F486149
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 403 | 1870 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300005615|Ga0070702_100053841|Ga0070702_1000538412 |
| Length | 314 |
| Sequence | LAKFRGVADEVQCRLGAWMSKEKCRIGIVAPASRMSPEVAERVPTLARSLYPDRTPEIIFHPQCFALHGHFAGDDETRTQAFLEFANDESYDAVWFARGGYGSCRVVEAVMRGLKEPSRRKAYLGYSDAGVLLAALYRAGFEHVAHGPVAQDILRDGGDAAIGRALAWLIDRSPEALEPSVSRVKMTAAFNMTVLSQLLGTPLQPDLDGHVLMLEEVGEAMYRIDRSLFHITSNADIRRVSGVMLGRCSSITPNEPDFGMNEEEIARYWCERSGIPWLGRADIGHDTDNKIVPFGTRPALSSVSDALNVRNKHV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 6 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 143 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 231 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 243 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 252 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 263 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 275 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 276 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 361 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 362 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 363 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 364 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 365 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 366 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 378 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 381 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 397 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 398 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 400 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 402 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.86 |
| Nodule | 0 |
| Rhizoplane | 8.88 |
| Rhizosphere | 89.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070702_100053841 | 3300005615 | Unclassified | 2313 |
| 2 | JGI24032J14994_100084 | 3300001430 | Bacteria | 4081 |
| 3 | JGI24741J21665_1005888 | 3300001915 | Bacteria | 2511 |
| 4 | JGI24752J21851_1001192 | 3300001976 | Bacteria | 3525 |
| 5 | JGI24752J21851_1006891 | 3300001976 | Bacteria | 1485 |
| 6 | JGI24746J21847_1000561 | 3300001977 | Bacteria | 5596 |
| 7 | JGI24747J21853_1001109 | 3300001978 | Bacteria | 1940 |
| 8 | JGI24740J21852_10041133 | 3300001979 | Bacteria | 1395 |
| 9 | JGI24739J22299_10003310 | 3300001989 | Bacteria | 6143 |
| 10 | JGI24737J22298_10002636 | 3300001990 | Bacteria | 6346 |
| 11 | JGI24743J22301_10001496 | 3300001991 | Bacteria | 3251 |
| 12 | JGI24750J21931_1000486 | 3300002070 | Bacteria | 6264 |
| 13 | JGI24745J21846_1000039 | 3300002073 | Bacteria | 8901 |
| 14 | JGI24748J21848_1000823 | 3300002074 | Bacteria | 3361 |
| 15 | JGI24738J21930_10000730 | 3300002075 | Bacteria | 9473 |
| 16 | JGI24749J21850_1000343 | 3300002076 | Bacteria | 6984 |
| 17 | JGI24744J21845_10005872 | 3300002077 | Bacteria | 2545 |
| 18 | JGI24035J26624_1000058 | 3300002126 | Bacteria | 8751 |
| 19 | JGI24034J26672_10001627 | 3300002239 | Bacteria | 3005 |
| 20 | JGI24742J22300_10000198 | 3300002244 | Bacteria | 8911 |
| 21 | JGI24751J29686_10000813 | 3300002459 | Bacteria | 7277 |
| 22 | JGI25405J52794_10024537 | 3300003911 | Bacteria | 1231 |
| 23 | Ga0065712_10071767 | 3300005290 | Bacteria | 5071 |
| 24 | Ga0065715_10089090 | 3300005293 | Bacteria | 14624 |
| 25 | Ga0065707_10093537 | 3300005295 | Bacteria | 3615 |
| 26 | Ga0070676_10003608 | 3300005328 | Bacteria | 8088 |
| 27 | Ga0070683_100000585 | 3300005329 | Bacteria | 26003 |
| 28 | Ga0070690_100002968 | 3300005330 | Bacteria | 9179 |
| 29 | Ga0070670_100019485 | 3300005331 | Bacteria | 5823 |
| 30 | Ga0070677_10000046 | 3300005333 | Bacteria | 38785 |
| 31 | Ga0068869_100018348 | 3300005334 | Bacteria | 4761 |
| 32 | Ga0068869_100044707 | 3300005334 | Bacteria | 3185 |
| 33 | Ga0068869_100119476 | 3300005334 | Bacteria | 2014 |
| 34 | Ga0070666_10012900 | 3300005335 | Bacteria | 5286 |
| 35 | Ga0070666_10191364 | 3300005335 | Unclassified | 1438 |
| 36 | Ga0070680_100038291 | 3300005336 | Bacteria | 3878 |
| 37 | Ga0070682_100011129 | 3300005337 | Bacteria | 5133 |
| 38 | Ga0068868_100004852 | 3300005338 | Bacteria | 9443 |
| 39 | Ga0068868_100014135 | 3300005338 | Bacteria | 5878 |
| 40 | Ga0068868_100626183 | 3300005338 | Unclassified | 956 |
| 41 | Ga0070660_100016729 | 3300005339 | Bacteria | 5332 |
| 42 | Ga0070660_100143674 | 3300005339 | Bacteria | 1916 |
| 43 | Ga0070689_100013338 | 3300005340 | Bacteria | 5943 |
| 44 | Ga0070689_100053130 | 3300005340 | Bacteria | 3135 |
| 45 | Ga0070691_10005832 | 3300005341 | Bacteria | 5620 |
| 46 | Ga0070687_100007741 | 3300005343 | Bacteria | 4504 |
| 47 | Ga0070687_100058976 | 3300005343 | Bacteria | 2019 |
| 48 | Ga0070661_100011022 | 3300005344 | Bacteria | 6299 |
| 49 | Ga0070661_100072801 | 3300005344 | Unclassified | 2529 |
| 50 | Ga0070661_100132055 | 3300005344 | Bacteria | 1876 |
| 51 | Ga0070692_10000631 | 3300005345 | Bacteria | 11126 |
| 52 | Ga0070668_100027612 | 3300005347 | Bacteria | 4309 |
| 53 | Ga0070668_100087196 | 3300005347 | Bacteria | 2456 |
| 54 | Ga0070668_100093787 | 3300005347 | Bacteria | 2369 |
| 55 | Ga0070669_100014919 | 3300005353 | Bacteria | 5536 |
| 56 | Ga0070669_100015243 | 3300005353 | Bacteria | 5475 |
| 57 | Ga0070669_100134364 | 3300005353 | Bacteria | 1901 |
| 58 | Ga0070675_100017649 | 3300005354 | Bacteria | 5675 |
| 59 | Ga0070671_100003717 | 3300005355 | Bacteria | 11973 |
| 60 | Ga0070671_100005631 | 3300005355 | Bacteria | 9970 |
| 61 | Ga0070671_100014351 | 3300005355 | Bacteria | 6400 |
| 62 | Ga0070671_100014919 | 3300005355 | Bacteria | 6277 |
| 63 | Ga0070674_100010047 | 3300005356 | Bacteria | 5700 |
| 64 | Ga0070674_100133491 | 3300005356 | Unclassified | 1854 |
| 65 | Ga0070674_100231723 | 3300005356 | Unclassified | 1442 |
| 66 | Ga0070673_100017883 | 3300005364 | Bacteria | 5052 |
| 67 | Ga0070673_100024844 | 3300005364 | Bacteria | 4399 |
| 68 | Ga0070673_100186262 | 3300005364 | Bacteria | 1780 |
| 69 | Ga0070673_100249808 | 3300005364 | Unclassified | 1545 |
| 70 | Ga0070673_100420164 | 3300005364 | Bacteria | 1199 |
| 71 | Ga0070673_100629212 | 3300005364 | Bacteria | 981 |
| 72 | Ga0070688_100005511 | 3300005365 | Bacteria | 6675 |
| 73 | Ga0070688_100098479 | 3300005365 | Bacteria | 1924 |
| 74 | Ga0070659_100016762 | 3300005366 | Bacteria | 5504 |
| 75 | Ga0070659_100131107 | 3300005366 | Unclassified | 2036 |
| 76 | Ga0070667_100013764 | 3300005367 | Bacteria | 6688 |
| 77 | Ga0070667_100070171 | 3300005367 | Bacteria | 2982 |
| 78 | Ga0070703_10012402 | 3300005406 | Bacteria | 2415 |
| 79 | Ga0070709_10078709 | 3300005434 | Bacteria | 2146 |
| 80 | Ga0070709_10388138 | 3300005434 | Bacteria | 1040 |
| 81 | Ga0070714_100027998 | 3300005435 | Bacteria | 4671 |
| 82 | Ga0070714_100110010 | 3300005435 | Unclassified | 2439 |
| 83 | Ga0070714_100124643 | 3300005435 | Bacteria | 2295 |
| 84 | Ga0070713_100168029 | 3300005436 | Bacteria | 1963 |
| 85 | Ga0070713_100209598 | 3300005436 | Unclassified | 1764 |
| 86 | Ga0070713_100396162 | 3300005436 | Unclassified | 1289 |
| 87 | Ga0070710_10008064 | 3300005437 | Bacteria | 5119 |
| 88 | Ga0070710_10019971 | 3300005437 | Bacteria | 3470 |
| 89 | Ga0070701_10000116 | 3300005438 | Bacteria | 23157 |
| 90 | Ga0070711_100016945 | 3300005439 | Bacteria | 4633 |
| 91 | Ga0070711_100026760 | 3300005439 | Bacteria | 3782 |
| 92 | Ga0070711_100069259 | 3300005439 | Bacteria | 2482 |
| 93 | Ga0070705_100011033 | 3300005440 | Bacteria | 4544 |
| 94 | Ga0070700_100001202 | 3300005441 | Bacteria | 12834 |
| 95 | Ga0070700_100015702 | 3300005441 | Bacteria | 4300 |
| 96 | Ga0070694_100001057 | 3300005444 | Bacteria | 15735 |
| 97 | Ga0070708_100035671 | 3300005445 | Bacteria | 4333 |
| 98 | Ga0070663_100018435 | 3300005455 | Bacteria | 4577 |
| 99 | Ga0070663_100183797 | 3300005455 | Bacteria | 1623 |
| 100 | Ga0070678_100004906 | 3300005456 | Bacteria | 7649 |
| 101 | Ga0070678_100011782 | 3300005456 | Bacteria | 5408 |
| 102 | Ga0070678_100069580 | 3300005456 | Bacteria | 2628 |
| 103 | Ga0070662_100017132 | 3300005457 | Bacteria | 4877 |
| 104 | Ga0070681_10027863 | 3300005458 | Bacteria | 5680 |
| 105 | Ga0070681_10107353 | 3300005458 | Bacteria | 2732 |
| 106 | Ga0068867_100000619 | 3300005459 | Bacteria | 23562 |
| 107 | Ga0070685_10021655 | 3300005466 | Bacteria | 3497 |
| 108 | Ga0070685_10169401 | 3300005466 | Bacteria | 1398 |
| 109 | Ga0070679_100035946 | 3300005530 | Bacteria | 4915 |
| 110 | Ga0070679_100428136 | 3300005530 | Bacteria | 1269 |
| 111 | Ga0070684_100011691 | 3300005535 | Bacteria | 6998 |
| 112 | Ga0070684_100033921 | 3300005535 | Bacteria | 4361 |
| 113 | Ga0070684_100171844 | 3300005535 | Bacteria | 1968 |
| 114 | Ga0068853_100004569 | 3300005539 | Bacteria | 10736 |
| 115 | Ga0068853_100145190 | 3300005539 | Bacteria | 2132 |
| 116 | Ga0068853_100412258 | 3300005539 | Bacteria | 1266 |
| 117 | Ga0068853_100460587 | 3300005539 | Bacteria | 1197 |
| 118 | Ga0070672_100000875 | 3300005543 | Bacteria | 18026 |
| 119 | Ga0070672_100036512 | 3300005543 | Bacteria | 3744 |
| 120 | Ga0070672_100089246 | 3300005543 | Bacteria | 2483 |
| 121 | Ga0070672_100185890 | 3300005543 | Unclassified | 1733 |
| 122 | Ga0070686_100000923 | 3300005544 | Bacteria | 16929 |
| 123 | Ga0070686_100026854 | 3300005544 | Bacteria | 3479 |
| 124 | Ga0070686_100059944 | 3300005544 | Bacteria | 2454 |
| 125 | Ga0070686_100082785 | 3300005544 | Unclassified | 2129 |
| 126 | Ga0070695_100000960 | 3300005545 | Bacteria | 15663 |
| 127 | Ga0070695_100149014 | 3300005545 | Bacteria | 1631 |
| 128 | Ga0070696_100010637 | 3300005546 | Bacteria | 6162 |
| 129 | Ga0070696_100015013 | 3300005546 | Bacteria | 5201 |
| 130 | Ga0070696_100110528 | 3300005546 | Bacteria | 1979 |
| 131 | Ga0070665_100008168 | 3300005548 | Bacteria | 10598 |
| 132 | Ga0070665_100119963 | 3300005548 | Bacteria | 2632 |
| 133 | Ga0070704_100015740 | 3300005549 | Bacteria | 4761 |
| 134 | Ga0068855_100057904 | 3300005563 | Bacteria | 4541 |
| 135 | Ga0070664_100008796 | 3300005564 | Bacteria | 8180 |
| 136 | Ga0070664_100011917 | 3300005564 | Bacteria | 7057 |
| 137 | Ga0070664_100094572 | 3300005564 | Bacteria | 2591 |
| 138 | Ga0070664_100099610 | 3300005564 | Bacteria | 2526 |
| 139 | Ga0070664_100235984 | 3300005564 | Bacteria | 1640 |
| 140 | Ga0070664_100416869 | 3300005564 | Bacteria | 1229 |
| 141 | Ga0068857_100007206 | 3300005577 | Bacteria | 9575 |
| 142 | Ga0068857_100359926 | 3300005577 | Bacteria | 1348 |
| 143 | Ga0068857_100504131 | 3300005577 | Bacteria | 1136 |
| 144 | Ga0068854_100003201 | 3300005578 | Bacteria | 10216 |
| 145 | Ga0068854_100019078 | 3300005578 | Bacteria | 4615 |
| 146 | Ga0068854_100045715 | 3300005578 | Bacteria | 3114 |
| 147 | Ga0068856_100044263 | 3300005614 | Bacteria | 4380 |
| 148 | Ga0068856_100092282 | 3300005614 | Bacteria | 3013 |
| 149 | Ga0068856_100206495 | 3300005614 | Bacteria | 1979 |
| 150 | Ga0068856_100224931 | 3300005614 | Bacteria | 1892 |
| 151 | Ga0070702_100003539 | 3300005615 | Bacteria | 6998 |
| 152 | Ga0070702_100068498 | 3300005615 | Bacteria | 2089 |
| 153 | Ga0070702_100105591 | 3300005615 | Bacteria | 1736 |
| 154 | Ga0068852_100026464 | 3300005616 | Bacteria | 4715 |
| 155 | Ga0068852_100040689 | 3300005616 | Bacteria | 3923 |
| 156 | Ga0068859_100000323 | 3300005617 | Bacteria | 47637 |
| 157 | Ga0068859_100014029 | 3300005617 | Bacteria | 8034 |
| 158 | Ga0068864_100000501 | 3300005618 | Bacteria | 33748 |
| 159 | Ga0068864_100002687 | 3300005618 | Bacteria | 14661 |
| 160 | Ga0068864_100157366 | 3300005618 | Bacteria | 2063 |
| 161 | Ga0068864_100174037 | 3300005618 | Bacteria | 1964 |
| 162 | Ga0068866_10001605 | 3300005718 | Bacteria | 9581 |
| 163 | Ga0068861_100005083 | 3300005719 | Bacteria | 8875 |
| 164 | Ga0068870_10000104 | 3300005840 | Bacteria | 28590 |
| 165 | Ga0068863_100002181 | 3300005841 | Bacteria | 19410 |
| 166 | Ga0068863_100012118 | 3300005841 | Bacteria | 8329 |
| 167 | Ga0068863_100030102 | 3300005841 | Bacteria | 5185 |
| 168 | Ga0068858_100002458 | 3300005842 | Bacteria | 18704 |
| 169 | Ga0068858_100009333 | 3300005842 | Bacteria | 9368 |
| 170 | Ga0068860_100029756 | 3300005843 | Bacteria | 5254 |
| 171 | Ga0068860_100087246 | 3300005843 | Bacteria | 2970 |
| 172 | Ga0068860_100256322 | 3300005843 | Bacteria | 1704 |
| 173 | Ga0068860_100366894 | 3300005843 | Bacteria | 1419 |
| 174 | Ga0068862_100017639 | 3300005844 | Bacteria | 5943 |
| 175 | Ga0068862_100020470 | 3300005844 | Bacteria | 5527 |
| 176 | Ga0068862_100029753 | 3300005844 | Bacteria | 4602 |
| 177 | Ga0068862_100224551 | 3300005844 | Bacteria | 1701 |
| 178 | Ga0068862_100588683 | 3300005844 | Unclassified | 1067 |
| 179 | Ga0081455_10001425 | 3300005937 | Bacteria | 29567 |
| 180 | Ga0081455_10005674 | 3300005937 | Bacteria | 13622 |
| 181 | Ga0081455_10034020 | 3300005937 | Bacteria | 4572 |
| 182 | Ga0081455_10045447 | 3300005937 | Bacteria | 3821 |
| 183 | Ga0081455_10049231 | 3300005937 | Bacteria | 3634 |
| 184 | Ga0081538_10122488 | 3300005981 | Bacteria | 1245 |
| 185 | Ga0081540_1000086 | 3300005983 | Bacteria | 99615 |
| 186 | Ga0081540_1013162 | 3300005983 | Bacteria | 5397 |
| 187 | Ga0081540_1017462 | 3300005983 | Bacteria | 4441 |
| 188 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 189 | Ga0070717_10028620 | 3300006028 | Unclassified | 4462 |
| 190 | Ga0070717_10204499 | 3300006028 | Bacteria | 1731 |
| 191 | Ga0075365_10053618 | 3300006038 | Bacteria | 2671 |
| 192 | Ga0070715_10007523 | 3300006163 | Bacteria | 3753 |
| 193 | Ga0070715_10007548 | 3300006163 | Bacteria | 3749 |
| 194 | Ga0070716_100045030 | 3300006173 | Bacteria | 2475 |
| 195 | Ga0070712_100000903 | 3300006175 | Bacteria | 17757 |
| 196 | Ga0070712_100001246 | 3300006175 | Bacteria | 15388 |
| 197 | Ga0070712_100014800 | 3300006175 | Bacteria | 5012 |
| 198 | Ga0070712_100036996 | 3300006175 | Bacteria | 3324 |
| 199 | Ga0070712_100105178 | 3300006175 | Bacteria | 2096 |
| 200 | Ga0070712_100229508 | 3300006175 | Bacteria | 1473 |
| 201 | Ga0075367_10046625 | 3300006178 | Bacteria | 2547 |
| 202 | Ga0097621_100008529 | 3300006237 | Bacteria | 7380 |
| 203 | Ga0068871_100000485 | 3300006358 | Bacteria | 27172 |
| 204 | Ga0068871_100104376 | 3300006358 | Bacteria | 2377 |
| 205 | Ga0068871_100325046 | 3300006358 | Bacteria | 1355 |
| 206 | Ga0075428_100019515 | 3300006844 | Bacteria | 7503 |
| 207 | Ga0075428_100055252 | 3300006844 | Bacteria | 4350 |
| 208 | Ga0075428_100213853 | 3300006844 | Bacteria | 2083 |
| 209 | Ga0075430_100000164 | 3300006846 | Bacteria | 43703 |
| 210 | Ga0075430_100002416 | 3300006846 | Bacteria | 15551 |
| 211 | Ga0075430_100030141 | 3300006846 | Bacteria | 4607 |
| 212 | Ga0075430_100501158 | 3300006846 | Bacteria | 1002 |
| 213 | Ga0075431_100000986 | 3300006847 | Bacteria | 25337 |
| 214 | Ga0075431_100042134 | 3300006847 | Bacteria | 4708 |
| 215 | Ga0075433_10001944 | 3300006852 | Bacteria | 15534 |
| 216 | Ga0075433_10010489 | 3300006852 | Bacteria | 7438 |
| 217 | Ga0075434_100004417 | 3300006871 | Bacteria | 12674 |
| 218 | Ga0075434_100030711 | 3300006871 | Bacteria | 5293 |
| 219 | Ga0075434_100255023 | 3300006871 | Bacteria | 1773 |
| 220 | Ga0075429_100016531 | 3300006880 | Bacteria | 6392 |
| 221 | Ga0075429_100443136 | 3300006880 | Bacteria | 1138 |
| 222 | Ga0068865_100001815 | 3300006881 | Bacteria | 12539 |
| 223 | Ga0068865_100241434 | 3300006881 | Bacteria | 1422 |
| 224 | Ga0097620_100000323 | 3300006931 | Bacteria | 47637 |
| 225 | Ga0097620_100014029 | 3300006931 | Bacteria | 8034 |
| 226 | Ga0075435_100023740 | 3300007076 | Bacteria | 4749 |
| 227 | Ga0075435_100072290 | 3300007076 | Unclassified | 2818 |
| 228 | Ga0075435_100141920 | 3300007076 | Bacteria | 2016 |
| 229 | Ga0075435_100236147 | 3300007076 | Bacteria | 1554 |
| 230 | Ga0105250_10004482 | 3300009092 | Bacteria | 6420 |
| 231 | Ga0105240_10125942 | 3300009093 | Bacteria | 3078 |
| 232 | Ga0111539_10000930 | 3300009094 | Bacteria | 38345 |
| 233 | Ga0111539_10002680 | 3300009094 | Bacteria | 23585 |
| 234 | Ga0111539_10004845 | 3300009094 | Bacteria | 17538 |
| 235 | Ga0111539_10007277 | 3300009094 | Bacteria | 14171 |
| 236 | Ga0111539_10053440 | 3300009094 | Bacteria | 4808 |
| 237 | Ga0111539_10264825 | 3300009094 | Bacteria | 2001 |
| 238 | Ga0105245_10001701 | 3300009098 | Bacteria | 20027 |
| 239 | Ga0105245_10014199 | 3300009098 | Bacteria | 6941 |
| 240 | Ga0105247_10015729 | 3300009101 | Bacteria | 4530 |
| 241 | Ga0105247_10020219 | 3300009101 | Bacteria | 4002 |
| 242 | Ga0105247_10162666 | 3300009101 | Bacteria | 1479 |
| 243 | Ga0105247_10236681 | 3300009101 | Bacteria | 1242 |
| 244 | Ga0114129_10004791 | 3300009147 | Bacteria | 19126 |
| 245 | Ga0114129_10065648 | 3300009147 | Bacteria | 5064 |
| 246 | Ga0114129_10123771 | 3300009147 | Bacteria | 3556 |
| 247 | Ga0114129_10256062 | 3300009147 | Unclassified | 2348 |
| 248 | Ga0114129_10434617 | 3300009147 | Bacteria | 1724 |
| 249 | Ga0114129_10963216 | 3300009147 | Bacteria | 1077 |
| 250 | Ga0105243_10026025 | 3300009148 | Bacteria | 4477 |
| 251 | Ga0105243_10085590 | 3300009148 | Unclassified | 2584 |
| 252 | Ga0105243_10090303 | 3300009148 | Bacteria | 2520 |
| 253 | Ga0105243_10382476 | 3300009148 | Bacteria | 1302 |
| 254 | Ga0105241_10000805 | 3300009174 | Bacteria | 23823 |
| 255 | Ga0105241_10012529 | 3300009174 | Bacteria | 6218 |
| 256 | Ga0105241_10099248 | 3300009174 | Unclassified | 2312 |
| 257 | Ga0105241_10283075 | 3300009174 | Bacteria | 1417 |
| 258 | Ga0105242_10004554 | 3300009176 | Bacteria | 10756 |
| 259 | Ga0105242_10020924 | 3300009176 | Bacteria | 5131 |
| 260 | Ga0105242_10109990 | 3300009176 | Unclassified | 2347 |
| 261 | Ga0105242_10205064 | 3300009176 | Bacteria | 1753 |
| 262 | Ga0105242_10228977 | 3300009176 | Bacteria | 1665 |
| 263 | Ga0105248_10007773 | 3300009177 | Bacteria | 11767 |
| 264 | Ga0105248_10012541 | 3300009177 | Bacteria | 9350 |
| 265 | Ga0105248_10014249 | 3300009177 | Bacteria | 8752 |
| 266 | Ga0105248_10045407 | 3300009177 | Bacteria | 4927 |
| 267 | Ga0105248_10073290 | 3300009177 | Bacteria | 3849 |
| 268 | Ga0105248_10256090 | 3300009177 | Bacteria | 1970 |
| 269 | Ga0105237_10024690 | 3300009545 | Bacteria | 6148 |
| 270 | Ga0105238_10057979 | 3300009551 | Bacteria | 3882 |
| 271 | Ga0105249_10075277 | 3300009553 | Bacteria | 3126 |
| 272 | Ga0105249_10301612 | 3300009553 | Bacteria | 1607 |
| 273 | Ga0105249_10450947 | 3300009553 | Bacteria | 1325 |
| 274 | Ga0105239_10043858 | 3300010375 | Bacteria | 4904 |
| 275 | Ga0105239_10082161 | 3300010375 | Bacteria | 3547 |
| 276 | Ga0105239_10355647 | 3300010375 | Bacteria | 1654 |
| 277 | Ga0105246_10002092 | 3300011119 | Bacteria | 12025 |
| 278 | Ga0105246_10158351 | 3300011119 | Unclassified | 1722 |
| 279 | Ga0105246_10195911 | 3300011119 | Bacteria | 1567 |
| 280 | Ga0105246_10248405 | 3300011119 | Bacteria | 1410 |
| 281 | Ga0105246_10321907 | 3300011119 | Bacteria | 1257 |
| 282 | Ga0105246_10328553 | 3300011119 | Unclassified | 1245 |
| 283 | Ga0157338_1001046 | 3300012515 | Unclassified | 1884 |
| 284 | Ga0157373_10174842 | 3300013100 | Bacteria | 1511 |
| 285 | Ga0157371_10014330 | 3300013102 | Bacteria | 5986 |
| 286 | Ga0157369_10502410 | 3300013105 | Bacteria | 1254 |
| 287 | Ga0157369_10689858 | 3300013105 | Bacteria | 1052 |
| 288 | Ga0157374_10005194 | 3300013296 | Bacteria | 10921 |
| 289 | Ga0157374_10351302 | 3300013296 | Bacteria | 1465 |
| 290 | Ga0157374_10440896 | 3300013296 | Unclassified | 1303 |
| 291 | Ga0157378_10011410 | 3300013297 | Bacteria | 7779 |
| 292 | Ga0157378_10539966 | 3300013297 | Bacteria | 1170 |
| 293 | Ga0163162_10039217 | 3300013306 | Bacteria | 4732 |
| 294 | Ga0163162_10078758 | 3300013306 | Bacteria | 3361 |
| 295 | Ga0163162_10090824 | 3300013306 | Bacteria | 3136 |
| 296 | Ga0157372_10016173 | 3300013307 | Bacteria | 8004 |
| 297 | Ga0157375_10001699 | 3300013308 | Bacteria | 18899 |
| 298 | Ga0157375_10505573 | 3300013308 | Bacteria | 1372 |
| 299 | Ga0157375_10693608 | 3300013308 | Unclassified | 1172 |
| 300 | Ga0163163_10000489 | 3300014325 | Bacteria | 35830 |
| 301 | Ga0163163_10029460 | 3300014325 | Bacteria | 5281 |
| 302 | Ga0163163_10103106 | 3300014325 | Bacteria | 2877 |
| 303 | Ga0163163_10144821 | 3300014325 | Bacteria | 2419 |
| 304 | Ga0157380_10020406 | 3300014326 | Bacteria | 4953 |
| 305 | Ga0157380_10023469 | 3300014326 | Bacteria | 4653 |
| 306 | Ga0157377_10002656 | 3300014745 | Bacteria | 7931 |
| 307 | Ga0157379_10004716 | 3300014968 | Bacteria | 11706 |
| 308 | Ga0157379_10007629 | 3300014968 | Bacteria | 9363 |
| 309 | Ga0157379_10010586 | 3300014968 | Bacteria | 8039 |
| 310 | Ga0157379_10013998 | 3300014968 | Bacteria | 7031 |
| 311 | Ga0157379_10212857 | 3300014968 | Bacteria | 1750 |
| 312 | Ga0157376_10030975 | 3300014969 | Bacteria | 4278 |
| 313 | Ga0157376_10170656 | 3300014969 | Bacteria | 1981 |
| 314 | Ga0157376_10222620 | 3300014969 | Bacteria | 1748 |
| 315 | Ga0157376_10518259 | 3300014969 | Bacteria | 1175 |
| 316 | Ga0163161_10002208 | 3300017792 | Bacteria | 14038 |
| 317 | Ga0163161_10038349 | 3300017792 | Unclassified | 3437 |
| 318 | Ga0224572_1001032 | 3300024225 | Bacteria | 3872 |
| 319 | Ga0207666_1000245 | 3300025271 | Bacteria | 7999 |
| 320 | Ga0207673_1003029 | 3300025290 | Bacteria | 1949 |
| 321 | Ga0207697_10003263 | 3300025315 | Bacteria | 8062 |
| 322 | Ga0207653_10017221 | 3300025885 | Bacteria | 2273 |
| 323 | Ga0207682_10000793 | 3300025893 | Bacteria | 14622 |
| 324 | Ga0207692_10025244 | 3300025898 | Bacteria | 2773 |
| 325 | Ga0207642_10001880 | 3300025899 | Bacteria | 6476 |
| 326 | Ga0207710_10007749 | 3300025900 | Bacteria | 4543 |
| 327 | Ga0207710_10089573 | 3300025900 | Bacteria | 1438 |
| 328 | Ga0207688_10000420 | 3300025901 | Bacteria | 19959 |
| 329 | Ga0207680_10006456 | 3300025903 | Bacteria | 5668 |
| 330 | Ga0207680_10133951 | 3300025903 | Bacteria | 1636 |
| 331 | Ga0207647_10004676 | 3300025904 | Bacteria | 10143 |
| 332 | Ga0207647_10046531 | 3300025904 | Bacteria | 2703 |
| 333 | Ga0207685_10020702 | 3300025905 | Bacteria | 2191 |
| 334 | Ga0207699_10088829 | 3300025906 | Bacteria | 1935 |
| 335 | Ga0207645_10000668 | 3300025907 | Bacteria | 28444 |
| 336 | Ga0207643_10000085 | 3300025908 | Bacteria | 61372 |
| 337 | Ga0207643_10011878 | 3300025908 | Bacteria | 4700 |
| 338 | Ga0207654_10000373 | 3300025911 | Bacteria | 26098 |
| 339 | Ga0207654_10095182 | 3300025911 | Bacteria | 1824 |
| 340 | Ga0207707_10011682 | 3300025912 | Bacteria | 7643 |
| 341 | Ga0207707_10104589 | 3300025912 | Bacteria | 2474 |
| 342 | Ga0207695_10153710 | 3300025913 | Bacteria | 2238 |
| 343 | Ga0207671_10006714 | 3300025914 | Bacteria | 10192 |
| 344 | Ga0207693_10001322 | 3300025915 | Bacteria | 21965 |
| 345 | Ga0207693_10001438 | 3300025915 | Bacteria | 21113 |
| 346 | Ga0207693_10026127 | 3300025915 | Bacteria | 4623 |
| 347 | Ga0207693_10029261 | 3300025915 | Bacteria | 4353 |
| 348 | Ga0207693_10064662 | 3300025915 | Bacteria | 2865 |
| 349 | Ga0207693_10124525 | 3300025915 | Bacteria | 2025 |
| 350 | Ga0207693_10185317 | 3300025915 | Bacteria | 1638 |
| 351 | Ga0207663_10005341 | 3300025916 | Bacteria | 6465 |
| 352 | Ga0207663_10083280 | 3300025916 | Bacteria | 2101 |
| 353 | Ga0207663_10168519 | 3300025916 | Bacteria | 1553 |
| 354 | Ga0207663_10228576 | 3300025916 | Unclassified | 1358 |
| 355 | Ga0207660_10002189 | 3300025917 | Bacteria | 12932 |
| 356 | Ga0207662_10000730 | 3300025918 | Bacteria | 15052 |
| 357 | Ga0207657_10007870 | 3300025919 | Bacteria | 10880 |
| 358 | Ga0207657_10072772 | 3300025919 | Bacteria | 2906 |
| 359 | Ga0207649_10000476 | 3300025920 | Bacteria | 28654 |
| 360 | Ga0207649_10230862 | 3300025920 | Bacteria | 1323 |
| 361 | Ga0207652_10003058 | 3300025921 | Bacteria | 13968 |
| 362 | Ga0207681_10006586 | 3300025923 | Bacteria | 7132 |
| 363 | Ga0207681_10048551 | 3300025923 | Bacteria | 2865 |
| 364 | Ga0207650_10028502 | 3300025925 | Bacteria | 4005 |
| 365 | Ga0207650_10198426 | 3300025925 | Unclassified | 1606 |
| 366 | Ga0207659_10010174 | 3300025926 | Bacteria | 5898 |
| 367 | Ga0207687_10001321 | 3300025927 | Bacteria | 16972 |
| 368 | Ga0207687_10192793 | 3300025927 | Bacteria | 1587 |
| 369 | Ga0207700_10044752 | 3300025928 | Bacteria | 3261 |
| 370 | Ga0207700_10069414 | 3300025928 | Bacteria | 2705 |
| 371 | Ga0207700_10137461 | 3300025928 | Unclassified | 2004 |
| 372 | Ga0207700_10165035 | 3300025928 | Bacteria | 1842 |
| 373 | Ga0207700_10223955 | 3300025928 | Unclassified | 1596 |
| 374 | Ga0207700_10301920 | 3300025928 | Bacteria | 1383 |
| 375 | Ga0207644_10000759 | 3300025931 | Bacteria | 20458 |
| 376 | Ga0207644_10004908 | 3300025931 | Bacteria | 8719 |
| 377 | Ga0207644_10007993 | 3300025931 | Bacteria | 6917 |
| 378 | Ga0207644_10024244 | 3300025931 | Bacteria | 4163 |
| 379 | Ga0207690_10004643 | 3300025932 | Bacteria | 8126 |
| 380 | Ga0207690_10022775 | 3300025932 | Bacteria | 3900 |
| 381 | Ga0207690_10100671 | 3300025932 | Unclassified | 2063 |
| 382 | Ga0207690_10119236 | 3300025932 | Bacteria | 1914 |
| 383 | Ga0207706_10013555 | 3300025933 | Bacteria | 7406 |
| 384 | Ga0207706_10043416 | 3300025933 | Bacteria | 3983 |
| 385 | Ga0207706_10129440 | 3300025933 | Bacteria | 2220 |
| 386 | Ga0207686_10000682 | 3300025934 | Bacteria | 21032 |
| 387 | Ga0207686_10058551 | 3300025934 | Bacteria | 2429 |
| 388 | Ga0207709_10002503 | 3300025935 | Bacteria | 11496 |
| 389 | Ga0207709_10022112 | 3300025935 | Bacteria | 3605 |
| 390 | Ga0207709_10050302 | 3300025935 | Bacteria | 2548 |
| 391 | Ga0207670_10000908 | 3300025936 | Bacteria | 15642 |
| 392 | Ga0207670_10081270 | 3300025936 | Bacteria | 2268 |
| 393 | Ga0207669_10000129 | 3300025937 | Bacteria | 37620 |
| 394 | Ga0207704_10000366 | 3300025938 | Bacteria | 20998 |
| 395 | Ga0207665_10015654 | 3300025939 | Unclassified | 4977 |
| 396 | Ga0207665_10026086 | 3300025939 | Bacteria | 3856 |
| 397 | Ga0207665_10399677 | 3300025939 | Bacteria | 1046 |
| 398 | Ga0207691_10010088 | 3300025940 | Bacteria | 9064 |
| 399 | Ga0207691_10029040 | 3300025940 | Bacteria | 5173 |
| 400 | Ga0207691_10040566 | 3300025940 | Bacteria | 4300 |
| 401 | Ga0207691_10041706 | 3300025940 | Bacteria | 4236 |
| 402 | Ga0207691_10107655 | 3300025940 | Bacteria | 2481 |
| 403 | Ga0207711_10000042 | 3300025941 | Bacteria | 158782 |
| 404 | Ga0207711_10043312 | 3300025941 | Bacteria | 3838 |
| 405 | Ga0207711_10203389 | 3300025941 | Bacteria | 1808 |
| 406 | Ga0207711_10351715 | 3300025941 | Bacteria | 1364 |
| 407 | Ga0207711_10446168 | 3300025941 | Unclassified | 1204 |
| 408 | Ga0207689_10002200 | 3300025942 | Bacteria | 18279 |
| 409 | Ga0207689_10027825 | 3300025942 | Bacteria | 4731 |
| 410 | Ga0207661_10000373 | 3300025944 | Bacteria | 28733 |
| 411 | Ga0207661_10537366 | 3300025944 | Unclassified | 1070 |
| 412 | Ga0207679_10001125 | 3300025945 | Bacteria | 17047 |
| 413 | Ga0207679_10030464 | 3300025945 | Bacteria | 3768 |
| 414 | Ga0207667_10025152 | 3300025949 | Bacteria | 6523 |
| 415 | Ga0207651_10002032 | 3300025960 | Bacteria | 9512 |
| 416 | Ga0207651_10031594 | 3300025960 | Unclassified | 3388 |
| 417 | Ga0207712_10002238 | 3300025961 | Bacteria | 12597 |
| 418 | Ga0207712_10043634 | 3300025961 | Bacteria | 3094 |
| 419 | Ga0207668_10001143 | 3300025972 | Bacteria | 15797 |
| 420 | Ga0207668_10559908 | 3300025972 | Bacteria | 991 |
| 421 | Ga0207640_10019608 | 3300025981 | Bacteria | 3999 |
| 422 | Ga0207640_10346001 | 3300025981 | Bacteria | 1193 |
| 423 | Ga0207640_10426011 | 3300025981 | Bacteria | 1087 |
| 424 | Ga0207640_10479902 | 3300025981 | Bacteria | 1031 |
| 425 | Ga0207658_10008091 | 3300025986 | Bacteria | 7161 |
| 426 | Ga0207658_10017529 | 3300025986 | Bacteria | 4936 |
| 427 | Ga0207658_10020382 | 3300025986 | Bacteria | 4591 |
| 428 | Ga0207658_10057545 | 3300025986 | Bacteria | 2890 |
| 429 | Ga0207658_10096320 | 3300025986 | Bacteria | 2307 |
| 430 | Ga0207677_10009995 | 3300026023 | Bacteria | 5354 |
| 431 | Ga0207703_10001627 | 3300026035 | Bacteria | 20231 |
| 432 | Ga0207703_10002493 | 3300026035 | Bacteria | 15957 |
| 433 | Ga0207703_10041859 | 3300026035 | Bacteria | 3672 |
| 434 | Ga0207639_10005334 | 3300026041 | Bacteria | 8683 |
| 435 | Ga0207639_10203397 | 3300026041 | Bacteria | 1700 |
| 436 | Ga0207678_10010758 | 3300026067 | Bacteria | 8039 |
| 437 | Ga0207678_10018247 | 3300026067 | Bacteria | 6161 |
| 438 | Ga0207678_10067149 | 3300026067 | Unclassified | 3078 |
| 439 | Ga0207708_10007465 | 3300026075 | Bacteria | 8078 |
| 440 | Ga0207708_10007573 | 3300026075 | Bacteria | 8033 |
| 441 | Ga0207702_10017909 | 3300026078 | Bacteria | 5861 |
| 442 | Ga0207702_10030876 | 3300026078 | Bacteria | 4465 |
| 443 | Ga0207702_10132468 | 3300026078 | Bacteria | 2245 |
| 444 | Ga0207702_10303614 | 3300026078 | Bacteria | 1515 |
| 445 | Ga0207641_10000927 | 3300026088 | Bacteria | 30260 |
| 446 | Ga0207641_10002374 | 3300026088 | Bacteria | 17373 |
| 447 | Ga0207641_10030449 | 3300026088 | Bacteria | 4470 |
| 448 | Ga0207648_10001362 | 3300026089 | Bacteria | 26996 |
| 449 | Ga0207676_10000435 | 3300026095 | Bacteria | 35291 |
| 450 | Ga0207676_10001403 | 3300026095 | Bacteria | 17929 |
| 451 | Ga0207676_10016664 | 3300026095 | Bacteria | 5322 |
| 452 | Ga0207676_10107821 | 3300026095 | Bacteria | 2324 |
| 453 | Ga0207674_10011327 | 3300026116 | Bacteria | 10022 |
| 454 | Ga0207675_100004955 | 3300026118 | Bacteria | 12836 |
| 455 | Ga0207675_100150113 | 3300026118 | Bacteria | 2218 |
| 456 | Ga0207683_10001172 | 3300026121 | Bacteria | 23710 |
| 457 | Ga0207683_10001220 | 3300026121 | Bacteria | 23334 |
| 458 | Ga0207683_10077777 | 3300026121 | Bacteria | 2939 |
| 459 | Ga0207683_10077868 | 3300026121 | Bacteria | 2937 |
| 460 | Ga0207683_10102696 | 3300026121 | Bacteria | 2553 |
| 461 | Ga0207698_10016256 | 3300026142 | Bacteria | 5011 |
| 462 | Ga0207698_10026603 | 3300026142 | Bacteria | 4094 |
| 463 | Ga0207698_10812108 | 3300026142 | Bacteria | 938 |
| 464 | Ga0210002_1000487 | 3300027617 | Bacteria | 5390 |
| 465 | Ga0209983_1011416 | 3300027665 | Bacteria | 1818 |
| 466 | Ga0209998_10001714 | 3300027717 | Bacteria | 5229 |
| 467 | Ga0207428_10000322 | 3300027907 | Bacteria | 62220 |
| 468 | Ga0207428_10000896 | 3300027907 | Bacteria | 33348 |
| 469 | Ga0207428_10061970 | 3300027907 | Bacteria | 2958 |
| 470 | Ga0207428_10069209 | 3300027907 | Bacteria | 2775 |
| 471 | Ga0268266_10000832 | 3300028379 | Bacteria | 40381 |
| 472 | Ga0268266_10118531 | 3300028379 | Bacteria | 2353 |
| 473 | Ga0268265_10002919 | 3300028380 | Bacteria | 12534 |
| 474 | Ga0268265_10005917 | 3300028380 | Bacteria | 8329 |
| 475 | Ga0268265_10052875 | 3300028380 | Bacteria | 3074 |
| 476 | Ga0268265_10167423 | 3300028380 | Bacteria | 1874 |
| 477 | Ga0268264_10001202 | 3300028381 | Bacteria | 24970 |
| 478 | Ga0268264_10070437 | 3300028381 | Bacteria | 2960 |
| 479 | Ga0268264_10344177 | 3300028381 | Bacteria | 1417 |
| 480 | Ga0265338_10038132 | 3300028800 | Bacteria | 4558 |
| 481 | Ga0265760_10036800 | 3300031090 | Bacteria | 1452 |
| 482 | Ga0265330_10029512 | 3300031235 | Bacteria | 2466 |
| 483 | Ga0265320_10162888 | 3300031240 | Unclassified | 1004 |
| 484 | Ga0265325_10001243 | 3300031241 | Bacteria | 18175 |
| 485 | Ga0265339_10000091 | 3300031249 | Bacteria | 75937 |
| 486 | Ga0265339_10018360 | 3300031249 | Bacteria | 4123 |
| 487 | Ga0265339_10029357 | 3300031249 | Bacteria | 3120 |
| 488 | Ga0265316_10064489 | 3300031344 | Bacteria | 2838 |
| 489 | Ga0265316_10135806 | 3300031344 | Bacteria | 1850 |
| 490 | Ga0307513_10013540 | 3300031456 | Bacteria | 10004 |
| 491 | Ga0265313_10001068 | 3300031595 | Bacteria | 26548 |
| 492 | Ga0265313_10017130 | 3300031595 | Bacteria | 4133 |
| 493 | Ga0265313_10097002 | 3300031595 | Bacteria | 1314 |
| 494 | Ga0265314_10057584 | 3300031711 | Bacteria | 2667 |
| 495 | Ga0265314_10108459 | 3300031711 | Bacteria | 1769 |
| 496 | Ga0265342_10027560 | 3300031712 | Bacteria | 3548 |
| 497 | Ga0265342_10028347 | 3300031712 | Bacteria | 3490 |
| 498 | Ga0265342_10060407 | 3300031712 | Bacteria | 2235 |
| 499 | Ga0265342_10156548 | 3300031712 | Unclassified | 1262 |
| 500 | Ga0307413_10164418 | 3300031824 | Bacteria | 1563 |
| 501 | Ga0307410_10008367 | 3300031852 | Bacteria | 5732 |
| 502 | Ga0307409_100201662 | 3300031995 | Bacteria | 1780 |
| 503 | Ga0307416_100214981 | 3300032002 | Bacteria | 1838 |
| 504 | Ga0373930_0010920 | 3300034816 | Bacteria | 1631 |
| 505 | Ga0373948_0000934 | 3300034817 | Bacteria | 3911 |
| 506 | Ga0373950_0008932 | 3300034818 | Bacteria | 1588 |
| 507 | Ga0373958_0008311 | 3300034819 | Bacteria | 1678 |
| 508 | Ga0373959_0017794 | 3300034820 | Bacteria | 1330 |
| 509 | Ga0373938_0001605 | 3300034957 | Bacteria | 3640 |
| 510 | Ga0373938_0004290 | 3300034957 | Bacteria | 2374 |
| 511 | Ga0373926_0013724 | 3300035083 | Bacteria | 2750 |
| 512 | Ga0373929_0007035 | 3300035085 | Bacteria | 2047 |
| 513 | Ga0373934_0013975 | 3300035086 | Unclassified | 3039 |
| 514 | Ga0373940_0012918 | 3300035088 | Bacteria | 2009 |
| 515 | Ga0373940_0032676 | 3300035088 | Bacteria | 1396 |
| 516 | Ga0373944_0102245 | 3300035089 | Unclassified | 969 |
| 517 | Ga0373949_0001617 | 3300035090 | Bacteria | 6309 |
| 518 | Ga0373949_0008699 | 3300035090 | Unclassified | 2222 |
| 519 | Ga0373951_0000816 | 3300035091 | Bacteria | 8470 |
| 520 | Ga0373952_0000725 | 3300035092 | Bacteria | 5889 |
| 521 | Ga0373952_0012409 | 3300035092 | Bacteria | 1676 |
| 522 | Ga0373923_0031535 | 3300035111 | Bacteria | 2137 |
| 523 | Ga0373923_0036242 | 3300035111 | Bacteria | 2013 |
| 524 | Ga0373923_0063142 | 3300035111 | Unclassified | 1577 |
| 525 | Ga0373923_0065154 | 3300035111 | Bacteria | 1555 |
| 526 | Ga0373932_0002655 | 3300035112 | Bacteria | 4456 |
| 527 | Ga0373936_0067900 | 3300035113 | Unclassified | 1466 |
| 528 | Ga0373939_0002266 | 3300035114 | Bacteria | 4552 |
| 529 | Ga0373939_0011072 | 3300035114 | Unclassified | 2268 |
| 530 | Ga0373941_0000710 | 3300035115 | Bacteria | 6832 |
| 531 | Ga0373945_0054522 | 3300035116 | Bacteria | 1478 |
| 532 | Ga0373954_0029351 | 3300035118 | Unclassified | 2532 |
| 533 | Ga0373956_0101308 | 3300035119 | Bacteria | 1336 |
| 534 | Ga0373957_0048508 | 3300035120 | Bacteria | 1618 |
| 535 | Ga0373960_0000528 | 3300035121 | Bacteria | 7654 |
| 536 | Ga0373960_0001486 | 3300035121 | Bacteria | 5201 |
| 537 | Ga0373960_0080156 | 3300035121 | Bacteria | 1026 |
| 538 | Ga0373943_0004637 | 3300035170 | Bacteria | 6215 |
| 539 | Ga0373943_0031187 | 3300035170 | Unclassified | 2527 |
| 540 | Ga0373943_0053186 | 3300035170 | Bacteria | 1999 |
| 541 | Ga0373946_0011371 | 3300035171 | Bacteria | 3320 |
| 542 | Ga0373946_0082488 | 3300035171 | Bacteria | 1410 |
| 543 | Ga0373955_0009883 | 3300035172 | Bacteria | 4488 |
| 544 | Ga0373955_0022291 | 3300035172 | Bacteria | 3211 |
| 545 | Ga0373942_0003528 | 3300035207 | Bacteria | 3673 |
| 546 | Ga0373961_0012891 | 3300035241 | Bacteria | 2099 |
| 547 | Ga0373962_0000893 | 3300035242 | Bacteria | 6824 |
| 548 | Ga0373924_0002373 | 3300035410 | Bacteria | 6338 |
| 549 | Ga0373931_0016718 | 3300035691 | Bacteria | 3615 |
| 550 | Ga0373931_0065125 | 3300035691 | Bacteria | 1974 |
| 551 | Ga0373931_0072616 | 3300035691 | Unclassified | 1882 |
| 552 | Ga0373931_0191196 | 3300035691 | Unclassified | 1218 |
| 553 | Ga0373935_0037934 | 3300035692 | Unclassified | 3016 |
| 554 | Ga0373935_0099561 | 3300035692 | Bacteria | 1914 |
| 555 | Ga0373935_0208383 | 3300035692 | Unclassified | 1353 |
| 556 | Ga0373935_0422678 | 3300035692 | Unclassified | 959 |
| 557 | Ga0373927_0015422 | 3300035695 | Bacteria | 5050 |
| 558 | Ga0373927_0044216 | 3300035695 | Bacteria | 2882 |
| 559 | Ga0373927_0062284 | 3300035695 | Unclassified | 2412 |
| 560 | Ga0373927_0123840 | 3300035695 | Bacteria | 1687 |
| 561 | Ga0373927_0153377 | 3300035695 | Bacteria | 1508 |
| 562 | Ga0373933_0004840 | 3300035724 | Bacteria | 7356 |
| 563 | Ga0373933_0014329 | 3300035724 | Bacteria | 4409 |
| 564 | Ga0373933_0056092 | 3300035724 | Bacteria | 2364 |
| 565 | Ga0373933_0070402 | 3300035724 | Bacteria | 2128 |
| 566 | Ga0373947_0001934 | 3300035725 | Bacteria | 12684 |
| 567 | Ga0373947_0005748 | 3300035725 | Bacteria | 7231 |
| 568 | Ga0373947_0011643 | 3300035725 | Bacteria | 5044 |
| 569 | Ga0373947_0057024 | 3300035725 | Bacteria | 2362 |
| 570 | Ga0373937_0002583 | 3300036401 | Bacteria | 15057 |
| 571 | Ga0373937_0005204 | 3300036401 | Bacteria | 11104 |
| 572 | Ga0373937_0007138 | 3300036401 | Bacteria | 9654 |
| 573 | Ga0373937_0509815 | 3300036401 | Unclassified | 1143 |
| 574 | Ga0373937_0581488 | 3300036401 | Unclassified | 1063 |
| 575 | Ga0373925_0018031 | 3300037068 | Bacteria | 5127 |
| 576 | Ga0373925_0025873 | 3300037068 | Bacteria | 4290 |
| 577 | Ga0373925_0035442 | 3300037068 | Bacteria | 3681 |
| 578 | Ga0373925_0043734 | 3300037068 | Unclassified | 3325 |
| 579 | Ga0373925_0068198 | 3300037068 | Bacteria | 2684 |
| 580 | Ga0373925_0100873 | 3300037068 | Bacteria | 2219 |
| 581 | Ga0395899_0099652 | 3300037312 | Bacteria | 2099 |
| 582 | Ga0395899_0102330 | 3300037312 | Bacteria | 2067 |
| 583 | Ga0395899_0170745 | 3300037312 | Bacteria | 1531 |
| 584 | Ga0395900_0037499 | 3300037418 | Bacteria | 4997 |
| 585 | Ga0395900_0153873 | 3300037418 | Bacteria | 2349 |
| 586 | Ga0395898_0047892 | 3300037466 | Bacteria | 4192 |
| 587 | Ga0395898_0083593 | 3300037466 | Bacteria | 3077 |
| 588 | Ga0395898_0331420 | 3300037466 | Bacteria | 1451 |
| 589 | Ga0395905_0031832 | 3300037471 | Bacteria | 4963 |
| 590 | Ga0395905_0061486 | 3300037471 | Bacteria | 3513 |
| 591 | Ga0395905_0181965 | 3300037471 | Bacteria | 1973 |
| 592 | Ga0395905_0527274 | 3300037471 | Unclassified | 1082 |
| 593 | Ga0395901_0021682 | 3300038443 | Bacteria | 6582 |
| 594 | Ga0395901_0039197 | 3300038443 | Bacteria | 4903 |
| 595 | Ga0395901_0159622 | 3300038443 | Bacteria | 2368 |
| 596 | Ga0395901_0252021 | 3300038443 | Bacteria | 1839 |
| 597 | Ga0436365_0204940 | 3300039437 | Bacteria | 1017 |
| 598 | Ga0436365_0933878 | 3300039437 | Bacteria | 3053 |
| 599 | Ga0436365_0947958 | 3300039437 | Bacteria | 2217 |
| 600 | Ga0436361_0201393 | 3300039447 | Bacteria | 14498 |
| 601 | Ga0436361_0265181 | 3300039447 | Bacteria | 1019 |
| 602 | Ga0436361_0862585 | 3300039447 | Bacteria | 1608 |
| 603 | Ga0436361_0866592 | 3300039447 | Bacteria | 896 |
| 604 | Ga0436363_0460390 | 3300039450 | Bacteria | 6221 |
| 605 | Ga0436363_1308327 | 3300039450 | Bacteria | 2813 |
| 606 | Ga0450905_000421 | 3300042142 | Bacteria | 5172 |
| 607 | Ga0450889_000015 | 3300042144 | Bacteria | 15151 |
| 608 | Ga0439464_0039570 | 3300042439 | Unclassified | 1341 |
| 609 | Ga0451577_0113507 | 3300042876 | Bacteria | 2425 |
| 610 | Ga0451576_0000159 | 3300045051 | Bacteria | 171363 |
| 611 | Ga0495617_038603 | 3300046452 | Unclassified | 1597 |
| 612 | Ga0495592_0031388 | 3300046454 | Bacteria | 4015 |
| 613 | Ga0495603_0007068 | 3300046455 | Bacteria | 6734 |
| 614 | Ga0495603_0046367 | 3300046455 | Bacteria | 2590 |
| 615 | Ga0495590_0039865 | 3300046457 | Bacteria | 1639 |
| 616 | Ga0495629_0000140 | 3300046459 | Bacteria | 63496 |
| 617 | Ga0495629_0002843 | 3300046459 | Bacteria | 13232 |
| 618 | Ga0495629_0030081 | 3300046459 | Bacteria | 3850 |
| 619 | Ga0495629_0047991 | 3300046459 | Bacteria | 2994 |
| 620 | Ga0495641_0009773 | 3300046461 | Bacteria | 5659 |
| 621 | Ga0495651_0001969 | 3300046462 | Bacteria | 15901 |
| 622 | Ga0495651_0003550 | 3300046462 | Bacteria | 11959 |
| 623 | Ga0495653_0009210 | 3300046463 | Bacteria | 8076 |
| 624 | Ga0495653_0023662 | 3300046463 | Bacteria | 4958 |
| 625 | Ga0495580_0118134 | 3300046472 | Bacteria | 1841 |
| 626 | Ga0495580_0157080 | 3300046472 | Bacteria | 1575 |
| 627 | Ga0495580_0221222 | 3300046472 | Bacteria | 1301 |
| 628 | Ga0495582_0121208 | 3300046473 | Unclassified | 1473 |
| 629 | Ga0495639_0244386 | 3300046475 | Bacteria | 886 |
| 630 | Ga0495662_0021111 | 3300046476 | Bacteria | 3149 |
| 631 | Ga0495662_0037776 | 3300046476 | Bacteria | 2332 |
| 632 | Ga0495664_0001514 | 3300046477 | Bacteria | 12304 |
| 633 | Ga0495664_0062554 | 3300046477 | Bacteria | 2217 |
| 634 | Ga0495664_0095894 | 3300046477 | Bacteria | 1785 |
| 635 | Ga0495584_0013124 | 3300046491 | Bacteria | 4226 |
| 636 | Ga0495584_0077012 | 3300046491 | Bacteria | 1677 |
| 637 | Ga0495584_0120731 | 3300046491 | Archaea | 1327 |
| 638 | Ga0495584_0152354 | 3300046491 | Bacteria | 1174 |
| 639 | Ga0495585_0012013 | 3300046492 | Bacteria | 5110 |
| 640 | Ga0495585_0044457 | 3300046492 | Bacteria | 2481 |
| 641 | Ga0495594_0004885 | 3300046499 | Bacteria | 6901 |
| 642 | Ga0495594_0186120 | 3300046499 | Unclassified | 1182 |
| 643 | Ga0495594_0236898 | 3300046499 | Bacteria | 1040 |
| 644 | Ga0495606_0000252 | 3300046507 | Bacteria | 94511 |
| 645 | Ga0495608_0002947 | 3300046511 | Bacteria | 12168 |
| 646 | Ga0495608_0007807 | 3300046511 | Bacteria | 7528 |
| 647 | Ga0495618_0011920 | 3300046514 | Bacteria | 5276 |
| 648 | Ga0495618_0018939 | 3300046514 | Unclassified | 4229 |
| 649 | Ga0495618_0020553 | 3300046514 | Bacteria | 4064 |
| 650 | Ga0495618_0046181 | 3300046514 | Unclassified | 2748 |
| 651 | Ga0495620_0106045 | 3300046515 | Bacteria | 1117 |
| 652 | Ga0495628_0016676 | 3300046516 | Bacteria | 6125 |
| 653 | Ga0495628_0168694 | 3300046516 | Bacteria | 1660 |
| 654 | Ga0495630_0074980 | 3300046517 | Bacteria | 2549 |
| 655 | Ga0495630_0226282 | 3300046517 | Bacteria | 1428 |
| 656 | Ga0495630_0655881 | 3300046517 | Bacteria | 803 |
| 657 | Ga0495637_0081423 | 3300046520 | Unclassified | 1290 |
| 658 | Ga0495644_0009079 | 3300046523 | Bacteria | 3828 |
| 659 | Ga0495663_0020370 | 3300046525 | Bacteria | 1903 |
| 660 | Ga0495663_0070071 | 3300046525 | Bacteria | 1115 |
| 661 | Ga0495666_0065009 | 3300046526 | Bacteria | 1740 |
| 662 | Ga0495642_0062486 | 3300046528 | Bacteria | 1547 |
| 663 | Ga0495642_0145203 | 3300046528 | Bacteria | 1025 |
| 664 | Ga0495652_0007323 | 3300046529 | Bacteria | 10178 |
| 665 | Ga0495652_0020176 | 3300046529 | Bacteria | 5924 |
| 666 | Ga0495652_0248193 | 3300046529 | Unclassified | 1320 |
| 667 | Ga0495652_0444653 | 3300046529 | Unclassified | 909 |
| 668 | Ga0495665_0019725 | 3300046531 | Bacteria | 3626 |
| 669 | Ga0495665_0044130 | 3300046531 | Bacteria | 2370 |
| 670 | Ga0495665_0124079 | 3300046531 | Bacteria | 1352 |
| 671 | Ga0495640_0003070 | 3300046533 | Bacteria | 13446 |
| 672 | Ga0495640_0011331 | 3300046533 | Bacteria | 6865 |
| 673 | Ga0495640_0022000 | 3300046533 | Bacteria | 4669 |
| 674 | Ga0495640_0256887 | 3300046533 | Bacteria | 1092 |
| 675 | Ga0495586_0015904 | 3300046535 | Bacteria | 4003 |
| 676 | Ga0495587_0107035 | 3300046536 | Unclassified | 1608 |
| 677 | Ga0495645_0008448 | 3300046543 | Bacteria | 7193 |
| 678 | Ga0495645_0243125 | 3300046543 | Bacteria | 1200 |
| 679 | Ga0495622_0007036 | 3300046557 | Bacteria | 5223 |
| 680 | Ga0495622_0115247 | 3300046557 | Bacteria | 1229 |
| 681 | Ga0495633_0028229 | 3300046558 | Bacteria | 2737 |
| 682 | Ga0495667_0000936 | 3300046559 | Bacteria | 18847 |
| 683 | Ga0495667_0007174 | 3300046559 | Bacteria | 7562 |
| 684 | Ga0495667_0052243 | 3300046559 | Unclassified | 2693 |
| 685 | Ga0495667_0079051 | 3300046559 | Bacteria | 2138 |
| 686 | Ga0495656_0001649 | 3300046615 | Bacteria | 7304 |
| 687 | Ga0495668_0107403 | 3300046616 | Bacteria | 1526 |
| 688 | Ga0495634_0006588 | 3300046642 | Bacteria | 8808 |
| 689 | Ga0495634_0049795 | 3300046642 | Bacteria | 2815 |
| 690 | Ga0495634_0137246 | 3300046642 | Bacteria | 1555 |
| 691 | Ga0495634_0289166 | 3300046642 | Unclassified | 993 |
| 692 | Ga0495611_0092957 | 3300046648 | Bacteria | 1395 |
| 693 | Ga0495625_0081142 | 3300046660 | Bacteria | 2258 |
| 694 | Ga0495635_0000803 | 3300046663 | Bacteria | 20530 |
| 695 | Ga0495635_0010366 | 3300046663 | Bacteria | 6518 |
| 696 | Ga0495635_0010910 | 3300046663 | Bacteria | 6370 |
| 697 | Ga0495635_0023545 | 3300046663 | Bacteria | 4289 |
| 698 | Ga0495635_0204552 | 3300046663 | Bacteria | 1338 |
| 699 | Ga0495659_0004853 | 3300046664 | Unclassified | 4232 |
| 700 | Ga0495659_0058045 | 3300046664 | Bacteria | 1423 |
| 701 | Ga0495657_0008655 | 3300046675 | Bacteria | 7765 |
| 702 | Ga0495657_0013677 | 3300046675 | Bacteria | 5978 |
| 703 | Ga0495599_0009856 | 3300046678 | Bacteria | 5849 |
| 704 | Ga0495623_0004153 | 3300046679 | Bacteria | 9551 |
| 705 | Ga0495623_0104284 | 3300046679 | Bacteria | 1724 |
| 706 | Ga0495646_0011637 | 3300046680 | Bacteria | 5590 |
| 707 | Ga0495646_0015003 | 3300046680 | Bacteria | 4922 |
| 708 | Ga0495647_0001772 | 3300046681 | Bacteria | 6694 |
| 709 | Ga0495647_0100883 | 3300046681 | Unclassified | 1195 |
| 710 | Ga0495658_0001441 | 3300046683 | Bacteria | 12509 |
| 711 | Ga0495658_0019035 | 3300046683 | Bacteria | 3579 |
| 712 | Ga0495658_0021917 | 3300046683 | Bacteria | 3373 |
| 713 | Ga0495658_0175856 | 3300046683 | Bacteria | 1326 |
| 714 | Ga0495669_0007930 | 3300046684 | Bacteria | 4457 |
| 715 | Ga0495613_0032219 | 3300046689 | Unclassified | 3892 |
| 716 | Ga0495613_0053690 | 3300046689 | Bacteria | 2964 |
| 717 | Ga0495613_0112177 | 3300046689 | Bacteria | 1964 |
| 718 | Ga0495613_0224577 | 3300046689 | Bacteria | 1317 |
| 719 | Ga0495624_0004977 | 3300046690 | Bacteria | 9627 |
| 720 | Ga0495624_0041472 | 3300046690 | Bacteria | 2943 |
| 721 | Ga0495624_0071665 | 3300046690 | Bacteria | 2156 |
| 722 | Ga0495670_0044171 | 3300046691 | Bacteria | 2224 |
| 723 | Ga0495670_0088786 | 3300046691 | Archaea | 1580 |
| 724 | Ga0495649_0005354 | 3300046694 | Bacteria | 8185 |
| 725 | Ga0495589_0025192 | 3300046794 | Bacteria | 3020 |
| 726 | Ga0495589_0139408 | 3300046794 | Bacteria | 1162 |
| 727 | Ga0495600_0012802 | 3300046809 | Bacteria | 5254 |
| 728 | Ga0495581_0011677 | 3300047315 | Bacteria | 5083 |
| 729 | Ga0495581_0033129 | 3300047315 | Unclassified | 2992 |
| 730 | Ga0495581_0167927 | 3300047315 | Bacteria | 1283 |
| 731 | Ga0495604_0001803 | 3300047317 | Bacteria | 17442 |
| 732 | Ga0495604_0007398 | 3300047317 | Bacteria | 8702 |
| 733 | Ga0495604_0122120 | 3300047317 | Unclassified | 1884 |
| 734 | Ga0495636_0164204 | 3300047318 | Bacteria | 1002 |
| 735 | Ga0495674_0005466 | 3300047319 | Bacteria | 12206 |
| 736 | Ga0495674_0010028 | 3300047319 | Bacteria | 8979 |
| 737 | Ga0495674_0014669 | 3300047319 | Bacteria | 7331 |
| 738 | Ga0495674_0017525 | 3300047319 | Bacteria | 6666 |
| 739 | Ga0495674_0029644 | 3300047319 | Bacteria | 4980 |
| 740 | Ga0495674_0180017 | 3300047319 | Unclassified | 1761 |
| 741 | Ga0495676_0050527 | 3300047321 | Bacteria | 3334 |
| 742 | Ga0495676_0280443 | 3300047321 | Bacteria | 1128 |
| 743 | Ga0495676_0306672 | 3300047321 | Bacteria | 1069 |
| 744 | Ga0495676_0356632 | 3300047321 | Bacteria | 977 |
| 745 | Ga0495680_0006822 | 3300047322 | Bacteria | 10546 |
| 746 | Ga0495680_0014641 | 3300047322 | Bacteria | 6784 |
| 747 | Ga0495680_0123956 | 3300047322 | Bacteria | 1905 |
| 748 | Ga0495675_0023294 | 3300047444 | Bacteria | 3945 |
| 749 | Ga0495679_018305 | 3300047446 | Bacteria | 2489 |
| 750 | Ga0495684_0007012 | 3300047471 | Bacteria | 8752 |
| 751 | Ga0495684_0008246 | 3300047471 | Bacteria | 8065 |
| 752 | Ga0495684_0008574 | 3300047471 | Bacteria | 7915 |
| 753 | Ga0495684_0236077 | 3300047471 | Bacteria | 1335 |
| 754 | Ga0495686_0070290 | 3300047472 | Bacteria | 2157 |
| 755 | Ga0495593_0013260 | 3300047673 | Bacteria | 4705 |
| 756 | Ga0495593_0016502 | 3300047673 | Bacteria | 4164 |
| 757 | Ga0495593_0046567 | 3300047673 | Bacteria | 2310 |
| 758 | Ga0495602_0003594 | 3300048088 | Bacteria | 16058 |
| 759 | Ga0495602_0038382 | 3300048088 | Bacteria | 4428 |
| 760 | Ga0495602_0226321 | 3300048088 | Bacteria | 1408 |
| 761 | Ga0495615_0027225 | 3300048090 | Unclassified | 1340 |
| 762 | Ga0495626_0093157 | 3300048091 | Unclassified | 1323 |
| 763 | Ga0496100_0013352 | 3300048903 | Bacteria | 4735 |
| 764 | Ga0496100_0045666 | 3300048903 | Bacteria | 2812 |
| 765 | Ga0496100_0050754 | 3300048903 | Bacteria | 2689 |
| 766 | Ga0496100_0051881 | 3300048903 | Bacteria | 2664 |
| 767 | Ga0496100_0195655 | 3300048903 | Bacteria | 1470 |
| 768 | Ga0496100_0220772 | 3300048903 | Bacteria | 1391 |
| 769 | Ga0496100_0307207 | 3300048903 | Bacteria | 1188 |
| 770 | Ga0496101_0024236 | 3300048904 | Bacteria | 4197 |
| 771 | Ga0496101_0071673 | 3300048904 | Bacteria | 2540 |
| 772 | Ga0496101_0111412 | 3300048904 | Unclassified | 2060 |
| 773 | Ga0496102_0016598 | 3300048905 | Bacteria | 6437 |
| 774 | Ga0496102_0020964 | 3300048905 | Bacteria | 5779 |
| 775 | Ga0496102_0029331 | 3300048905 | Bacteria | 4923 |
| 776 | Ga0496102_0177184 | 3300048905 | Bacteria | 2008 |
| 777 | Ga0496102_0362042 | 3300048905 | Bacteria | 1366 |
| 778 | Ga0496103_0005145 | 3300048906 | Bacteria | 7872 |
| 779 | Ga0496103_0023092 | 3300048906 | Unclassified | 3749 |
| 780 | Ga0496103_0035005 | 3300048906 | Bacteria | 3073 |
| 781 | Ga0496103_0066782 | 3300048906 | Bacteria | 2245 |
| 782 | Ga0496103_0086307 | 3300048906 | Bacteria | 1978 |
| 783 | Ga0496103_0106122 | 3300048906 | Bacteria | 1781 |
| 784 | Ga0496104_0001024 | 3300048907 | Bacteria | 23928 |
| 785 | Ga0496104_0017158 | 3300048907 | Bacteria | 6585 |
| 786 | Ga0496104_0038358 | 3300048907 | Bacteria | 4482 |
| 787 | Ga0496104_0100386 | 3300048907 | Bacteria | 2770 |
| 788 | Ga0496104_0103201 | 3300048907 | Bacteria | 2732 |
| 789 | Ga0496104_0198467 | 3300048907 | Bacteria | 1918 |
| 790 | Ga0496104_0241051 | 3300048907 | Bacteria | 1720 |
| 791 | Ga0496105_0004939 | 3300048908 | Bacteria | 10082 |
| 792 | Ga0496105_0044353 | 3300048908 | Unclassified | 3667 |
| 793 | Ga0496105_0057598 | 3300048908 | Bacteria | 3208 |
| 794 | Ga0496105_0067781 | 3300048908 | Bacteria | 2947 |
| 795 | Ga0496105_0072206 | 3300048908 | Bacteria | 2852 |
| 796 | Ga0496105_0091432 | 3300048908 | Bacteria | 2513 |
| 797 | Ga0496105_0377511 | 3300048908 | Unclassified | 1128 |
| 798 | Ga0496106_0009502 | 3300048909 | Bacteria | 7185 |
| 799 | Ga0496106_0020443 | 3300048909 | Bacteria | 4912 |
| 800 | Ga0496106_0029158 | 3300048909 | Unclassified | 4111 |
| 801 | Ga0496106_0054915 | 3300048909 | Bacteria | 3010 |
| 802 | Ga0496106_0178532 | 3300048909 | Bacteria | 1685 |
| 803 | Ga0496106_0186010 | 3300048909 | Bacteria | 1650 |
| 804 | Ga0496106_0227121 | 3300048909 | Bacteria | 1490 |
| 805 | Ga0496106_0353995 | 3300048909 | Bacteria | 1179 |
| 806 | Ga0496106_0596748 | 3300048909 | Unclassified | 884 |
| 807 | Ga0496107_0012082 | 3300048910 | Bacteria | 6021 |
| 808 | Ga0496107_0048939 | 3300048910 | Bacteria | 3046 |
| 809 | Ga0496107_0099472 | 3300048910 | Bacteria | 2131 |
| 810 | Ga0496107_0277241 | 3300048910 | Bacteria | 1248 |
| 811 | Ga0496108_0016733 | 3300048911 | Bacteria | 5990 |
| 812 | Ga0496108_0050498 | 3300048911 | Bacteria | 3482 |
| 813 | Ga0496108_0051252 | 3300048911 | Bacteria | 3457 |
| 814 | Ga0496108_0060107 | 3300048911 | Bacteria | 3197 |
| 815 | Ga0496108_0364456 | 3300048911 | Unclassified | 1261 |
| 816 | Ga0496109_0018181 | 3300048912 | Bacteria | 6172 |
| 817 | Ga0496109_0018404 | 3300048912 | Bacteria | 6137 |
| 818 | Ga0496109_0036648 | 3300048912 | Bacteria | 4427 |
| 819 | Ga0496109_0190717 | 3300048912 | Bacteria | 1926 |
| 820 | Ga0496109_0192897 | 3300048912 | Bacteria | 1914 |
| 821 | Ga0496109_0391774 | 3300048912 | Bacteria | 1313 |
| 822 | Ga0496109_0528156 | 3300048912 | Unclassified | 1113 |
| 823 | Ga0496110_0020286 | 3300048913 | Bacteria | 5612 |
| 824 | Ga0496111_0024263 | 3300048914 | Bacteria | 4268 |
| 825 | Ga0496111_0205156 | 3300048914 | Unclassified | 1465 |
| 826 | Ga0496111_0302191 | 3300048914 | Unclassified | 1186 |
| 827 | Ga0496111_0320355 | 3300048914 | Unclassified | 1148 |
| 828 | Ga0496111_0345451 | 3300048914 | Unclassified | 1102 |
| 829 | Ga0496112_0000020 | 3300048915 | Bacteria | 169373 |
| 830 | Ga0496112_0058612 | 3300048915 | Bacteria | 3792 |
| 831 | Ga0496112_0069748 | 3300048915 | Bacteria | 3472 |
| 832 | Ga0496112_0177036 | 3300048915 | Bacteria | 2097 |
| 833 | Ga0496112_0222279 | 3300048915 | Unclassified | 1844 |
| 834 | Ga0496112_0250452 | 3300048915 | Bacteria | 1722 |
| 835 | Ga0496113_0044500 | 3300048916 | Bacteria | 3289 |
| 836 | Ga0496113_0110618 | 3300048916 | Bacteria | 2138 |
| 837 | Ga0496113_0140539 | 3300048916 | Bacteria | 1899 |
| 838 | Ga0496114_0004331 | 3300048917 | Bacteria | 10991 |
| 839 | Ga0496114_0068905 | 3300048917 | Bacteria | 2970 |
| 840 | Ga0496114_0263638 | 3300048917 | Unclassified | 1517 |
| 841 | Ga0496115_0014383 | 3300048918 | Bacteria | 5991 |
| 842 | Ga0496115_0023267 | 3300048918 | Bacteria | 4807 |
| 843 | Ga0496115_0099823 | 3300048918 | Bacteria | 2379 |
| 844 | Ga0496115_0135587 | 3300048918 | Bacteria | 2030 |
| 845 | Ga0496115_0318565 | 3300048918 | Bacteria | 1272 |
| 846 | Ga0501299_026121 | 3300049522 | Bacteria | 1101 |
| 847 | Ga0501034_0007786 | 3300049571 | Bacteria | 11398 |
| 848 | Ga0501034_0082784 | 3300049571 | Bacteria | 3211 |
| 849 | Ga0501034_0137132 | 3300049571 | Bacteria | 2427 |
| 850 | Ga0501036_0050044 | 3300049572 | Bacteria | 3539 |
| 851 | Ga0501038_0082959 | 3300049574 | Bacteria | 2698 |
| 852 | Ga0501043_0009861 | 3300049579 | Bacteria | 7488 |
| 853 | Ga0501047_0004174 | 3300049581 | Bacteria | 13597 |
| 854 | Ga0501047_0029576 | 3300049581 | Bacteria | 5282 |
| 855 | Ga0501067_0000100 | 3300049583 | Bacteria | 49264 |
| 856 | Ga0501067_0002755 | 3300049583 | Bacteria | 9669 |
| 857 | Ga0501068_0077298 | 3300049584 | Bacteria | 2038 |
| 858 | Ga0501073_0000010 | 3300049589 | Bacteria | 171144 |
| 859 | Ga0501076_0248465 | 3300049592 | Bacteria | 1455 |
| 860 | Ga0501077_0026616 | 3300049593 | Bacteria | 3670 |
| 861 | Ga0501077_0186240 | 3300049593 | Bacteria | 1319 |
| 862 | Ga0501257_000006 | 3300049686 | Bacteria | 57368 |
| 863 | Ga0501080_0003502 | 3300049742 | Bacteria | 13821 |
| 864 | Ga0501080_0004643 | 3300049742 | Bacteria | 12246 |
| 865 | Ga0501083_0013011 | 3300049744 | Bacteria | 5815 |
| 866 | Ga0501280_002743 | 3300049776 | Bacteria | 2855 |
| 867 | Ga0501035_0035770 | 3300049822 | Bacteria | 4506 |
| 868 | Ga0501044_0004511 | 3300049823 | Bacteria | 15569 |
| 869 | Ga0501044_0013701 | 3300049823 | Bacteria | 8764 |
| 870 | nmdc:mga05p37_1239_c1 | 3300050507 | Bacteria | 29626 |
| 871 | nmdc:mga05p37_3181_c1 | 3300050507 | Bacteria | 19102 |
| 872 | nmdc:mga05p37_487794_c1 | 3300050507 | Bacteria | 1417 |
| 873 | nmdc:mga05p37_7041_c1 | 3300050507 | Bacteria | 13256 |
| 874 | nmdc:mga09592_10200_c1 | 3300050508 | Bacteria | 7646 |
| 875 | nmdc:mga09592_431648_c1 | 3300050508 | Bacteria | 1137 |
| 876 | nmdc:mga0qj67_189804_c1 | 3300050509 | Bacteria | 1670 |
| 877 | nmdc:mga0qj67_23_c1 | 3300050509 | Bacteria | 107313 |
| 878 | nmdc:mga0qj67_2544_c1 | 3300050509 | Bacteria | 13035 |
| 879 | nmdc:mga06r32_3795_c1 | 3300050510 | Bacteria | 13525 |
| 880 | nmdc:mga06r32_571_c1 | 3300050510 | Bacteria | 32046 |
| 881 | nmdc:mga08y16_11920_c1 | 3300050511 | Bacteria | 9132 |
| 882 | nmdc:mga08y16_122211_c1 | 3300050511 | Bacteria | 2709 |
| 883 | nmdc:mga08y16_204_c3 | 3300050511 | Bacteria | 8325 |
| 884 | nmdc:mga08y16_23259_c1 | 3300050511 | Bacteria | 6543 |
| 885 | nmdc:mga08y16_8805_c1 | 3300050511 | Bacteria | 10591 |
| 886 | nmdc:mga0n895_181261_c1 | 3300050512 | Bacteria | 2138 |
| 887 | nmdc:mga0n895_236005_c1 | 3300050512 | Bacteria | 1856 |
| 888 | nmdc:mga0n895_280745_c1 | 3300050512 | Unclassified | 1689 |
| 889 | nmdc:mga0n895_39393_c1 | 3300050512 | Bacteria | 4585 |
| 890 | nmdc:mga0n895_62981_c1 | 3300050512 | Bacteria | 3667 |
| 891 | nmdc:mga0n895_72345_c1 | 3300050512 | Bacteria | 3420 |
| 892 | nmdc:mga0n895_83692_c1 | 3300050512 | Bacteria | 3183 |
| 893 | nmdc:mga0rr50_1652_c1 | 3300050513 | Bacteria | 12298 |
| 894 | nmdc:mga0rr50_168331_c1 | 3300050513 | Unclassified | 1784 |
| 895 | nmdc:mga0rr50_218278_c1 | 3300050513 | Bacteria | 1574 |
| 896 | nmdc:mga0rr50_22311_c1 | 3300050513 | Bacteria | 4342 |
| 897 | nmdc:mga0rr50_245259_c1 | 3300050513 | Bacteria | 1486 |
| 898 | nmdc:mga0rr50_33461_c1 | 3300050513 | Bacteria | 3672 |
| 899 | nmdc:mga08x19_156645_c1 | 3300050514 | Bacteria | 1545 |
| 900 | nmdc:mga08x19_226485_c1 | 3300050514 | Bacteria | 1286 |
| 901 | nmdc:mga0a205_1982_c1 | 3300050515 | Bacteria | 17840 |
| 902 | nmdc:mga0a205_58841_c1 | 3300050515 | Bacteria | 3712 |
| 903 | nmdc:mga0a205_61577_c1 | 3300050515 | Bacteria | 3625 |
| 904 | Ga0495601_0001168 | 3300053077 | Bacteria | 14367 |
| 905 | Ga0495601_0014239 | 3300053077 | Bacteria | 4791 |
| 906 | Ga0495601_0018872 | 3300053077 | Bacteria | 4201 |
| 907 | Ga0495601_0036049 | 3300053077 | Bacteria | 3088 |
| 908 | Ga0495601_0155634 | 3300053077 | Unclassified | 1492 |
| 909 | Ga0495601_0245059 | 3300053077 | Bacteria | 1170 |
| 910 | Ga0495612_0002956 | 3300053078 | Bacteria | 7053 |
| 911 | Ga0495612_0004722 | 3300053078 | Bacteria | 5641 |
| 912 | Ga0495612_0008814 | 3300053078 | Bacteria | 4088 |
| 913 | Ga0495612_0022742 | 3300053078 | Unclassified | 2512 |
| 914 | Ga0495595_0003369 | 3300053084 | Bacteria | 6343 |
| 915 | Ga0495595_0003462 | 3300053084 | Bacteria | 6263 |
| 916 | Ga0495595_0004314 | 3300053084 | Bacteria | 5721 |
| 917 | Ga0495595_0005583 | 3300053084 | Bacteria | 5092 |
| 918 | Ga0495595_0064165 | 3300053084 | Unclassified | 1726 |
| 919 | Ga0495619_0000108 | 3300053085 | Bacteria | 62197 |
| 920 | Ga0495619_0002250 | 3300053085 | Bacteria | 12774 |
| 921 | Ga0495619_0004216 | 3300053085 | Bacteria | 9170 |
| 922 | Ga0495619_0006397 | 3300053085 | Bacteria | 7463 |
| 923 | Ga0495619_0009826 | 3300053085 | Bacteria | 6031 |
| 924 | Ga0495619_0023395 | 3300053085 | Unclassified | 3961 |
| 925 | Ga0495619_0044134 | 3300053085 | Plasmid | 2925 |
| 926 | Ga0495619_0152966 | 3300053085 | Bacteria | 1591 |
| 927 | Ga0495619_0384767 | 3300053085 | Bacteria | 969 |
| 928 | Ga0500643_000419 | 3300053087 | Bacteria | 32299 |
| 929 | Ga0500595_017797 | 3300053119 | Bacteria | 2614 |
| 930 | Ga0500658_0000232 | 3300053134 | Bacteria | 26163 |
| 931 | Ga0500624_000075 | 3300053157 | Bacteria | 56822 |
| 932 | Ga0500636_0221051 | 3300053177 | Bacteria | 987 |
| 933 | Ga0500637_0000049 | 3300053178 | Bacteria | 43426 |
| 934 | Ga0501084_0035032 | 3300054114 | Bacteria | 4197 |
| 935 | Ga0501082_0044497 | 3300060353 | Bacteria | 3829 |
| 936 | Ga0070702_100053841 | |||
| 937 | JGI24032J14994_100084 | |||
| 938 | JGI24741J21665_1005888 | |||
| 939 | JGI24752J21851_1001192 | |||
| 940 | JGI24752J21851_1006891 | |||
| 941 | JGI24746J21847_1000561 | |||
| 942 | JGI24747J21853_1001109 | |||
| 943 | JGI24740J21852_10041133 | |||
| 944 | JGI24739J22299_10003310 | |||
| 945 | JGI24737J22298_10002636 | |||
| 946 | JGI24743J22301_10001496 | |||
| 947 | JGI24750J21931_1000486 | |||
| 948 | JGI24745J21846_1000039 | |||
| 949 | JGI24748J21848_1000823 | |||
| 950 | JGI24738J21930_10000730 | |||
| 951 | JGI24749J21850_1000343 | |||
| 952 | JGI24744J21845_10005872 | |||
| 953 | JGI24035J26624_1000058 | |||
| 954 | JGI24034J26672_10001627 | |||
| 955 | JGI24742J22300_10000198 | |||
| 956 | JGI24751J29686_10000813 | |||
| 957 | JGI25405J52794_10024537 | |||
| 958 | Ga0065712_10071767 | |||
| 959 | Ga0065715_10089090 | |||
| 960 | Ga0065707_10093537 | |||
| 961 | Ga0070676_10003608 | |||
| 962 | Ga0070683_100000585 | |||
| 963 | Ga0070690_100002968 | |||
| 964 | Ga0070670_100019485 | |||
| 965 | Ga0070677_10000046 | |||
| 966 | Ga0068869_100018348 | |||
| 967 | Ga0068869_100044707 | |||
| 968 | Ga0068869_100119476 | |||
| 969 | Ga0070666_10012900 | |||
| 970 | Ga0070666_10191364 | |||
| 971 | Ga0070680_100038291 | |||
| 972 | Ga0070682_100011129 | |||
| 973 | Ga0068868_100004852 | |||
| 974 | Ga0068868_100014135 | |||
| 975 | Ga0068868_100626183 | |||
| 976 | Ga0070660_100016729 | |||
| 977 | Ga0070660_100143674 | |||
| 978 | Ga0070689_100013338 | |||
| 979 | Ga0070689_100053130 | |||
| 980 | Ga0070691_10005832 | |||
| 981 | Ga0070687_100007741 | |||
| 982 | Ga0070687_100058976 | |||
| 983 | Ga0070661_100011022 | |||
| 984 | Ga0070661_100072801 | |||
| 985 | Ga0070661_100132055 | |||
| 986 | Ga0070692_10000631 | |||
| 987 | Ga0070668_100027612 | |||
| 988 | Ga0070668_100087196 | |||
| 989 | Ga0070668_100093787 | |||
| 990 | Ga0070669_100014919 | |||
| 991 | Ga0070669_100015243 | |||
| 992 | Ga0070669_100134364 | |||
| 993 | Ga0070675_100017649 | |||
| 994 | Ga0070671_100003717 | |||
| 995 | Ga0070671_100005631 | |||
| 996 | Ga0070671_100014351 | |||
| 997 | Ga0070671_100014919 | |||
| 998 | Ga0070674_100010047 | |||
| 999 | Ga0070674_100133491 | |||
| 1000 | Ga0070674_100231723 | |||
| 1001 | Ga0070673_100017883 | |||
| 1002 | Ga0070673_100024844 | |||
| 1003 | Ga0070673_100186262 | |||
| 1004 | Ga0070673_100249808 | |||
| 1005 | Ga0070673_100420164 | |||
| 1006 | Ga0070673_100629212 | |||
| 1007 | Ga0070688_100005511 | |||
| 1008 | Ga0070688_100098479 | |||
| 1009 | Ga0070659_100016762 | |||
| 1010 | Ga0070659_100131107 | |||
| 1011 | Ga0070667_100013764 | |||
| 1012 | Ga0070667_100070171 | |||
| 1013 | Ga0070703_10012402 | |||
| 1014 | Ga0070709_10078709 | |||
| 1015 | Ga0070709_10388138 | |||
| 1016 | Ga0070714_100027998 | |||
| 1017 | Ga0070714_100110010 | |||
| 1018 | Ga0070714_100124643 | |||
| 1019 | Ga0070713_100168029 | |||
| 1020 | Ga0070713_100209598 | |||
| 1021 | Ga0070713_100396162 | |||
| 1022 | Ga0070710_10008064 | |||
| 1023 | Ga0070710_10019971 | |||
| 1024 | Ga0070701_10000116 | |||
| 1025 | Ga0070711_100016945 | |||
| 1026 | Ga0070711_100026760 | |||
| 1027 | Ga0070711_100069259 | |||
| 1028 | Ga0070705_100011033 | |||
| 1029 | Ga0070700_100001202 | |||
| 1030 | Ga0070700_100015702 | |||
| 1031 | Ga0070694_100001057 | |||
| 1032 | Ga0070708_100035671 | |||
| 1033 | Ga0070663_100018435 | |||
| 1034 | Ga0070663_100183797 | |||
| 1035 | Ga0070678_100004906 | |||
| 1036 | Ga0070678_100011782 | |||
| 1037 | Ga0070678_100069580 | |||
| 1038 | Ga0070662_100017132 | |||
| 1039 | Ga0070681_10027863 | |||
| 1040 | Ga0070681_10107353 | |||
| 1041 | Ga0068867_100000619 | |||
| 1042 | Ga0070685_10021655 | |||
| 1043 | Ga0070685_10169401 | |||
| 1044 | Ga0070679_100035946 | |||
| 1045 | Ga0070679_100428136 | |||
| 1046 | Ga0070684_100011691 | |||
| 1047 | Ga0070684_100033921 | |||
| 1048 | Ga0070684_100171844 | |||
| 1049 | Ga0068853_100004569 | |||
| 1050 | Ga0068853_100145190 | |||
| 1051 | Ga0068853_100412258 | |||
| 1052 | Ga0068853_100460587 | |||
| 1053 | Ga0070672_100000875 | |||
| 1054 | Ga0070672_100036512 | |||
| 1055 | Ga0070672_100089246 | |||
| 1056 | Ga0070672_100185890 | |||
| 1057 | Ga0070686_100000923 | |||
| 1058 | Ga0070686_100026854 | |||
| 1059 | Ga0070686_100059944 | |||
| 1060 | Ga0070686_100082785 | |||
| 1061 | Ga0070695_100000960 | |||
| 1062 | Ga0070695_100149014 | |||
| 1063 | Ga0070696_100010637 | |||
| 1064 | Ga0070696_100015013 | |||
| 1065 | Ga0070696_100110528 | |||
| 1066 | Ga0070665_100008168 | |||
| 1067 | Ga0070665_100119963 | |||
| 1068 | Ga0070704_100015740 | |||
| 1069 | Ga0068855_100057904 | |||
| 1070 | Ga0070664_100008796 | |||
| 1071 | Ga0070664_100011917 | |||
| 1072 | Ga0070664_100094572 | |||
| 1073 | Ga0070664_100099610 | |||
| 1074 | Ga0070664_100235984 | |||
| 1075 | Ga0070664_100416869 | |||
| 1076 | Ga0068857_100007206 | |||
| 1077 | Ga0068857_100359926 | |||
| 1078 | Ga0068857_100504131 | |||
| 1079 | Ga0068854_100003201 | |||
| 1080 | Ga0068854_100019078 | |||
| 1081 | Ga0068854_100045715 | |||
| 1082 | Ga0068856_100044263 | |||
| 1083 | Ga0068856_100092282 | |||
| 1084 | Ga0068856_100206495 | |||
| 1085 | Ga0068856_100224931 | |||
| 1086 | Ga0070702_100003539 | |||
| 1087 | Ga0070702_100068498 | |||
| 1088 | Ga0070702_100105591 | |||
| 1089 | Ga0068852_100026464 | |||
| 1090 | Ga0068852_100040689 | |||
| 1091 | Ga0068859_100000323 | |||
| 1092 | Ga0068859_100014029 | |||
| 1093 | Ga0068864_100000501 | |||
| 1094 | Ga0068864_100002687 | |||
| 1095 | Ga0068864_100157366 | |||
| 1096 | Ga0068864_100174037 | |||
| 1097 | Ga0068866_10001605 | |||
| 1098 | Ga0068861_100005083 | |||
| 1099 | Ga0068870_10000104 | |||
| 1100 | Ga0068863_100002181 | |||
| 1101 | Ga0068863_100012118 | |||
| 1102 | Ga0068863_100030102 | |||
| 1103 | Ga0068858_100002458 | |||
| 1104 | Ga0068858_100009333 | |||
| 1105 | Ga0068860_100029756 | |||
| 1106 | Ga0068860_100087246 | |||
| 1107 | Ga0068860_100256322 | |||
| 1108 | Ga0068860_100366894 | |||
| 1109 | Ga0068862_100017639 | |||
| 1110 | Ga0068862_100020470 | |||
| 1111 | Ga0068862_100029753 | |||
| 1112 | Ga0068862_100224551 | |||
| 1113 | Ga0068862_100588683 | |||
| 1114 | Ga0081455_10001425 | |||
| 1115 | Ga0081455_10005674 | |||
| 1116 | Ga0081455_10034020 | |||
| 1117 | Ga0081455_10045447 | |||
| 1118 | Ga0081455_10049231 | |||
| 1119 | Ga0081538_10122488 | |||
| 1120 | Ga0081540_1000086 | |||
| 1121 | Ga0081540_1013162 | |||
| 1122 | Ga0081540_1017462 | |||
| 1123 | Ga0081539_10000064 | |||
| 1124 | Ga0070717_10028620 | |||
| 1125 | Ga0070717_10204499 | |||
| 1126 | Ga0075365_10053618 | |||
| 1127 | Ga0070715_10007523 | |||
| 1128 | Ga0070715_10007548 | |||
| 1129 | Ga0070716_100045030 | |||
| 1130 | Ga0070712_100000903 | |||
| 1131 | Ga0070712_100001246 | |||
| 1132 | Ga0070712_100014800 | |||
| 1133 | Ga0070712_100036996 | |||
| 1134 | Ga0070712_100105178 | |||
| 1135 | Ga0070712_100229508 | |||
| 1136 | Ga0075367_10046625 | |||
| 1137 | Ga0097621_100008529 | |||
| 1138 | Ga0068871_100000485 | |||
| 1139 | Ga0068871_100104376 | |||
| 1140 | Ga0068871_100325046 | |||
| 1141 | Ga0075428_100019515 | |||
| 1142 | Ga0075428_100055252 | |||
| 1143 | Ga0075428_100213853 | |||
| 1144 | Ga0075430_100000164 | |||
| 1145 | Ga0075430_100002416 | |||
| 1146 | Ga0075430_100030141 | |||
| 1147 | Ga0075430_100501158 | |||
| 1148 | Ga0075431_100000986 | |||
| 1149 | Ga0075431_100042134 | |||
| 1150 | Ga0075433_10001944 | |||
| 1151 | Ga0075433_10010489 | |||
| 1152 | Ga0075434_100004417 | |||
| 1153 | Ga0075434_100030711 | |||
| 1154 | Ga0075434_100255023 | |||
| 1155 | Ga0075429_100016531 | |||
| 1156 | Ga0075429_100443136 | |||
| 1157 | Ga0068865_100001815 | |||
| 1158 | Ga0068865_100241434 | |||
| 1159 | Ga0097620_100000323 | |||
| 1160 | Ga0097620_100014029 | |||
| 1161 | Ga0075435_100023740 | |||
| 1162 | Ga0075435_100072290 | |||
| 1163 | Ga0075435_100141920 | |||
| 1164 | Ga0075435_100236147 | |||
| 1165 | Ga0105250_10004482 | |||
| 1166 | Ga0105240_10125942 | |||
| 1167 | Ga0111539_10000930 | |||
| 1168 | Ga0111539_10002680 | |||
| 1169 | Ga0111539_10004845 | |||
| 1170 | Ga0111539_10007277 | |||
| 1171 | Ga0111539_10053440 | |||
| 1172 | Ga0111539_10264825 | |||
| 1173 | Ga0105245_10001701 | |||
| 1174 | Ga0105245_10014199 | |||
| 1175 | Ga0105247_10015729 | |||
| 1176 | Ga0105247_10020219 | |||
| 1177 | Ga0105247_10162666 | |||
| 1178 | Ga0105247_10236681 | |||
| 1179 | Ga0114129_10004791 | |||
| 1180 | Ga0114129_10065648 | |||
| 1181 | Ga0114129_10123771 | |||
| 1182 | Ga0114129_10256062 | |||
| 1183 | Ga0114129_10434617 | |||
| 1184 | Ga0114129_10963216 | |||
| 1185 | Ga0105243_10026025 | |||
| 1186 | Ga0105243_10085590 | |||
| 1187 | Ga0105243_10090303 | |||
| 1188 | Ga0105243_10382476 | |||
| 1189 | Ga0105241_10000805 | |||
| 1190 | Ga0105241_10012529 | |||
| 1191 | Ga0105241_10099248 | |||
| 1192 | Ga0105241_10283075 | |||
| 1193 | Ga0105242_10004554 | |||
| 1194 | Ga0105242_10020924 | |||
| 1195 | Ga0105242_10109990 | |||
| 1196 | Ga0105242_10205064 | |||
| 1197 | Ga0105242_10228977 | |||
| 1198 | Ga0105248_10007773 | |||
| 1199 | Ga0105248_10012541 | |||
| 1200 | Ga0105248_10014249 | |||
| 1201 | Ga0105248_10045407 | |||
| 1202 | Ga0105248_10073290 | |||
| 1203 | Ga0105248_10256090 | |||
| 1204 | Ga0105237_10024690 | |||
| 1205 | Ga0105238_10057979 | |||
| 1206 | Ga0105249_10075277 | |||
| 1207 | Ga0105249_10301612 | |||
| 1208 | Ga0105249_10450947 | |||
| 1209 | Ga0105239_10043858 | |||
| 1210 | Ga0105239_10082161 | |||
| 1211 | Ga0105239_10355647 | |||
| 1212 | Ga0105246_10002092 | |||
| 1213 | Ga0105246_10158351 | |||
| 1214 | Ga0105246_10195911 | |||
| 1215 | Ga0105246_10248405 | |||
| 1216 | Ga0105246_10321907 | |||
| 1217 | Ga0105246_10328553 | |||
| 1218 | Ga0157338_1001046 | |||
| 1219 | Ga0157373_10174842 | |||
| 1220 | Ga0157371_10014330 | |||
| 1221 | Ga0157369_10502410 | |||
| 1222 | Ga0157369_10689858 | |||
| 1223 | Ga0157374_10005194 | |||
| 1224 | Ga0157374_10351302 | |||
| 1225 | Ga0157374_10440896 | |||
| 1226 | Ga0157378_10011410 | |||
| 1227 | Ga0157378_10539966 | |||
| 1228 | Ga0163162_10039217 | |||
| 1229 | Ga0163162_10078758 | |||
| 1230 | Ga0163162_10090824 | |||
| 1231 | Ga0157372_10016173 | |||
| 1232 | Ga0157375_10001699 | |||
| 1233 | Ga0157375_10505573 | |||
| 1234 | Ga0157375_10693608 | |||
| 1235 | Ga0163163_10000489 | |||
| 1236 | Ga0163163_10029460 | |||
| 1237 | Ga0163163_10103106 | |||
| 1238 | Ga0163163_10144821 | |||
| 1239 | Ga0157380_10020406 | |||
| 1240 | Ga0157380_10023469 | |||
| 1241 | Ga0157377_10002656 | |||
| 1242 | Ga0157379_10004716 | |||
| 1243 | Ga0157379_10007629 | |||
| 1244 | Ga0157379_10010586 | |||
| 1245 | Ga0157379_10013998 | |||
| 1246 | Ga0157379_10212857 | |||
| 1247 | Ga0157376_10030975 | |||
| 1248 | Ga0157376_10170656 | |||
| 1249 | Ga0157376_10222620 | |||
| 1250 | Ga0157376_10518259 | |||
| 1251 | Ga0163161_10002208 | |||
| 1252 | Ga0163161_10038349 | |||
| 1253 | Ga0224572_1001032 | |||
| 1254 | Ga0207666_1000245 | |||
| 1255 | Ga0207673_1003029 | |||
| 1256 | Ga0207697_10003263 | |||
| 1257 | Ga0207653_10017221 | |||
| 1258 | Ga0207682_10000793 | |||
| 1259 | Ga0207692_10025244 | |||
| 1260 | Ga0207642_10001880 | |||
| 1261 | Ga0207710_10007749 | |||
| 1262 | Ga0207710_10089573 | |||
| 1263 | Ga0207688_10000420 | |||
| 1264 | Ga0207680_10006456 | |||
| 1265 | Ga0207680_10133951 | |||
| 1266 | Ga0207647_10004676 | |||
| 1267 | Ga0207647_10046531 | |||
| 1268 | Ga0207685_10020702 | |||
| 1269 | Ga0207699_10088829 | |||
| 1270 | Ga0207645_10000668 | |||
| 1271 | Ga0207643_10000085 | |||
| 1272 | Ga0207643_10011878 | |||
| 1273 | Ga0207654_10000373 | |||
| 1274 | Ga0207654_10095182 | |||
| 1275 | Ga0207707_10011682 | |||
| 1276 | Ga0207707_10104589 | |||
| 1277 | Ga0207695_10153710 | |||
| 1278 | Ga0207671_10006714 | |||
| 1279 | Ga0207693_10001322 | |||
| 1280 | Ga0207693_10001438 | |||
| 1281 | Ga0207693_10026127 | |||
| 1282 | Ga0207693_10029261 | |||
| 1283 | Ga0207693_10064662 | |||
| 1284 | Ga0207693_10124525 | |||
| 1285 | Ga0207693_10185317 | |||
| 1286 | Ga0207663_10005341 | |||
| 1287 | Ga0207663_10083280 | |||
| 1288 | Ga0207663_10168519 | |||
| 1289 | Ga0207663_10228576 | |||
| 1290 | Ga0207660_10002189 | |||
| 1291 | Ga0207662_10000730 | |||
| 1292 | Ga0207657_10007870 | |||
| 1293 | Ga0207657_10072772 | |||
| 1294 | Ga0207649_10000476 | |||
| 1295 | Ga0207649_10230862 | |||
| 1296 | Ga0207652_10003058 | |||
| 1297 | Ga0207681_10006586 | |||
| 1298 | Ga0207681_10048551 | |||
| 1299 | Ga0207650_10028502 | |||
| 1300 | Ga0207650_10198426 | |||
| 1301 | Ga0207659_10010174 | |||
| 1302 | Ga0207687_10001321 | |||
| 1303 | Ga0207687_10192793 | |||
| 1304 | Ga0207700_10044752 | |||
| 1305 | Ga0207700_10069414 | |||
| 1306 | Ga0207700_10137461 | |||
| 1307 | Ga0207700_10165035 | |||
| 1308 | Ga0207700_10223955 | |||
| 1309 | Ga0207700_10301920 | |||
| 1310 | Ga0207644_10000759 | |||
| 1311 | Ga0207644_10004908 | |||
| 1312 | Ga0207644_10007993 | |||
| 1313 | Ga0207644_10024244 | |||
| 1314 | Ga0207690_10004643 | |||
| 1315 | Ga0207690_10022775 | |||
| 1316 | Ga0207690_10100671 | |||
| 1317 | Ga0207690_10119236 | |||
| 1318 | Ga0207706_10013555 | |||
| 1319 | Ga0207706_10043416 | |||
| 1320 | Ga0207706_10129440 | |||
| 1321 | Ga0207686_10000682 | |||
| 1322 | Ga0207686_10058551 | |||
| 1323 | Ga0207709_10002503 | |||
| 1324 | Ga0207709_10022112 | |||
| 1325 | Ga0207709_10050302 | |||
| 1326 | Ga0207670_10000908 | |||
| 1327 | Ga0207670_10081270 | |||
| 1328 | Ga0207669_10000129 | |||
| 1329 | Ga0207704_10000366 | |||
| 1330 | Ga0207665_10015654 | |||
| 1331 | Ga0207665_10026086 | |||
| 1332 | Ga0207665_10399677 | |||
| 1333 | Ga0207691_10010088 | |||
| 1334 | Ga0207691_10029040 | |||
| 1335 | Ga0207691_10040566 | |||
| 1336 | Ga0207691_10041706 | |||
| 1337 | Ga0207691_10107655 | |||
| 1338 | Ga0207711_10000042 | |||
| 1339 | Ga0207711_10043312 | |||
| 1340 | Ga0207711_10203389 | |||
| 1341 | Ga0207711_10351715 | |||
| 1342 | Ga0207711_10446168 | |||
| 1343 | Ga0207689_10002200 | |||
| 1344 | Ga0207689_10027825 | |||
| 1345 | Ga0207661_10000373 | |||
| 1346 | Ga0207661_10537366 | |||
| 1347 | Ga0207679_10001125 | |||
| 1348 | Ga0207679_10030464 | |||
| 1349 | Ga0207667_10025152 | |||
| 1350 | Ga0207651_10002032 | |||
| 1351 | Ga0207651_10031594 | |||
| 1352 | Ga0207712_10002238 | |||
| 1353 | Ga0207712_10043634 | |||
| 1354 | Ga0207668_10001143 | |||
| 1355 | Ga0207668_10559908 | |||
| 1356 | Ga0207640_10019608 | |||
| 1357 | Ga0207640_10346001 | |||
| 1358 | Ga0207640_10426011 | |||
| 1359 | Ga0207640_10479902 | |||
| 1360 | Ga0207658_10008091 | |||
| 1361 | Ga0207658_10017529 | |||
| 1362 | Ga0207658_10020382 | |||
| 1363 | Ga0207658_10057545 | |||
| 1364 | Ga0207658_10096320 | |||
| 1365 | Ga0207677_10009995 | |||
| 1366 | Ga0207703_10001627 | |||
| 1367 | Ga0207703_10002493 | |||
| 1368 | Ga0207703_10041859 | |||
| 1369 | Ga0207639_10005334 | |||
| 1370 | Ga0207639_10203397 | |||
| 1371 | Ga0207678_10010758 | |||
| 1372 | Ga0207678_10018247 | |||
| 1373 | Ga0207678_10067149 | |||
| 1374 | Ga0207708_10007465 | |||
| 1375 | Ga0207708_10007573 | |||
| 1376 | Ga0207702_10017909 | |||
| 1377 | Ga0207702_10030876 | |||
| 1378 | Ga0207702_10132468 | |||
| 1379 | Ga0207702_10303614 | |||
| 1380 | Ga0207641_10000927 | |||
| 1381 | Ga0207641_10002374 | |||
| 1382 | Ga0207641_10030449 | |||
| 1383 | Ga0207648_10001362 | |||
| 1384 | Ga0207676_10000435 | |||
| 1385 | Ga0207676_10001403 | |||
| 1386 | Ga0207676_10016664 | |||
| 1387 | Ga0207676_10107821 | |||
| 1388 | Ga0207674_10011327 | |||
| 1389 | Ga0207675_100004955 | |||
| 1390 | Ga0207675_100150113 | |||
| 1391 | Ga0207683_10001172 | |||
| 1392 | Ga0207683_10001220 | |||
| 1393 | Ga0207683_10077777 | |||
| 1394 | Ga0207683_10077868 | |||
| 1395 | Ga0207683_10102696 | |||
| 1396 | Ga0207698_10016256 | |||
| 1397 | Ga0207698_10026603 | |||
| 1398 | Ga0207698_10812108 | |||
| 1399 | Ga0210002_1000487 | |||
| 1400 | Ga0209983_1011416 | |||
| 1401 | Ga0209998_10001714 | |||
| 1402 | Ga0207428_10000322 | |||
| 1403 | Ga0207428_10000896 | |||
| 1404 | Ga0207428_10061970 | |||
| 1405 | Ga0207428_10069209 | |||
| 1406 | Ga0268266_10000832 | |||
| 1407 | Ga0268266_10118531 | |||
| 1408 | Ga0268265_10002919 | |||
| 1409 | Ga0268265_10005917 | |||
| 1410 | Ga0268265_10052875 | |||
| 1411 | Ga0268265_10167423 | |||
| 1412 | Ga0268264_10001202 | |||
| 1413 | Ga0268264_10070437 | |||
| 1414 | Ga0268264_10344177 | |||
| 1415 | Ga0265338_10038132 | |||
| 1416 | Ga0265760_10036800 | |||
| 1417 | Ga0265330_10029512 | |||
| 1418 | Ga0265320_10162888 | |||
| 1419 | Ga0265325_10001243 | |||
| 1420 | Ga0265339_10000091 | |||
| 1421 | Ga0265339_10018360 | |||
| 1422 | Ga0265339_10029357 | |||
| 1423 | Ga0265316_10064489 | |||
| 1424 | Ga0265316_10135806 | |||
| 1425 | Ga0307513_10013540 | |||
| 1426 | Ga0265313_10001068 | |||
| 1427 | Ga0265313_10017130 | |||
| 1428 | Ga0265313_10097002 | |||
| 1429 | Ga0265314_10057584 | |||
| 1430 | Ga0265314_10108459 | |||
| 1431 | Ga0265342_10027560 | |||
| 1432 | Ga0265342_10028347 | |||
| 1433 | Ga0265342_10060407 | |||
| 1434 | Ga0265342_10156548 | |||
| 1435 | Ga0307413_10164418 | |||
| 1436 | Ga0307410_10008367 | |||
| 1437 | Ga0307409_100201662 | |||
| 1438 | Ga0307416_100214981 | |||
| 1439 | Ga0373930_0010920 | |||
| 1440 | Ga0373948_0000934 | |||
| 1441 | Ga0373950_0008932 | |||
| 1442 | Ga0373958_0008311 | |||
| 1443 | Ga0373959_0017794 | |||
| 1444 | Ga0373938_0001605 | |||
| 1445 | Ga0373938_0004290 | |||
| 1446 | Ga0373926_0013724 | |||
| 1447 | Ga0373929_0007035 | |||
| 1448 | Ga0373934_0013975 | |||
| 1449 | Ga0373940_0012918 | |||
| 1450 | Ga0373940_0032676 | |||
| 1451 | Ga0373944_0102245 | |||
| 1452 | Ga0373949_0001617 | |||
| 1453 | Ga0373949_0008699 | |||
| 1454 | Ga0373951_0000816 | |||
| 1455 | Ga0373952_0000725 | |||
| 1456 | Ga0373952_0012409 | |||
| 1457 | Ga0373923_0031535 | |||
| 1458 | Ga0373923_0036242 | |||
| 1459 | Ga0373923_0063142 | |||
| 1460 | Ga0373923_0065154 | |||
| 1461 | Ga0373932_0002655 | |||
| 1462 | Ga0373936_0067900 | |||
| 1463 | Ga0373939_0002266 | |||
| 1464 | Ga0373939_0011072 | |||
| 1465 | Ga0373941_0000710 | |||
| 1466 | Ga0373945_0054522 | |||
| 1467 | Ga0373954_0029351 | |||
| 1468 | Ga0373956_0101308 | |||
| 1469 | Ga0373957_0048508 | |||
| 1470 | Ga0373960_0000528 | |||
| 1471 | Ga0373960_0001486 | |||
| 1472 | Ga0373960_0080156 | |||
| 1473 | Ga0373943_0004637 | |||
| 1474 | Ga0373943_0031187 | |||
| 1475 | Ga0373943_0053186 | |||
| 1476 | Ga0373946_0011371 | |||
| 1477 | Ga0373946_0082488 | |||
| 1478 | Ga0373955_0009883 | |||
| 1479 | Ga0373955_0022291 | |||
| 1480 | Ga0373942_0003528 | |||
| 1481 | Ga0373961_0012891 | |||
| 1482 | Ga0373962_0000893 | |||
| 1483 | Ga0373924_0002373 | |||
| 1484 | Ga0373931_0016718 | |||
| 1485 | Ga0373931_0065125 | |||
| 1486 | Ga0373931_0072616 | |||
| 1487 | Ga0373931_0191196 | |||
| 1488 | Ga0373935_0037934 | |||
| 1489 | Ga0373935_0099561 | |||
| 1490 | Ga0373935_0208383 | |||
| 1491 | Ga0373935_0422678 | |||
| 1492 | Ga0373927_0015422 | |||
| 1493 | Ga0373927_0044216 | |||
| 1494 | Ga0373927_0062284 | |||
| 1495 | Ga0373927_0123840 | |||
| 1496 | Ga0373927_0153377 | |||
| 1497 | Ga0373933_0004840 | |||
| 1498 | Ga0373933_0014329 | |||
| 1499 | Ga0373933_0056092 | |||
| 1500 | Ga0373933_0070402 | |||
| 1501 | Ga0373947_0001934 | |||
| 1502 | Ga0373947_0005748 | |||
| 1503 | Ga0373947_0011643 | |||
| 1504 | Ga0373947_0057024 | |||
| 1505 | Ga0373937_0002583 | |||
| 1506 | Ga0373937_0005204 | |||
| 1507 | Ga0373937_0007138 | |||
| 1508 | Ga0373937_0509815 | |||
| 1509 | Ga0373937_0581488 | |||
| 1510 | Ga0373925_0018031 | |||
| 1511 | Ga0373925_0025873 | |||
| 1512 | Ga0373925_0035442 | |||
| 1513 | Ga0373925_0043734 | |||
| 1514 | Ga0373925_0068198 | |||
| 1515 | Ga0373925_0100873 | |||
| 1516 | Ga0395899_0099652 | |||
| 1517 | Ga0395899_0102330 | |||
| 1518 | Ga0395899_0170745 | |||
| 1519 | Ga0395900_0037499 | |||
| 1520 | Ga0395900_0153873 | |||
| 1521 | Ga0395898_0047892 | |||
| 1522 | Ga0395898_0083593 | |||
| 1523 | Ga0395898_0331420 | |||
| 1524 | Ga0395905_0031832 | |||
| 1525 | Ga0395905_0061486 | |||
| 1526 | Ga0395905_0181965 | |||
| 1527 | Ga0395905_0527274 | |||
| 1528 | Ga0395901_0021682 | |||
| 1529 | Ga0395901_0039197 | |||
| 1530 | Ga0395901_0159622 | |||
| 1531 | Ga0395901_0252021 | |||
| 1532 | Ga0436365_0204940 | |||
| 1533 | Ga0436365_0933878 | |||
| 1534 | Ga0436365_0947958 | |||
| 1535 | Ga0436361_0201393 | |||
| 1536 | Ga0436361_0265181 | |||
| 1537 | Ga0436361_0862585 | |||
| 1538 | Ga0436361_0866592 | |||
| 1539 | Ga0436363_0460390 | |||
| 1540 | Ga0436363_1308327 | |||
| 1541 | Ga0450905_000421 | |||
| 1542 | Ga0450889_000015 | |||
| 1543 | Ga0439464_0039570 | |||
| 1544 | Ga0451577_0113507 | |||
| 1545 | Ga0451576_0000159 | |||
| 1546 | Ga0495617_038603 | |||
| 1547 | Ga0495592_0031388 | |||
| 1548 | Ga0495603_0007068 | |||
| 1549 | Ga0495603_0046367 | |||
| 1550 | Ga0495590_0039865 | |||
| 1551 | Ga0495629_0000140 | |||
| 1552 | Ga0495629_0002843 | |||
| 1553 | Ga0495629_0030081 | |||
| 1554 | Ga0495629_0047991 | |||
| 1555 | Ga0495641_0009773 | |||
| 1556 | Ga0495651_0001969 | |||
| 1557 | Ga0495651_0003550 | |||
| 1558 | Ga0495653_0009210 | |||
| 1559 | Ga0495653_0023662 | |||
| 1560 | Ga0495580_0118134 | |||
| 1561 | Ga0495580_0157080 | |||
| 1562 | Ga0495580_0221222 | |||
| 1563 | Ga0495582_0121208 | |||
| 1564 | Ga0495639_0244386 | |||
| 1565 | Ga0495662_0021111 | |||
| 1566 | Ga0495662_0037776 | |||
| 1567 | Ga0495664_0001514 | |||
| 1568 | Ga0495664_0062554 | |||
| 1569 | Ga0495664_0095894 | |||
| 1570 | Ga0495584_0013124 | |||
| 1571 | Ga0495584_0077012 | |||
| 1572 | Ga0495584_0120731 | |||
| 1573 | Ga0495584_0152354 | |||
| 1574 | Ga0495585_0012013 | |||
| 1575 | Ga0495585_0044457 | |||
| 1576 | Ga0495594_0004885 | |||
| 1577 | Ga0495594_0186120 | |||
| 1578 | Ga0495594_0236898 | |||
| 1579 | Ga0495606_0000252 | |||
| 1580 | Ga0495608_0002947 | |||
| 1581 | Ga0495608_0007807 | |||
| 1582 | Ga0495618_0011920 | |||
| 1583 | Ga0495618_0018939 | |||
| 1584 | Ga0495618_0020553 | |||
| 1585 | Ga0495618_0046181 | |||
| 1586 | Ga0495620_0106045 | |||
| 1587 | Ga0495628_0016676 | |||
| 1588 | Ga0495628_0168694 | |||
| 1589 | Ga0495630_0074980 | |||
| 1590 | Ga0495630_0226282 | |||
| 1591 | Ga0495630_0655881 | |||
| 1592 | Ga0495637_0081423 | |||
| 1593 | Ga0495644_0009079 | |||
| 1594 | Ga0495663_0020370 | |||
| 1595 | Ga0495663_0070071 | |||
| 1596 | Ga0495666_0065009 | |||
| 1597 | Ga0495642_0062486 | |||
| 1598 | Ga0495642_0145203 | |||
| 1599 | Ga0495652_0007323 | |||
| 1600 | Ga0495652_0020176 | |||
| 1601 | Ga0495652_0248193 | |||
| 1602 | Ga0495652_0444653 | |||
| 1603 | Ga0495665_0019725 | |||
| 1604 | Ga0495665_0044130 | |||
| 1605 | Ga0495665_0124079 | |||
| 1606 | Ga0495640_0003070 | |||
| 1607 | Ga0495640_0011331 | |||
| 1608 | Ga0495640_0022000 | |||
| 1609 | Ga0495640_0256887 | |||
| 1610 | Ga0495586_0015904 | |||
| 1611 | Ga0495587_0107035 | |||
| 1612 | Ga0495645_0008448 | |||
| 1613 | Ga0495645_0243125 | |||
| 1614 | Ga0495622_0007036 | |||
| 1615 | Ga0495622_0115247 | |||
| 1616 | Ga0495633_0028229 | |||
| 1617 | Ga0495667_0000936 | |||
| 1618 | Ga0495667_0007174 | |||
| 1619 | Ga0495667_0052243 | |||
| 1620 | Ga0495667_0079051 | |||
| 1621 | Ga0495656_0001649 | |||
| 1622 | Ga0495668_0107403 | |||
| 1623 | Ga0495634_0006588 | |||
| 1624 | Ga0495634_0049795 | |||
| 1625 | Ga0495634_0137246 | |||
| 1626 | Ga0495634_0289166 | |||
| 1627 | Ga0495611_0092957 | |||
| 1628 | Ga0495625_0081142 | |||
| 1629 | Ga0495635_0000803 | |||
| 1630 | Ga0495635_0010366 | |||
| 1631 | Ga0495635_0010910 | |||
| 1632 | Ga0495635_0023545 | |||
| 1633 | Ga0495635_0204552 | |||
| 1634 | Ga0495659_0004853 | |||
| 1635 | Ga0495659_0058045 | |||
| 1636 | Ga0495657_0008655 | |||
| 1637 | Ga0495657_0013677 | |||
| 1638 | Ga0495599_0009856 | |||
| 1639 | Ga0495623_0004153 | |||
| 1640 | Ga0495623_0104284 | |||
| 1641 | Ga0495646_0011637 | |||
| 1642 | Ga0495646_0015003 | |||
| 1643 | Ga0495647_0001772 | |||
| 1644 | Ga0495647_0100883 | |||
| 1645 | Ga0495658_0001441 | |||
| 1646 | Ga0495658_0019035 | |||
| 1647 | Ga0495658_0021917 | |||
| 1648 | Ga0495658_0175856 | |||
| 1649 | Ga0495669_0007930 | |||
| 1650 | Ga0495613_0032219 | |||
| 1651 | Ga0495613_0053690 | |||
| 1652 | Ga0495613_0112177 | |||
| 1653 | Ga0495613_0224577 | |||
| 1654 | Ga0495624_0004977 | |||
| 1655 | Ga0495624_0041472 | |||
| 1656 | Ga0495624_0071665 | |||
| 1657 | Ga0495670_0044171 | |||
| 1658 | Ga0495670_0088786 | |||
| 1659 | Ga0495649_0005354 | |||
| 1660 | Ga0495589_0025192 | |||
| 1661 | Ga0495589_0139408 | |||
| 1662 | Ga0495600_0012802 | |||
| 1663 | Ga0495581_0011677 | |||
| 1664 | Ga0495581_0033129 | |||
| 1665 | Ga0495581_0167927 | |||
| 1666 | Ga0495604_0001803 | |||
| 1667 | Ga0495604_0007398 | |||
| 1668 | Ga0495604_0122120 | |||
| 1669 | Ga0495636_0164204 | |||
| 1670 | Ga0495674_0005466 | |||
| 1671 | Ga0495674_0010028 | |||
| 1672 | Ga0495674_0014669 | |||
| 1673 | Ga0495674_0017525 | |||
| 1674 | Ga0495674_0029644 | |||
| 1675 | Ga0495674_0180017 | |||
| 1676 | Ga0495676_0050527 | |||
| 1677 | Ga0495676_0280443 | |||
| 1678 | Ga0495676_0306672 | |||
| 1679 | Ga0495676_0356632 | |||
| 1680 | Ga0495680_0006822 | |||
| 1681 | Ga0495680_0014641 | |||
| 1682 | Ga0495680_0123956 | |||
| 1683 | Ga0495675_0023294 | |||
| 1684 | Ga0495679_018305 | |||
| 1685 | Ga0495684_0007012 | |||
| 1686 | Ga0495684_0008246 | |||
| 1687 | Ga0495684_0008574 | |||
| 1688 | Ga0495684_0236077 | |||
| 1689 | Ga0495686_0070290 | |||
| 1690 | Ga0495593_0013260 | |||
| 1691 | Ga0495593_0016502 | |||
| 1692 | Ga0495593_0046567 | |||
| 1693 | Ga0495602_0003594 | |||
| 1694 | Ga0495602_0038382 | |||
| 1695 | Ga0495602_0226321 | |||
| 1696 | Ga0495615_0027225 | |||
| 1697 | Ga0495626_0093157 | |||
| 1698 | Ga0496100_0013352 | |||
| 1699 | Ga0496100_0045666 | |||
| 1700 | Ga0496100_0050754 | |||
| 1701 | Ga0496100_0051881 | |||
| 1702 | Ga0496100_0195655 | |||
| 1703 | Ga0496100_0220772 | |||
| 1704 | Ga0496100_0307207 | |||
| 1705 | Ga0496101_0024236 | |||
| 1706 | Ga0496101_0071673 | |||
| 1707 | Ga0496101_0111412 | |||
| 1708 | Ga0496102_0016598 | |||
| 1709 | Ga0496102_0020964 | |||
| 1710 | Ga0496102_0029331 | |||
| 1711 | Ga0496102_0177184 | |||
| 1712 | Ga0496102_0362042 | |||
| 1713 | Ga0496103_0005145 | |||
| 1714 | Ga0496103_0023092 | |||
| 1715 | Ga0496103_0035005 | |||
| 1716 | Ga0496103_0066782 | |||
| 1717 | Ga0496103_0086307 | |||
| 1718 | Ga0496103_0106122 | |||
| 1719 | Ga0496104_0001024 | |||
| 1720 | Ga0496104_0017158 | |||
| 1721 | Ga0496104_0038358 | |||
| 1722 | Ga0496104_0100386 | |||
| 1723 | Ga0496104_0103201 | |||
| 1724 | Ga0496104_0198467 | |||
| 1725 | Ga0496104_0241051 | |||
| 1726 | Ga0496105_0004939 | |||
| 1727 | Ga0496105_0044353 | |||
| 1728 | Ga0496105_0057598 | |||
| 1729 | Ga0496105_0067781 | |||
| 1730 | Ga0496105_0072206 | |||
| 1731 | Ga0496105_0091432 | |||
| 1732 | Ga0496105_0377511 | |||
| 1733 | Ga0496106_0009502 | |||
| 1734 | Ga0496106_0020443 | |||
| 1735 | Ga0496106_0029158 | |||
| 1736 | Ga0496106_0054915 | |||
| 1737 | Ga0496106_0178532 | |||
| 1738 | Ga0496106_0186010 | |||
| 1739 | Ga0496106_0227121 | |||
| 1740 | Ga0496106_0353995 | |||
| 1741 | Ga0496106_0596748 | |||
| 1742 | Ga0496107_0012082 | |||
| 1743 | Ga0496107_0048939 | |||
| 1744 | Ga0496107_0099472 | |||
| 1745 | Ga0496107_0277241 | |||
| 1746 | Ga0496108_0016733 | |||
| 1747 | Ga0496108_0050498 | |||
| 1748 | Ga0496108_0051252 | |||
| 1749 | Ga0496108_0060107 | |||
| 1750 | Ga0496108_0364456 | |||
| 1751 | Ga0496109_0018181 | |||
| 1752 | Ga0496109_0018404 | |||
| 1753 | Ga0496109_0036648 | |||
| 1754 | Ga0496109_0190717 | |||
| 1755 | Ga0496109_0192897 | |||
| 1756 | Ga0496109_0391774 | |||
| 1757 | Ga0496109_0528156 | |||
| 1758 | Ga0496110_0020286 | |||
| 1759 | Ga0496111_0024263 | |||
| 1760 | Ga0496111_0205156 | |||
| 1761 | Ga0496111_0302191 | |||
| 1762 | Ga0496111_0320355 | |||
| 1763 | Ga0496111_0345451 | |||
| 1764 | Ga0496112_0000020 | |||
| 1765 | Ga0496112_0058612 | |||
| 1766 | Ga0496112_0069748 | |||
| 1767 | Ga0496112_0177036 | |||
| 1768 | Ga0496112_0222279 | |||
| 1769 | Ga0496112_0250452 | |||
| 1770 | Ga0496113_0044500 | |||
| 1771 | Ga0496113_0110618 | |||
| 1772 | Ga0496113_0140539 | |||
| 1773 | Ga0496114_0004331 | |||
| 1774 | Ga0496114_0068905 | |||
| 1775 | Ga0496114_0263638 | |||
| 1776 | Ga0496115_0014383 | |||
| 1777 | Ga0496115_0023267 | |||
| 1778 | Ga0496115_0099823 | |||
| 1779 | Ga0496115_0135587 | |||
| 1780 | Ga0496115_0318565 | |||
| 1781 | Ga0501299_026121 | |||
| 1782 | Ga0501034_0007786 | |||
| 1783 | Ga0501034_0082784 | |||
| 1784 | Ga0501034_0137132 | |||
| 1785 | Ga0501036_0050044 | |||
| 1786 | Ga0501038_0082959 | |||
| 1787 | Ga0501043_0009861 | |||
| 1788 | Ga0501047_0004174 | |||
| 1789 | Ga0501047_0029576 | |||
| 1790 | Ga0501067_0000100 | |||
| 1791 | Ga0501067_0002755 | |||
| 1792 | Ga0501068_0077298 | |||
| 1793 | Ga0501073_0000010 | |||
| 1794 | Ga0501076_0248465 | |||
| 1795 | Ga0501077_0026616 | |||
| 1796 | Ga0501077_0186240 | |||
| 1797 | Ga0501257_000006 | |||
| 1798 | Ga0501080_0003502 | |||
| 1799 | Ga0501080_0004643 | |||
| 1800 | Ga0501083_0013011 | |||
| 1801 | Ga0501280_002743 | |||
| 1802 | Ga0501035_0035770 | |||
| 1803 | Ga0501044_0004511 | |||
| 1804 | Ga0501044_0013701 | |||
| 1805 | nmdc:mga05p37_1239_c1 | |||
| 1806 | nmdc:mga05p37_3181_c1 | |||
| 1807 | nmdc:mga05p37_487794_c1 | |||
| 1808 | nmdc:mga05p37_7041_c1 | |||
| 1809 | nmdc:mga09592_10200_c1 | |||
| 1810 | nmdc:mga09592_431648_c1 | |||
| 1811 | nmdc:mga0qj67_189804_c1 | |||
| 1812 | nmdc:mga0qj67_23_c1 | |||
| 1813 | nmdc:mga0qj67_2544_c1 | |||
| 1814 | nmdc:mga06r32_3795_c1 | |||
| 1815 | nmdc:mga06r32_571_c1 | |||
| 1816 | nmdc:mga08y16_11920_c1 | |||
| 1817 | nmdc:mga08y16_122211_c1 | |||
| 1818 | nmdc:mga08y16_204_c3 | |||
| 1819 | nmdc:mga08y16_23259_c1 | |||
| 1820 | nmdc:mga08y16_8805_c1 | |||
| 1821 | nmdc:mga0n895_181261_c1 | |||
| 1822 | nmdc:mga0n895_236005_c1 | |||
| 1823 | nmdc:mga0n895_280745_c1 | |||
| 1824 | nmdc:mga0n895_39393_c1 | |||
| 1825 | nmdc:mga0n895_62981_c1 | |||
| 1826 | nmdc:mga0n895_72345_c1 | |||
| 1827 | nmdc:mga0n895_83692_c1 | |||
| 1828 | nmdc:mga0rr50_1652_c1 | |||
| 1829 | nmdc:mga0rr50_168331_c1 | |||
| 1830 | nmdc:mga0rr50_218278_c1 | |||
| 1831 | nmdc:mga0rr50_22311_c1 | |||
| 1832 | nmdc:mga0rr50_245259_c1 | |||
| 1833 | nmdc:mga0rr50_33461_c1 | |||
| 1834 | nmdc:mga08x19_156645_c1 | |||
| 1835 | nmdc:mga08x19_226485_c1 | |||
| 1836 | nmdc:mga0a205_1982_c1 | |||
| 1837 | nmdc:mga0a205_58841_c1 | |||
| 1838 | nmdc:mga0a205_61577_c1 | |||
| 1839 | Ga0495601_0001168 | |||
| 1840 | Ga0495601_0014239 | |||
| 1841 | Ga0495601_0018872 | |||
| 1842 | Ga0495601_0036049 | |||
| 1843 | Ga0495601_0155634 | |||
| 1844 | Ga0495601_0245059 | |||
| 1845 | Ga0495612_0002956 | |||
| 1846 | Ga0495612_0004722 | |||
| 1847 | Ga0495612_0008814 | |||
| 1848 | Ga0495612_0022742 | |||
| 1849 | Ga0495595_0003369 | |||
| 1850 | Ga0495595_0003462 | |||
| 1851 | Ga0495595_0004314 | |||
| 1852 | Ga0495595_0005583 | |||
| 1853 | Ga0495595_0064165 | |||
| 1854 | Ga0495619_0000108 | |||
| 1855 | Ga0495619_0002250 | |||
| 1856 | Ga0495619_0004216 | |||
| 1857 | Ga0495619_0006397 | |||
| 1858 | Ga0495619_0009826 | |||
| 1859 | Ga0495619_0023395 | |||
| 1860 | Ga0495619_0044134 | |||
| 1861 | Ga0495619_0152966 | |||
| 1862 | Ga0495619_0384767 | |||
| 1863 | Ga0500643_000419 | |||
| 1864 | Ga0500595_017797 | |||
| 1865 | Ga0500658_0000232 | |||
| 1866 | Ga0500624_000075 | |||
| 1867 | Ga0500636_0221051 | |||
| 1868 | Ga0500637_0000049 | |||
| 1869 | Ga0501084_0035032 | |||
| 1870 | Ga0501082_0044497 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3g23-assembly1.cif.gz_B | crystal structure of a ld-carboxypeptidase a (saro_1426) from novosphingobium aromaticivorans dsm at 1.89 a resolution | 0.9761 | 6 | 277 |
| 3g23-assembly1.cif.gz_B | crystal structure of a ld-carboxypeptidase a (saro_1426) from novosphingobium aromaticivorans dsm at 1.89 a resolution | 0.9619 | 6 | 277 |
| 6uuk-assembly1.cif.gz_A | crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes | 0.8419 | 9 | 277 |
| 1zl0-assembly2.cif.gz_B | structure of protein of unknown function pa5198 from pseudomonas aeruginosa | 0.8271 | 6 | 277 |
| 2aum-assembly1.cif.gz_B | active site ser115ala mutant of ld-carboxypeptidase | 0.8204 | 5 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3g23B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain | 0.9793 | 6 | 161 | 3.40.50.10740 |
| 3g23B02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like | 0.9301 | 164 | 268 | 3.50.30.60 |
| 3g23B02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like | 0.9213 | 164 | 268 | 3.50.30.60 |
| 3g23B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain | 0.9087 | 6 | 161 | 3.40.50.10740 |
| af_P76008_161_291_3.50.30.60 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like | 0.8383 | 160 | 278 | 3.50.30.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537QCQ8-F1-model_v4 | LD-carboxypeptidase | 0.996 | 1 | 278 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A1E4JDD5-F1-model_v4 | LD-carboxypeptidase | 0.9925 | 7 | 277 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A3D2VYE0-F1-model_v4 | LD-carboxypeptidase | 0.9913 | 89 | 280 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A839Z270-F1-model_v4 | Muramoyltetrapeptide carboxypeptidase (EC 3.4.17.13) | 0.9878 | 7 | 276 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A520H014-F1-model_v4 | LD-carboxypeptidase | 0.9867 | 41 | 278 |
GO:0004180
GO:0006508 GO:0008236 |