F486149

General Info

Members Datasets Scaffolds Average Seq Length
935 403 1870 280

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100053841|Ga0070702_1000538412
Length 314
Sequence LAKFRGVADEVQCRLGAWMSKEKCRIGIVAPASRMSPEVAERVPTLARSLYPDRTPEIIFHPQCFALHGHFAGDDETRTQAFLEFANDESYDAVWFARGGYGSCRVVEAVMRGLKEPSRRKAYLGYSDAGVLLAALYRAGFEHVAHGPVAQDILRDGGDAAIGRALAWLIDRSPEALEPSVSRVKMTAAFNMTVLSQLLGTPLQPDLDGHVLMLEEVGEAMYRIDRSLFHITSNADIRRVSGVMLGRCSSITPNEPDFGMNEEEIARYWCERSGIPWLGRADIGHDTDNKIVPFGTRPALSSVSDALNVRNKHV

Samples

Sample ID Description Type Environment
1 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
230 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
231 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
241 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
242 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
243 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
250 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
251 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
252 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
253 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
254 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
255 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
256 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
257 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
258 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
259 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
275 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
276 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
280 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
303 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
304 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
323 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
324 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
325 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
326 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
327 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
328 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
329 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
330 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
331 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
336 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
337 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
338 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
339 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
340 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
341 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
342 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
343 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
360 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
361 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
362 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
363 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
377 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
393 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
394 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
395 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
396 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
397 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
400 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
401 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
402 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
403 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 8.88
Rhizosphere 89.63
Stem 0
Stem Tuber 0
Unclassified 10.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070702_100053841 3300005615 Unclassified 2313
2 JGI24032J14994_100084 3300001430 Bacteria 4081
3 JGI24741J21665_1005888 3300001915 Bacteria 2511
4 JGI24752J21851_1001192 3300001976 Bacteria 3525
5 JGI24752J21851_1006891 3300001976 Bacteria 1485
6 JGI24746J21847_1000561 3300001977 Bacteria 5596
7 JGI24747J21853_1001109 3300001978 Bacteria 1940
8 JGI24740J21852_10041133 3300001979 Bacteria 1395
9 JGI24739J22299_10003310 3300001989 Bacteria 6143
10 JGI24737J22298_10002636 3300001990 Bacteria 6346
11 JGI24743J22301_10001496 3300001991 Bacteria 3251
12 JGI24750J21931_1000486 3300002070 Bacteria 6264
13 JGI24745J21846_1000039 3300002073 Bacteria 8901
14 JGI24748J21848_1000823 3300002074 Bacteria 3361
15 JGI24738J21930_10000730 3300002075 Bacteria 9473
16 JGI24749J21850_1000343 3300002076 Bacteria 6984
17 JGI24744J21845_10005872 3300002077 Bacteria 2545
18 JGI24035J26624_1000058 3300002126 Bacteria 8751
19 JGI24034J26672_10001627 3300002239 Bacteria 3005
20 JGI24742J22300_10000198 3300002244 Bacteria 8911
21 JGI24751J29686_10000813 3300002459 Bacteria 7277
22 JGI25405J52794_10024537 3300003911 Bacteria 1231
23 Ga0065712_10071767 3300005290 Bacteria 5071
24 Ga0065715_10089090 3300005293 Bacteria 14624
25 Ga0065707_10093537 3300005295 Bacteria 3615
26 Ga0070676_10003608 3300005328 Bacteria 8088
27 Ga0070683_100000585 3300005329 Bacteria 26003
28 Ga0070690_100002968 3300005330 Bacteria 9179
29 Ga0070670_100019485 3300005331 Bacteria 5823
30 Ga0070677_10000046 3300005333 Bacteria 38785
31 Ga0068869_100018348 3300005334 Bacteria 4761
32 Ga0068869_100044707 3300005334 Bacteria 3185
33 Ga0068869_100119476 3300005334 Bacteria 2014
34 Ga0070666_10012900 3300005335 Bacteria 5286
35 Ga0070666_10191364 3300005335 Unclassified 1438
36 Ga0070680_100038291 3300005336 Bacteria 3878
37 Ga0070682_100011129 3300005337 Bacteria 5133
38 Ga0068868_100004852 3300005338 Bacteria 9443
39 Ga0068868_100014135 3300005338 Bacteria 5878
40 Ga0068868_100626183 3300005338 Unclassified 956
41 Ga0070660_100016729 3300005339 Bacteria 5332
42 Ga0070660_100143674 3300005339 Bacteria 1916
43 Ga0070689_100013338 3300005340 Bacteria 5943
44 Ga0070689_100053130 3300005340 Bacteria 3135
45 Ga0070691_10005832 3300005341 Bacteria 5620
46 Ga0070687_100007741 3300005343 Bacteria 4504
47 Ga0070687_100058976 3300005343 Bacteria 2019
48 Ga0070661_100011022 3300005344 Bacteria 6299
49 Ga0070661_100072801 3300005344 Unclassified 2529
50 Ga0070661_100132055 3300005344 Bacteria 1876
51 Ga0070692_10000631 3300005345 Bacteria 11126
52 Ga0070668_100027612 3300005347 Bacteria 4309
53 Ga0070668_100087196 3300005347 Bacteria 2456
54 Ga0070668_100093787 3300005347 Bacteria 2369
55 Ga0070669_100014919 3300005353 Bacteria 5536
56 Ga0070669_100015243 3300005353 Bacteria 5475
57 Ga0070669_100134364 3300005353 Bacteria 1901
58 Ga0070675_100017649 3300005354 Bacteria 5675
59 Ga0070671_100003717 3300005355 Bacteria 11973
60 Ga0070671_100005631 3300005355 Bacteria 9970
61 Ga0070671_100014351 3300005355 Bacteria 6400
62 Ga0070671_100014919 3300005355 Bacteria 6277
63 Ga0070674_100010047 3300005356 Bacteria 5700
64 Ga0070674_100133491 3300005356 Unclassified 1854
65 Ga0070674_100231723 3300005356 Unclassified 1442
66 Ga0070673_100017883 3300005364 Bacteria 5052
67 Ga0070673_100024844 3300005364 Bacteria 4399
68 Ga0070673_100186262 3300005364 Bacteria 1780
69 Ga0070673_100249808 3300005364 Unclassified 1545
70 Ga0070673_100420164 3300005364 Bacteria 1199
71 Ga0070673_100629212 3300005364 Bacteria 981
72 Ga0070688_100005511 3300005365 Bacteria 6675
73 Ga0070688_100098479 3300005365 Bacteria 1924
74 Ga0070659_100016762 3300005366 Bacteria 5504
75 Ga0070659_100131107 3300005366 Unclassified 2036
76 Ga0070667_100013764 3300005367 Bacteria 6688
77 Ga0070667_100070171 3300005367 Bacteria 2982
78 Ga0070703_10012402 3300005406 Bacteria 2415
79 Ga0070709_10078709 3300005434 Bacteria 2146
80 Ga0070709_10388138 3300005434 Bacteria 1040
81 Ga0070714_100027998 3300005435 Bacteria 4671
82 Ga0070714_100110010 3300005435 Unclassified 2439
83 Ga0070714_100124643 3300005435 Bacteria 2295
84 Ga0070713_100168029 3300005436 Bacteria 1963
85 Ga0070713_100209598 3300005436 Unclassified 1764
86 Ga0070713_100396162 3300005436 Unclassified 1289
87 Ga0070710_10008064 3300005437 Bacteria 5119
88 Ga0070710_10019971 3300005437 Bacteria 3470
89 Ga0070701_10000116 3300005438 Bacteria 23157
90 Ga0070711_100016945 3300005439 Bacteria 4633
91 Ga0070711_100026760 3300005439 Bacteria 3782
92 Ga0070711_100069259 3300005439 Bacteria 2482
93 Ga0070705_100011033 3300005440 Bacteria 4544
94 Ga0070700_100001202 3300005441 Bacteria 12834
95 Ga0070700_100015702 3300005441 Bacteria 4300
96 Ga0070694_100001057 3300005444 Bacteria 15735
97 Ga0070708_100035671 3300005445 Bacteria 4333
98 Ga0070663_100018435 3300005455 Bacteria 4577
99 Ga0070663_100183797 3300005455 Bacteria 1623
100 Ga0070678_100004906 3300005456 Bacteria 7649
101 Ga0070678_100011782 3300005456 Bacteria 5408
102 Ga0070678_100069580 3300005456 Bacteria 2628
103 Ga0070662_100017132 3300005457 Bacteria 4877
104 Ga0070681_10027863 3300005458 Bacteria 5680
105 Ga0070681_10107353 3300005458 Bacteria 2732
106 Ga0068867_100000619 3300005459 Bacteria 23562
107 Ga0070685_10021655 3300005466 Bacteria 3497
108 Ga0070685_10169401 3300005466 Bacteria 1398
109 Ga0070679_100035946 3300005530 Bacteria 4915
110 Ga0070679_100428136 3300005530 Bacteria 1269
111 Ga0070684_100011691 3300005535 Bacteria 6998
112 Ga0070684_100033921 3300005535 Bacteria 4361
113 Ga0070684_100171844 3300005535 Bacteria 1968
114 Ga0068853_100004569 3300005539 Bacteria 10736
115 Ga0068853_100145190 3300005539 Bacteria 2132
116 Ga0068853_100412258 3300005539 Bacteria 1266
117 Ga0068853_100460587 3300005539 Bacteria 1197
118 Ga0070672_100000875 3300005543 Bacteria 18026
119 Ga0070672_100036512 3300005543 Bacteria 3744
120 Ga0070672_100089246 3300005543 Bacteria 2483
121 Ga0070672_100185890 3300005543 Unclassified 1733
122 Ga0070686_100000923 3300005544 Bacteria 16929
123 Ga0070686_100026854 3300005544 Bacteria 3479
124 Ga0070686_100059944 3300005544 Bacteria 2454
125 Ga0070686_100082785 3300005544 Unclassified 2129
126 Ga0070695_100000960 3300005545 Bacteria 15663
127 Ga0070695_100149014 3300005545 Bacteria 1631
128 Ga0070696_100010637 3300005546 Bacteria 6162
129 Ga0070696_100015013 3300005546 Bacteria 5201
130 Ga0070696_100110528 3300005546 Bacteria 1979
131 Ga0070665_100008168 3300005548 Bacteria 10598
132 Ga0070665_100119963 3300005548 Bacteria 2632
133 Ga0070704_100015740 3300005549 Bacteria 4761
134 Ga0068855_100057904 3300005563 Bacteria 4541
135 Ga0070664_100008796 3300005564 Bacteria 8180
136 Ga0070664_100011917 3300005564 Bacteria 7057
137 Ga0070664_100094572 3300005564 Bacteria 2591
138 Ga0070664_100099610 3300005564 Bacteria 2526
139 Ga0070664_100235984 3300005564 Bacteria 1640
140 Ga0070664_100416869 3300005564 Bacteria 1229
141 Ga0068857_100007206 3300005577 Bacteria 9575
142 Ga0068857_100359926 3300005577 Bacteria 1348
143 Ga0068857_100504131 3300005577 Bacteria 1136
144 Ga0068854_100003201 3300005578 Bacteria 10216
145 Ga0068854_100019078 3300005578 Bacteria 4615
146 Ga0068854_100045715 3300005578 Bacteria 3114
147 Ga0068856_100044263 3300005614 Bacteria 4380
148 Ga0068856_100092282 3300005614 Bacteria 3013
149 Ga0068856_100206495 3300005614 Bacteria 1979
150 Ga0068856_100224931 3300005614 Bacteria 1892
151 Ga0070702_100003539 3300005615 Bacteria 6998
152 Ga0070702_100068498 3300005615 Bacteria 2089
153 Ga0070702_100105591 3300005615 Bacteria 1736
154 Ga0068852_100026464 3300005616 Bacteria 4715
155 Ga0068852_100040689 3300005616 Bacteria 3923
156 Ga0068859_100000323 3300005617 Bacteria 47637
157 Ga0068859_100014029 3300005617 Bacteria 8034
158 Ga0068864_100000501 3300005618 Bacteria 33748
159 Ga0068864_100002687 3300005618 Bacteria 14661
160 Ga0068864_100157366 3300005618 Bacteria 2063
161 Ga0068864_100174037 3300005618 Bacteria 1964
162 Ga0068866_10001605 3300005718 Bacteria 9581
163 Ga0068861_100005083 3300005719 Bacteria 8875
164 Ga0068870_10000104 3300005840 Bacteria 28590
165 Ga0068863_100002181 3300005841 Bacteria 19410
166 Ga0068863_100012118 3300005841 Bacteria 8329
167 Ga0068863_100030102 3300005841 Bacteria 5185
168 Ga0068858_100002458 3300005842 Bacteria 18704
169 Ga0068858_100009333 3300005842 Bacteria 9368
170 Ga0068860_100029756 3300005843 Bacteria 5254
171 Ga0068860_100087246 3300005843 Bacteria 2970
172 Ga0068860_100256322 3300005843 Bacteria 1704
173 Ga0068860_100366894 3300005843 Bacteria 1419
174 Ga0068862_100017639 3300005844 Bacteria 5943
175 Ga0068862_100020470 3300005844 Bacteria 5527
176 Ga0068862_100029753 3300005844 Bacteria 4602
177 Ga0068862_100224551 3300005844 Bacteria 1701
178 Ga0068862_100588683 3300005844 Unclassified 1067
179 Ga0081455_10001425 3300005937 Bacteria 29567
180 Ga0081455_10005674 3300005937 Bacteria 13622
181 Ga0081455_10034020 3300005937 Bacteria 4572
182 Ga0081455_10045447 3300005937 Bacteria 3821
183 Ga0081455_10049231 3300005937 Bacteria 3634
184 Ga0081538_10122488 3300005981 Bacteria 1245
185 Ga0081540_1000086 3300005983 Bacteria 99615
186 Ga0081540_1013162 3300005983 Bacteria 5397
187 Ga0081540_1017462 3300005983 Bacteria 4441
188 Ga0081539_10000064 3300005985 Bacteria 247020
189 Ga0070717_10028620 3300006028 Unclassified 4462
190 Ga0070717_10204499 3300006028 Bacteria 1731
191 Ga0075365_10053618 3300006038 Bacteria 2671
192 Ga0070715_10007523 3300006163 Bacteria 3753
193 Ga0070715_10007548 3300006163 Bacteria 3749
194 Ga0070716_100045030 3300006173 Bacteria 2475
195 Ga0070712_100000903 3300006175 Bacteria 17757
196 Ga0070712_100001246 3300006175 Bacteria 15388
197 Ga0070712_100014800 3300006175 Bacteria 5012
198 Ga0070712_100036996 3300006175 Bacteria 3324
199 Ga0070712_100105178 3300006175 Bacteria 2096
200 Ga0070712_100229508 3300006175 Bacteria 1473
201 Ga0075367_10046625 3300006178 Bacteria 2547
202 Ga0097621_100008529 3300006237 Bacteria 7380
203 Ga0068871_100000485 3300006358 Bacteria 27172
204 Ga0068871_100104376 3300006358 Bacteria 2377
205 Ga0068871_100325046 3300006358 Bacteria 1355
206 Ga0075428_100019515 3300006844 Bacteria 7503
207 Ga0075428_100055252 3300006844 Bacteria 4350
208 Ga0075428_100213853 3300006844 Bacteria 2083
209 Ga0075430_100000164 3300006846 Bacteria 43703
210 Ga0075430_100002416 3300006846 Bacteria 15551
211 Ga0075430_100030141 3300006846 Bacteria 4607
212 Ga0075430_100501158 3300006846 Bacteria 1002
213 Ga0075431_100000986 3300006847 Bacteria 25337
214 Ga0075431_100042134 3300006847 Bacteria 4708
215 Ga0075433_10001944 3300006852 Bacteria 15534
216 Ga0075433_10010489 3300006852 Bacteria 7438
217 Ga0075434_100004417 3300006871 Bacteria 12674
218 Ga0075434_100030711 3300006871 Bacteria 5293
219 Ga0075434_100255023 3300006871 Bacteria 1773
220 Ga0075429_100016531 3300006880 Bacteria 6392
221 Ga0075429_100443136 3300006880 Bacteria 1138
222 Ga0068865_100001815 3300006881 Bacteria 12539
223 Ga0068865_100241434 3300006881 Bacteria 1422
224 Ga0097620_100000323 3300006931 Bacteria 47637
225 Ga0097620_100014029 3300006931 Bacteria 8034
226 Ga0075435_100023740 3300007076 Bacteria 4749
227 Ga0075435_100072290 3300007076 Unclassified 2818
228 Ga0075435_100141920 3300007076 Bacteria 2016
229 Ga0075435_100236147 3300007076 Bacteria 1554
230 Ga0105250_10004482 3300009092 Bacteria 6420
231 Ga0105240_10125942 3300009093 Bacteria 3078
232 Ga0111539_10000930 3300009094 Bacteria 38345
233 Ga0111539_10002680 3300009094 Bacteria 23585
234 Ga0111539_10004845 3300009094 Bacteria 17538
235 Ga0111539_10007277 3300009094 Bacteria 14171
236 Ga0111539_10053440 3300009094 Bacteria 4808
237 Ga0111539_10264825 3300009094 Bacteria 2001
238 Ga0105245_10001701 3300009098 Bacteria 20027
239 Ga0105245_10014199 3300009098 Bacteria 6941
240 Ga0105247_10015729 3300009101 Bacteria 4530
241 Ga0105247_10020219 3300009101 Bacteria 4002
242 Ga0105247_10162666 3300009101 Bacteria 1479
243 Ga0105247_10236681 3300009101 Bacteria 1242
244 Ga0114129_10004791 3300009147 Bacteria 19126
245 Ga0114129_10065648 3300009147 Bacteria 5064
246 Ga0114129_10123771 3300009147 Bacteria 3556
247 Ga0114129_10256062 3300009147 Unclassified 2348
248 Ga0114129_10434617 3300009147 Bacteria 1724
249 Ga0114129_10963216 3300009147 Bacteria 1077
250 Ga0105243_10026025 3300009148 Bacteria 4477
251 Ga0105243_10085590 3300009148 Unclassified 2584
252 Ga0105243_10090303 3300009148 Bacteria 2520
253 Ga0105243_10382476 3300009148 Bacteria 1302
254 Ga0105241_10000805 3300009174 Bacteria 23823
255 Ga0105241_10012529 3300009174 Bacteria 6218
256 Ga0105241_10099248 3300009174 Unclassified 2312
257 Ga0105241_10283075 3300009174 Bacteria 1417
258 Ga0105242_10004554 3300009176 Bacteria 10756
259 Ga0105242_10020924 3300009176 Bacteria 5131
260 Ga0105242_10109990 3300009176 Unclassified 2347
261 Ga0105242_10205064 3300009176 Bacteria 1753
262 Ga0105242_10228977 3300009176 Bacteria 1665
263 Ga0105248_10007773 3300009177 Bacteria 11767
264 Ga0105248_10012541 3300009177 Bacteria 9350
265 Ga0105248_10014249 3300009177 Bacteria 8752
266 Ga0105248_10045407 3300009177 Bacteria 4927
267 Ga0105248_10073290 3300009177 Bacteria 3849
268 Ga0105248_10256090 3300009177 Bacteria 1970
269 Ga0105237_10024690 3300009545 Bacteria 6148
270 Ga0105238_10057979 3300009551 Bacteria 3882
271 Ga0105249_10075277 3300009553 Bacteria 3126
272 Ga0105249_10301612 3300009553 Bacteria 1607
273 Ga0105249_10450947 3300009553 Bacteria 1325
274 Ga0105239_10043858 3300010375 Bacteria 4904
275 Ga0105239_10082161 3300010375 Bacteria 3547
276 Ga0105239_10355647 3300010375 Bacteria 1654
277 Ga0105246_10002092 3300011119 Bacteria 12025
278 Ga0105246_10158351 3300011119 Unclassified 1722
279 Ga0105246_10195911 3300011119 Bacteria 1567
280 Ga0105246_10248405 3300011119 Bacteria 1410
281 Ga0105246_10321907 3300011119 Bacteria 1257
282 Ga0105246_10328553 3300011119 Unclassified 1245
283 Ga0157338_1001046 3300012515 Unclassified 1884
284 Ga0157373_10174842 3300013100 Bacteria 1511
285 Ga0157371_10014330 3300013102 Bacteria 5986
286 Ga0157369_10502410 3300013105 Bacteria 1254
287 Ga0157369_10689858 3300013105 Bacteria 1052
288 Ga0157374_10005194 3300013296 Bacteria 10921
289 Ga0157374_10351302 3300013296 Bacteria 1465
290 Ga0157374_10440896 3300013296 Unclassified 1303
291 Ga0157378_10011410 3300013297 Bacteria 7779
292 Ga0157378_10539966 3300013297 Bacteria 1170
293 Ga0163162_10039217 3300013306 Bacteria 4732
294 Ga0163162_10078758 3300013306 Bacteria 3361
295 Ga0163162_10090824 3300013306 Bacteria 3136
296 Ga0157372_10016173 3300013307 Bacteria 8004
297 Ga0157375_10001699 3300013308 Bacteria 18899
298 Ga0157375_10505573 3300013308 Bacteria 1372
299 Ga0157375_10693608 3300013308 Unclassified 1172
300 Ga0163163_10000489 3300014325 Bacteria 35830
301 Ga0163163_10029460 3300014325 Bacteria 5281
302 Ga0163163_10103106 3300014325 Bacteria 2877
303 Ga0163163_10144821 3300014325 Bacteria 2419
304 Ga0157380_10020406 3300014326 Bacteria 4953
305 Ga0157380_10023469 3300014326 Bacteria 4653
306 Ga0157377_10002656 3300014745 Bacteria 7931
307 Ga0157379_10004716 3300014968 Bacteria 11706
308 Ga0157379_10007629 3300014968 Bacteria 9363
309 Ga0157379_10010586 3300014968 Bacteria 8039
310 Ga0157379_10013998 3300014968 Bacteria 7031
311 Ga0157379_10212857 3300014968 Bacteria 1750
312 Ga0157376_10030975 3300014969 Bacteria 4278
313 Ga0157376_10170656 3300014969 Bacteria 1981
314 Ga0157376_10222620 3300014969 Bacteria 1748
315 Ga0157376_10518259 3300014969 Bacteria 1175
316 Ga0163161_10002208 3300017792 Bacteria 14038
317 Ga0163161_10038349 3300017792 Unclassified 3437
318 Ga0224572_1001032 3300024225 Bacteria 3872
319 Ga0207666_1000245 3300025271 Bacteria 7999
320 Ga0207673_1003029 3300025290 Bacteria 1949
321 Ga0207697_10003263 3300025315 Bacteria 8062
322 Ga0207653_10017221 3300025885 Bacteria 2273
323 Ga0207682_10000793 3300025893 Bacteria 14622
324 Ga0207692_10025244 3300025898 Bacteria 2773
325 Ga0207642_10001880 3300025899 Bacteria 6476
326 Ga0207710_10007749 3300025900 Bacteria 4543
327 Ga0207710_10089573 3300025900 Bacteria 1438
328 Ga0207688_10000420 3300025901 Bacteria 19959
329 Ga0207680_10006456 3300025903 Bacteria 5668
330 Ga0207680_10133951 3300025903 Bacteria 1636
331 Ga0207647_10004676 3300025904 Bacteria 10143
332 Ga0207647_10046531 3300025904 Bacteria 2703
333 Ga0207685_10020702 3300025905 Bacteria 2191
334 Ga0207699_10088829 3300025906 Bacteria 1935
335 Ga0207645_10000668 3300025907 Bacteria 28444
336 Ga0207643_10000085 3300025908 Bacteria 61372
337 Ga0207643_10011878 3300025908 Bacteria 4700
338 Ga0207654_10000373 3300025911 Bacteria 26098
339 Ga0207654_10095182 3300025911 Bacteria 1824
340 Ga0207707_10011682 3300025912 Bacteria 7643
341 Ga0207707_10104589 3300025912 Bacteria 2474
342 Ga0207695_10153710 3300025913 Bacteria 2238
343 Ga0207671_10006714 3300025914 Bacteria 10192
344 Ga0207693_10001322 3300025915 Bacteria 21965
345 Ga0207693_10001438 3300025915 Bacteria 21113
346 Ga0207693_10026127 3300025915 Bacteria 4623
347 Ga0207693_10029261 3300025915 Bacteria 4353
348 Ga0207693_10064662 3300025915 Bacteria 2865
349 Ga0207693_10124525 3300025915 Bacteria 2025
350 Ga0207693_10185317 3300025915 Bacteria 1638
351 Ga0207663_10005341 3300025916 Bacteria 6465
352 Ga0207663_10083280 3300025916 Bacteria 2101
353 Ga0207663_10168519 3300025916 Bacteria 1553
354 Ga0207663_10228576 3300025916 Unclassified 1358
355 Ga0207660_10002189 3300025917 Bacteria 12932
356 Ga0207662_10000730 3300025918 Bacteria 15052
357 Ga0207657_10007870 3300025919 Bacteria 10880
358 Ga0207657_10072772 3300025919 Bacteria 2906
359 Ga0207649_10000476 3300025920 Bacteria 28654
360 Ga0207649_10230862 3300025920 Bacteria 1323
361 Ga0207652_10003058 3300025921 Bacteria 13968
362 Ga0207681_10006586 3300025923 Bacteria 7132
363 Ga0207681_10048551 3300025923 Bacteria 2865
364 Ga0207650_10028502 3300025925 Bacteria 4005
365 Ga0207650_10198426 3300025925 Unclassified 1606
366 Ga0207659_10010174 3300025926 Bacteria 5898
367 Ga0207687_10001321 3300025927 Bacteria 16972
368 Ga0207687_10192793 3300025927 Bacteria 1587
369 Ga0207700_10044752 3300025928 Bacteria 3261
370 Ga0207700_10069414 3300025928 Bacteria 2705
371 Ga0207700_10137461 3300025928 Unclassified 2004
372 Ga0207700_10165035 3300025928 Bacteria 1842
373 Ga0207700_10223955 3300025928 Unclassified 1596
374 Ga0207700_10301920 3300025928 Bacteria 1383
375 Ga0207644_10000759 3300025931 Bacteria 20458
376 Ga0207644_10004908 3300025931 Bacteria 8719
377 Ga0207644_10007993 3300025931 Bacteria 6917
378 Ga0207644_10024244 3300025931 Bacteria 4163
379 Ga0207690_10004643 3300025932 Bacteria 8126
380 Ga0207690_10022775 3300025932 Bacteria 3900
381 Ga0207690_10100671 3300025932 Unclassified 2063
382 Ga0207690_10119236 3300025932 Bacteria 1914
383 Ga0207706_10013555 3300025933 Bacteria 7406
384 Ga0207706_10043416 3300025933 Bacteria 3983
385 Ga0207706_10129440 3300025933 Bacteria 2220
386 Ga0207686_10000682 3300025934 Bacteria 21032
387 Ga0207686_10058551 3300025934 Bacteria 2429
388 Ga0207709_10002503 3300025935 Bacteria 11496
389 Ga0207709_10022112 3300025935 Bacteria 3605
390 Ga0207709_10050302 3300025935 Bacteria 2548
391 Ga0207670_10000908 3300025936 Bacteria 15642
392 Ga0207670_10081270 3300025936 Bacteria 2268
393 Ga0207669_10000129 3300025937 Bacteria 37620
394 Ga0207704_10000366 3300025938 Bacteria 20998
395 Ga0207665_10015654 3300025939 Unclassified 4977
396 Ga0207665_10026086 3300025939 Bacteria 3856
397 Ga0207665_10399677 3300025939 Bacteria 1046
398 Ga0207691_10010088 3300025940 Bacteria 9064
399 Ga0207691_10029040 3300025940 Bacteria 5173
400 Ga0207691_10040566 3300025940 Bacteria 4300
401 Ga0207691_10041706 3300025940 Bacteria 4236
402 Ga0207691_10107655 3300025940 Bacteria 2481
403 Ga0207711_10000042 3300025941 Bacteria 158782
404 Ga0207711_10043312 3300025941 Bacteria 3838
405 Ga0207711_10203389 3300025941 Bacteria 1808
406 Ga0207711_10351715 3300025941 Bacteria 1364
407 Ga0207711_10446168 3300025941 Unclassified 1204
408 Ga0207689_10002200 3300025942 Bacteria 18279
409 Ga0207689_10027825 3300025942 Bacteria 4731
410 Ga0207661_10000373 3300025944 Bacteria 28733
411 Ga0207661_10537366 3300025944 Unclassified 1070
412 Ga0207679_10001125 3300025945 Bacteria 17047
413 Ga0207679_10030464 3300025945 Bacteria 3768
414 Ga0207667_10025152 3300025949 Bacteria 6523
415 Ga0207651_10002032 3300025960 Bacteria 9512
416 Ga0207651_10031594 3300025960 Unclassified 3388
417 Ga0207712_10002238 3300025961 Bacteria 12597
418 Ga0207712_10043634 3300025961 Bacteria 3094
419 Ga0207668_10001143 3300025972 Bacteria 15797
420 Ga0207668_10559908 3300025972 Bacteria 991
421 Ga0207640_10019608 3300025981 Bacteria 3999
422 Ga0207640_10346001 3300025981 Bacteria 1193
423 Ga0207640_10426011 3300025981 Bacteria 1087
424 Ga0207640_10479902 3300025981 Bacteria 1031
425 Ga0207658_10008091 3300025986 Bacteria 7161
426 Ga0207658_10017529 3300025986 Bacteria 4936
427 Ga0207658_10020382 3300025986 Bacteria 4591
428 Ga0207658_10057545 3300025986 Bacteria 2890
429 Ga0207658_10096320 3300025986 Bacteria 2307
430 Ga0207677_10009995 3300026023 Bacteria 5354
431 Ga0207703_10001627 3300026035 Bacteria 20231
432 Ga0207703_10002493 3300026035 Bacteria 15957
433 Ga0207703_10041859 3300026035 Bacteria 3672
434 Ga0207639_10005334 3300026041 Bacteria 8683
435 Ga0207639_10203397 3300026041 Bacteria 1700
436 Ga0207678_10010758 3300026067 Bacteria 8039
437 Ga0207678_10018247 3300026067 Bacteria 6161
438 Ga0207678_10067149 3300026067 Unclassified 3078
439 Ga0207708_10007465 3300026075 Bacteria 8078
440 Ga0207708_10007573 3300026075 Bacteria 8033
441 Ga0207702_10017909 3300026078 Bacteria 5861
442 Ga0207702_10030876 3300026078 Bacteria 4465
443 Ga0207702_10132468 3300026078 Bacteria 2245
444 Ga0207702_10303614 3300026078 Bacteria 1515
445 Ga0207641_10000927 3300026088 Bacteria 30260
446 Ga0207641_10002374 3300026088 Bacteria 17373
447 Ga0207641_10030449 3300026088 Bacteria 4470
448 Ga0207648_10001362 3300026089 Bacteria 26996
449 Ga0207676_10000435 3300026095 Bacteria 35291
450 Ga0207676_10001403 3300026095 Bacteria 17929
451 Ga0207676_10016664 3300026095 Bacteria 5322
452 Ga0207676_10107821 3300026095 Bacteria 2324
453 Ga0207674_10011327 3300026116 Bacteria 10022
454 Ga0207675_100004955 3300026118 Bacteria 12836
455 Ga0207675_100150113 3300026118 Bacteria 2218
456 Ga0207683_10001172 3300026121 Bacteria 23710
457 Ga0207683_10001220 3300026121 Bacteria 23334
458 Ga0207683_10077777 3300026121 Bacteria 2939
459 Ga0207683_10077868 3300026121 Bacteria 2937
460 Ga0207683_10102696 3300026121 Bacteria 2553
461 Ga0207698_10016256 3300026142 Bacteria 5011
462 Ga0207698_10026603 3300026142 Bacteria 4094
463 Ga0207698_10812108 3300026142 Bacteria 938
464 Ga0210002_1000487 3300027617 Bacteria 5390
465 Ga0209983_1011416 3300027665 Bacteria 1818
466 Ga0209998_10001714 3300027717 Bacteria 5229
467 Ga0207428_10000322 3300027907 Bacteria 62220
468 Ga0207428_10000896 3300027907 Bacteria 33348
469 Ga0207428_10061970 3300027907 Bacteria 2958
470 Ga0207428_10069209 3300027907 Bacteria 2775
471 Ga0268266_10000832 3300028379 Bacteria 40381
472 Ga0268266_10118531 3300028379 Bacteria 2353
473 Ga0268265_10002919 3300028380 Bacteria 12534
474 Ga0268265_10005917 3300028380 Bacteria 8329
475 Ga0268265_10052875 3300028380 Bacteria 3074
476 Ga0268265_10167423 3300028380 Bacteria 1874
477 Ga0268264_10001202 3300028381 Bacteria 24970
478 Ga0268264_10070437 3300028381 Bacteria 2960
479 Ga0268264_10344177 3300028381 Bacteria 1417
480 Ga0265338_10038132 3300028800 Bacteria 4558
481 Ga0265760_10036800 3300031090 Bacteria 1452
482 Ga0265330_10029512 3300031235 Bacteria 2466
483 Ga0265320_10162888 3300031240 Unclassified 1004
484 Ga0265325_10001243 3300031241 Bacteria 18175
485 Ga0265339_10000091 3300031249 Bacteria 75937
486 Ga0265339_10018360 3300031249 Bacteria 4123
487 Ga0265339_10029357 3300031249 Bacteria 3120
488 Ga0265316_10064489 3300031344 Bacteria 2838
489 Ga0265316_10135806 3300031344 Bacteria 1850
490 Ga0307513_10013540 3300031456 Bacteria 10004
491 Ga0265313_10001068 3300031595 Bacteria 26548
492 Ga0265313_10017130 3300031595 Bacteria 4133
493 Ga0265313_10097002 3300031595 Bacteria 1314
494 Ga0265314_10057584 3300031711 Bacteria 2667
495 Ga0265314_10108459 3300031711 Bacteria 1769
496 Ga0265342_10027560 3300031712 Bacteria 3548
497 Ga0265342_10028347 3300031712 Bacteria 3490
498 Ga0265342_10060407 3300031712 Bacteria 2235
499 Ga0265342_10156548 3300031712 Unclassified 1262
500 Ga0307413_10164418 3300031824 Bacteria 1563
501 Ga0307410_10008367 3300031852 Bacteria 5732
502 Ga0307409_100201662 3300031995 Bacteria 1780
503 Ga0307416_100214981 3300032002 Bacteria 1838
504 Ga0373930_0010920 3300034816 Bacteria 1631
505 Ga0373948_0000934 3300034817 Bacteria 3911
506 Ga0373950_0008932 3300034818 Bacteria 1588
507 Ga0373958_0008311 3300034819 Bacteria 1678
508 Ga0373959_0017794 3300034820 Bacteria 1330
509 Ga0373938_0001605 3300034957 Bacteria 3640
510 Ga0373938_0004290 3300034957 Bacteria 2374
511 Ga0373926_0013724 3300035083 Bacteria 2750
512 Ga0373929_0007035 3300035085 Bacteria 2047
513 Ga0373934_0013975 3300035086 Unclassified 3039
514 Ga0373940_0012918 3300035088 Bacteria 2009
515 Ga0373940_0032676 3300035088 Bacteria 1396
516 Ga0373944_0102245 3300035089 Unclassified 969
517 Ga0373949_0001617 3300035090 Bacteria 6309
518 Ga0373949_0008699 3300035090 Unclassified 2222
519 Ga0373951_0000816 3300035091 Bacteria 8470
520 Ga0373952_0000725 3300035092 Bacteria 5889
521 Ga0373952_0012409 3300035092 Bacteria 1676
522 Ga0373923_0031535 3300035111 Bacteria 2137
523 Ga0373923_0036242 3300035111 Bacteria 2013
524 Ga0373923_0063142 3300035111 Unclassified 1577
525 Ga0373923_0065154 3300035111 Bacteria 1555
526 Ga0373932_0002655 3300035112 Bacteria 4456
527 Ga0373936_0067900 3300035113 Unclassified 1466
528 Ga0373939_0002266 3300035114 Bacteria 4552
529 Ga0373939_0011072 3300035114 Unclassified 2268
530 Ga0373941_0000710 3300035115 Bacteria 6832
531 Ga0373945_0054522 3300035116 Bacteria 1478
532 Ga0373954_0029351 3300035118 Unclassified 2532
533 Ga0373956_0101308 3300035119 Bacteria 1336
534 Ga0373957_0048508 3300035120 Bacteria 1618
535 Ga0373960_0000528 3300035121 Bacteria 7654
536 Ga0373960_0001486 3300035121 Bacteria 5201
537 Ga0373960_0080156 3300035121 Bacteria 1026
538 Ga0373943_0004637 3300035170 Bacteria 6215
539 Ga0373943_0031187 3300035170 Unclassified 2527
540 Ga0373943_0053186 3300035170 Bacteria 1999
541 Ga0373946_0011371 3300035171 Bacteria 3320
542 Ga0373946_0082488 3300035171 Bacteria 1410
543 Ga0373955_0009883 3300035172 Bacteria 4488
544 Ga0373955_0022291 3300035172 Bacteria 3211
545 Ga0373942_0003528 3300035207 Bacteria 3673
546 Ga0373961_0012891 3300035241 Bacteria 2099
547 Ga0373962_0000893 3300035242 Bacteria 6824
548 Ga0373924_0002373 3300035410 Bacteria 6338
549 Ga0373931_0016718 3300035691 Bacteria 3615
550 Ga0373931_0065125 3300035691 Bacteria 1974
551 Ga0373931_0072616 3300035691 Unclassified 1882
552 Ga0373931_0191196 3300035691 Unclassified 1218
553 Ga0373935_0037934 3300035692 Unclassified 3016
554 Ga0373935_0099561 3300035692 Bacteria 1914
555 Ga0373935_0208383 3300035692 Unclassified 1353
556 Ga0373935_0422678 3300035692 Unclassified 959
557 Ga0373927_0015422 3300035695 Bacteria 5050
558 Ga0373927_0044216 3300035695 Bacteria 2882
559 Ga0373927_0062284 3300035695 Unclassified 2412
560 Ga0373927_0123840 3300035695 Bacteria 1687
561 Ga0373927_0153377 3300035695 Bacteria 1508
562 Ga0373933_0004840 3300035724 Bacteria 7356
563 Ga0373933_0014329 3300035724 Bacteria 4409
564 Ga0373933_0056092 3300035724 Bacteria 2364
565 Ga0373933_0070402 3300035724 Bacteria 2128
566 Ga0373947_0001934 3300035725 Bacteria 12684
567 Ga0373947_0005748 3300035725 Bacteria 7231
568 Ga0373947_0011643 3300035725 Bacteria 5044
569 Ga0373947_0057024 3300035725 Bacteria 2362
570 Ga0373937_0002583 3300036401 Bacteria 15057
571 Ga0373937_0005204 3300036401 Bacteria 11104
572 Ga0373937_0007138 3300036401 Bacteria 9654
573 Ga0373937_0509815 3300036401 Unclassified 1143
574 Ga0373937_0581488 3300036401 Unclassified 1063
575 Ga0373925_0018031 3300037068 Bacteria 5127
576 Ga0373925_0025873 3300037068 Bacteria 4290
577 Ga0373925_0035442 3300037068 Bacteria 3681
578 Ga0373925_0043734 3300037068 Unclassified 3325
579 Ga0373925_0068198 3300037068 Bacteria 2684
580 Ga0373925_0100873 3300037068 Bacteria 2219
581 Ga0395899_0099652 3300037312 Bacteria 2099
582 Ga0395899_0102330 3300037312 Bacteria 2067
583 Ga0395899_0170745 3300037312 Bacteria 1531
584 Ga0395900_0037499 3300037418 Bacteria 4997
585 Ga0395900_0153873 3300037418 Bacteria 2349
586 Ga0395898_0047892 3300037466 Bacteria 4192
587 Ga0395898_0083593 3300037466 Bacteria 3077
588 Ga0395898_0331420 3300037466 Bacteria 1451
589 Ga0395905_0031832 3300037471 Bacteria 4963
590 Ga0395905_0061486 3300037471 Bacteria 3513
591 Ga0395905_0181965 3300037471 Bacteria 1973
592 Ga0395905_0527274 3300037471 Unclassified 1082
593 Ga0395901_0021682 3300038443 Bacteria 6582
594 Ga0395901_0039197 3300038443 Bacteria 4903
595 Ga0395901_0159622 3300038443 Bacteria 2368
596 Ga0395901_0252021 3300038443 Bacteria 1839
597 Ga0436365_0204940 3300039437 Bacteria 1017
598 Ga0436365_0933878 3300039437 Bacteria 3053
599 Ga0436365_0947958 3300039437 Bacteria 2217
600 Ga0436361_0201393 3300039447 Bacteria 14498
601 Ga0436361_0265181 3300039447 Bacteria 1019
602 Ga0436361_0862585 3300039447 Bacteria 1608
603 Ga0436361_0866592 3300039447 Bacteria 896
604 Ga0436363_0460390 3300039450 Bacteria 6221
605 Ga0436363_1308327 3300039450 Bacteria 2813
606 Ga0450905_000421 3300042142 Bacteria 5172
607 Ga0450889_000015 3300042144 Bacteria 15151
608 Ga0439464_0039570 3300042439 Unclassified 1341
609 Ga0451577_0113507 3300042876 Bacteria 2425
610 Ga0451576_0000159 3300045051 Bacteria 171363
611 Ga0495617_038603 3300046452 Unclassified 1597
612 Ga0495592_0031388 3300046454 Bacteria 4015
613 Ga0495603_0007068 3300046455 Bacteria 6734
614 Ga0495603_0046367 3300046455 Bacteria 2590
615 Ga0495590_0039865 3300046457 Bacteria 1639
616 Ga0495629_0000140 3300046459 Bacteria 63496
617 Ga0495629_0002843 3300046459 Bacteria 13232
618 Ga0495629_0030081 3300046459 Bacteria 3850
619 Ga0495629_0047991 3300046459 Bacteria 2994
620 Ga0495641_0009773 3300046461 Bacteria 5659
621 Ga0495651_0001969 3300046462 Bacteria 15901
622 Ga0495651_0003550 3300046462 Bacteria 11959
623 Ga0495653_0009210 3300046463 Bacteria 8076
624 Ga0495653_0023662 3300046463 Bacteria 4958
625 Ga0495580_0118134 3300046472 Bacteria 1841
626 Ga0495580_0157080 3300046472 Bacteria 1575
627 Ga0495580_0221222 3300046472 Bacteria 1301
628 Ga0495582_0121208 3300046473 Unclassified 1473
629 Ga0495639_0244386 3300046475 Bacteria 886
630 Ga0495662_0021111 3300046476 Bacteria 3149
631 Ga0495662_0037776 3300046476 Bacteria 2332
632 Ga0495664_0001514 3300046477 Bacteria 12304
633 Ga0495664_0062554 3300046477 Bacteria 2217
634 Ga0495664_0095894 3300046477 Bacteria 1785
635 Ga0495584_0013124 3300046491 Bacteria 4226
636 Ga0495584_0077012 3300046491 Bacteria 1677
637 Ga0495584_0120731 3300046491 Archaea 1327
638 Ga0495584_0152354 3300046491 Bacteria 1174
639 Ga0495585_0012013 3300046492 Bacteria 5110
640 Ga0495585_0044457 3300046492 Bacteria 2481
641 Ga0495594_0004885 3300046499 Bacteria 6901
642 Ga0495594_0186120 3300046499 Unclassified 1182
643 Ga0495594_0236898 3300046499 Bacteria 1040
644 Ga0495606_0000252 3300046507 Bacteria 94511
645 Ga0495608_0002947 3300046511 Bacteria 12168
646 Ga0495608_0007807 3300046511 Bacteria 7528
647 Ga0495618_0011920 3300046514 Bacteria 5276
648 Ga0495618_0018939 3300046514 Unclassified 4229
649 Ga0495618_0020553 3300046514 Bacteria 4064
650 Ga0495618_0046181 3300046514 Unclassified 2748
651 Ga0495620_0106045 3300046515 Bacteria 1117
652 Ga0495628_0016676 3300046516 Bacteria 6125
653 Ga0495628_0168694 3300046516 Bacteria 1660
654 Ga0495630_0074980 3300046517 Bacteria 2549
655 Ga0495630_0226282 3300046517 Bacteria 1428
656 Ga0495630_0655881 3300046517 Bacteria 803
657 Ga0495637_0081423 3300046520 Unclassified 1290
658 Ga0495644_0009079 3300046523 Bacteria 3828
659 Ga0495663_0020370 3300046525 Bacteria 1903
660 Ga0495663_0070071 3300046525 Bacteria 1115
661 Ga0495666_0065009 3300046526 Bacteria 1740
662 Ga0495642_0062486 3300046528 Bacteria 1547
663 Ga0495642_0145203 3300046528 Bacteria 1025
664 Ga0495652_0007323 3300046529 Bacteria 10178
665 Ga0495652_0020176 3300046529 Bacteria 5924
666 Ga0495652_0248193 3300046529 Unclassified 1320
667 Ga0495652_0444653 3300046529 Unclassified 909
668 Ga0495665_0019725 3300046531 Bacteria 3626
669 Ga0495665_0044130 3300046531 Bacteria 2370
670 Ga0495665_0124079 3300046531 Bacteria 1352
671 Ga0495640_0003070 3300046533 Bacteria 13446
672 Ga0495640_0011331 3300046533 Bacteria 6865
673 Ga0495640_0022000 3300046533 Bacteria 4669
674 Ga0495640_0256887 3300046533 Bacteria 1092
675 Ga0495586_0015904 3300046535 Bacteria 4003
676 Ga0495587_0107035 3300046536 Unclassified 1608
677 Ga0495645_0008448 3300046543 Bacteria 7193
678 Ga0495645_0243125 3300046543 Bacteria 1200
679 Ga0495622_0007036 3300046557 Bacteria 5223
680 Ga0495622_0115247 3300046557 Bacteria 1229
681 Ga0495633_0028229 3300046558 Bacteria 2737
682 Ga0495667_0000936 3300046559 Bacteria 18847
683 Ga0495667_0007174 3300046559 Bacteria 7562
684 Ga0495667_0052243 3300046559 Unclassified 2693
685 Ga0495667_0079051 3300046559 Bacteria 2138
686 Ga0495656_0001649 3300046615 Bacteria 7304
687 Ga0495668_0107403 3300046616 Bacteria 1526
688 Ga0495634_0006588 3300046642 Bacteria 8808
689 Ga0495634_0049795 3300046642 Bacteria 2815
690 Ga0495634_0137246 3300046642 Bacteria 1555
691 Ga0495634_0289166 3300046642 Unclassified 993
692 Ga0495611_0092957 3300046648 Bacteria 1395
693 Ga0495625_0081142 3300046660 Bacteria 2258
694 Ga0495635_0000803 3300046663 Bacteria 20530
695 Ga0495635_0010366 3300046663 Bacteria 6518
696 Ga0495635_0010910 3300046663 Bacteria 6370
697 Ga0495635_0023545 3300046663 Bacteria 4289
698 Ga0495635_0204552 3300046663 Bacteria 1338
699 Ga0495659_0004853 3300046664 Unclassified 4232
700 Ga0495659_0058045 3300046664 Bacteria 1423
701 Ga0495657_0008655 3300046675 Bacteria 7765
702 Ga0495657_0013677 3300046675 Bacteria 5978
703 Ga0495599_0009856 3300046678 Bacteria 5849
704 Ga0495623_0004153 3300046679 Bacteria 9551
705 Ga0495623_0104284 3300046679 Bacteria 1724
706 Ga0495646_0011637 3300046680 Bacteria 5590
707 Ga0495646_0015003 3300046680 Bacteria 4922
708 Ga0495647_0001772 3300046681 Bacteria 6694
709 Ga0495647_0100883 3300046681 Unclassified 1195
710 Ga0495658_0001441 3300046683 Bacteria 12509
711 Ga0495658_0019035 3300046683 Bacteria 3579
712 Ga0495658_0021917 3300046683 Bacteria 3373
713 Ga0495658_0175856 3300046683 Bacteria 1326
714 Ga0495669_0007930 3300046684 Bacteria 4457
715 Ga0495613_0032219 3300046689 Unclassified 3892
716 Ga0495613_0053690 3300046689 Bacteria 2964
717 Ga0495613_0112177 3300046689 Bacteria 1964
718 Ga0495613_0224577 3300046689 Bacteria 1317
719 Ga0495624_0004977 3300046690 Bacteria 9627
720 Ga0495624_0041472 3300046690 Bacteria 2943
721 Ga0495624_0071665 3300046690 Bacteria 2156
722 Ga0495670_0044171 3300046691 Bacteria 2224
723 Ga0495670_0088786 3300046691 Archaea 1580
724 Ga0495649_0005354 3300046694 Bacteria 8185
725 Ga0495589_0025192 3300046794 Bacteria 3020
726 Ga0495589_0139408 3300046794 Bacteria 1162
727 Ga0495600_0012802 3300046809 Bacteria 5254
728 Ga0495581_0011677 3300047315 Bacteria 5083
729 Ga0495581_0033129 3300047315 Unclassified 2992
730 Ga0495581_0167927 3300047315 Bacteria 1283
731 Ga0495604_0001803 3300047317 Bacteria 17442
732 Ga0495604_0007398 3300047317 Bacteria 8702
733 Ga0495604_0122120 3300047317 Unclassified 1884
734 Ga0495636_0164204 3300047318 Bacteria 1002
735 Ga0495674_0005466 3300047319 Bacteria 12206
736 Ga0495674_0010028 3300047319 Bacteria 8979
737 Ga0495674_0014669 3300047319 Bacteria 7331
738 Ga0495674_0017525 3300047319 Bacteria 6666
739 Ga0495674_0029644 3300047319 Bacteria 4980
740 Ga0495674_0180017 3300047319 Unclassified 1761
741 Ga0495676_0050527 3300047321 Bacteria 3334
742 Ga0495676_0280443 3300047321 Bacteria 1128
743 Ga0495676_0306672 3300047321 Bacteria 1069
744 Ga0495676_0356632 3300047321 Bacteria 977
745 Ga0495680_0006822 3300047322 Bacteria 10546
746 Ga0495680_0014641 3300047322 Bacteria 6784
747 Ga0495680_0123956 3300047322 Bacteria 1905
748 Ga0495675_0023294 3300047444 Bacteria 3945
749 Ga0495679_018305 3300047446 Bacteria 2489
750 Ga0495684_0007012 3300047471 Bacteria 8752
751 Ga0495684_0008246 3300047471 Bacteria 8065
752 Ga0495684_0008574 3300047471 Bacteria 7915
753 Ga0495684_0236077 3300047471 Bacteria 1335
754 Ga0495686_0070290 3300047472 Bacteria 2157
755 Ga0495593_0013260 3300047673 Bacteria 4705
756 Ga0495593_0016502 3300047673 Bacteria 4164
757 Ga0495593_0046567 3300047673 Bacteria 2310
758 Ga0495602_0003594 3300048088 Bacteria 16058
759 Ga0495602_0038382 3300048088 Bacteria 4428
760 Ga0495602_0226321 3300048088 Bacteria 1408
761 Ga0495615_0027225 3300048090 Unclassified 1340
762 Ga0495626_0093157 3300048091 Unclassified 1323
763 Ga0496100_0013352 3300048903 Bacteria 4735
764 Ga0496100_0045666 3300048903 Bacteria 2812
765 Ga0496100_0050754 3300048903 Bacteria 2689
766 Ga0496100_0051881 3300048903 Bacteria 2664
767 Ga0496100_0195655 3300048903 Bacteria 1470
768 Ga0496100_0220772 3300048903 Bacteria 1391
769 Ga0496100_0307207 3300048903 Bacteria 1188
770 Ga0496101_0024236 3300048904 Bacteria 4197
771 Ga0496101_0071673 3300048904 Bacteria 2540
772 Ga0496101_0111412 3300048904 Unclassified 2060
773 Ga0496102_0016598 3300048905 Bacteria 6437
774 Ga0496102_0020964 3300048905 Bacteria 5779
775 Ga0496102_0029331 3300048905 Bacteria 4923
776 Ga0496102_0177184 3300048905 Bacteria 2008
777 Ga0496102_0362042 3300048905 Bacteria 1366
778 Ga0496103_0005145 3300048906 Bacteria 7872
779 Ga0496103_0023092 3300048906 Unclassified 3749
780 Ga0496103_0035005 3300048906 Bacteria 3073
781 Ga0496103_0066782 3300048906 Bacteria 2245
782 Ga0496103_0086307 3300048906 Bacteria 1978
783 Ga0496103_0106122 3300048906 Bacteria 1781
784 Ga0496104_0001024 3300048907 Bacteria 23928
785 Ga0496104_0017158 3300048907 Bacteria 6585
786 Ga0496104_0038358 3300048907 Bacteria 4482
787 Ga0496104_0100386 3300048907 Bacteria 2770
788 Ga0496104_0103201 3300048907 Bacteria 2732
789 Ga0496104_0198467 3300048907 Bacteria 1918
790 Ga0496104_0241051 3300048907 Bacteria 1720
791 Ga0496105_0004939 3300048908 Bacteria 10082
792 Ga0496105_0044353 3300048908 Unclassified 3667
793 Ga0496105_0057598 3300048908 Bacteria 3208
794 Ga0496105_0067781 3300048908 Bacteria 2947
795 Ga0496105_0072206 3300048908 Bacteria 2852
796 Ga0496105_0091432 3300048908 Bacteria 2513
797 Ga0496105_0377511 3300048908 Unclassified 1128
798 Ga0496106_0009502 3300048909 Bacteria 7185
799 Ga0496106_0020443 3300048909 Bacteria 4912
800 Ga0496106_0029158 3300048909 Unclassified 4111
801 Ga0496106_0054915 3300048909 Bacteria 3010
802 Ga0496106_0178532 3300048909 Bacteria 1685
803 Ga0496106_0186010 3300048909 Bacteria 1650
804 Ga0496106_0227121 3300048909 Bacteria 1490
805 Ga0496106_0353995 3300048909 Bacteria 1179
806 Ga0496106_0596748 3300048909 Unclassified 884
807 Ga0496107_0012082 3300048910 Bacteria 6021
808 Ga0496107_0048939 3300048910 Bacteria 3046
809 Ga0496107_0099472 3300048910 Bacteria 2131
810 Ga0496107_0277241 3300048910 Bacteria 1248
811 Ga0496108_0016733 3300048911 Bacteria 5990
812 Ga0496108_0050498 3300048911 Bacteria 3482
813 Ga0496108_0051252 3300048911 Bacteria 3457
814 Ga0496108_0060107 3300048911 Bacteria 3197
815 Ga0496108_0364456 3300048911 Unclassified 1261
816 Ga0496109_0018181 3300048912 Bacteria 6172
817 Ga0496109_0018404 3300048912 Bacteria 6137
818 Ga0496109_0036648 3300048912 Bacteria 4427
819 Ga0496109_0190717 3300048912 Bacteria 1926
820 Ga0496109_0192897 3300048912 Bacteria 1914
821 Ga0496109_0391774 3300048912 Bacteria 1313
822 Ga0496109_0528156 3300048912 Unclassified 1113
823 Ga0496110_0020286 3300048913 Bacteria 5612
824 Ga0496111_0024263 3300048914 Bacteria 4268
825 Ga0496111_0205156 3300048914 Unclassified 1465
826 Ga0496111_0302191 3300048914 Unclassified 1186
827 Ga0496111_0320355 3300048914 Unclassified 1148
828 Ga0496111_0345451 3300048914 Unclassified 1102
829 Ga0496112_0000020 3300048915 Bacteria 169373
830 Ga0496112_0058612 3300048915 Bacteria 3792
831 Ga0496112_0069748 3300048915 Bacteria 3472
832 Ga0496112_0177036 3300048915 Bacteria 2097
833 Ga0496112_0222279 3300048915 Unclassified 1844
834 Ga0496112_0250452 3300048915 Bacteria 1722
835 Ga0496113_0044500 3300048916 Bacteria 3289
836 Ga0496113_0110618 3300048916 Bacteria 2138
837 Ga0496113_0140539 3300048916 Bacteria 1899
838 Ga0496114_0004331 3300048917 Bacteria 10991
839 Ga0496114_0068905 3300048917 Bacteria 2970
840 Ga0496114_0263638 3300048917 Unclassified 1517
841 Ga0496115_0014383 3300048918 Bacteria 5991
842 Ga0496115_0023267 3300048918 Bacteria 4807
843 Ga0496115_0099823 3300048918 Bacteria 2379
844 Ga0496115_0135587 3300048918 Bacteria 2030
845 Ga0496115_0318565 3300048918 Bacteria 1272
846 Ga0501299_026121 3300049522 Bacteria 1101
847 Ga0501034_0007786 3300049571 Bacteria 11398
848 Ga0501034_0082784 3300049571 Bacteria 3211
849 Ga0501034_0137132 3300049571 Bacteria 2427
850 Ga0501036_0050044 3300049572 Bacteria 3539
851 Ga0501038_0082959 3300049574 Bacteria 2698
852 Ga0501043_0009861 3300049579 Bacteria 7488
853 Ga0501047_0004174 3300049581 Bacteria 13597
854 Ga0501047_0029576 3300049581 Bacteria 5282
855 Ga0501067_0000100 3300049583 Bacteria 49264
856 Ga0501067_0002755 3300049583 Bacteria 9669
857 Ga0501068_0077298 3300049584 Bacteria 2038
858 Ga0501073_0000010 3300049589 Bacteria 171144
859 Ga0501076_0248465 3300049592 Bacteria 1455
860 Ga0501077_0026616 3300049593 Bacteria 3670
861 Ga0501077_0186240 3300049593 Bacteria 1319
862 Ga0501257_000006 3300049686 Bacteria 57368
863 Ga0501080_0003502 3300049742 Bacteria 13821
864 Ga0501080_0004643 3300049742 Bacteria 12246
865 Ga0501083_0013011 3300049744 Bacteria 5815
866 Ga0501280_002743 3300049776 Bacteria 2855
867 Ga0501035_0035770 3300049822 Bacteria 4506
868 Ga0501044_0004511 3300049823 Bacteria 15569
869 Ga0501044_0013701 3300049823 Bacteria 8764
870 nmdc:mga05p37_1239_c1 3300050507 Bacteria 29626
871 nmdc:mga05p37_3181_c1 3300050507 Bacteria 19102
872 nmdc:mga05p37_487794_c1 3300050507 Bacteria 1417
873 nmdc:mga05p37_7041_c1 3300050507 Bacteria 13256
874 nmdc:mga09592_10200_c1 3300050508 Bacteria 7646
875 nmdc:mga09592_431648_c1 3300050508 Bacteria 1137
876 nmdc:mga0qj67_189804_c1 3300050509 Bacteria 1670
877 nmdc:mga0qj67_23_c1 3300050509 Bacteria 107313
878 nmdc:mga0qj67_2544_c1 3300050509 Bacteria 13035
879 nmdc:mga06r32_3795_c1 3300050510 Bacteria 13525
880 nmdc:mga06r32_571_c1 3300050510 Bacteria 32046
881 nmdc:mga08y16_11920_c1 3300050511 Bacteria 9132
882 nmdc:mga08y16_122211_c1 3300050511 Bacteria 2709
883 nmdc:mga08y16_204_c3 3300050511 Bacteria 8325
884 nmdc:mga08y16_23259_c1 3300050511 Bacteria 6543
885 nmdc:mga08y16_8805_c1 3300050511 Bacteria 10591
886 nmdc:mga0n895_181261_c1 3300050512 Bacteria 2138
887 nmdc:mga0n895_236005_c1 3300050512 Bacteria 1856
888 nmdc:mga0n895_280745_c1 3300050512 Unclassified 1689
889 nmdc:mga0n895_39393_c1 3300050512 Bacteria 4585
890 nmdc:mga0n895_62981_c1 3300050512 Bacteria 3667
891 nmdc:mga0n895_72345_c1 3300050512 Bacteria 3420
892 nmdc:mga0n895_83692_c1 3300050512 Bacteria 3183
893 nmdc:mga0rr50_1652_c1 3300050513 Bacteria 12298
894 nmdc:mga0rr50_168331_c1 3300050513 Unclassified 1784
895 nmdc:mga0rr50_218278_c1 3300050513 Bacteria 1574
896 nmdc:mga0rr50_22311_c1 3300050513 Bacteria 4342
897 nmdc:mga0rr50_245259_c1 3300050513 Bacteria 1486
898 nmdc:mga0rr50_33461_c1 3300050513 Bacteria 3672
899 nmdc:mga08x19_156645_c1 3300050514 Bacteria 1545
900 nmdc:mga08x19_226485_c1 3300050514 Bacteria 1286
901 nmdc:mga0a205_1982_c1 3300050515 Bacteria 17840
902 nmdc:mga0a205_58841_c1 3300050515 Bacteria 3712
903 nmdc:mga0a205_61577_c1 3300050515 Bacteria 3625
904 Ga0495601_0001168 3300053077 Bacteria 14367
905 Ga0495601_0014239 3300053077 Bacteria 4791
906 Ga0495601_0018872 3300053077 Bacteria 4201
907 Ga0495601_0036049 3300053077 Bacteria 3088
908 Ga0495601_0155634 3300053077 Unclassified 1492
909 Ga0495601_0245059 3300053077 Bacteria 1170
910 Ga0495612_0002956 3300053078 Bacteria 7053
911 Ga0495612_0004722 3300053078 Bacteria 5641
912 Ga0495612_0008814 3300053078 Bacteria 4088
913 Ga0495612_0022742 3300053078 Unclassified 2512
914 Ga0495595_0003369 3300053084 Bacteria 6343
915 Ga0495595_0003462 3300053084 Bacteria 6263
916 Ga0495595_0004314 3300053084 Bacteria 5721
917 Ga0495595_0005583 3300053084 Bacteria 5092
918 Ga0495595_0064165 3300053084 Unclassified 1726
919 Ga0495619_0000108 3300053085 Bacteria 62197
920 Ga0495619_0002250 3300053085 Bacteria 12774
921 Ga0495619_0004216 3300053085 Bacteria 9170
922 Ga0495619_0006397 3300053085 Bacteria 7463
923 Ga0495619_0009826 3300053085 Bacteria 6031
924 Ga0495619_0023395 3300053085 Unclassified 3961
925 Ga0495619_0044134 3300053085 Plasmid 2925
926 Ga0495619_0152966 3300053085 Bacteria 1591
927 Ga0495619_0384767 3300053085 Bacteria 969
928 Ga0500643_000419 3300053087 Bacteria 32299
929 Ga0500595_017797 3300053119 Bacteria 2614
930 Ga0500658_0000232 3300053134 Bacteria 26163
931 Ga0500624_000075 3300053157 Bacteria 56822
932 Ga0500636_0221051 3300053177 Bacteria 987
933 Ga0500637_0000049 3300053178 Bacteria 43426
934 Ga0501084_0035032 3300054114 Bacteria 4197
935 Ga0501082_0044497 3300060353 Bacteria 3829
936 Ga0070702_100053841
937 JGI24032J14994_100084
938 JGI24741J21665_1005888
939 JGI24752J21851_1001192
940 JGI24752J21851_1006891
941 JGI24746J21847_1000561
942 JGI24747J21853_1001109
943 JGI24740J21852_10041133
944 JGI24739J22299_10003310
945 JGI24737J22298_10002636
946 JGI24743J22301_10001496
947 JGI24750J21931_1000486
948 JGI24745J21846_1000039
949 JGI24748J21848_1000823
950 JGI24738J21930_10000730
951 JGI24749J21850_1000343
952 JGI24744J21845_10005872
953 JGI24035J26624_1000058
954 JGI24034J26672_10001627
955 JGI24742J22300_10000198
956 JGI24751J29686_10000813
957 JGI25405J52794_10024537
958 Ga0065712_10071767
959 Ga0065715_10089090
960 Ga0065707_10093537
961 Ga0070676_10003608
962 Ga0070683_100000585
963 Ga0070690_100002968
964 Ga0070670_100019485
965 Ga0070677_10000046
966 Ga0068869_100018348
967 Ga0068869_100044707
968 Ga0068869_100119476
969 Ga0070666_10012900
970 Ga0070666_10191364
971 Ga0070680_100038291
972 Ga0070682_100011129
973 Ga0068868_100004852
974 Ga0068868_100014135
975 Ga0068868_100626183
976 Ga0070660_100016729
977 Ga0070660_100143674
978 Ga0070689_100013338
979 Ga0070689_100053130
980 Ga0070691_10005832
981 Ga0070687_100007741
982 Ga0070687_100058976
983 Ga0070661_100011022
984 Ga0070661_100072801
985 Ga0070661_100132055
986 Ga0070692_10000631
987 Ga0070668_100027612
988 Ga0070668_100087196
989 Ga0070668_100093787
990 Ga0070669_100014919
991 Ga0070669_100015243
992 Ga0070669_100134364
993 Ga0070675_100017649
994 Ga0070671_100003717
995 Ga0070671_100005631
996 Ga0070671_100014351
997 Ga0070671_100014919
998 Ga0070674_100010047
999 Ga0070674_100133491
1000 Ga0070674_100231723
1001 Ga0070673_100017883
1002 Ga0070673_100024844
1003 Ga0070673_100186262
1004 Ga0070673_100249808
1005 Ga0070673_100420164
1006 Ga0070673_100629212
1007 Ga0070688_100005511
1008 Ga0070688_100098479
1009 Ga0070659_100016762
1010 Ga0070659_100131107
1011 Ga0070667_100013764
1012 Ga0070667_100070171
1013 Ga0070703_10012402
1014 Ga0070709_10078709
1015 Ga0070709_10388138
1016 Ga0070714_100027998
1017 Ga0070714_100110010
1018 Ga0070714_100124643
1019 Ga0070713_100168029
1020 Ga0070713_100209598
1021 Ga0070713_100396162
1022 Ga0070710_10008064
1023 Ga0070710_10019971
1024 Ga0070701_10000116
1025 Ga0070711_100016945
1026 Ga0070711_100026760
1027 Ga0070711_100069259
1028 Ga0070705_100011033
1029 Ga0070700_100001202
1030 Ga0070700_100015702
1031 Ga0070694_100001057
1032 Ga0070708_100035671
1033 Ga0070663_100018435
1034 Ga0070663_100183797
1035 Ga0070678_100004906
1036 Ga0070678_100011782
1037 Ga0070678_100069580
1038 Ga0070662_100017132
1039 Ga0070681_10027863
1040 Ga0070681_10107353
1041 Ga0068867_100000619
1042 Ga0070685_10021655
1043 Ga0070685_10169401
1044 Ga0070679_100035946
1045 Ga0070679_100428136
1046 Ga0070684_100011691
1047 Ga0070684_100033921
1048 Ga0070684_100171844
1049 Ga0068853_100004569
1050 Ga0068853_100145190
1051 Ga0068853_100412258
1052 Ga0068853_100460587
1053 Ga0070672_100000875
1054 Ga0070672_100036512
1055 Ga0070672_100089246
1056 Ga0070672_100185890
1057 Ga0070686_100000923
1058 Ga0070686_100026854
1059 Ga0070686_100059944
1060 Ga0070686_100082785
1061 Ga0070695_100000960
1062 Ga0070695_100149014
1063 Ga0070696_100010637
1064 Ga0070696_100015013
1065 Ga0070696_100110528
1066 Ga0070665_100008168
1067 Ga0070665_100119963
1068 Ga0070704_100015740
1069 Ga0068855_100057904
1070 Ga0070664_100008796
1071 Ga0070664_100011917
1072 Ga0070664_100094572
1073 Ga0070664_100099610
1074 Ga0070664_100235984
1075 Ga0070664_100416869
1076 Ga0068857_100007206
1077 Ga0068857_100359926
1078 Ga0068857_100504131
1079 Ga0068854_100003201
1080 Ga0068854_100019078
1081 Ga0068854_100045715
1082 Ga0068856_100044263
1083 Ga0068856_100092282
1084 Ga0068856_100206495
1085 Ga0068856_100224931
1086 Ga0070702_100003539
1087 Ga0070702_100068498
1088 Ga0070702_100105591
1089 Ga0068852_100026464
1090 Ga0068852_100040689
1091 Ga0068859_100000323
1092 Ga0068859_100014029
1093 Ga0068864_100000501
1094 Ga0068864_100002687
1095 Ga0068864_100157366
1096 Ga0068864_100174037
1097 Ga0068866_10001605
1098 Ga0068861_100005083
1099 Ga0068870_10000104
1100 Ga0068863_100002181
1101 Ga0068863_100012118
1102 Ga0068863_100030102
1103 Ga0068858_100002458
1104 Ga0068858_100009333
1105 Ga0068860_100029756
1106 Ga0068860_100087246
1107 Ga0068860_100256322
1108 Ga0068860_100366894
1109 Ga0068862_100017639
1110 Ga0068862_100020470
1111 Ga0068862_100029753
1112 Ga0068862_100224551
1113 Ga0068862_100588683
1114 Ga0081455_10001425
1115 Ga0081455_10005674
1116 Ga0081455_10034020
1117 Ga0081455_10045447
1118 Ga0081455_10049231
1119 Ga0081538_10122488
1120 Ga0081540_1000086
1121 Ga0081540_1013162
1122 Ga0081540_1017462
1123 Ga0081539_10000064
1124 Ga0070717_10028620
1125 Ga0070717_10204499
1126 Ga0075365_10053618
1127 Ga0070715_10007523
1128 Ga0070715_10007548
1129 Ga0070716_100045030
1130 Ga0070712_100000903
1131 Ga0070712_100001246
1132 Ga0070712_100014800
1133 Ga0070712_100036996
1134 Ga0070712_100105178
1135 Ga0070712_100229508
1136 Ga0075367_10046625
1137 Ga0097621_100008529
1138 Ga0068871_100000485
1139 Ga0068871_100104376
1140 Ga0068871_100325046
1141 Ga0075428_100019515
1142 Ga0075428_100055252
1143 Ga0075428_100213853
1144 Ga0075430_100000164
1145 Ga0075430_100002416
1146 Ga0075430_100030141
1147 Ga0075430_100501158
1148 Ga0075431_100000986
1149 Ga0075431_100042134
1150 Ga0075433_10001944
1151 Ga0075433_10010489
1152 Ga0075434_100004417
1153 Ga0075434_100030711
1154 Ga0075434_100255023
1155 Ga0075429_100016531
1156 Ga0075429_100443136
1157 Ga0068865_100001815
1158 Ga0068865_100241434
1159 Ga0097620_100000323
1160 Ga0097620_100014029
1161 Ga0075435_100023740
1162 Ga0075435_100072290
1163 Ga0075435_100141920
1164 Ga0075435_100236147
1165 Ga0105250_10004482
1166 Ga0105240_10125942
1167 Ga0111539_10000930
1168 Ga0111539_10002680
1169 Ga0111539_10004845
1170 Ga0111539_10007277
1171 Ga0111539_10053440
1172 Ga0111539_10264825
1173 Ga0105245_10001701
1174 Ga0105245_10014199
1175 Ga0105247_10015729
1176 Ga0105247_10020219
1177 Ga0105247_10162666
1178 Ga0105247_10236681
1179 Ga0114129_10004791
1180 Ga0114129_10065648
1181 Ga0114129_10123771
1182 Ga0114129_10256062
1183 Ga0114129_10434617
1184 Ga0114129_10963216
1185 Ga0105243_10026025
1186 Ga0105243_10085590
1187 Ga0105243_10090303
1188 Ga0105243_10382476
1189 Ga0105241_10000805
1190 Ga0105241_10012529
1191 Ga0105241_10099248
1192 Ga0105241_10283075
1193 Ga0105242_10004554
1194 Ga0105242_10020924
1195 Ga0105242_10109990
1196 Ga0105242_10205064
1197 Ga0105242_10228977
1198 Ga0105248_10007773
1199 Ga0105248_10012541
1200 Ga0105248_10014249
1201 Ga0105248_10045407
1202 Ga0105248_10073290
1203 Ga0105248_10256090
1204 Ga0105237_10024690
1205 Ga0105238_10057979
1206 Ga0105249_10075277
1207 Ga0105249_10301612
1208 Ga0105249_10450947
1209 Ga0105239_10043858
1210 Ga0105239_10082161
1211 Ga0105239_10355647
1212 Ga0105246_10002092
1213 Ga0105246_10158351
1214 Ga0105246_10195911
1215 Ga0105246_10248405
1216 Ga0105246_10321907
1217 Ga0105246_10328553
1218 Ga0157338_1001046
1219 Ga0157373_10174842
1220 Ga0157371_10014330
1221 Ga0157369_10502410
1222 Ga0157369_10689858
1223 Ga0157374_10005194
1224 Ga0157374_10351302
1225 Ga0157374_10440896
1226 Ga0157378_10011410
1227 Ga0157378_10539966
1228 Ga0163162_10039217
1229 Ga0163162_10078758
1230 Ga0163162_10090824
1231 Ga0157372_10016173
1232 Ga0157375_10001699
1233 Ga0157375_10505573
1234 Ga0157375_10693608
1235 Ga0163163_10000489
1236 Ga0163163_10029460
1237 Ga0163163_10103106
1238 Ga0163163_10144821
1239 Ga0157380_10020406
1240 Ga0157380_10023469
1241 Ga0157377_10002656
1242 Ga0157379_10004716
1243 Ga0157379_10007629
1244 Ga0157379_10010586
1245 Ga0157379_10013998
1246 Ga0157379_10212857
1247 Ga0157376_10030975
1248 Ga0157376_10170656
1249 Ga0157376_10222620
1250 Ga0157376_10518259
1251 Ga0163161_10002208
1252 Ga0163161_10038349
1253 Ga0224572_1001032
1254 Ga0207666_1000245
1255 Ga0207673_1003029
1256 Ga0207697_10003263
1257 Ga0207653_10017221
1258 Ga0207682_10000793
1259 Ga0207692_10025244
1260 Ga0207642_10001880
1261 Ga0207710_10007749
1262 Ga0207710_10089573
1263 Ga0207688_10000420
1264 Ga0207680_10006456
1265 Ga0207680_10133951
1266 Ga0207647_10004676
1267 Ga0207647_10046531
1268 Ga0207685_10020702
1269 Ga0207699_10088829
1270 Ga0207645_10000668
1271 Ga0207643_10000085
1272 Ga0207643_10011878
1273 Ga0207654_10000373
1274 Ga0207654_10095182
1275 Ga0207707_10011682
1276 Ga0207707_10104589
1277 Ga0207695_10153710
1278 Ga0207671_10006714
1279 Ga0207693_10001322
1280 Ga0207693_10001438
1281 Ga0207693_10026127
1282 Ga0207693_10029261
1283 Ga0207693_10064662
1284 Ga0207693_10124525
1285 Ga0207693_10185317
1286 Ga0207663_10005341
1287 Ga0207663_10083280
1288 Ga0207663_10168519
1289 Ga0207663_10228576
1290 Ga0207660_10002189
1291 Ga0207662_10000730
1292 Ga0207657_10007870
1293 Ga0207657_10072772
1294 Ga0207649_10000476
1295 Ga0207649_10230862
1296 Ga0207652_10003058
1297 Ga0207681_10006586
1298 Ga0207681_10048551
1299 Ga0207650_10028502
1300 Ga0207650_10198426
1301 Ga0207659_10010174
1302 Ga0207687_10001321
1303 Ga0207687_10192793
1304 Ga0207700_10044752
1305 Ga0207700_10069414
1306 Ga0207700_10137461
1307 Ga0207700_10165035
1308 Ga0207700_10223955
1309 Ga0207700_10301920
1310 Ga0207644_10000759
1311 Ga0207644_10004908
1312 Ga0207644_10007993
1313 Ga0207644_10024244
1314 Ga0207690_10004643
1315 Ga0207690_10022775
1316 Ga0207690_10100671
1317 Ga0207690_10119236
1318 Ga0207706_10013555
1319 Ga0207706_10043416
1320 Ga0207706_10129440
1321 Ga0207686_10000682
1322 Ga0207686_10058551
1323 Ga0207709_10002503
1324 Ga0207709_10022112
1325 Ga0207709_10050302
1326 Ga0207670_10000908
1327 Ga0207670_10081270
1328 Ga0207669_10000129
1329 Ga0207704_10000366
1330 Ga0207665_10015654
1331 Ga0207665_10026086
1332 Ga0207665_10399677
1333 Ga0207691_10010088
1334 Ga0207691_10029040
1335 Ga0207691_10040566
1336 Ga0207691_10041706
1337 Ga0207691_10107655
1338 Ga0207711_10000042
1339 Ga0207711_10043312
1340 Ga0207711_10203389
1341 Ga0207711_10351715
1342 Ga0207711_10446168
1343 Ga0207689_10002200
1344 Ga0207689_10027825
1345 Ga0207661_10000373
1346 Ga0207661_10537366
1347 Ga0207679_10001125
1348 Ga0207679_10030464
1349 Ga0207667_10025152
1350 Ga0207651_10002032
1351 Ga0207651_10031594
1352 Ga0207712_10002238
1353 Ga0207712_10043634
1354 Ga0207668_10001143
1355 Ga0207668_10559908
1356 Ga0207640_10019608
1357 Ga0207640_10346001
1358 Ga0207640_10426011
1359 Ga0207640_10479902
1360 Ga0207658_10008091
1361 Ga0207658_10017529
1362 Ga0207658_10020382
1363 Ga0207658_10057545
1364 Ga0207658_10096320
1365 Ga0207677_10009995
1366 Ga0207703_10001627
1367 Ga0207703_10002493
1368 Ga0207703_10041859
1369 Ga0207639_10005334
1370 Ga0207639_10203397
1371 Ga0207678_10010758
1372 Ga0207678_10018247
1373 Ga0207678_10067149
1374 Ga0207708_10007465
1375 Ga0207708_10007573
1376 Ga0207702_10017909
1377 Ga0207702_10030876
1378 Ga0207702_10132468
1379 Ga0207702_10303614
1380 Ga0207641_10000927
1381 Ga0207641_10002374
1382 Ga0207641_10030449
1383 Ga0207648_10001362
1384 Ga0207676_10000435
1385 Ga0207676_10001403
1386 Ga0207676_10016664
1387 Ga0207676_10107821
1388 Ga0207674_10011327
1389 Ga0207675_100004955
1390 Ga0207675_100150113
1391 Ga0207683_10001172
1392 Ga0207683_10001220
1393 Ga0207683_10077777
1394 Ga0207683_10077868
1395 Ga0207683_10102696
1396 Ga0207698_10016256
1397 Ga0207698_10026603
1398 Ga0207698_10812108
1399 Ga0210002_1000487
1400 Ga0209983_1011416
1401 Ga0209998_10001714
1402 Ga0207428_10000322
1403 Ga0207428_10000896
1404 Ga0207428_10061970
1405 Ga0207428_10069209
1406 Ga0268266_10000832
1407 Ga0268266_10118531
1408 Ga0268265_10002919
1409 Ga0268265_10005917
1410 Ga0268265_10052875
1411 Ga0268265_10167423
1412 Ga0268264_10001202
1413 Ga0268264_10070437
1414 Ga0268264_10344177
1415 Ga0265338_10038132
1416 Ga0265760_10036800
1417 Ga0265330_10029512
1418 Ga0265320_10162888
1419 Ga0265325_10001243
1420 Ga0265339_10000091
1421 Ga0265339_10018360
1422 Ga0265339_10029357
1423 Ga0265316_10064489
1424 Ga0265316_10135806
1425 Ga0307513_10013540
1426 Ga0265313_10001068
1427 Ga0265313_10017130
1428 Ga0265313_10097002
1429 Ga0265314_10057584
1430 Ga0265314_10108459
1431 Ga0265342_10027560
1432 Ga0265342_10028347
1433 Ga0265342_10060407
1434 Ga0265342_10156548
1435 Ga0307413_10164418
1436 Ga0307410_10008367
1437 Ga0307409_100201662
1438 Ga0307416_100214981
1439 Ga0373930_0010920
1440 Ga0373948_0000934
1441 Ga0373950_0008932
1442 Ga0373958_0008311
1443 Ga0373959_0017794
1444 Ga0373938_0001605
1445 Ga0373938_0004290
1446 Ga0373926_0013724
1447 Ga0373929_0007035
1448 Ga0373934_0013975
1449 Ga0373940_0012918
1450 Ga0373940_0032676
1451 Ga0373944_0102245
1452 Ga0373949_0001617
1453 Ga0373949_0008699
1454 Ga0373951_0000816
1455 Ga0373952_0000725
1456 Ga0373952_0012409
1457 Ga0373923_0031535
1458 Ga0373923_0036242
1459 Ga0373923_0063142
1460 Ga0373923_0065154
1461 Ga0373932_0002655
1462 Ga0373936_0067900
1463 Ga0373939_0002266
1464 Ga0373939_0011072
1465 Ga0373941_0000710
1466 Ga0373945_0054522
1467 Ga0373954_0029351
1468 Ga0373956_0101308
1469 Ga0373957_0048508
1470 Ga0373960_0000528
1471 Ga0373960_0001486
1472 Ga0373960_0080156
1473 Ga0373943_0004637
1474 Ga0373943_0031187
1475 Ga0373943_0053186
1476 Ga0373946_0011371
1477 Ga0373946_0082488
1478 Ga0373955_0009883
1479 Ga0373955_0022291
1480 Ga0373942_0003528
1481 Ga0373961_0012891
1482 Ga0373962_0000893
1483 Ga0373924_0002373
1484 Ga0373931_0016718
1485 Ga0373931_0065125
1486 Ga0373931_0072616
1487 Ga0373931_0191196
1488 Ga0373935_0037934
1489 Ga0373935_0099561
1490 Ga0373935_0208383
1491 Ga0373935_0422678
1492 Ga0373927_0015422
1493 Ga0373927_0044216
1494 Ga0373927_0062284
1495 Ga0373927_0123840
1496 Ga0373927_0153377
1497 Ga0373933_0004840
1498 Ga0373933_0014329
1499 Ga0373933_0056092
1500 Ga0373933_0070402
1501 Ga0373947_0001934
1502 Ga0373947_0005748
1503 Ga0373947_0011643
1504 Ga0373947_0057024
1505 Ga0373937_0002583
1506 Ga0373937_0005204
1507 Ga0373937_0007138
1508 Ga0373937_0509815
1509 Ga0373937_0581488
1510 Ga0373925_0018031
1511 Ga0373925_0025873
1512 Ga0373925_0035442
1513 Ga0373925_0043734
1514 Ga0373925_0068198
1515 Ga0373925_0100873
1516 Ga0395899_0099652
1517 Ga0395899_0102330
1518 Ga0395899_0170745
1519 Ga0395900_0037499
1520 Ga0395900_0153873
1521 Ga0395898_0047892
1522 Ga0395898_0083593
1523 Ga0395898_0331420
1524 Ga0395905_0031832
1525 Ga0395905_0061486
1526 Ga0395905_0181965
1527 Ga0395905_0527274
1528 Ga0395901_0021682
1529 Ga0395901_0039197
1530 Ga0395901_0159622
1531 Ga0395901_0252021
1532 Ga0436365_0204940
1533 Ga0436365_0933878
1534 Ga0436365_0947958
1535 Ga0436361_0201393
1536 Ga0436361_0265181
1537 Ga0436361_0862585
1538 Ga0436361_0866592
1539 Ga0436363_0460390
1540 Ga0436363_1308327
1541 Ga0450905_000421
1542 Ga0450889_000015
1543 Ga0439464_0039570
1544 Ga0451577_0113507
1545 Ga0451576_0000159
1546 Ga0495617_038603
1547 Ga0495592_0031388
1548 Ga0495603_0007068
1549 Ga0495603_0046367
1550 Ga0495590_0039865
1551 Ga0495629_0000140
1552 Ga0495629_0002843
1553 Ga0495629_0030081
1554 Ga0495629_0047991
1555 Ga0495641_0009773
1556 Ga0495651_0001969
1557 Ga0495651_0003550
1558 Ga0495653_0009210
1559 Ga0495653_0023662
1560 Ga0495580_0118134
1561 Ga0495580_0157080
1562 Ga0495580_0221222
1563 Ga0495582_0121208
1564 Ga0495639_0244386
1565 Ga0495662_0021111
1566 Ga0495662_0037776
1567 Ga0495664_0001514
1568 Ga0495664_0062554
1569 Ga0495664_0095894
1570 Ga0495584_0013124
1571 Ga0495584_0077012
1572 Ga0495584_0120731
1573 Ga0495584_0152354
1574 Ga0495585_0012013
1575 Ga0495585_0044457
1576 Ga0495594_0004885
1577 Ga0495594_0186120
1578 Ga0495594_0236898
1579 Ga0495606_0000252
1580 Ga0495608_0002947
1581 Ga0495608_0007807
1582 Ga0495618_0011920
1583 Ga0495618_0018939
1584 Ga0495618_0020553
1585 Ga0495618_0046181
1586 Ga0495620_0106045
1587 Ga0495628_0016676
1588 Ga0495628_0168694
1589 Ga0495630_0074980
1590 Ga0495630_0226282
1591 Ga0495630_0655881
1592 Ga0495637_0081423
1593 Ga0495644_0009079
1594 Ga0495663_0020370
1595 Ga0495663_0070071
1596 Ga0495666_0065009
1597 Ga0495642_0062486
1598 Ga0495642_0145203
1599 Ga0495652_0007323
1600 Ga0495652_0020176
1601 Ga0495652_0248193
1602 Ga0495652_0444653
1603 Ga0495665_0019725
1604 Ga0495665_0044130
1605 Ga0495665_0124079
1606 Ga0495640_0003070
1607 Ga0495640_0011331
1608 Ga0495640_0022000
1609 Ga0495640_0256887
1610 Ga0495586_0015904
1611 Ga0495587_0107035
1612 Ga0495645_0008448
1613 Ga0495645_0243125
1614 Ga0495622_0007036
1615 Ga0495622_0115247
1616 Ga0495633_0028229
1617 Ga0495667_0000936
1618 Ga0495667_0007174
1619 Ga0495667_0052243
1620 Ga0495667_0079051
1621 Ga0495656_0001649
1622 Ga0495668_0107403
1623 Ga0495634_0006588
1624 Ga0495634_0049795
1625 Ga0495634_0137246
1626 Ga0495634_0289166
1627 Ga0495611_0092957
1628 Ga0495625_0081142
1629 Ga0495635_0000803
1630 Ga0495635_0010366
1631 Ga0495635_0010910
1632 Ga0495635_0023545
1633 Ga0495635_0204552
1634 Ga0495659_0004853
1635 Ga0495659_0058045
1636 Ga0495657_0008655
1637 Ga0495657_0013677
1638 Ga0495599_0009856
1639 Ga0495623_0004153
1640 Ga0495623_0104284
1641 Ga0495646_0011637
1642 Ga0495646_0015003
1643 Ga0495647_0001772
1644 Ga0495647_0100883
1645 Ga0495658_0001441
1646 Ga0495658_0019035
1647 Ga0495658_0021917
1648 Ga0495658_0175856
1649 Ga0495669_0007930
1650 Ga0495613_0032219
1651 Ga0495613_0053690
1652 Ga0495613_0112177
1653 Ga0495613_0224577
1654 Ga0495624_0004977
1655 Ga0495624_0041472
1656 Ga0495624_0071665
1657 Ga0495670_0044171
1658 Ga0495670_0088786
1659 Ga0495649_0005354
1660 Ga0495589_0025192
1661 Ga0495589_0139408
1662 Ga0495600_0012802
1663 Ga0495581_0011677
1664 Ga0495581_0033129
1665 Ga0495581_0167927
1666 Ga0495604_0001803
1667 Ga0495604_0007398
1668 Ga0495604_0122120
1669 Ga0495636_0164204
1670 Ga0495674_0005466
1671 Ga0495674_0010028
1672 Ga0495674_0014669
1673 Ga0495674_0017525
1674 Ga0495674_0029644
1675 Ga0495674_0180017
1676 Ga0495676_0050527
1677 Ga0495676_0280443
1678 Ga0495676_0306672
1679 Ga0495676_0356632
1680 Ga0495680_0006822
1681 Ga0495680_0014641
1682 Ga0495680_0123956
1683 Ga0495675_0023294
1684 Ga0495679_018305
1685 Ga0495684_0007012
1686 Ga0495684_0008246
1687 Ga0495684_0008574
1688 Ga0495684_0236077
1689 Ga0495686_0070290
1690 Ga0495593_0013260
1691 Ga0495593_0016502
1692 Ga0495593_0046567
1693 Ga0495602_0003594
1694 Ga0495602_0038382
1695 Ga0495602_0226321
1696 Ga0495615_0027225
1697 Ga0495626_0093157
1698 Ga0496100_0013352
1699 Ga0496100_0045666
1700 Ga0496100_0050754
1701 Ga0496100_0051881
1702 Ga0496100_0195655
1703 Ga0496100_0220772
1704 Ga0496100_0307207
1705 Ga0496101_0024236
1706 Ga0496101_0071673
1707 Ga0496101_0111412
1708 Ga0496102_0016598
1709 Ga0496102_0020964
1710 Ga0496102_0029331
1711 Ga0496102_0177184
1712 Ga0496102_0362042
1713 Ga0496103_0005145
1714 Ga0496103_0023092
1715 Ga0496103_0035005
1716 Ga0496103_0066782
1717 Ga0496103_0086307
1718 Ga0496103_0106122
1719 Ga0496104_0001024
1720 Ga0496104_0017158
1721 Ga0496104_0038358
1722 Ga0496104_0100386
1723 Ga0496104_0103201
1724 Ga0496104_0198467
1725 Ga0496104_0241051
1726 Ga0496105_0004939
1727 Ga0496105_0044353
1728 Ga0496105_0057598
1729 Ga0496105_0067781
1730 Ga0496105_0072206
1731 Ga0496105_0091432
1732 Ga0496105_0377511
1733 Ga0496106_0009502
1734 Ga0496106_0020443
1735 Ga0496106_0029158
1736 Ga0496106_0054915
1737 Ga0496106_0178532
1738 Ga0496106_0186010
1739 Ga0496106_0227121
1740 Ga0496106_0353995
1741 Ga0496106_0596748
1742 Ga0496107_0012082
1743 Ga0496107_0048939
1744 Ga0496107_0099472
1745 Ga0496107_0277241
1746 Ga0496108_0016733
1747 Ga0496108_0050498
1748 Ga0496108_0051252
1749 Ga0496108_0060107
1750 Ga0496108_0364456
1751 Ga0496109_0018181
1752 Ga0496109_0018404
1753 Ga0496109_0036648
1754 Ga0496109_0190717
1755 Ga0496109_0192897
1756 Ga0496109_0391774
1757 Ga0496109_0528156
1758 Ga0496110_0020286
1759 Ga0496111_0024263
1760 Ga0496111_0205156
1761 Ga0496111_0302191
1762 Ga0496111_0320355
1763 Ga0496111_0345451
1764 Ga0496112_0000020
1765 Ga0496112_0058612
1766 Ga0496112_0069748
1767 Ga0496112_0177036
1768 Ga0496112_0222279
1769 Ga0496112_0250452
1770 Ga0496113_0044500
1771 Ga0496113_0110618
1772 Ga0496113_0140539
1773 Ga0496114_0004331
1774 Ga0496114_0068905
1775 Ga0496114_0263638
1776 Ga0496115_0014383
1777 Ga0496115_0023267
1778 Ga0496115_0099823
1779 Ga0496115_0135587
1780 Ga0496115_0318565
1781 Ga0501299_026121
1782 Ga0501034_0007786
1783 Ga0501034_0082784
1784 Ga0501034_0137132
1785 Ga0501036_0050044
1786 Ga0501038_0082959
1787 Ga0501043_0009861
1788 Ga0501047_0004174
1789 Ga0501047_0029576
1790 Ga0501067_0000100
1791 Ga0501067_0002755
1792 Ga0501068_0077298
1793 Ga0501073_0000010
1794 Ga0501076_0248465
1795 Ga0501077_0026616
1796 Ga0501077_0186240
1797 Ga0501257_000006
1798 Ga0501080_0003502
1799 Ga0501080_0004643
1800 Ga0501083_0013011
1801 Ga0501280_002743
1802 Ga0501035_0035770
1803 Ga0501044_0004511
1804 Ga0501044_0013701
1805 nmdc:mga05p37_1239_c1
1806 nmdc:mga05p37_3181_c1
1807 nmdc:mga05p37_487794_c1
1808 nmdc:mga05p37_7041_c1
1809 nmdc:mga09592_10200_c1
1810 nmdc:mga09592_431648_c1
1811 nmdc:mga0qj67_189804_c1
1812 nmdc:mga0qj67_23_c1
1813 nmdc:mga0qj67_2544_c1
1814 nmdc:mga06r32_3795_c1
1815 nmdc:mga06r32_571_c1
1816 nmdc:mga08y16_11920_c1
1817 nmdc:mga08y16_122211_c1
1818 nmdc:mga08y16_204_c3
1819 nmdc:mga08y16_23259_c1
1820 nmdc:mga08y16_8805_c1
1821 nmdc:mga0n895_181261_c1
1822 nmdc:mga0n895_236005_c1
1823 nmdc:mga0n895_280745_c1
1824 nmdc:mga0n895_39393_c1
1825 nmdc:mga0n895_62981_c1
1826 nmdc:mga0n895_72345_c1
1827 nmdc:mga0n895_83692_c1
1828 nmdc:mga0rr50_1652_c1
1829 nmdc:mga0rr50_168331_c1
1830 nmdc:mga0rr50_218278_c1
1831 nmdc:mga0rr50_22311_c1
1832 nmdc:mga0rr50_245259_c1
1833 nmdc:mga0rr50_33461_c1
1834 nmdc:mga08x19_156645_c1
1835 nmdc:mga08x19_226485_c1
1836 nmdc:mga0a205_1982_c1
1837 nmdc:mga0a205_58841_c1
1838 nmdc:mga0a205_61577_c1
1839 Ga0495601_0001168
1840 Ga0495601_0014239
1841 Ga0495601_0018872
1842 Ga0495601_0036049
1843 Ga0495601_0155634
1844 Ga0495601_0245059
1845 Ga0495612_0002956
1846 Ga0495612_0004722
1847 Ga0495612_0008814
1848 Ga0495612_0022742
1849 Ga0495595_0003369
1850 Ga0495595_0003462
1851 Ga0495595_0004314
1852 Ga0495595_0005583
1853 Ga0495595_0064165
1854 Ga0495619_0000108
1855 Ga0495619_0002250
1856 Ga0495619_0004216
1857 Ga0495619_0006397
1858 Ga0495619_0009826
1859 Ga0495619_0023395
1860 Ga0495619_0044134
1861 Ga0495619_0152966
1862 Ga0495619_0384767
1863 Ga0500643_000419
1864 Ga0500595_017797
1865 Ga0500658_0000232
1866 Ga0500624_000075
1867 Ga0500636_0221051
1868 Ga0500637_0000049
1869 Ga0501084_0035032
1870 Ga0501082_0044497

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17676

Peptidase_S66C

LD-carboxypeptidase C-terminal domain

188

300

0.89

PF02016

Peptidase_S66

LD-carboxypeptidase N-terminal domain

26

147

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g23-assembly1.cif.gz_B crystal structure of a ld-carboxypeptidase a (saro_1426) from novosphingobium aromaticivorans dsm at 1.89 a resolution 0.9761 6 277
3g23-assembly1.cif.gz_B crystal structure of a ld-carboxypeptidase a (saro_1426) from novosphingobium aromaticivorans dsm at 1.89 a resolution 0.9619 6 277
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8419 9 277
1zl0-assembly2.cif.gz_B structure of protein of unknown function pa5198 from pseudomonas aeruginosa 0.8271 6 277
2aum-assembly1.cif.gz_B active site ser115ala mutant of ld-carboxypeptidase 0.8204 5 278
ID Description Score Start End Superfamily
3g23B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.9793 6 161 3.40.50.10740
3g23B02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.9301 164 268 3.50.30.60
3g23B02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.9213 164 268 3.50.30.60
3g23B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.9087 6 161 3.40.50.10740
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.8383 160 278 3.50.30.60
ID Description Score Start End GO Terms
AF-A0A537QCQ8-F1-model_v4 LD-carboxypeptidase 0.996 1 278 GO:0004180
GO:0006508
GO:0008236
AF-A0A1E4JDD5-F1-model_v4 LD-carboxypeptidase 0.9925 7 277 GO:0004180
GO:0006508
GO:0008236
AF-A0A3D2VYE0-F1-model_v4 LD-carboxypeptidase 0.9913 89 280 GO:0004180
GO:0006508
GO:0008236
AF-A0A839Z270-F1-model_v4 Muramoyltetrapeptide carboxypeptidase (EC 3.4.17.13) 0.9878 7 276 GO:0004180
GO:0006508
GO:0008236
AF-A0A520H014-F1-model_v4 LD-carboxypeptidase 0.9867 41 278 GO:0004180
GO:0006508
GO:0008236

Map