ga0495626_0026006_983_1966 311
473 3300048905 Ga0496102_0059217 Ga0496102_0059217_896_1840 311
474 3300048905 Ga0496102_0164950 Ga0496102_0164950_72_1040 311
475 3300048906 Ga0496103_0010783 Ga0496103_0010783_3710_4678 311
476 3300048908 Ga0496105_0159699 Ga0496105_0159699_778_1773 311
477 3300049459 Ga0495678_001036 Ga0495678_001036_16152_17102 311
478 3300049460 Ga0495682_0001711 Ga0495682_0001711_1297_2247 311
479 3300049460 Ga0495682_0010773 Ga0495682_0010773_410_1360 311
480 3300003775 Ga0055524_1000008 Ga0055524_1000008221 312
481 3300006948 Ga0099826_10000001 Ga0099826_10000001383 312
482 3300021361 Ga0213872_10000032 Ga0213872_10000032122 312
483 3300025299 Ga0209256_1000005 Ga0209256_10000051167 312
484 3300037418 Ga0395900_0382854 Ga0395900_0382854_301_1251 312
485 3300039447 Ga0436361_0482460 Ga0436361_0482460_7192_8139 312
486 3300044656 Ga0466969_0013941 Ga0466969_0013941_586_1536 312
487 3300046474 Ga0495605_0000087 Ga0495605_0000087_31509_32459 312
488 3300046491 Ga0495584_0000656 Ga0495584_0000656_12014_12964 312
489 3300046507 Ga0495606_0042741 Ga0495606_0042741_668_1618 312
490 3300046542 Ga0495597_0013016 Ga0495597_0013016_2367_3305 312
491 3300046616 Ga0495668_0004518 Ga0495668_0004518_5449_6387 312
492 3300046674 Ga0495588_0000070 Ga0495588_0000070_100634_101584 312
493 3300046674 Ga0495588_0011957 Ga0495588_0011957_411_1349 312
494 3300046794 Ga0495589_0000216 Ga0495589_0000216_28991_29941 312
495 3300046810 Ga0495660_0000816 Ga0495660_0000816_5644_6603 312
496 3300046810 Ga0495660_0001684 Ga0495660_0001684_4890_5840 312
497 3300046810 Ga0495660_0009142 Ga0495660_0009142_4240_5190 312
498 3300047320 Ga0495672_0000621 Ga0495672_0000621_8714_9664 312
499 3300047320 Ga0495672_0006978 Ga0495672_0006978_3862_4800 312
500 3300047321 Ga0495676_0000035 Ga0495676_0000035_108821_109759 312
501 3300047323 Ga0495683_0006758 Ga0495683_0006758_1921_2871 312
502 3300047443 Ga0495687_003388 Ga0495687_003388_4883_5833 312
503 3300047445 Ga0495677_0000891 Ga0495677_0000891_3006_3956 312
504 3300047470 Ga0495681_0011083 Ga0495681_0011083_4056_5015 312
505 3300048091 Ga0495626_0000006 Ga0495626_0000006_58187_59137 312
506 3300048924 Ga0496121_0154528 Ga0496121_0154528_718_1668 312
507 3300048925 Ga0496122_0018115 Ga0496122_0018115_3769_4719 312
508 3300048926 Ga0496123_0001815 Ga0496123_0001815_6440_7390 312
509 3300048928 Ga0496125_0105057 Ga0496125_0105057_815_1765 312
510 3300049459 Ga0495678_000004 Ga0495678_000004_45663_46622 312
511 3300037418 Ga0395900_0016378 Ga0395900_0016378_2599_3555 313
512 3300037466 Ga0395898_0274951 Ga0395898_0274951_308_1264 313
513 3300046463 Ga0495653_0006487 Ga0495653_0006487_5700_6647 313
514 3300046463 Ga0495653_0148055 Ga0495653_0148055_550_1497 313
515 3300046471 Ga0495650_0000376 Ga0495650_0000376_18611_19567 313
516 3300046473 Ga0495582_0012187 Ga0495582_0012187_3053_4000 313
517 3300046474 Ga0495605_0012102 Ga0495605_0012102_759_1715 313
518 3300046474 Ga0495605_0022354 Ga0495605_0022354_1486_2430 313
519 3300046492 Ga0495585_0124613 Ga0495585_0124613_52_1014 313
520 3300046500 Ga0495596_0001303 Ga0495596_0001303_11624_12568 313
521 3300046507 Ga0495606_0097559 Ga0495606_0097559_649_1596 313
522 3300046517 Ga0495630_0041577 Ga0495630_0041577_2009_2956 313
523 3300046518 Ga0495631_0007858 Ga0495631_0007858_4418_5362 313
524 3300046522 Ga0495643_0004686 Ga0495643_0004686_7012_7956 313
525 3300046523 Ga0495644_0008115 Ga0495644_0008115_2572_3516 313
526 3300046524 Ga0495648_0005134 Ga0495648_0005134_3878_4834 313
527 3300046526 Ga0495666_0023693 Ga0495666_0023693_102_1049 313
528 3300046526 Ga0495666_0050727 Ga0495666_0050727_814_1761 313
529 3300046531 Ga0495665_0002647 Ga0495665_0002647_1416_2363 313
530 3300046533 Ga0495640_0108935 Ga0495640_0108935_376_1323 313
531 3300046535 Ga0495586_0049651 Ga0495586_0049651_1220_2167 313
532 3300046536 Ga0495587_0041172 Ga0495587_0041172_1277_2224 313
533 3300046538 Ga0495609_0001889 Ga0495609_0001889_10838_11794 313
534 3300046642 Ga0495634_0055594 Ga0495634_0055594_192_1139 313
535 3300046648 Ga0495611_0004070 Ga0495611_0004070_1748_2692 313
536 3300046679 Ga0495623_0006925 Ga0495623_0006925_638_1585 313
537 3300046679 Ga0495623_0043564 Ga0495623_0043564_242_1189 313
538 3300046794 Ga0495589_0022474 Ga0495589_0022474_1704_2660 313
539 3300047317 Ga0495604_0050480 Ga0495604_0050480_288_1235 313
540 3300047320 Ga0495672_0000337 Ga0495672_0000337_40989_41945 313
541 3300047320 Ga0495672_0008498 Ga0495672_0008498_747_1691 313
542 3300047322 Ga0495680_0030531 Ga0495680_0030531_1306_2253 313
543 3300047323 Ga0495683_0067963 Ga0495683_0067963_638_1582 313
544 3300047444 Ga0495675_0010943 Ga0495675_0010943_1260_2207 313
545 3300047469 Ga0495673_0010826 Ga0495673_0010826_3747_4691 313
546 3300047470 Ga0495681_0001793 Ga0495681_0001793_2808_3803 313
547 3300047472 Ga0495686_0000651 Ga0495686_0000651_3181_4125 313
548 3300048088 Ga0495602_0004054 Ga0495602_0004054_10573_11520 313
549 3300048091 Ga0495626_0030871 Ga0495626_0030871_1393_2337 313
550 3300001979 JGI24740J21852_10000908 JGI24740J21852_100009082 314
551 3300001979 JGI24740J21852_10005306 JGI24740J21852_100053062 314
552 3300002705 JGI25156J39149_1009127 JGI25156J39149_10091273 314
553 3300002738 JGI25154J39366_1000317 JGI25154J39366_100031718 314
554 3300002773 JGI25152J39213_1005631 JGI25152J39213_10056313 314
555 3300003215 JGI25153J46596_10002329 JGI25153J46596_100023299 314
556 3300003215 JGI25153J46596_10008710 JGI25153J46596_100087103 314
557 3300003752 Ga0055539_1000079 Ga0055539_100007914 314
558 3300003756 Ga0055533_1000470 Ga0055533_10004703 314
559 3300003758 Ga0055532_1000075 Ga0055532_100007558 314
560 3300003758 Ga0055532_1000112 Ga0055532_10001129 314
561 3300003759 Ga0055525_1000009 Ga0055525_1000009446 314
562 3300003759 Ga0055525_1000581 Ga0055525_10005811 314
563 3300003760 Ga0055527_1000733 Ga0055527_10007337 314
564 3300003761 Ga0055535_1000013 Ga0055535_100001358 314
565 3300003763 Ga0055529_1000068 Ga0055529_100006828 314
566 3300003763 Ga0055529_1000085 Ga0055529_100008559 314
567 3300003771 Ga0055526_1000050 Ga0055526_10000505 314
568 3300003771 Ga0055526_1010244 Ga0055526_10102442 314
569 3300003791 Ga0055530_10013932 Ga0055530_100139322 314
570 3300003841 Ga0055541_1000476 Ga0055541_10004764 314
571 3300005262 Ga0065165_1006284 Ga0065165_10062844 314
572 3300005262 Ga0065165_1019452 Ga0065165_10194523 314
573 3300005327 Ga0070658_10049875 Ga0070658_100498751 314
574 3300005336 Ga0070680_100250438 Ga0070680_1002504381 314
575 3300005344 Ga0070661_100000007 Ga0070661_10000000757 314
576 3300005344 Ga0070661_100035543 Ga0070661_1000355433 314
577 3300005366 Ga0070659_100045745 Ga0070659_1000457454 314
578 3300005455 Ga0070663_100000002 Ga0070663_10000000257 314
579 3300005563 Ga0068855_100125378 Ga0068855_1001253783 314
580 3300005564 Ga0070664_100000004 Ga0070664_10000000459 314
581 3300005577 Ga0068857_100004834 Ga0068857_10000483412 314
582 3300005578 Ga0068854_100000034 Ga0068854_10000003485 314
583 3300005614 Ga0068856_100000051 Ga0068856_10000005176 314
584 3300006028 Ga0070717_10158188 Ga0070717_101581884 314
585 3300006048 Ga0075363_100079316 Ga0075363_1000793162 314
586 3300006051 Ga0075364_10069062 Ga0075364_100690623 314
587 3300006177 Ga0075362_10015690 Ga0075362_100156902 314
588 3300006186 Ga0075369_10028666 Ga0075369_100286662 314
589 3300006195 Ga0075366_10030880 Ga0075366_100308802 314
590 3300006353 Ga0075370_10010558 Ga0075370_100105583 314
591 3300006881 Ga0068865_100078895 Ga0068865_1000788951 314
592 3300006946 Ga0079104_1007845 Ga0079104_10078455 314
593 3300009036 Ga0105244_10007709 Ga0105244_100077095 314
594 3300009036 Ga0105244_10097393 Ga0105244_100973932 314
595 3300009093 Ga0105240_10230511 Ga0105240_102305112 314
596 3300009148 Ga0105243_10020972 Ga0105243_100209724 314
597 3300013100 Ga0157373_10006916 Ga0157373_100069168 314
598 3300013102 Ga0157371_10000270 Ga0157371_100002704 314
599 3300013104 Ga0157370_10000014 Ga0157370_1000001459 314
600 3300013105 Ga0157369_10005917 Ga0157369_1000591712 314
601 3300013307 Ga0157372_10000032 Ga0157372_1000003239 314
602 3300015261 Ga0182006_1000029 Ga0182006_1000029173 314
603 3300015261 Ga0182006_1001626 Ga0182006_10016264 314
604 3300015261 Ga0182006_1003399 Ga0182006_10033996 314
605 3300015265 Ga0182005_1000012 Ga0182005_1000012119 314
606 3300020077 Ga0206351_10676099 Ga0206351_106760992 314
607 3300020610 Ga0154015_1662132 Ga0154015_16621328 314
608 3300021361 Ga0213872_10006281 Ga0213872_100062814 314
609 3300022467 Ga0224712_10049331 Ga0224712_100493312 314
610 3300025224 Ga0209784_100008 Ga0209784_100008634 314
611 3300025224 Ga0209784_100398 Ga0209784_10039812 314
612 3300025224 Ga0209784_100604 Ga0209784_1006049 314
613 3300025225 Ga0209566_100006 Ga0209566_100006634 314
614 3300025225 Ga0209566_100383 Ga0209566_1003837 314
615 3300025225 Ga0209566_101077 Ga0209566_1010775 314
616 3300025226 Ga0209674_100083 Ga0209674_100083103 314
617 3300025226 Ga0209674_100142 Ga0209674_10014224 314
618 3300025228 Ga0209672_100419 Ga0209672_10041912 314
619 3300025229 Ga0209147_100005 Ga0209147_100005637 314
620 3300025230 Ga0209563_100015 Ga0209563_100015561 314
621 3300025230 Ga0209563_100016 Ga0209563_100016634 314
622 3300025230 Ga0209563_111169 Ga0209563_1111691 314
623 3300025242 Ga0209258_100007 Ga0209258_100007637 314
624 3300025245 Ga0207425_1000158 Ga0207425_10001582 314
625 3300025246 Ga0209646_1000007 Ga0209646_1000007333 314
626 3300025246 Ga0209646_1000016 Ga0209646_1000016125 314
627 3300025250 Ga0209026_1002022 Ga0209026_10020224 314
628 3300025250 Ga0209026_1012928 Ga0209026_10129282 314
629 3300025253 Ga0209677_100008 Ga0209677_10000859 314
630 3300025253 Ga0209677_105001 Ga0209677_1050014 314
631 3300025254 Ga0209148_1000051 Ga0209148_1000051246 314
632 3300025256 Ga0209759_1003975 Ga0209759_10039754 314
633 3300025256 Ga0209759_1006274 Ga0209759_10062742 314
634 3300025258 Ga0209129_1000169 Ga0209129_100016915 314
635 3300025272 Ga0209455_1000011 Ga0209455_1000011562 314
636 3300025272 Ga0209455_1000026 Ga0209455_1000026484 314
637 3300025273 Ga0209673_1005650 Ga0209673_10056505 314
638 3300025273 Ga0209673_1015149 Ga0209673_10151492 314
639 3300025294 Ga0209025_1011738 Ga0209025_10117386 314
640 3300025295 Ga0209564_1000002 Ga0209564_10000021013 314
641 3300025295 Ga0209564_1000007 Ga0209564_1000007368 314
642 3300025295 Ga0209564_1000057 Ga0209564_1000057134 314
643 3300025297 Ga0209758_1000214 Ga0209758_1000214104 314
644 3300025297 Ga0209758_1000232 Ga0209758_1000232103 314
645 3300025297 Ga0209758_1000950 Ga0209758_100095015 314
646 3300025298 Ga0209050_1001215 Ga0209050_100121527 314
647 3300025728 Ga0207655_1014025 Ga0207655_10140253 314
648 3300025728 Ga0207655_1030673 Ga0207655_10306732 314
649 3300025909 Ga0207705_10005829 Ga0207705_100058295 314
650 3300025911 Ga0207654_10004484 Ga0207654_100044848 314
651 3300025911 Ga0207654_10236255 Ga0207654_102362551 314
652 3300025913 Ga0207695_10003419 Ga0207695_100034193 314
653 3300025919 Ga0207657_10010492 Ga0207657_1001049210 314
654 3300025919 Ga0207657_10043211 Ga0207657_100432115 314
655 3300025920 Ga0207649_10000131 Ga0207649_1000013116 314
656 3300025933 Ga0207706_10238402 Ga0207706_102384021 314
657 3300025934 Ga0207686_10084299 Ga0207686_100842993 314
658 3300025935 Ga0207709_10009729 Ga0207709_100097293 314
659 3300025938 Ga0207704_10124672 Ga0207704_101246723 314
660 3300025945 Ga0207679_10000002 Ga0207679_1000000290 314
661 3300025945 Ga0207679_10048717 Ga0207679_100487173 314
662 3300025949 Ga0207667_10059113 Ga0207667_100591135 314
663 3300025949 Ga0207667_10112262 Ga0207667_101122623 314
664 3300025981 Ga0207640_10000121 Ga0207640_1000012127 314
665 3300025981 Ga0207640_10206926 Ga0207640_102069261 314
666 3300026067 Ga0207678_10000003 Ga0207678_1000000359 314
667 3300026078 Ga0207702_10000010 Ga0207702_100000108 314
668 3300026116 Ga0207674_10017674 Ga0207674_100176744 314
669 3300027111 Ga0209281_1008607 Ga0209281_10086072 314
670 3300030744 Ga0316181_1223875 Ga0316181_12238752 314
671 3300031456 Ga0307513_10054483 Ga0307513_100544833 314
672 3300035114 Ga0373939_0051271 Ga0373939_0051271_13_963 314
673 3300037312 Ga0395899_0000581 Ga0395899_0000581_2779_3771 314
674 3300037312 Ga0395899_0001454 Ga0395899_0001454_6959_7969 314
675 3300037312 Ga0395899_0004791 Ga0395899_0004791_100_1062 314
676 3300037312 Ga0395899_0117705 Ga0395899_0117705_444_1436 314
677 3300037312 Ga0395899_0196432 Ga0395899_0196432_20_1009 314
678 3300037312 Ga0395899_0219252 Ga0395899_0219252_306_1271 314
679 3300037418 Ga0395900_0000484 Ga0395900_0000484_19406_20371 314
680 3300037418 Ga0395900_0002244 Ga0395900_0002244_7770_8735 314
681 3300037418 Ga0395900_0003719 Ga0395900_0003719_2729_3691 314
682 3300037418 Ga0395900_0014843 Ga0395900_0014843_3818_4762 314
683 3300037418 Ga0395900_0048346 Ga0395900_0048346_2037_3029 314
684 3300037418 Ga0395900_0132620 Ga0395900_0132620_1144_2109 314
685 3300037418 Ga0395900_0171483 Ga0395900_0171483_175_1185 314
686 3300037418 Ga0395900_0251514 Ga0395900_0251514_155_1120 314
687 3300037418 Ga0395900_0314438 Ga0395900_0314438_254_1219 314
688 3300037418 Ga0395900_0320813 Ga0395900_0320813_552_1517 314
689 3300037418 Ga0395900_0364622 Ga0395900_0364622_47_1012 314
690 3300037466 Ga0395898_0031471 Ga0395898_0031471_3516_4526 314
691 3300037466 Ga0395898_0170026 Ga0395898_0170026_413_1378 314
692 3300037466 Ga0395898_0398923 Ga0395898_0398923_214_1179 314
693 3300037471 Ga0395905_0000111 Ga0395905_0000111_6427_7431 314
694 3300037471 Ga0395905_0036606 Ga0395905_0036606_3485_4441 314
695 3300037471 Ga0395905_0086248 Ga0395905_0086248_122_1084 314
696 3300037471 Ga0395905_0121640 Ga0395905_0121640_200_1168 314
697 3300037471 Ga0395905_0214715 Ga0395905_0214715_345_1289 314
698 3300037471 Ga0395905_0366561 Ga0395905_0366561_186_1175 314
699 3300037471 Ga0395905_0514437 Ga0395905_0514437_114_1079 314
700 3300038443 Ga0395901_0182347 Ga0395901_0182347_541_1497 314
701 3300038443 Ga0395901_0308645 Ga0395901_0308645_278_1246 314
702 3300038443 Ga0395901_0397330 Ga0395901_0397330_270_1235 314
703 3300038443 Ga0395901_0519091 Ga0395901_0519091_91_1056 314
704 3300039447 Ga0436361_0604829 Ga0436361_0604829_3664_4617 314
705 3300041456 Ga0451795_0749222 Ga0451795_0749222_72_1064 314
706 3300041458 Ga0451798_0885868 Ga0451798_0885868_767_1759 314
707 3300041463 Ga0451804_0963191 Ga0451804_0963191_817_1809 314
708 3300041486 Ga0451807_1511311 Ga0451807_1511311_1410_2402 314
709 3300042005 Ga0439448_0000681 Ga0439448_0000681_6435_7412 314
710 3300042012 Ga0439455_0010427 Ga0439455_0010427_605_1582 314
711 3300044656 Ga0466969_0025166 Ga0466969_0025166_806_1750 314
712 3300044658 Ga0466972_0000018 Ga0466972_0000018_150283_151275 314
713 3300044658 Ga0466972_0004773 Ga0466972_0004773_5349_6422 314
714 3300044658 Ga0466972_0029272 Ga0466972_0029272_842_1804 314
715 3300044658 Ga0466972_0048500 Ga0466972_0048500_863_1807 314
716 3300044671 Ga0466978_0039971 Ga0466978_0039971_894_1838 314
717 3300044683 Ga0466965_0008358 Ga0466965_0008358_2023_2985 314
718 3300044683 Ga0466965_0015432 Ga0466965_0015432_1014_1976 314
719 3300044683 Ga0466965_0021746 Ga0466965_0021746_1995_2939 314
720 3300044684 Ga0466966_0004557 Ga0466966_0004557_4790_5785 314
721 3300044684 Ga0466966_0033361 Ga0466966_0033361_1039_2001 314
722 3300044684 Ga0466966_0074032 Ga0466966_0074032_880_1842 314
723 3300044693 Ga0466961_0000035 Ga0466961_0000035_3154_4098 314
724 3300044706 Ga0466964_0002262 Ga0466964_0002262_780_1742 314
725 3300044706 Ga0466964_0015269 Ga0466964_0015269_38_982 314
726 3300044706 Ga0466964_0021363 Ga0466964_0021363_429_1448 314
727 3300044735 Ga0466968_0001597 Ga0466968_0001597_6253_7215 314
728 3300044765 Ga0466970_0023409 Ga0466970_0023409_1308_2252 314
729 3300044842 Ga0466957_0009421 Ga0466957_0009421_1827_2789 314
730 3300044842 Ga0466957_0037607 Ga0466957_0037607_1098_2042 314
731 3300045976 Ga0466967_0018036 Ga0466967_0018036_424_1389 314
732 3300046452 Ga0495617_002808 Ga0495617_002808_2427_3386 314
733 3300046453 Ga0495627_000007 Ga0495627_000007_28580_29698 314
734 3300046457 Ga0495590_0000010 Ga0495590_0000010_184416_185372 314
735 3300046458 Ga0495591_040443 Ga0495591_040443_125_1090 314
736 3300046460 Ga0495638_0018090 Ga0495638_0018090_3124_4083 314
737 3300046460 Ga0495638_0200143 Ga0495638_0200143_34_1023 314
738 3300046471 Ga0495650_0000044 Ga0495650_0000044_338233_339192 314
739 3300046471 Ga0495650_0000066 Ga0495650_0000066_268449_269399 314
740 3300046471 Ga0495650_0000159 Ga0495650_0000159_134942_135892 314
741 3300046471 Ga0495650_0000299 Ga0495650_0000299_54693_55646 314
742 3300046471 Ga0495650_0002387 Ga0495650_0002387_10958_11914 314
743 3300046471 Ga0495650_0011738 Ga0495650_0011738_1779_2729 314
744 3300046474 Ga0495605_0000027 Ga0495605_0000027_126295_127245 314
745 3300046474 Ga0495605_0021237 Ga0495605_0021237_2118_3074 314
746 3300046491 Ga0495584_0018670 Ga0495584_0018670_356_1318 314
747 3300046491 Ga0495584_0026465 Ga0495584_0026465_747_1748 314
748 3300046491 Ga0495584_0061937 Ga0495584_0061937_391_1347 314
749 3300046492 Ga0495585_0002659 Ga0495585_0002659_8883_9845 314
750 3300046492 Ga0495585_0005608 Ga0495585_0005608_6329_7279 314
751 3300046492 Ga0495585_0006411 Ga0495585_0006411_5932_6903 314
752 3300046492 Ga0495585_0062429 Ga0495585_0062429_293_1294 314
753 3300046499 Ga0495594_0020960 Ga0495594_0020960_2404_3375 314
754 3300046500 Ga0495596_0001025 Ga0495596_0001025_12701_13666 314
755 3300046500 Ga0495596_0018016 Ga0495596_0018016_130_1101 314
756 3300046500 Ga0495596_0028655 Ga0495596_0028655_649_1650 314
757 3300046500 Ga0495596_0031312 Ga0495596_0031312_430_1419 314
758 3300046501 Ga0495607_0006251 Ga0495607_0006251_2501_3454 314
759 3300046501 Ga0495607_0024157 Ga0495607_0024157_679_1680 314
760 3300046501 Ga0495607_0073202 Ga0495607_0073202_220_1185 314
761 3300046506 Ga0495583_0000006 Ga0495583_0000006_218617_219573 314
762 3300046506 Ga0495583_0042030 Ga0495583_0042030_743_1744 314
763 3300046507 Ga0495606_0000015 Ga0495606_0000015_178735_179685 314
764 3300046507 Ga0495606_0000103 Ga0495606_0000103_5589_6539 314
765 3300046507 Ga0495606_0000132 Ga0495606_0000132_120300_121250 314
766 3300046507 Ga0495606_0001376 Ga0495606_0001376_28273_29232 314
767 3300046507 Ga0495606_0002672 Ga0495606_0002672_17134_18093 314
768 3300046507 Ga0495606_0020832 Ga0495606_0020832_988_1947 314
769 3300046507 Ga0495606_0032198 Ga0495606_0032198_368_1369 314
770 3300046507 Ga0495606_0170628 Ga0495606_0170628_131_1120 314
771 3300046512 Ga0495610_0000008 Ga0495610_0000008_106628_107578 314
772 3300046512 Ga0495610_0001892 Ga0495610_0001892_14350_15300 314
773 3300046512 Ga0495610_0011619 Ga0495610_0011619_1008_1967 314
774 3300046512 Ga0495610_0019698 Ga0495610_0019698_1464_2423 314
775 3300046513 Ga0495616_0011598 Ga0495616_0011598_2768_3733 314
776 3300046513 Ga0495616_0019243 Ga0495616_0019243_2092_3048 314
777 3300046518 Ga0495631_0000612 Ga0495631_0000612_9757_10746 314
778 3300046518 Ga0495631_0010695 Ga0495631_0010695_400_1401 314
779 3300046519 Ga0495632_0000040 Ga0495632_0000040_111665_112633 314
780 3300046519 Ga0495632_0025628 Ga0495632_0025628_806_1768 314
781 3300046520 Ga0495637_0000524 Ga0495637_0000524_7280_8230 314
782 3300046520 Ga0495637_0002085 Ga0495637_0002085_9168_10127 314
783 3300046522 Ga0495643_0000022 Ga0495643_0000022_189636_190595 314
784 3300046522 Ga0495643_0000117 Ga0495643_0000117_88591_89583 314
785 3300046522 Ga0495643_0007442 Ga0495643_0007442_2172_3212 314
786 3300046522 Ga0495643_0009654 Ga0495643_0009654_1829_2818 314
787 3300046522 Ga0495643_0037964 Ga0495643_0037964_994_2052 314
788 3300046522 Ga0495643_0088116 Ga0495643_0088116_37_993 314
789 3300046523 Ga0495644_0010949 Ga0495644_0010949_707_1708 314
790 3300046524 Ga0495648_0000875 Ga0495648_0000875_2910_3866 314
791 3300046524 Ga0495648_0011418 Ga0495648_0011418_3034_4023 314
792 3300046524 Ga0495648_0025099 Ga0495648_0025099_1388_2338 314
793 3300046524 Ga0495648_0039003 Ga0495648_0039003_239_1198 314
794 3300046524 Ga0495648_0042043 Ga0495648_0042043_1608_2609 314
795 3300046524 Ga0495648_0067721 Ga0495648_0067721_1009_1968 314
796 3300046524 Ga0495648_0074753 Ga0495648_0074753_248_1213 314
797 3300046526 Ga0495666_0000268 Ga0495666_0000268_10310_11275 314
798 3300046528 Ga0495642_0003386 Ga0495642_0003386_1616_2656 314
799 3300046528 Ga0495642_0005390 Ga0495642_0005390_322_1287 314
800 3300046528 Ga0495642_0017136 Ga0495642_0017136_609_1580 314
801 3300046528 Ga0495642_0033201 Ga0495642_0033201_384_1385 314
802 3300046530 Ga0495654_0000002 Ga0495654_0000002_657473_658423 314
803 3300046530 Ga0495654_0012228 Ga0495654_0012228_3520_4509 314
804 3300046530 Ga0495654_0026607 Ga0495654_0026607_1601_2551 314
805 3300046531 Ga0495665_0030522 Ga0495665_0030522_855_1820 314
806 3300046533 Ga0495640_0017995 Ga0495640_0017995_1665_2630 314
807 3300046535 Ga0495586_0110386 Ga0495586_0110386_482_1447 314
808 3300046538 Ga0495609_0000607 Ga0495609_0000607_1396_2454 314
809 3300046538 Ga0495609_0002159 Ga0495609_0002159_2167_3153 314
810 3300046538 Ga0495609_0003723 Ga0495609_0003723_6893_7882 314
811 3300046538 Ga0495609_0036056 Ga0495609_0036056_1083_2072 314
812 3300046542 Ga0495597_0000357 Ga0495597_0000357_18771_19763 314
813 3300046542 Ga0495597_0000447 Ga0495597_0000447_6686_7645 314
814 3300046542 Ga0495597_0002318 Ga0495597_0002318_8860_9846 314
815 3300046557 Ga0495622_0000012 Ga0495622_0000012_156158_157117 314
816 3300046557 Ga0495622_0000281 Ga0495622_0000281_842_1798 314
817 3300046557 Ga0495622_0008632 Ga0495622_0008632_3191_4147 314
818 3300046558 Ga0495633_0000375 Ga0495633_0000375_34873_35829 314
819 3300046558 Ga0495633_0006501 Ga0495633_0006501_2467_3417 314
820 3300046558 Ga0495633_0006512 Ga0495633_0006512_5797_6762 314
821 3300046558 Ga0495633_0078927 Ga0495633_0078927_369_1325 314
822 3300046616 Ga0495668_0000038 Ga0495668_0000038_225444_226394 314
823 3300046616 Ga0495668_0000394 Ga0495668_0000394_34726_35682 314
824 3300046616 Ga0495668_0000606 Ga0495668_0000606_2565_3515 314
825 3300046616 Ga0495668_0001536 Ga0495668_0001536_4044_5033 314
826 3300046616 Ga0495668_0001656 Ga0495668_0001656_17448_18449 314
827 3300046616 Ga0495668_0006974 Ga0495668_0006974_2881_3831 314
828 3300046616 Ga0495668_0015959 Ga0495668_0015959_1867_2868 314
829 3300046616 Ga0495668_0016325 Ga0495668_0016325_1988_2950 314
830 3300046616 Ga0495668_0079666 Ga0495668_0079666_316_1272 314
831 3300046648 Ga0495611_0004871 Ga0495611_0004871_1613_2584 314
832 3300046660 Ga0495625_0000488 Ga0495625_0000488_34849_35802 314
833 3300046660 Ga0495625_0000516 Ga0495625_0000516_40516_41472 314
834 3300046660 Ga0495625_0007421 Ga0495625_0007421_4975_5964 314
835 3300046660 Ga0495625_0027778 Ga0495625_0027778_2179_3138 314
836 3300046660 Ga0495625_0039967 Ga0495625_0039967_2028_3029 314
837 3300046665 Ga0495661_0000252 Ga0495661_0000252_58282_59250 314
838 3300046665 Ga0495661_0001940 Ga0495661_0001940_10499_11539 314
839 3300046665 Ga0495661_0001951 Ga0495661_0001951_11476_12438 314
840 3300046665 Ga0495661_0009650 Ga0495661_0009650_2184_3134 314
841 3300046665 Ga0495661_0044131 Ga0495661_0044131_1609_2574 314
842 3300046679 Ga0495623_0058165 Ga0495623_0058165_763_1728 314
843 3300046684 Ga0495669_0000117 Ga0495669_0000117_44483_45475 314
844 3300046684 Ga0495669_0005350 Ga0495669_0005350_3000_3965 314
845 3300046684 Ga0495669_0036339 Ga0495669_0036339_817_1818 314
846 3300046684 Ga0495669_0079492 Ga0495669_0079492_422_1393 314
847 3300046689 Ga0495613_0015998 Ga0495613_0015998_337_1293 314
848 3300046691 Ga0495670_0012121 Ga0495670_0012121_961_1950 314
849 3300046691 Ga0495670_0012732 Ga0495670_0012732_2959_3915 314
850 3300046691 Ga0495670_0039099 Ga0495670_0039099_10_975 314
851 3300046691 Ga0495670_0059741 Ga0495670_0059741_380_1381 314
852 3300046692 Ga0495671_0000002 Ga0495671_0000002_714486_715436 314
853 3300046692 Ga0495671_0018306 Ga0495671_0018306_529_1518 314
854 3300046692 Ga0495671_0058739 Ga0495671_0058739_162_1151 314
855 3300046692 Ga0495671_0090874 Ga0495671_0090874_72_1031 314
856 3300046694 Ga0495649_0010742 Ga0495649_0010742_84_1040 314
857 3300046810 Ga0495660_0007317 Ga0495660_0007317_2700_3650 314
858 3300046810 Ga0495660_0010489 Ga0495660_0010489_1411_2376 314
859 3300046810 Ga0495660_0015568 Ga0495660_0015568_1744_2700 314
860 3300046810 Ga0495660_0150918 Ga0495660_0150918_20_1009 314
861 3300047317 Ga0495604_0189388 Ga0495604_0189388_387_1352 314
862 3300047320 Ga0495672_0000022 Ga0495672_0000022_21465_22415 314
863 3300047320 Ga0495672_0000095 Ga0495672_0000095_983_1942 314
864 3300047320 Ga0495672_0035785 Ga0495672_0035785_743_1744 314
865 3300047323 Ga0495683_0007411 Ga0495683_0007411_4637_5587 314
866 3300047323 Ga0495683_0067578 Ga0495683_0067578_16_1017 314
867 3300047443 Ga0495687_000154 Ga0495687_000154_17038_18027 314
868 3300047443 Ga0495687_023322 Ga0495687_023322_794_1834 314
869 3300047443 Ga0495687_077333 Ga0495687_077333_208_1206 314
870 3300047445 Ga0495677_0005914 Ga0495677_0005914_2291_3253 314
871 3300047445 Ga0495677_0046929 Ga0495677_0046929_343_1344 314
872 3300047446 Ga0495679_010228 Ga0495679_010228_93_1082 314
873 3300047446 Ga0495679_029590 Ga0495679_029590_316_1317 314
874 3300047447 Ga0495685_002279 Ga0495685_002279_356_1357 314
875 3300047469 Ga0495673_0000005 Ga0495673_0000005_536497_537447 314
876 3300047469 Ga0495673_0000064 Ga0495673_0000064_98974_99924 314
877 3300047469 Ga0495673_0000109 Ga0495673_0000109_32780_33751 314
878 3300047470 Ga0495681_0002624 Ga0495681_0002624_1240_2202 314
879 3300047470 Ga0495681_0066821 Ga0495681_0066821_517_1488 314
880 3300047472 Ga0495686_0000573 Ga0495686_0000573_45063_46025 314
881 3300047472 Ga0495686_0001478 Ga0495686_0001478_19332_20321 314
882 3300047472 Ga0495686_0051664 Ga0495686_0051664_636_1586 314
883 3300048088 Ga0495602_0196278 Ga0495602_0196278_489_1454 314
884 3300048091 Ga0495626_0003060 Ga0495626_0003060_8370_9332 314
885 3300048091 Ga0495626_0015090 Ga0495626_0015090_1408_2409 314
886 3300048091 Ga0495626_0085933 Ga0495626_0085933_279_1250 314
887 3300048903 Ga0496100_0115200 Ga0496100_0115200_202_1164 314
888 3300048905 Ga0496102_0022369 Ga0496102_0022369_928_1893 314
889 3300048905 Ga0496102_0075042 Ga0496102_0075042_1897_2862 314
890 3300048909 Ga0496106_0007989 Ga0496106_0007989_4956_5921 314
891 3300048910 Ga0496107_0049152 Ga0496107_0049152_792_1757 314
892 3300048912 Ga0496109_0008975 Ga0496109_0008975_1019_1987 314
893 3300048913 Ga0496110_0000137 Ga0496110_0000137_17341_18309 314
894 3300048916 Ga0496113_0007534 Ga0496113_0007534_5089_6066 314
895 3300048916 Ga0496113_0040210 Ga0496113_0040210_1292_2260 314
896 3300048925 Ga0496122_0000942 Ga0496122_0000942_41263_42231 314
897 3300048925 Ga0496122_0008838 Ga0496122_0008838_6116_7093 314
898 3300048925 Ga0496122_0013411 Ga0496122_0013411_6600_7550 314
899 3300048926 Ga0496123_0001138 Ga0496123_0001138_11382_12332 314
900 3300048926 Ga0496123_0004199 Ga0496123_0004199_3788_4756 314
901 3300048927 Ga0496124_0025513 Ga0496124_0025513_423_1388 314
902 3300048927 Ga0496124_0054203 Ga0496124_0054203_1220_2170 314
903 3300048928 Ga0496125_0000911 Ga0496125_0000911_27704_28672 314
904 3300048929 Ga0496126_0021538 Ga0496126_0021538_2852_3802 314
905 3300049459 Ga0495678_000467 Ga0495678_000467_22479_23468 314
906 3300049459 Ga0495678_000497 Ga0495678_000497_36875_37834 314
907 3300049460 Ga0495682_0003180 Ga0495682_0003180_1680_2669 314
908 3300049460 Ga0495682_0011989 Ga0495682_0011989_152_1141 314
909 3300049460 Ga0495682_0039942 Ga0495682_0039942_367_1368 314
910 3300049571 Ga0501034_0087899 Ga0501034_0087899_1558_2520 314
911 3300049571 Ga0501034_0134402 Ga0501034_0134402_1398_2390 314
912 3300050490 nmdc:mga03n38_27215_c1 nmdc:mga03n38_27215_c1_992_1984 314
913 3300050493 nmdc:mga0k408_101832_c1 nmdc:mga0k408_101832_c1_692_1684 314
914 3300050496 nmdc:mga07m45_10132_c1 nmdc:mga07m45_10132_c1_2510_3502 314
915 3300053086 Ga0500578_0002290 Ga0500578_0002290_2260_3252 314
916 3300053087 Ga0500643_019787 Ga0500643_019787_1012_2004 314
917 3300053088 Ga0500644_0013727 Ga0500644_0013727_14_1006 314
918 3300053090 Ga0500646_0004847 Ga0500646_0004847_448_1440 314
919 3300053093 Ga0500651_0035082 Ga0500651_0035082_60_1052 314
920 3300053093 Ga0500651_0047912 Ga0500651_0047912_624_1619 314
921 3300053098 Ga0500650_0119029 Ga0500650_0119029_124_1116 314
922 3300053109 Ga0500569_026107 Ga0500569_026107_111_1103 314
923 3300053118 Ga0500594_0001255 Ga0500594_0001255_1713_2672 314
924 3300053125 Ga0500618_000032 Ga0500618_000032_80505_81455 314
925 3300053130 Ga0500642_0012981 Ga0500642_0012981_818_1810 314
926 3300053130 Ga0500642_0115290 Ga0500642_0115290_125_1120 314
927 3300053131 Ga0500652_001359 Ga0500652_001359_2644_3636 314
928 3300053134 Ga0500658_0073117 Ga0500658_0073117_260_1252 314
929 3300053139 Ga0500568_0053703 Ga0500568_0053703_140_1132 314
930 3300053145 Ga0500586_020582 Ga0500586_020582_769_1719 314
931 3300053151 Ga0500604_0006863 Ga0500604_0006863_565_1557 314
932 3300053156 Ga0500622_0001393 Ga0500622_0001393_3840_4832 314
933 3300059643 Ga0587072_000288 Ga0587072_000288_3367_4311 314
934 3300061719 Ga0466962_0012603 Ga0466962_0012603_1578_2543 314
935 3300061719 Ga0466962_0014302 Ga0466962_0014302_2473_3468 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

21

80

0.98

PF03466

LysR_substrate

LysR substrate binding domain

104

313

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9598 1 84
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9523 1 81
5z4z-assembly2.cif.gz_C-2 crystal structure of pacysb ntd domain with space group c2 0.9518 4 84
5z4y-assembly1.cif.gz_B crystal structure of pacysb ntd domain with space group p4 0.9447 4 84
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9411 1 84
ID Description Score Start End Superfamily
af_P0ACR7_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9949 5 79 1.10.10.10
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9856 4 84 1.10.10.10
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9833 4 83 1.10.10.10
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9818 4 84 1.10.10.10
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9805 4 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A240B5D6-F1-model_v4 D-malate degradation protein R 0.9462 99 295 GO:0003700
GO:0006351
GO:0043565
AF-A0A485CE98-F1-model_v4 D-malate degradation protein R 0.9458 89 292 GO:0003700
GO:0006351
GO:0043565
AF-K8CRU7-F1-model_v4 deleted 0.9442 112 292
AF-V7DAT4-F1-model_v4 LysR family transcriptional regulator 0.9291 85 296
AF-A0A240B5D6-F1-model_v4 D-malate degradation protein R 0.9193 99 295 GO:0003700
GO:0006351
GO:0043565

Feature Viewer

pLDDT pTM Quality
89.16 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map