F486134

General Info

Members Datasets Scaffolds Average Seq Length
934 420 1868 254

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0001354|Ga0495606_0001354_17127_18038
Length 303
Sequence MSQQRTGHEAGITGRVGAVTPSAALGSQPDFPDLPEATVARLPEYLRALHHLAETGHDTVSSEGLATAAGVNSAKLRKDLSHLGSYGTRGVGYDIEPLVGQIEYILGLNKRRAVALVGVGNLGHALAGYAGFASRGFRIAALFDADLTRVGELINGLAVRHISDIPEVVKSEAISIAVLATPAGAAQAVADQLVAAGVTSILNFAPVVLNLPEQVDVRKVDLAVELQILSFHEHRKSARGAELAKAVALAGDQATSAAPAALNGAEPVRPVARAAGRGRVARVIAEAGGAVNGSPAARGEVAA

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
106 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
107 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
127 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
203 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
204 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
205 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
210 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
211 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
237 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
242 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
243 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
244 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
249 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
276 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
277 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
278 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
279 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
280 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
281 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
282 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
285 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
286 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
296 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
321 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
322 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
323 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
375 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
376 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
379 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
380 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 2501939600 Micromonospora sp. L5 Isolate Unclassified
382 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
383 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
384 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
385 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
386 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
387 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
388 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
389 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
390 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
391 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
392 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
393 2855683550 Micromonospora sp. RP3T Isolate Unclassified
394 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
395 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
396 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
397 2858882152 Micromonospora noduli MED15 Isolate Nodule
398 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
399 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
400 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
401 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
402 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
403 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
404 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
405 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
406 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
407 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
408 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
409 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
410 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
411 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
412 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
413 649633069 Micromonospora sp. L5 Isolate Unclassified
414 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
415 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
416 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
417 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
418 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
419 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
420 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.36
Metatranscriptomes 2.36
Isolates 4.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0.64
Rhizoplane 6.21
Rhizosphere 86.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0001354 3300046507 Bacteria 33260
2 JGI24751J29686_10005593 3300002459 Bacteria 2559
3 JGI25406J46586_10001930 3300003203 Bacteria 9779
4 JGI25406J46586_10043530 3300003203 Bacteria 1562
5 rootL2_10009411 3300003322 Bacteria 1199
6 JGI25404J52841_10024113 3300003659 Bacteria 1311
7 Ga0070658_10022159 3300005327 Bacteria 5096
8 Ga0070658_10166820 3300005327 Bacteria 1849
9 Ga0070676_10025161 3300005328 Bacteria 3362
10 Ga0070676_10269124 3300005328 Bacteria 1144
11 Ga0070683_100079237 3300005329 Bacteria 3074
12 Ga0070683_100198596 3300005329 Bacteria 1905
13 Ga0070683_100277135 3300005329 Bacteria 1595
14 Ga0070683_100484768 3300005329 Bacteria 1181
15 Ga0070690_100108690 3300005330 Bacteria 1848
16 Ga0068869_100044797 3300005334 Bacteria 3182
17 Ga0070666_10029152 3300005335 Bacteria 3626
18 Ga0070666_10141599 3300005335 Bacteria 1675
19 Ga0070680_100270183 3300005336 Bacteria 1439
20 Ga0070680_100296607 3300005336 Bacteria 1370
21 Ga0070682_100001383 3300005337 Bacteria 13697
22 Ga0068868_100015236 3300005338 Bacteria 5683
23 Ga0070660_100057728 3300005339 Bacteria 3008
24 Ga0070689_100221380 3300005340 Bacteria 1552
25 Ga0070691_10047770 3300005341 Bacteria 2036
26 Ga0070691_10082568 3300005341 Bacteria 1575
27 Ga0070691_10100572 3300005341 Bacteria 1435
28 Ga0070687_100058055 3300005343 Bacteria 2031
29 Ga0070661_100039242 3300005344 Bacteria 3451
30 Ga0070668_100002088 3300005347 Bacteria 14615
31 Ga0070668_100162646 3300005347 Bacteria 1812
32 Ga0070669_100158943 3300005353 Bacteria 1755
33 Ga0070675_100012505 3300005354 Bacteria 6653
34 Ga0070671_100003212 3300005355 Bacteria 12745
35 Ga0070671_100118916 3300005355 Bacteria 2223
36 Ga0070671_100345265 3300005355 Bacteria 1270
37 Ga0070674_100166770 3300005356 Bacteria 1676
38 Ga0070673_100103833 3300005364 Bacteria 2345
39 Ga0070673_100802550 3300005364 Bacteria 869
40 Ga0070688_100171172 3300005365 Bacteria 1499
41 Ga0070659_100167668 3300005366 Bacteria 1797
42 Ga0070667_100361439 3300005367 Bacteria 1316
43 Ga0070709_10005585 3300005434 Bacteria 6809
44 Ga0070709_10013118 3300005434 Bacteria 4651
45 Ga0070709_10020792 3300005434 Bacteria 3816
46 Ga0070709_10416908 3300005434 Bacteria 1005
47 Ga0070709_10427722 3300005434 Bacteria 993
48 Ga0070714_100000241 3300005435 Bacteria 42677
49 Ga0070714_100001408 3300005435 Bacteria 17443
50 Ga0070714_100017345 3300005435 Bacteria 5831
51 Ga0070714_100179800 3300005435 Bacteria 1924
52 Ga0070713_100017737 3300005436 Bacteria 5395
53 Ga0070713_100028459 3300005436 Bacteria 4413
54 Ga0070713_100095336 3300005436 Bacteria 2567
55 Ga0070713_100177665 3300005436 Bacteria 1911
56 Ga0070713_100352547 3300005436 Bacteria 1366
57 Ga0070710_10043408 3300005437 Bacteria 2490
58 Ga0070710_10118384 3300005437 Bacteria 1600
59 Ga0070701_10036294 3300005438 Bacteria 2483
60 Ga0070701_10038602 3300005438 Bacteria 2418
61 Ga0070711_100037656 3300005439 Bacteria 3246
62 Ga0070711_100052032 3300005439 Bacteria 2817
63 Ga0070711_100157095 3300005439 Bacteria 1721
64 Ga0070711_100181203 3300005439 Bacteria 1613
65 Ga0070711_100192828 3300005439 Bacteria 1567
66 Ga0070711_100260195 3300005439 Bacteria 1365
67 Ga0070705_100062618 3300005440 Bacteria 2216
68 Ga0070700_100042188 3300005441 Bacteria 2800
69 Ga0070694_100052088 3300005444 Bacteria 2766
70 Ga0070708_100176822 3300005445 Bacteria 1994
71 Ga0070663_100010629 3300005455 Bacteria 5742
72 Ga0070663_100036070 3300005455 Bacteria 3434
73 Ga0070663_100332357 3300005455 Bacteria 1225
74 Ga0070663_100436160 3300005455 Bacteria 1077
75 Ga0070678_100143587 3300005456 Bacteria 1913
76 Ga0070678_100402776 3300005456 Bacteria 1189
77 Ga0070681_10006696 3300005458 Bacteria 11211
78 Ga0070681_10033020 3300005458 Bacteria 5195
79 Ga0070681_10080851 3300005458 Bacteria 3205
80 Ga0068867_100493125 3300005459 Bacteria 1052
81 Ga0070706_100015280 3300005467 Bacteria 7087
82 Ga0070706_100200598 3300005467 Bacteria 1863
83 Ga0070707_100012139 3300005468 Bacteria 8042
84 Ga0070698_100001093 3300005471 Bacteria 29814
85 Ga0070698_100004321 3300005471 Bacteria 15616
86 Ga0070698_100036536 3300005471 Bacteria 5073
87 Ga0070698_100074116 3300005471 Bacteria 3409
88 Ga0070699_100335904 3300005518 Bacteria 1359
89 Ga0070679_100067907 3300005530 Bacteria 3556
90 Ga0070684_100036900 3300005535 Bacteria 4190
91 Ga0070684_100063933 3300005535 Bacteria 3227
92 Ga0070684_100069485 3300005535 Bacteria 3097
93 Ga0070697_100011045 3300005536 Bacteria 7057
94 Ga0070697_100182251 3300005536 Bacteria 1780
95 Ga0070697_100308991 3300005536 Bacteria 1360
96 Ga0068853_100061332 3300005539 Bacteria 3252
97 Ga0068853_100312281 3300005539 Bacteria 1455
98 Ga0070672_100091873 3300005543 Bacteria 2449
99 Ga0070686_100078946 3300005544 Bacteria 2175
100 Ga0070695_100246443 3300005545 Bacteria 1298
101 Ga0070696_100037527 3300005546 Bacteria 3343
102 Ga0070696_100090801 3300005546 Bacteria 2174
103 Ga0070693_100000312 3300005547 Bacteria 22443
104 Ga0070693_100085068 3300005547 Bacteria 1894
105 Ga0070665_100080607 3300005548 Bacteria 3261
106 Ga0070665_100111058 3300005548 Bacteria 2744
107 Ga0070665_100153500 3300005548 Bacteria 2305
108 Ga0070665_100453265 3300005548 Bacteria 1292
109 Ga0070704_100498604 3300005549 Bacteria 1056
110 Ga0068855_100004544 3300005563 Bacteria 16945
111 Ga0068855_100061299 3300005563 Bacteria 4395
112 Ga0068855_100190945 3300005563 Bacteria 2310
113 Ga0068855_100201719 3300005563 Bacteria 2239
114 Ga0068855_100306487 3300005563 Bacteria 1758
115 Ga0070664_100099016 3300005564 Bacteria 2533
116 Ga0068857_100069826 3300005577 Bacteria 3128
117 Ga0068857_100145969 3300005577 Bacteria 2141
118 Ga0068854_100067344 3300005578 Bacteria 2608
119 Ga0068856_100238557 3300005614 Bacteria 1834
120 Ga0068856_100412226 3300005614 Bacteria 1371
121 Ga0070702_100000170 3300005615 Bacteria 20754
122 Ga0070702_100014942 3300005615 Bacteria 3951
123 Ga0068852_100012422 3300005616 Bacteria 6467
124 Ga0068852_100401464 3300005616 Bacteria 1348
125 Ga0068859_100065132 3300005617 Bacteria 3678
126 Ga0068859_100091690 3300005617 Bacteria 3090
127 Ga0068859_100377677 3300005617 Bacteria 1513
128 Ga0068864_100003646 3300005618 Bacteria 12733
129 Ga0068864_100189888 3300005618 Bacteria 1883
130 Ga0068864_100384004 3300005618 Bacteria 1331
131 Ga0068864_100444756 3300005618 Bacteria 1239
132 Ga0068866_10068389 3300005718 Bacteria 1867
133 Ga0068861_100106971 3300005719 Bacteria 2235
134 Ga0068861_100319769 3300005719 Bacteria 1351
135 Ga0068851_10024989 3300005834 Bacteria 2928
136 Ga0068870_10001077 3300005840 Bacteria 10846
137 Ga0068870_10229878 3300005840 Bacteria 1140
138 Ga0068863_100008790 3300005841 Bacteria 9863
139 Ga0068863_100031057 3300005841 Bacteria 5101
140 Ga0068863_100037714 3300005841 Bacteria 4600
141 Ga0068863_100091883 3300005841 Bacteria 2879
142 Ga0068863_100266623 3300005841 Bacteria 1657
143 Ga0068863_100305567 3300005841 Bacteria 1543
144 Ga0068863_100753901 3300005841 Bacteria 969
145 Ga0068858_100028228 3300005842 Bacteria 5214
146 Ga0068858_100092053 3300005842 Bacteria 2822
147 Ga0068858_100152083 3300005842 Bacteria 2176
148 Ga0068860_100103529 3300005843 Bacteria 2717
149 Ga0068860_100428845 3300005843 Bacteria 1312
150 Ga0068862_100030107 3300005844 Bacteria 4574
151 Ga0081540_1000097 3300005983 Bacteria 92047
152 Ga0081540_1013035 3300005983 Bacteria 5427
153 Ga0081540_1071784 3300005983 Bacteria 1598
154 Ga0081540_1118498 3300005983 Bacteria 1104
155 Ga0081539_10000362 3300005985 Bacteria 99991
156 Ga0081539_10000717 3300005985 Bacteria 66511
157 Ga0081539_10003779 3300005985 Bacteria 17898
158 Ga0081539_10008025 3300005985 Bacteria 9361
159 Ga0081539_10018199 3300005985 Bacteria 4889
160 Ga0070717_10013206 3300006028 Bacteria 6318
161 Ga0070717_10020853 3300006028 Bacteria 5159
162 Ga0070717_10044157 3300006028 Bacteria 3639
163 Ga0070717_10050070 3300006028 Bacteria 3431
164 Ga0070717_10173178 3300006028 Bacteria 1878
165 Ga0070717_10579219 3300006028 Bacteria 1017
166 Ga0075432_10070917 3300006058 Bacteria 1252
167 Ga0070715_10067132 3300006163 Bacteria 1592
168 Ga0070715_10070915 3300006163 Bacteria 1556
169 Ga0070715_10100774 3300006163 Bacteria 1347
170 Ga0070715_10262595 3300006163 Bacteria 907
171 Ga0070716_100004930 3300006173 Bacteria 6425
172 Ga0070716_100012743 3300006173 Bacteria 4268
173 Ga0070716_100080197 3300006173 Bacteria 1945
174 Ga0070716_100181962 3300006173 Bacteria 1381
175 Ga0070712_100016169 3300006175 Bacteria 4816
176 Ga0070712_100054161 3300006175 Bacteria 2804
177 Ga0070712_100083229 3300006175 Bacteria 2323
178 Ga0097621_100026472 3300006237 Bacteria 4550
179 Ga0097621_100037503 3300006237 Bacteria 3884
180 Ga0097621_100530504 3300006237 Bacteria 1070
181 Ga0068871_100133340 3300006358 Bacteria 2108
182 Ga0068871_100268267 3300006358 Bacteria 1491
183 Ga0075428_100000285 3300006844 Bacteria 49638
184 Ga0075428_100001086 3300006844 Bacteria 28950
185 Ga0075428_100295248 3300006844 Bacteria 1743
186 Ga0075428_100320786 3300006844 Bacteria 1665
187 Ga0075430_100011110 3300006846 Bacteria 7633
188 Ga0075430_100018929 3300006846 Bacteria 5859
189 Ga0075431_100010461 3300006847 Bacteria 9331
190 Ga0075431_100039635 3300006847 Bacteria 4853
191 Ga0075431_100071337 3300006847 Bacteria 3584
192 Ga0075431_100446959 3300006847 Bacteria 1289
193 Ga0075433_10015321 3300006852 Bacteria 6283
194 Ga0075433_10026693 3300006852 Bacteria 4894
195 Ga0075433_10051383 3300006852 Bacteria 3589
196 Ga0075433_10162875 3300006852 Bacteria 1985
197 Ga0075434_100074892 3300006871 Bacteria 3378
198 Ga0075434_100143855 3300006871 Bacteria 2405
199 Ga0075429_100011961 3300006880 Bacteria 7524
200 Ga0075436_100046516 3300006914 Bacteria 2992
201 Ga0075436_100062594 3300006914 Bacteria 2571
202 Ga0097620_100065132 3300006931 Bacteria 3678
203 Ga0097620_100091682 3300006931 Bacteria 3090
204 Ga0097620_100377657 3300006931 Bacteria 1513
205 Ga0075435_100036424 3300007076 Bacteria 3910
206 Ga0075435_100658089 3300007076 Bacteria 909
207 Ga0105251_10035236 3300009011 Bacteria 2470
208 Ga0105240_10096263 3300009093 Bacteria 3608
209 Ga0105240_10132202 3300009093 Bacteria 2992
210 Ga0105240_10175492 3300009093 Bacteria 2534
211 Ga0111539_10301104 3300009094 Bacteria 1866
212 Ga0111539_11082833 3300009094 Bacteria 931
213 Ga0105245_10038978 3300009098 Bacteria 4229
214 Ga0105245_10395074 3300009098 Bacteria 1380
215 Ga0105247_10002988 3300009101 Bacteria 11217
216 Ga0105247_10023763 3300009101 Bacteria 3694
217 Ga0105247_10113109 3300009101 Bacteria 1750
218 Ga0105247_10118037 3300009101 Bacteria 1715
219 Ga0114129_10000585 3300009147 Bacteria 44984
220 Ga0114129_10001404 3300009147 Bacteria 32492
221 Ga0114129_10020050 3300009147 Bacteria 9515
222 Ga0114129_10169304 3300009147 Bacteria 2979
223 Ga0114129_10247729 3300009147 Bacteria 2393
224 Ga0114129_10380441 3300009147 Bacteria 1864
225 Ga0114129_10502901 3300009147 Bacteria 1583
226 Ga0105243_10367277 3300009148 Bacteria 1326
227 Ga0105241_10056186 3300009174 Bacteria 3018
228 Ga0105241_10096145 3300009174 Bacteria 2346
229 Ga0105248_10009836 3300009177 Bacteria 10536
230 Ga0105248_10030112 3300009177 Bacteria 6058
231 Ga0105248_10220471 3300009177 Bacteria 2135
232 Ga0105248_10365179 3300009177 Bacteria 1625
233 Ga0105248_10408363 3300009177 Bacteria 1529
234 Ga0105238_10139918 3300009551 Bacteria 2397
235 Ga0105238_10153501 3300009551 Bacteria 2278
236 Ga0105238_10289739 3300009551 Bacteria 1619
237 Ga0105239_10470371 3300010375 Bacteria 1427
238 Ga0105239_10550717 3300010375 Bacteria 1314
239 Ga0105246_10009862 3300011119 Bacteria 5890
240 Ga0105246_10031721 3300011119 Bacteria 3498
241 Ga0105246_10304781 3300011119 Bacteria 1288
242 Ga0157346_1003394 3300012480 Bacteria 887
243 Ga0157335_1002624 3300012492 Bacteria 1098
244 Ga0157341_1000300 3300012494 Bacteria 2347
245 Ga0157373_10039274 3300013100 Bacteria 3389
246 Ga0157373_10113560 3300013100 Bacteria 1904
247 Ga0157371_10170664 3300013102 Bacteria 1554
248 Ga0157370_10227721 3300013104 Bacteria 1726
249 Ga0157369_10036634 3300013105 Bacteria 5373
250 Ga0157369_10123499 3300013105 Bacteria 2746
251 Ga0157369_10300238 3300013105 Bacteria 1671
252 Ga0157369_10312716 3300013105 Bacteria 1633
253 Ga0157374_10143396 3300013296 Bacteria 2319
254 Ga0157378_10292443 3300013297 Bacteria 1574
255 Ga0163162_10224648 3300013306 Bacteria 2007
256 Ga0163162_10369275 3300013306 Bacteria 1568
257 Ga0157372_10018413 3300013307 Bacteria 7507
258 Ga0157372_10181727 3300013307 Bacteria 2435
259 Ga0157372_10533262 3300013307 Bacteria 1368
260 Ga0157375_10033480 3300013308 Bacteria 4884
261 Ga0157375_10474650 3300013308 Bacteria 1416
262 Ga0163163_10005527 3300014325 Bacteria 10942
263 Ga0163163_10066983 3300014325 Bacteria 3568
264 Ga0163163_10084893 3300014325 Bacteria 3173
265 Ga0163163_10085666 3300014325 Bacteria 3159
266 Ga0163163_10233703 3300014325 Bacteria 1888
267 Ga0157380_10049550 3300014326 Bacteria 3313
268 Ga0157380_10071988 3300014326 Bacteria 2798
269 Ga0182008_10111921 3300014497 Bacteria 1353
270 Ga0157377_10029761 3300014745 Bacteria 2952
271 Ga0157377_10068253 3300014745 Bacteria 2049
272 Ga0157379_10046736 3300014968 Bacteria 3862
273 Ga0157379_10609083 3300014968 Bacteria 1020
274 Ga0157376_10028563 3300014969 Bacteria 4434
275 Ga0157376_10238907 3300014969 Bacteria 1692
276 Ga0157376_10712627 3300014969 Bacteria 1010
277 Ga0163161_10040904 3300017792 Bacteria 3330
278 Ga0197907_10762344 3300020069 Bacteria 1225
279 Ga0197907_11015168 3300020069 Bacteria 1829
280 Ga0206356_10405628 3300020070 Bacteria 4042
281 Ga0206356_10489382 3300020070 Bacteria 2280
282 Ga0206356_10723889 3300020070 Bacteria 866
283 Ga0206356_10728356 3300020070 Bacteria 1545
284 Ga0206355_1368205 3300020076 Bacteria 1628
285 Ga0206355_1397913 3300020076 Bacteria 1137
286 Ga0206351_10506233 3300020077 Bacteria 2473
287 Ga0206350_10116847 3300020080 Bacteria 2230
288 Ga0206350_10544556 3300020080 Bacteria 1099
289 Ga0206350_11470673 3300020080 Bacteria 1398
290 Ga0206354_10072260 3300020081 Bacteria 1941
291 Ga0206354_11430440 3300020081 Bacteria 3961
292 Ga0206353_10430671 3300020082 Bacteria 3559
293 Ga0206353_10653977 3300020082 Bacteria 3453
294 Ga0213876_10001874 3300021384 Bacteria 12658
295 Ga0213875_10000781 3300021388 Bacteria 23756
296 Ga0224712_10104987 3300022467 Bacteria 1204
297 Ga0224712_10139492 3300022467 Bacteria 1066
298 Ga0224712_10150291 3300022467 Bacteria 1031
299 Ga0207656_10034157 3300025321 Bacteria 2122
300 Ga0207713_1050646 3300025735 Bacteria 1656
301 Ga0207713_1060396 3300025735 Bacteria 1449
302 Ga0207653_10030488 3300025885 Bacteria 1740
303 Ga0207692_10022951 3300025898 Bacteria 2879
304 Ga0207692_10033058 3300025898 Bacteria 2491
305 Ga0207692_10040234 3300025898 Bacteria 2306
306 Ga0207692_10073282 3300025898 Bacteria 1811
307 Ga0207710_10021043 3300025900 Bacteria 2793
308 Ga0207710_10058324 3300025900 Bacteria 1745
309 Ga0207688_10007394 3300025901 Bacteria 5981
310 Ga0207688_10007902 3300025901 Bacteria 5790
311 Ga0207688_10248991 3300025901 Bacteria 1076
312 Ga0207680_10040798 3300025903 Bacteria 2704
313 Ga0207647_10169197 3300025904 Bacteria 1273
314 Ga0207685_10039708 3300025905 Bacteria 1749
315 Ga0207699_10003669 3300025906 Bacteria 7332
316 Ga0207699_10004669 3300025906 Bacteria 6549
317 Ga0207699_10019293 3300025906 Bacteria 3633
318 Ga0207699_10098857 3300025906 Bacteria 1847
319 Ga0207699_10132956 3300025906 Bacteria 1625
320 Ga0207699_10137033 3300025906 Bacteria 1604
321 Ga0207699_10220016 3300025906 Bacteria 1296
322 Ga0207699_10270608 3300025906 Bacteria 1177
323 Ga0207645_10105047 3300025907 Bacteria 1824
324 Ga0207643_10000062 3300025908 Bacteria 71074
325 Ga0207705_10018746 3300025909 Bacteria 4951
326 Ga0207705_10172805 3300025909 Bacteria 1627
327 Ga0207684_10009273 3300025910 Bacteria 8692
328 Ga0207684_10080045 3300025910 Bacteria 2779
329 Ga0207654_10009696 3300025911 Bacteria 4899
330 Ga0207654_10197261 3300025911 Bacteria 1323
331 Ga0207707_10009697 3300025912 Bacteria 8354
332 Ga0207707_10147957 3300025912 Bacteria 2053
333 Ga0207707_10223166 3300025912 Bacteria 1640
334 Ga0207695_10151778 3300025913 Bacteria 2255
335 Ga0207695_10245111 3300025913 Bacteria 1692
336 Ga0207671_10030740 3300025914 Bacteria 4003
337 Ga0207671_10220119 3300025914 Bacteria 1487
338 Ga0207693_10024639 3300025915 Bacteria 4773
339 Ga0207693_10155645 3300025915 Bacteria 1797
340 Ga0207663_10012326 3300025916 Bacteria 4621
341 Ga0207663_10038321 3300025916 Bacteria 2896
342 Ga0207663_10061230 3300025916 Bacteria 2388
343 Ga0207663_10135441 3300025916 Bacteria 1708
344 Ga0207663_10182722 3300025916 Bacteria 1499
345 Ga0207663_10290786 3300025916 Bacteria 1217
346 Ga0207660_10002954 3300025917 Bacteria 11120
347 Ga0207662_10016531 3300025918 Bacteria 4166
348 Ga0207662_10032585 3300025918 Bacteria 3035
349 Ga0207657_10003435 3300025919 Bacteria 16892
350 Ga0207657_10042175 3300025919 Bacteria 4028
351 Ga0207649_10023459 3300025920 Bacteria 3574
352 Ga0207652_10014743 3300025921 Bacteria 6334
353 Ga0207652_10015959 3300025921 Bacteria 6123
354 Ga0207646_10006542 3300025922 Bacteria 12028
355 Ga0207646_10016172 3300025922 Bacteria 7011
356 Ga0207646_10029899 3300025922 Bacteria 4945
357 Ga0207681_10102720 3300025923 Bacteria 2065
358 Ga0207681_10206640 3300025923 Bacteria 1511
359 Ga0207694_10180105 3300025924 Bacteria 1714
360 Ga0207650_10008989 3300025925 Bacteria 6830
361 Ga0207659_10043962 3300025926 Bacteria 3141
362 Ga0207687_10120646 3300025927 Bacteria 1960
363 Ga0207687_10148187 3300025927 Bacteria 1788
364 Ga0207700_10003757 3300025928 Bacteria 8863
365 Ga0207700_10003804 3300025928 Bacteria 8816
366 Ga0207700_10012466 3300025928 Bacteria 5484
367 Ga0207700_10020572 3300025928 Bacteria 4486
368 Ga0207700_10064383 3300025928 Bacteria 2792
369 Ga0207700_10070758 3300025928 Bacteria 2683
370 Ga0207700_10071822 3300025928 Bacteria 2666
371 Ga0207700_10152645 3300025928 Bacteria 1910
372 Ga0207700_10499220 3300025928 Bacteria 1077
373 Ga0207664_10000171 3300025929 Bacteria 51218
374 Ga0207664_10006127 3300025929 Bacteria 8242
375 Ga0207664_10063189 3300025929 Bacteria 2958
376 Ga0207664_10066010 3300025929 Bacteria 2899
377 Ga0207664_10130710 3300025929 Bacteria 2113
378 Ga0207664_10177209 3300025929 Bacteria 1828
379 Ga0207664_10187700 3300025929 Bacteria 1778
380 Ga0207664_10194628 3300025929 Bacteria 1747
381 Ga0207644_10008563 3300025931 Bacteria 6692
382 Ga0207644_10220983 3300025931 Bacteria 1501
383 Ga0207644_10234310 3300025931 Bacteria 1460
384 Ga0207644_10260818 3300025931 Bacteria 1386
385 Ga0207644_10297315 3300025931 Bacteria 1300
386 Ga0207690_10111096 3300025932 Bacteria 1974
387 Ga0207706_10033968 3300025933 Bacteria 4539
388 Ga0207706_10383004 3300025933 Bacteria 1220
389 Ga0207709_10082602 3300025935 Bacteria 2075
390 Ga0207670_10011841 3300025936 Bacteria 5078
391 Ga0207670_10211328 3300025936 Bacteria 1480
392 Ga0207704_10086544 3300025938 Bacteria 2044
393 Ga0207665_10002702 3300025939 Bacteria 11894
394 Ga0207665_10017100 3300025939 Bacteria 4763
395 Ga0207665_10023353 3300025939 Bacteria 4074
396 Ga0207665_10094888 3300025939 Bacteria 2072
397 Ga0207665_10140297 3300025939 Bacteria 1723
398 Ga0207691_10077602 3300025940 Bacteria 2992
399 Ga0207711_10027183 3300025941 Bacteria 4806
400 Ga0207711_10037065 3300025941 Bacteria 4140
401 Ga0207711_10173550 3300025941 Bacteria 1957
402 Ga0207711_10180498 3300025941 Bacteria 1919
403 Ga0207711_10221171 3300025941 Bacteria 1732
404 Ga0207689_10002952 3300025942 Bacteria 15710
405 Ga0207689_10025596 3300025942 Bacteria 4944
406 Ga0207689_10152742 3300025942 Bacteria 1903
407 Ga0207661_10008496 3300025944 Bacteria 7338
408 Ga0207661_10055821 3300025944 Bacteria 3169
409 Ga0207661_10293647 3300025944 Bacteria 1455
410 Ga0207661_10588014 3300025944 Bacteria 1021
411 Ga0207679_10000826 3300025945 Bacteria 19925
412 Ga0207679_10058132 3300025945 Bacteria 2864
413 Ga0207679_10064875 3300025945 Bacteria 2731
414 Ga0207679_10171473 3300025945 Bacteria 1787
415 Ga0207667_10024240 3300025949 Bacteria 6666
416 Ga0207667_10398985 3300025949 Bacteria 1400
417 Ga0207668_10013862 3300025972 Bacteria 4978
418 Ga0207668_10348923 3300025972 Bacteria 1237
419 Ga0207668_10397576 3300025972 Bacteria 1164
420 Ga0207658_10100687 3300025986 Bacteria 2263
421 Ga0207658_10322334 3300025986 Bacteria 1338
422 Ga0207677_10028617 3300026023 Bacteria 3527
423 Ga0207677_10183556 3300026023 Bacteria 1648
424 Ga0207677_10199777 3300026023 Bacteria 1588
425 Ga0207703_10011442 3300026035 Bacteria 6899
426 Ga0207703_10084387 3300026035 Bacteria 2656
427 Ga0207703_10155232 3300026035 Bacteria 1999
428 Ga0207703_10362963 3300026035 Bacteria 1336
429 Ga0207639_10092005 3300026041 Bacteria 2430
430 Ga0207639_10140916 3300026041 Bacteria 2008
431 Ga0207639_10157404 3300026041 Bacteria 1910
432 Ga0207678_10000510 3300026067 Bacteria 35197
433 Ga0207678_10028460 3300026067 Bacteria 4879
434 Ga0207678_10042446 3300026067 Bacteria 3940
435 Ga0207678_10571972 3300026067 Bacteria 989
436 Ga0207708_10017836 3300026075 Bacteria 5342
437 Ga0207708_10033271 3300026075 Bacteria 3916
438 Ga0207702_10012078 3300026078 Bacteria 7183
439 Ga0207702_10013722 3300026078 Bacteria 6731
440 Ga0207702_10018909 3300026078 Bacteria 5700
441 Ga0207702_10019774 3300026078 Bacteria 5575
442 Ga0207702_10106123 3300026078 Bacteria 2489
443 Ga0207641_10013718 3300026088 Bacteria 6648
444 Ga0207641_10024995 3300026088 Bacteria 4926
445 Ga0207641_10040646 3300026088 Bacteria 3894
446 Ga0207641_10084564 3300026088 Bacteria 2762
447 Ga0207641_10132404 3300026088 Bacteria 2240
448 Ga0207641_10283187 3300026088 Bacteria 1560
449 Ga0207648_10210422 3300026089 Bacteria 1726
450 Ga0207676_10001571 3300026095 Bacteria 16806
451 Ga0207676_10013516 3300026095 Bacteria 5862
452 Ga0207676_10108732 3300026095 Bacteria 2315
453 Ga0207676_10134752 3300026095 Bacteria 2105
454 Ga0207676_10213943 3300026095 Bacteria 1712
455 Ga0207674_10004920 3300026116 Bacteria 15972
456 Ga0207674_10005169 3300026116 Bacteria 15556
457 Ga0207674_10042275 3300026116 Bacteria 4709
458 Ga0207674_10065447 3300026116 Bacteria 3663
459 Ga0207675_100296946 3300026118 Bacteria 1573
460 Ga0207683_10000214 3300026121 Bacteria 50433
461 Ga0207683_10185636 3300026121 Bacteria 1886
462 Ga0207698_10059237 3300026142 Bacteria 2972
463 Ga0207698_10133347 3300026142 Bacteria 2127
464 Ga0207698_10218808 3300026142 Bacteria 1719
465 Ga0207428_10001830 3300027907 Bacteria 21763
466 Ga0207428_10217547 3300027907 Bacteria 1433
467 Ga0268266_10025741 3300028379 Bacteria 5006
468 Ga0268266_10159713 3300028379 Bacteria 2038
469 Ga0268266_10296479 3300028379 Bacteria 1507
470 Ga0268266_10357724 3300028379 Bacteria 1373
471 Ga0268266_10412019 3300028379 Bacteria 1279
472 Ga0268265_10159519 3300028380 Bacteria 1914
473 Ga0268265_10237713 3300028380 Bacteria 1605
474 Ga0268264_10032660 3300028381 Bacteria 4271
475 Ga0265337_1003185 3300028556 Bacteria 7208
476 Ga0265326_10001914 3300028558 Bacteria 7127
477 Ga0265319_1000682 3300028563 Bacteria 22125
478 Ga0265334_10000160 3300028573 Bacteria 41820
479 Ga0265318_10037650 3300028577 Bacteria 1852
480 Ga0265323_10004706 3300028653 Bacteria 5853
481 Ga0265322_10007027 3300028654 Bacteria 3301
482 Ga0265336_10003919 3300028666 Bacteria 5703
483 Ga0265336_10007367 3300028666 Bacteria 3913
484 Ga0307515_10000119 3300028794 Bacteria 189566
485 Ga0307515_10105711 3300028794 Bacteria 3348
486 Ga0265338_10000148 3300028800 Bacteria 128839
487 Ga0265338_10033277 3300028800 Bacteria 5006
488 Ga0265338_10082736 3300028800 Bacteria 2687
489 Ga0265338_10093736 3300028800 Bacteria 2472
490 Ga0265324_10035197 3300029957 Bacteria 1743
491 Ga0307512_10003144 3300030522 Bacteria 19632
492 Ga0307512_10145633 3300030522 Bacteria 1434
493 Ga0265760_10020983 3300031090 Bacteria 1887
494 Ga0265332_10000443 3300031238 Bacteria 29217
495 Ga0265320_10001651 3300031240 Bacteria 15876
496 Ga0265320_10079171 3300031240 Bacteria 1536
497 Ga0265325_10002380 3300031241 Bacteria 12708
498 Ga0265325_10017046 3300031241 Bacteria 4043
499 Ga0265340_10018256 3300031247 Bacteria 3619
500 Ga0265339_10009430 3300031249 Bacteria 6138
501 Ga0265339_10113975 3300031249 Bacteria 1396
502 Ga0265316_10126499 3300031344 Bacteria 1926
503 Ga0307513_10007579 3300031456 Bacteria 14029
504 Ga0307509_10017954 3300031507 Bacteria 8123
505 Ga0265313_10043819 3300031595 Bacteria 2188
506 Ga0307508_10134404 3300031616 Bacteria 2076
507 Ga0265314_10005926 3300031711 Bacteria 10933
508 Ga0265314_10059181 3300031711 Bacteria 2622
509 Ga0265342_10003642 3300031712 Bacteria 12532
510 Ga0307516_10000149 3300031730 Bacteria 86821
511 Ga0307516_10039888 3300031730 Bacteria 4677
512 Ga0307516_10061367 3300031730 Bacteria 3648
513 Ga0307405_10465876 3300031731 Bacteria 1005
514 Ga0307413_10027446 3300031824 Bacteria 3155
515 Ga0307413_10250284 3300031824 Bacteria 1314
516 Ga0307410_10038849 3300031852 Bacteria 3121
517 Ga0307410_10297849 3300031852 Bacteria 1271
518 Ga0307406_10008662 3300031901 Bacteria 5683
519 Ga0307406_10530278 3300031901 Bacteria 960
520 Ga0307407_10037722 3300031903 Bacteria 2672
521 Ga0307409_100003817 3300031995 Bacteria 8312
522 Ga0307409_100444259 3300031995 Bacteria 1250
523 Ga0307409_100738338 3300031995 Bacteria 987
524 Ga0307416_100005302 3300032002 Bacteria 7903
525 Ga0307411_10257437 3300032005 Bacteria 1376
526 Ga0307415_100027971 3300032126 Bacteria 3580
527 Ga0307415_100378280 3300032126 Bacteria 1201
528 Ga0307415_100556073 3300032126 Bacteria 1013
529 Ga0307415_100783391 3300032126 Bacteria 869
530 Ga0307507_10172226 3300033179 Bacteria 1570
531 Ga0307510_10163330 3300033180 Bacteria 1820
532 Ga0307510_10257558 3300033180 Bacteria 1228
533 Ga0373959_0012000 3300034820 Bacteria 1540
534 Ga0373938_0003442 3300034957 Bacteria 2596
535 Ga0373938_0005082 3300034957 Bacteria 2224
536 Ga0373926_0000466 3300035083 Bacteria 10642
537 Ga0373926_0009931 3300035083 Bacteria 3186
538 Ga0373926_0032655 3300035083 Bacteria 1837
539 Ga0373926_0055287 3300035083 Bacteria 1438
540 Ga0373934_0002514 3300035086 Bacteria 6739
541 Ga0373934_0014637 3300035086 Bacteria 2972
542 Ga0373940_0000286 3300035088 Bacteria 7291
543 Ga0373944_0013974 3300035089 Bacteria 2235
544 Ga0373944_0048034 3300035089 Bacteria 1338
545 Ga0373949_0010190 3300035090 Bacteria 2059
546 Ga0373951_0026521 3300035091 Bacteria 1350
547 Ga0373952_0021185 3300035092 Bacteria 1370
548 Ga0373923_0006829 3300035111 Bacteria 3970
549 Ga0373923_0021375 3300035111 Bacteria 2525
550 Ga0373923_0034499 3300035111 Bacteria 2054
551 Ga0373932_0060220 3300035112 Bacteria 1151
552 Ga0373936_0001343 3300035113 Bacteria 8932
553 Ga0373936_0111602 3300035113 Bacteria 1161
554 Ga0373939_0002004 3300035114 Bacteria 4862
555 Ga0373939_0081131 3300035114 Bacteria 1077
556 Ga0373953_0003568 3300035117 Bacteria 4867
557 Ga0373953_0007432 3300035117 Bacteria 3669
558 Ga0373953_0065435 3300035117 Bacteria 1492
559 Ga0373953_0084343 3300035117 Bacteria 1324
560 Ga0373954_0153785 3300035118 Bacteria 1124
561 Ga0373956_0014216 3300035119 Bacteria 3323
562 Ga0373956_0017767 3300035119 Bacteria 3003
563 Ga0373956_0034899 3300035119 Bacteria 2216
564 Ga0373957_0004472 3300035120 Bacteria 4254
565 Ga0373957_0037853 3300035120 Bacteria 1803
566 Ga0373957_0072743 3300035120 Bacteria 1347
567 Ga0373960_0011533 3300035121 Bacteria 2178
568 Ga0373960_0081321 3300035121 Bacteria 1020
569 Ga0373943_0025333 3300035170 Bacteria 2772
570 Ga0373943_0083906 3300035170 Bacteria 1638
571 Ga0373943_0110995 3300035170 Bacteria 1446
572 Ga0373946_0004755 3300035171 Bacteria 4883
573 Ga0373946_0030978 3300035171 Bacteria 2138
574 Ga0373955_0004742 3300035172 Bacteria 6047
575 Ga0373955_0007371 3300035172 Bacteria 5053
576 Ga0373955_0010229 3300035172 Bacteria 4423
577 Ga0373942_0000185 3300035207 Bacteria 15769
578 Ga0373942_0042310 3300035207 Bacteria 1248
579 Ga0373961_0048573 3300035241 Bacteria 1251
580 Ga0373961_0058268 3300035241 Bacteria 1164
581 Ga0373961_0096467 3300035241 Bacteria 952
582 Ga0373962_0004291 3300035242 Bacteria 3442
583 Ga0373962_0005163 3300035242 Bacteria 3156
584 Ga0373924_0004136 3300035410 Bacteria 5048
585 Ga0373924_0007133 3300035410 Bacteria 4028
586 Ga0373931_0242268 3300035691 Bacteria 1093
587 Ga0373931_0401899 3300035691 Bacteria 867
588 Ga0373935_0066945 3300035692 Bacteria 2308
589 Ga0373927_0016941 3300035695 Bacteria 4802
590 Ga0373927_0066901 3300035695 Bacteria 2325
591 Ga0373927_0203365 3300035695 Bacteria 1300
592 Ga0373933_0001929 3300035724 Bacteria 11965
593 Ga0373933_0014478 3300035724 Bacteria 4388
594 Ga0373947_0001176 3300035725 Bacteria 16097
595 Ga0373947_0128877 3300035725 Bacteria 1613
596 Ga0373947_0148253 3300035725 Bacteria 1509
597 Ga0373947_0211998 3300035725 Bacteria 1271
598 Ga0373937_0008996 3300036401 Bacteria 8671
599 Ga0373937_0022290 3300036401 Bacteria 5694
600 Ga0373937_0046720 3300036401 Bacteria 3959
601 Ga0373937_0543095 3300036401 Bacteria 1104
602 Ga0310109_008703 3300036534 Bacteria 1353
603 Ga0373925_0000004 3300037068 Bacteria 361597
604 Ga0373925_0013204 3300037068 Bacteria 5978
605 Ga0373925_0117981 3300037068 Bacteria 2057
606 Ga0373925_0174663 3300037068 Bacteria 1697
607 Ga0373925_0641181 3300037068 Bacteria 875
608 Ga0395900_0001388 3300037418 Bacteria 29031
609 Ga0395900_0604213 3300037418 Bacteria 1037
610 Ga0395898_0007474 3300037466 Bacteria 11603
611 Ga0395898_0205064 3300037466 Bacteria 1881
612 Ga0395898_0441644 3300037466 Bacteria 1239
613 Ga0395905_0001885 3300037471 Bacteria 24168
614 Ga0395905_0584492 3300037471 Bacteria 1018
615 Ga0436364_0213102 3300037853 Bacteria 3798
616 Ga0436364_0969684 3300037853 Bacteria 2354
617 Ga0436364_1133930 3300037853 Bacteria 44830
618 Ga0436364_1202907 3300037853 Bacteria 10551
619 Ga0436364_1377900 3300037853 Bacteria 3398
620 Ga0395901_0001402 3300038443 Bacteria 25176
621 Ga0395901_0026591 3300038443 Bacteria 5942
622 Ga0436365_0567091 3300039437 Bacteria 46375
623 Ga0436360_0972388 3300039438 Bacteria 1010
624 Ga0436362_0612140 3300039453 Bacteria 1137
625 Ga0436362_0804513 3300039453 Bacteria 894
626 Ga0451839_1201347 3300041496 Bacteria 1129
627 Ga0451839_1338288 3300041496 Bacteria 894
628 Ga0451843_0226282 3300041509 Bacteria 1643
629 Ga0451853_2299179 3300041512 Bacteria 2211
630 Ga0439463_006694 3300042016 Bacteria 2851
631 Ga0450902_016570 3300042137 Bacteria 1201
632 Ga0439459_0032767 3300042438 Bacteria 1067
633 Ga0466961_0172666 3300044693 Bacteria 1344
634 Ga0466963_0041711 3300044694 Bacteria 3011
635 Ga0466963_0169609 3300044694 Bacteria 1521
636 Ga0466963_0423629 3300044694 Bacteria 939
637 Ga0466971_0026957 3300044719 Bacteria 2572
638 Ga0466960_0233682 3300044901 Bacteria 1015
639 Ga0466959_0022068 3300045049 Bacteria 4702
640 Ga0466959_0302947 3300045049 Bacteria 1094
641 Ga0466958_0213137 3300045836 Bacteria 1231
642 Ga0466967_0201516 3300045976 Bacteria 1885
643 Ga0466967_0298639 3300045976 Bacteria 1549
644 Ga0495592_0026164 3300046454 Bacteria 4426
645 Ga0495592_0071886 3300046454 Bacteria 2517
646 Ga0495592_0126054 3300046454 Bacteria 1796
647 Ga0495603_0011218 3300046455 Bacteria 5429
648 Ga0495603_0124763 3300046455 Bacteria 1500
649 Ga0495629_0014806 3300046459 Bacteria 5609
650 Ga0495629_0015166 3300046459 Bacteria 5539
651 Ga0495629_0028216 3300046459 Bacteria 3985
652 Ga0495629_0035347 3300046459 Bacteria 3531
653 Ga0495629_0040318 3300046459 Bacteria 3284
654 Ga0495629_0306855 3300046459 Bacteria 1086
655 Ga0495641_0003281 3300046461 Bacteria 12216
656 Ga0495641_0009096 3300046461 Bacteria 5949
657 Ga0495641_0093238 3300046461 Bacteria 1345
658 Ga0495641_0106403 3300046461 Bacteria 1251
659 Ga0495651_0015262 3300046462 Bacteria 5938
660 Ga0495651_0039521 3300046462 Bacteria 3672
661 Ga0495651_0048192 3300046462 Bacteria 3291
662 Ga0495651_0078960 3300046462 Bacteria 2488
663 Ga0495653_0029952 3300046463 Bacteria 4337
664 Ga0495653_0032685 3300046463 Bacteria 4129
665 Ga0495653_0121735 3300046463 Bacteria 1858
666 Ga0495653_0229116 3300046463 Bacteria 1244
667 Ga0495580_0034108 3300046472 Bacteria 3664
668 Ga0495580_0203229 3300046472 Bacteria 1364
669 Ga0495582_0002234 3300046473 Bacteria 10842
670 Ga0495582_0181712 3300046473 Bacteria 1198
671 Ga0495639_0110612 3300046475 Bacteria 1303
672 Ga0495662_0047270 3300046476 Bacteria 2077
673 Ga0495662_0084117 3300046476 Bacteria 1548
674 Ga0495662_0130515 3300046476 Bacteria 1235
675 Ga0495662_0132884 3300046476 Bacteria 1224
676 Ga0495664_0029985 3300046477 Bacteria 3184
677 Ga0495594_0216769 3300046499 Bacteria 1091
678 Ga0495608_0007212 3300046511 Bacteria 7863
679 Ga0495608_0020244 3300046511 Bacteria 4573
680 Ga0495608_0037080 3300046511 Bacteria 3279
681 Ga0495608_0073934 3300046511 Bacteria 2221
682 Ga0495618_0045409 3300046514 Bacteria 2771
683 Ga0495618_0058898 3300046514 Bacteria 2433
684 Ga0495618_0256209 3300046514 Bacteria 1096
685 Ga0495628_0037878 3300046516 Bacteria 3863
686 Ga0495630_0016178 3300046517 Bacteria 5450
687 Ga0495630_0085626 3300046517 Bacteria 2379
688 Ga0495630_0131286 3300046517 Bacteria 1902
689 Ga0495666_0068227 3300046526 Bacteria 1693
690 Ga0495652_0031017 3300046529 Bacteria 4683
691 Ga0495665_0007819 3300046531 Bacteria 5784
692 Ga0495665_0017421 3300046531 Bacteria 3864
693 Ga0495640_0016525 3300046533 Bacteria 5519
694 Ga0495640_0023697 3300046533 Bacteria 4467
695 Ga0495640_0210164 3300046533 Bacteria 1230
696 Ga0495586_0035950 3300046535 Bacteria 2660
697 Ga0495586_0053286 3300046535 Bacteria 2191
698 Ga0495587_0000622 3300046536 Bacteria 23992
699 Ga0495587_0016344 3300046536 Bacteria 4617
700 Ga0495587_0016487 3300046536 Bacteria 4595
701 Ga0495645_0020301 3300046543 Bacteria 4791
702 Ga0495645_0048532 3300046543 Bacteria 3092
703 Ga0495645_0083738 3300046543 Bacteria 2285
704 Ga0495622_0075444 3300046557 Bacteria 1554
705 Ga0495667_0022172 3300046559 Bacteria 4279
706 Ga0495667_0024735 3300046559 Bacteria 4044
707 Ga0495667_0032505 3300046559 Bacteria 3496
708 Ga0495667_0270609 3300046559 Bacteria 1079
709 Ga0495668_0000872 3300046616 Bacteria 33998
710 Ga0495634_0002233 3300046642 Bacteria 16223
711 Ga0495634_0010992 3300046642 Bacteria 6606
712 Ga0495634_0018939 3300046642 Bacteria 4895
713 Ga0495634_0037425 3300046642 Bacteria 3315
714 Ga0495625_0001540 3300046660 Bacteria 27551
715 Ga0495635_0009496 3300046663 Bacteria 6798
716 Ga0495635_0017916 3300046663 Bacteria 4946
717 Ga0495635_0018484 3300046663 Bacteria 4862
718 Ga0495588_0049893 3300046674 Bacteria 2153
719 Ga0495588_0059107 3300046674 Bacteria 1982
720 Ga0495657_0008676 3300046675 Bacteria 7759
721 Ga0495657_0012224 3300046675 Bacteria 6383
722 Ga0495657_0018394 3300046675 Bacteria 5059
723 Ga0495657_0051922 3300046675 Bacteria 2751
724 Ga0495599_0002361 3300046678 Bacteria 10962
725 Ga0495599_0033234 3300046678 Bacteria 3240
726 Ga0495599_0059564 3300046678 Bacteria 2388
727 Ga0495623_0076976 3300046679 Bacteria 2069
728 Ga0495646_0006386 3300046680 Bacteria 7476
729 Ga0495646_0039563 3300046680 Bacteria 2906
730 Ga0495646_0045559 3300046680 Bacteria 2678
731 Ga0495646_0261457 3300046680 Bacteria 924
732 Ga0495647_0003697 3300046681 Bacteria 4913
733 Ga0495658_0002971 3300046683 Bacteria 8490
734 Ga0495658_0003148 3300046683 Bacteria 8224
735 Ga0495658_0223885 3300046683 Bacteria 1178
736 Ga0495613_0011502 3300046689 Bacteria 6583
737 Ga0495613_0031106 3300046689 Bacteria 3964
738 Ga0495613_0032336 3300046689 Bacteria 3886
739 Ga0495624_0030464 3300046690 Bacteria 3514
740 Ga0495624_0037702 3300046690 Bacteria 3108
741 Ga0495624_0049971 3300046690 Bacteria 2650
742 Ga0495600_0099022 3300046809 Bacteria 1900
743 Ga0495600_0131570 3300046809 Bacteria 1626
744 Ga0495600_0193721 3300046809 Bacteria 1306
745 Ga0495600_0304710 3300046809 Bacteria 1004
746 Ga0495581_0006889 3300047315 Bacteria 6588
747 Ga0495581_0010234 3300047315 Bacteria 5425
748 Ga0495604_0012891 3300047317 Bacteria 6659
749 Ga0495604_0019147 3300047317 Bacteria 5482
750 Ga0495604_0187039 3300047317 Bacteria 1445
751 Ga0495674_0029900 3300047319 Bacteria 4956
752 Ga0495674_0073050 3300047319 Bacteria 2957
753 Ga0495674_0091846 3300047319 Bacteria 2592
754 Ga0495674_0123745 3300047319 Bacteria 2183
755 Ga0495680_0015432 3300047322 Bacteria 6591
756 Ga0495680_0062167 3300047322 Bacteria 2871
757 Ga0495680_0063309 3300047322 Bacteria 2840
758 Ga0495680_0078152 3300047322 Bacteria 2504
759 Ga0495680_0086308 3300047322 Bacteria 2361
760 Ga0495680_0143642 3300047322 Bacteria 1744
761 Ga0495680_0218264 3300047322 Bacteria 1362
762 Ga0495675_0031940 3300047444 Bacteria 3362
763 Ga0495675_0035175 3300047444 Bacteria 3199
764 Ga0495675_0088711 3300047444 Bacteria 1942
765 Ga0495684_0008153 3300047471 Bacteria 8104
766 Ga0495684_0017391 3300047471 Bacteria 5534
767 Ga0495684_0018808 3300047471 Bacteria 5322
768 Ga0495684_0021849 3300047471 Bacteria 4925
769 Ga0495684_0078056 3300047471 Bacteria 2512
770 Ga0495684_0104786 3300047471 Bacteria 2137
771 Ga0495593_0011104 3300047673 Bacteria 5181
772 Ga0495593_0018869 3300047673 Bacteria 3870
773 Ga0495593_0030932 3300047673 Bacteria 2927
774 Ga0495602_0032954 3300048088 Bacteria 4869
775 Ga0495602_0055085 3300048088 Bacteria 3504
776 Ga0495602_0066205 3300048088 Bacteria 3114
777 Ga0495602_0106935 3300048088 Bacteria 2282
778 Ga0495614_0018641 3300048089 Bacteria 3006
779 Ga0495614_0021494 3300048089 Bacteria 2786
780 Ga0495626_0000116 3300048091 Bacteria 104938
781 Ga0496100_0060510 3300048903 Bacteria 2493
782 Ga0496100_0066842 3300048903 Bacteria 2386
783 Ga0496100_0142289 3300048903 Bacteria 1701
784 Ga0496101_0029589 3300048904 Bacteria 3831
785 Ga0496101_0047796 3300048904 Bacteria 3073
786 Ga0496102_0071383 3300048905 Bacteria 3188
787 Ga0496102_0091815 3300048905 Bacteria 2811
788 Ga0496102_0120118 3300048905 Bacteria 2454
789 Ga0496102_0129343 3300048905 Bacteria 2362
790 Ga0496103_0026783 3300048906 Bacteria 3489
791 Ga0496103_0106662 3300048906 Bacteria 1777
792 Ga0496104_0023870 3300048907 Bacteria 5624
793 Ga0496104_0038270 3300048907 Bacteria 4488
794 Ga0496104_0043775 3300048907 Bacteria 4205
795 Ga0496104_0056957 3300048907 Bacteria 3698
796 Ga0496104_0273895 3300048907 Bacteria 1600
797 Ga0496105_0003718 3300048908 Bacteria 11358
798 Ga0496105_0016938 3300048908 Bacteria 5831
799 Ga0496105_0017370 3300048908 Bacteria 5766
800 Ga0496105_0110097 3300048908 Bacteria 2273
801 Ga0496106_0007783 3300048909 Bacteria 7928
802 Ga0496106_0039672 3300048909 Bacteria 3526
803 Ga0496106_0173381 3300048909 Bacteria 1710
804 Ga0496106_0175660 3300048909 Bacteria 1699
805 Ga0496107_0024004 3300048910 Bacteria 4310
806 Ga0496108_0000019 3300048911 Bacteria 234657
807 Ga0496108_0073796 3300048911 Bacteria 2880
808 Ga0496108_0158454 3300048911 Bacteria 1955
809 Ga0496108_0202754 3300048911 Bacteria 1721
810 Ga0496108_0299137 3300048911 Bacteria 1401
811 Ga0496108_0409849 3300048911 Bacteria 1184
812 Ga0496109_0017888 3300048912 Bacteria 6220
813 Ga0496109_0020481 3300048912 Bacteria 5842
814 Ga0496109_0201000 3300048912 Bacteria 1873
815 Ga0496109_0216369 3300048912 Bacteria 1801
816 Ga0496110_0001540 3300048913 Bacteria 16770
817 Ga0496110_0022279 3300048913 Bacteria 5377
818 Ga0496110_0051948 3300048913 Bacteria 3602
819 Ga0496110_0082705 3300048913 Bacteria 2863
820 Ga0496110_0143069 3300048913 Bacteria 2162
821 Ga0496110_0178736 3300048913 Bacteria 1927
822 Ga0496111_0003334 3300048914 Bacteria 9928
823 Ga0496111_0021617 3300048914 Bacteria 4496
824 Ga0496111_0043828 3300048914 Bacteria 3216
825 Ga0496111_0046373 3300048914 Bacteria 3129
826 Ga0496111_0227413 3300048914 Bacteria 1385
827 Ga0496112_0002106 3300048915 Bacteria 15786
828 Ga0496112_0018658 3300048915 Bacteria 6537
829 Ga0496112_0035356 3300048915 Bacteria 4866
830 Ga0496113_0013661 3300048916 Bacteria 5512
831 Ga0496113_0031326 3300048916 Bacteria 3858
832 Ga0496113_0221462 3300048916 Bacteria 1508
833 Ga0496113_0256892 3300048916 Bacteria 1395
834 Ga0496113_0323940 3300048916 Bacteria 1235
835 Ga0496114_0028738 3300048917 Bacteria 4565
836 Ga0496114_0097947 3300048917 Bacteria 2499
837 Ga0496115_0076563 3300048918 Bacteria 2719
838 Ga0496115_0115165 3300048918 Bacteria 2210
839 Ga0496119_0054393 3300048922 Bacteria 2437
840 Ga0496126_0020690 3300048929 Bacteria 6444
841 Ga0496126_0138305 3300048929 Bacteria 2098
842 Ga0496126_0404357 3300048929 Bacteria 1107
843 Ga0501043_0061450 3300049579 Bacteria 2951
844 Ga0501046_0061723 3300049580 Bacteria 2929
845 Ga0501081_0043759 3300049743 Bacteria 3072
846 Ga0501045_0018148 3300049824 Bacteria 5000
847 nmdc:mga05p37_162935_c1 3300050507 Bacteria 2723
848 nmdc:mga05p37_263411_c1 3300050507 Bacteria 2062
849 nmdc:mga05p37_31122_c1 3300050507 Bacteria 6517
850 nmdc:mga05p37_3785_c1 3300050507 Bacteria 17712
851 nmdc:mga05p37_509401_c1 3300050507 Bacteria 1379
852 nmdc:mga09592_179467_c1 3300050508 Bacteria 1831
853 nmdc:mga09592_62_c1 3300050508 Bacteria 60818
854 nmdc:mga09592_9038_c1 3300050508 Bacteria 8098
855 nmdc:mga0qj67_1407_c1 3300050509 Bacteria 16843
856 nmdc:mga0qj67_209857_c1 3300050509 Bacteria 1582
857 nmdc:mga0qj67_391269_c1 3300050509 Bacteria 1122
858 nmdc:mga0qj67_6584_c1 3300050509 Bacteria 8534
859 nmdc:mga0qj67_74169_c1 3300050509 Bacteria 2719
860 nmdc:mga06r32_1433_c1 3300050510 Bacteria 21539
861 nmdc:mga06r32_17514_c1 3300050510 Bacteria 6540
862 nmdc:mga06r32_356718_c1 3300050510 Bacteria 1446
863 nmdc:mga08y16_242660_c1 3300050511 Bacteria 1862
864 nmdc:mga08y16_26079_c1 3300050511 Bacteria 6165
865 nmdc:mga0n895_317576_c1 3300050512 Bacteria 1579
866 nmdc:mga0n895_398000_c1 3300050512 Bacteria 1393
867 nmdc:mga0n895_676030_c1 3300050512 Bacteria 1030
868 nmdc:mga0rr50_11810_c1 3300050513 Bacteria 5609
869 nmdc:mga0rr50_30610_c1 3300050513 Bacteria 3813
870 nmdc:mga0rr50_52877_c1 3300050513 Bacteria 3020
871 nmdc:mga0rr50_571866_c1 3300050513 Bacteria 963
872 nmdc:mga08x19_4526_c1 3300050514 Bacteria 8240
873 nmdc:mga0a205_12318_c1 3300050515 Bacteria 7909
874 nmdc:mga0a205_16922_c1 3300050515 Bacteria 6827
875 nmdc:mga0a205_365030_c1 3300050515 Bacteria 1310
876 nmdc:mga0a205_61866_c1 3300050515 Bacteria 3617
877 Ga0495601_0060185 3300053077 Bacteria 2409
878 Ga0495601_0075230 3300053077 Bacteria 2161
879 Ga0495601_0127975 3300053077 Bacteria 1653
880 Ga0495612_0044601 3300053078 Bacteria 1814
881 Ga0495595_0033403 3300053084 Bacteria 2321
882 Ga0495595_0034668 3300053084 Bacteria 2283
883 Ga0495619_0027468 3300053085 Bacteria 3665
884 Ga0495619_0044520 3300053085 Bacteria 2913
885 Ga0495619_0047213 3300053085 Bacteria 2835
886 Ga0495619_0103511 3300053085 Bacteria 1939
887 Ga0495619_0213170 3300053085 Bacteria 1337
888 Ga0500644_0022687 3300053088 Bacteria 1896
889 Ga0500569_003268 3300053109 Bacteria 3292
890 Ga0500594_0002062 3300053118 Bacteria 4344
891 Ga0500652_021506 3300053131 Bacteria 2431
892 Ga0500604_0014576 3300053151 Bacteria 2142
893 Ga0500616_0004554 3300053153 Bacteria 9816
894 Ga0587073_0015736 3300059492 Bacteria 1369
895 2501945467 2501939600 Bacteria 6907073
896 2515495525 2515154088 Bacteria 5526283
897 2515720284 2515154129 Bacteria 5584369
898 2515755970 2515154137 Bacteria 5711575
899 2516084387 2515154202 Bacteria 5471270
900 2516089692 2515154203 Bacteria 5458536
901 2623585190 2622736626 Bacteria 7181580
902 2753272236 2751185782 Bacteria 11227053
903 2772645528 2772190715 Bacteria 6959372
904 2832010230 2832004796 Bacteria 6538017
905 2855673897 2855670206 Bacteria 7120389
906 2855679495 2855676851 Bacteria 7063653
907 2855688738 2855683550 Bacteria 7134265
908 2856859023 2856858025 Bacteria 7255264
909 2857289429 2857288857 Bacteria 7189066
910 2858851941 2858848962 Bacteria 6963058
911 2858887963 2858882152 Bacteria 7230291
912 2858895370 2858888857 Bacteria 7060307
913 2858900128 2858895516 Bacteria 7378898
914 2858902804 2858902515 Bacteria 7086037
915 2866068358 2866065130 Bacteria 6518152
916 2867306151 2867302475 Bacteria 7087181
917 2867323163 2867319477 Bacteria 7069771
918 2869051489 2869048445 Bacteria 6875584
919 2869067008 2869061728 Bacteria 7112407
920 2869071718 2869068681 Bacteria 7205615
921 2880495050 2880489317 Bacteria 7096270
922 2880497279 2880495981 Bacteria 7340502
923 2887486910 2887478801 Bacteria 8972725
924 2929225847 2929219909 Bacteria 6984360
925 2929231164 2929226422 Bacteria 7248583
926 2996222146 2996221748 Bacteria 6799777
927 649813016 649633069 Bacteria 6962533
928 8001785279 8001781756 Bacteria 9586736
929 8003870827 8003870546 Bacteria 7396674
930 8054710385 8054704163 Bacteria 7247792
931 8054731508 8054727385 Bacteria 7558670
932 8054736142 8054734606 Bacteria 6947278
933 8055418465 8055412473 Bacteria 6257500
934 8056062043 8056060235 Bacteria 7259403
935 Ga0495606_0001354
936 JGI24751J29686_10005593
937 JGI25406J46586_10001930
938 JGI25406J46586_10043530
939 rootL2_10009411
940 JGI25404J52841_10024113
941 Ga0070658_10022159
942 Ga0070658_10166820
943 Ga0070676_10025161
944 Ga0070676_10269124
945 Ga0070683_100079237
946 Ga0070683_100198596
947 Ga0070683_100277135
948 Ga0070683_100484768
949 Ga0070690_100108690
950 Ga0068869_100044797
951 Ga0070666_10029152
952 Ga0070666_10141599
953 Ga0070680_100270183
954 Ga0070680_100296607
955 Ga0070682_100001383
956 Ga0068868_100015236
957 Ga0070660_100057728
958 Ga0070689_100221380
959 Ga0070691_10047770
960 Ga0070691_10082568
961 Ga0070691_10100572
962 Ga0070687_100058055
963 Ga0070661_100039242
964 Ga0070668_100002088
965 Ga0070668_100162646
966 Ga0070669_100158943
967 Ga0070675_100012505
968 Ga0070671_100003212
969 Ga0070671_100118916
970 Ga0070671_100345265
971 Ga0070674_100166770
972 Ga0070673_100103833
973 Ga0070673_100802550
974 Ga0070688_100171172
975 Ga0070659_100167668
976 Ga0070667_100361439
977 Ga0070709_10005585
978 Ga0070709_10013118
979 Ga0070709_10020792
980 Ga0070709_10416908
981 Ga0070709_10427722
982 Ga0070714_100000241
983 Ga0070714_100001408
984 Ga0070714_100017345
985 Ga0070714_100179800
986 Ga0070713_100017737
987 Ga0070713_100028459
988 Ga0070713_100095336
989 Ga0070713_100177665
990 Ga0070713_100352547
991 Ga0070710_10043408
992 Ga0070710_10118384
993 Ga0070701_10036294
994 Ga0070701_10038602
995 Ga0070711_100037656
996 Ga0070711_100052032
997 Ga0070711_100157095
998 Ga0070711_100181203
999 Ga0070711_100192828
1000 Ga0070711_100260195
1001 Ga0070705_100062618
1002 Ga0070700_100042188
1003 Ga0070694_100052088
1004 Ga0070708_100176822
1005 Ga0070663_100010629
1006 Ga0070663_100036070
1007 Ga0070663_100332357
1008 Ga0070663_100436160
1009 Ga0070678_100143587
1010 Ga0070678_100402776
1011 Ga0070681_10006696
1012 Ga0070681_10033020
1013 Ga0070681_10080851
1014 Ga0068867_100493125
1015 Ga0070706_100015280
1016 Ga0070706_100200598
1017 Ga0070707_100012139
1018 Ga0070698_100001093
1019 Ga0070698_100004321
1020 Ga0070698_100036536
1021 Ga0070698_100074116
1022 Ga0070699_100335904
1023 Ga0070679_100067907
1024 Ga0070684_100036900
1025 Ga0070684_100063933
1026 Ga0070684_100069485
1027 Ga0070697_100011045
1028 Ga0070697_100182251
1029 Ga0070697_100308991
1030 Ga0068853_100061332
1031 Ga0068853_100312281
1032 Ga0070672_100091873
1033 Ga0070686_100078946
1034 Ga0070695_100246443
1035 Ga0070696_100037527
1036 Ga0070696_100090801
1037 Ga0070693_100000312
1038 Ga0070693_100085068
1039 Ga0070665_100080607
1040 Ga0070665_100111058
1041 Ga0070665_100153500
1042 Ga0070665_100453265
1043 Ga0070704_100498604
1044 Ga0068855_100004544
1045 Ga0068855_100061299
1046 Ga0068855_100190945
1047 Ga0068855_100201719
1048 Ga0068855_100306487
1049 Ga0070664_100099016
1050 Ga0068857_100069826
1051 Ga0068857_100145969
1052 Ga0068854_100067344
1053 Ga0068856_100238557
1054 Ga0068856_100412226
1055 Ga0070702_100000170
1056 Ga0070702_100014942
1057 Ga0068852_100012422
1058 Ga0068852_100401464
1059 Ga0068859_100065132
1060 Ga0068859_100091690
1061 Ga0068859_100377677
1062 Ga0068864_100003646
1063 Ga0068864_100189888
1064 Ga0068864_100384004
1065 Ga0068864_100444756
1066 Ga0068866_10068389
1067 Ga0068861_100106971
1068 Ga0068861_100319769
1069 Ga0068851_10024989
1070 Ga0068870_10001077
1071 Ga0068870_10229878
1072 Ga0068863_100008790
1073 Ga0068863_100031057
1074 Ga0068863_100037714
1075 Ga0068863_100091883
1076 Ga0068863_100266623
1077 Ga0068863_100305567
1078 Ga0068863_100753901
1079 Ga0068858_100028228
1080 Ga0068858_100092053
1081 Ga0068858_100152083
1082 Ga0068860_100103529
1083 Ga0068860_100428845
1084 Ga0068862_100030107
1085 Ga0081540_1000097
1086 Ga0081540_1013035
1087 Ga0081540_1071784
1088 Ga0081540_1118498
1089 Ga0081539_10000362
1090 Ga0081539_10000717
1091 Ga0081539_10003779
1092 Ga0081539_10008025
1093 Ga0081539_10018199
1094 Ga0070717_10013206
1095 Ga0070717_10020853
1096 Ga0070717_10044157
1097 Ga0070717_10050070
1098 Ga0070717_10173178
1099 Ga0070717_10579219
1100 Ga0075432_10070917
1101 Ga0070715_10067132
1102 Ga0070715_10070915
1103 Ga0070715_10100774
1104 Ga0070715_10262595
1105 Ga0070716_100004930
1106 Ga0070716_100012743
1107 Ga0070716_100080197
1108 Ga0070716_100181962
1109 Ga0070712_100016169
1110 Ga0070712_100054161
1111 Ga0070712_100083229
1112 Ga0097621_100026472
1113 Ga0097621_100037503
1114 Ga0097621_100530504
1115 Ga0068871_100133340
1116 Ga0068871_100268267
1117 Ga0075428_100000285
1118 Ga0075428_100001086
1119 Ga0075428_100295248
1120 Ga0075428_100320786
1121 Ga0075430_100011110
1122 Ga0075430_100018929
1123 Ga0075431_100010461
1124 Ga0075431_100039635
1125 Ga0075431_100071337
1126 Ga0075431_100446959
1127 Ga0075433_10015321
1128 Ga0075433_10026693
1129 Ga0075433_10051383
1130 Ga0075433_10162875
1131 Ga0075434_100074892
1132 Ga0075434_100143855
1133 Ga0075429_100011961
1134 Ga0075436_100046516
1135 Ga0075436_100062594
1136 Ga0097620_100065132
1137 Ga0097620_100091682
1138 Ga0097620_100377657
1139 Ga0075435_100036424
1140 Ga0075435_100658089
1141 Ga0105251_10035236
1142 Ga0105240_10096263
1143 Ga0105240_10132202
1144 Ga0105240_10175492
1145 Ga0111539_10301104
1146 Ga0111539_11082833
1147 Ga0105245_10038978
1148 Ga0105245_10395074
1149 Ga0105247_10002988
1150 Ga0105247_10023763
1151 Ga0105247_10113109
1152 Ga0105247_10118037
1153 Ga0114129_10000585
1154 Ga0114129_10001404
1155 Ga0114129_10020050
1156 Ga0114129_10169304
1157 Ga0114129_10247729
1158 Ga0114129_10380441
1159 Ga0114129_10502901
1160 Ga0105243_10367277
1161 Ga0105241_10056186
1162 Ga0105241_10096145
1163 Ga0105248_10009836
1164 Ga0105248_10030112
1165 Ga0105248_10220471
1166 Ga0105248_10365179
1167 Ga0105248_10408363
1168 Ga0105238_10139918
1169 Ga0105238_10153501
1170 Ga0105238_10289739
1171 Ga0105239_10470371
1172 Ga0105239_10550717
1173 Ga0105246_10009862
1174 Ga0105246_10031721
1175 Ga0105246_10304781
1176 Ga0157346_1003394
1177 Ga0157335_1002624
1178 Ga0157341_1000300
1179 Ga0157373_10039274
1180 Ga0157373_10113560
1181 Ga0157371_10170664
1182 Ga0157370_10227721
1183 Ga0157369_10036634
1184 Ga0157369_10123499
1185 Ga0157369_10300238
1186 Ga0157369_10312716
1187 Ga0157374_10143396
1188 Ga0157378_10292443
1189 Ga0163162_10224648
1190 Ga0163162_10369275
1191 Ga0157372_10018413
1192 Ga0157372_10181727
1193 Ga0157372_10533262
1194 Ga0157375_10033480
1195 Ga0157375_10474650
1196 Ga0163163_10005527
1197 Ga0163163_10066983
1198 Ga0163163_10084893
1199 Ga0163163_10085666
1200 Ga0163163_10233703
1201 Ga0157380_10049550
1202 Ga0157380_10071988
1203 Ga0182008_10111921
1204 Ga0157377_10029761
1205 Ga0157377_10068253
1206 Ga0157379_10046736
1207 Ga0157379_10609083
1208 Ga0157376_10028563
1209 Ga0157376_10238907
1210 Ga0157376_10712627
1211 Ga0163161_10040904
1212 Ga0197907_10762344
1213 Ga0197907_11015168
1214 Ga0206356_10405628
1215 Ga0206356_10489382
1216 Ga0206356_10723889
1217 Ga0206356_10728356
1218 Ga0206355_1368205
1219 Ga0206355_1397913
1220 Ga0206351_10506233
1221 Ga0206350_10116847
1222 Ga0206350_10544556
1223 Ga0206350_11470673
1224 Ga0206354_10072260
1225 Ga0206354_11430440
1226 Ga0206353_10430671
1227 Ga0206353_10653977
1228 Ga0213876_10001874
1229 Ga0213875_10000781
1230 Ga0224712_10104987
1231 Ga0224712_10139492
1232 Ga0224712_10150291
1233 Ga0207656_10034157
1234 Ga0207713_1050646
1235 Ga0207713_1060396
1236 Ga0207653_10030488
1237 Ga0207692_10022951
1238 Ga0207692_10033058
1239 Ga0207692_10040234
1240 Ga0207692_10073282
1241 Ga0207710_10021043
1242 Ga0207710_10058324
1243 Ga0207688_10007394
1244 Ga0207688_10007902
1245 Ga0207688_10248991
1246 Ga0207680_10040798
1247 Ga0207647_10169197
1248 Ga0207685_10039708
1249 Ga0207699_10003669
1250 Ga0207699_10004669
1251 Ga0207699_10019293
1252 Ga0207699_10098857
1253 Ga0207699_10132956
1254 Ga0207699_10137033
1255 Ga0207699_10220016
1256 Ga0207699_10270608
1257 Ga0207645_10105047
1258 Ga0207643_10000062
1259 Ga0207705_10018746
1260 Ga0207705_10172805
1261 Ga0207684_10009273
1262 Ga0207684_10080045
1263 Ga0207654_10009696
1264 Ga0207654_10197261
1265 Ga0207707_10009697
1266 Ga0207707_10147957
1267 Ga0207707_10223166
1268 Ga0207695_10151778
1269 Ga0207695_10245111
1270 Ga0207671_10030740
1271 Ga0207671_10220119
1272 Ga0207693_10024639
1273 Ga0207693_10155645
1274 Ga0207663_10012326
1275 Ga0207663_10038321
1276 Ga0207663_10061230
1277 Ga0207663_10135441
1278 Ga0207663_10182722
1279 Ga0207663_10290786
1280 Ga0207660_10002954
1281 Ga0207662_10016531
1282 Ga0207662_10032585
1283 Ga0207657_10003435
1284 Ga0207657_10042175
1285 Ga0207649_10023459
1286 Ga0207652_10014743
1287 Ga0207652_10015959
1288 Ga0207646_10006542
1289 Ga0207646_10016172
1290 Ga0207646_10029899
1291 Ga0207681_10102720
1292 Ga0207681_10206640
1293 Ga0207694_10180105
1294 Ga0207650_10008989
1295 Ga0207659_10043962
1296 Ga0207687_10120646
1297 Ga0207687_10148187
1298 Ga0207700_10003757
1299 Ga0207700_10003804
1300 Ga0207700_10012466
1301 Ga0207700_10020572
1302 Ga0207700_10064383
1303 Ga0207700_10070758
1304 Ga0207700_10071822
1305 Ga0207700_10152645
1306 Ga0207700_10499220
1307 Ga0207664_10000171
1308 Ga0207664_10006127
1309 Ga0207664_10063189
1310 Ga0207664_10066010
1311 Ga0207664_10130710
1312 Ga0207664_10177209
1313 Ga0207664_10187700
1314 Ga0207664_10194628
1315 Ga0207644_10008563
1316 Ga0207644_10220983
1317 Ga0207644_10234310
1318 Ga0207644_10260818
1319 Ga0207644_10297315
1320 Ga0207690_10111096
1321 Ga0207706_10033968
1322 Ga0207706_10383004
1323 Ga0207709_10082602
1324 Ga0207670_10011841
1325 Ga0207670_10211328
1326 Ga0207704_10086544
1327 Ga0207665_10002702
1328 Ga0207665_10017100
1329 Ga0207665_10023353
1330 Ga0207665_10094888
1331 Ga0207665_10140297
1332 Ga0207691_10077602
1333 Ga0207711_10027183
1334 Ga0207711_10037065
1335 Ga0207711_10173550
1336 Ga0207711_10180498
1337 Ga0207711_10221171
1338 Ga0207689_10002952
1339 Ga0207689_10025596
1340 Ga0207689_10152742
1341 Ga0207661_10008496
1342 Ga0207661_10055821
1343 Ga0207661_10293647
1344 Ga0207661_10588014
1345 Ga0207679_10000826
1346 Ga0207679_10058132
1347 Ga0207679_10064875
1348 Ga0207679_10171473
1349 Ga0207667_10024240
1350 Ga0207667_10398985
1351 Ga0207668_10013862
1352 Ga0207668_10348923
1353 Ga0207668_10397576
1354 Ga0207658_10100687
1355 Ga0207658_10322334
1356 Ga0207677_10028617
1357 Ga0207677_10183556
1358 Ga0207677_10199777
1359 Ga0207703_10011442
1360 Ga0207703_10084387
1361 Ga0207703_10155232
1362 Ga0207703_10362963
1363 Ga0207639_10092005
1364 Ga0207639_10140916
1365 Ga0207639_10157404
1366 Ga0207678_10000510
1367 Ga0207678_10028460
1368 Ga0207678_10042446
1369 Ga0207678_10571972
1370 Ga0207708_10017836
1371 Ga0207708_10033271
1372 Ga0207702_10012078
1373 Ga0207702_10013722
1374 Ga0207702_10018909
1375 Ga0207702_10019774
1376 Ga0207702_10106123
1377 Ga0207641_10013718
1378 Ga0207641_10024995
1379 Ga0207641_10040646
1380 Ga0207641_10084564
1381 Ga0207641_10132404
1382 Ga0207641_10283187
1383 Ga0207648_10210422
1384 Ga0207676_10001571
1385 Ga0207676_10013516
1386 Ga0207676_10108732
1387 Ga0207676_10134752
1388 Ga0207676_10213943
1389 Ga0207674_10004920
1390 Ga0207674_10005169
1391 Ga0207674_10042275
1392 Ga0207674_10065447
1393 Ga0207675_100296946
1394 Ga0207683_10000214
1395 Ga0207683_10185636
1396 Ga0207698_10059237
1397 Ga0207698_10133347
1398 Ga0207698_10218808
1399 Ga0207428_10001830
1400 Ga0207428_10217547
1401 Ga0268266_10025741
1402 Ga0268266_10159713
1403 Ga0268266_10296479
1404 Ga0268266_10357724
1405 Ga0268266_10412019
1406 Ga0268265_10159519
1407 Ga0268265_10237713
1408 Ga0268264_10032660
1409 Ga0265337_1003185
1410 Ga0265326_10001914
1411 Ga0265319_1000682
1412 Ga0265334_10000160
1413 Ga0265318_10037650
1414 Ga0265323_10004706
1415 Ga0265322_10007027
1416 Ga0265336_10003919
1417 Ga0265336_10007367
1418 Ga0307515_10000119
1419 Ga0307515_10105711
1420 Ga0265338_10000148
1421 Ga0265338_10033277
1422 Ga0265338_10082736
1423 Ga0265338_10093736
1424 Ga0265324_10035197
1425 Ga0307512_10003144
1426 Ga0307512_10145633
1427 Ga0265760_10020983
1428 Ga0265332_10000443
1429 Ga0265320_10001651
1430 Ga0265320_10079171
1431 Ga0265325_10002380
1432 Ga0265325_10017046
1433 Ga0265340_10018256
1434 Ga0265339_10009430
1435 Ga0265339_10113975
1436 Ga0265316_10126499
1437 Ga0307513_10007579
1438 Ga0307509_10017954
1439 Ga0265313_10043819
1440 Ga0307508_10134404
1441 Ga0265314_10005926
1442 Ga0265314_10059181
1443 Ga0265342_10003642
1444 Ga0307516_10000149
1445 Ga0307516_10039888
1446 Ga0307516_10061367
1447 Ga0307405_10465876
1448 Ga0307413_10027446
1449 Ga0307413_10250284
1450 Ga0307410_10038849
1451 Ga0307410_10297849
1452 Ga0307406_10008662
1453 Ga0307406_10530278
1454 Ga0307407_10037722
1455 Ga0307409_100003817
1456 Ga0307409_100444259
1457 Ga0307409_100738338
1458 Ga0307416_100005302
1459 Ga0307411_10257437
1460 Ga0307415_100027971
1461 Ga0307415_100378280
1462 Ga0307415_100556073
1463 Ga0307415_100783391
1464 Ga0307507_10172226
1465 Ga0307510_10163330
1466 Ga0307510_10257558
1467 Ga0373959_0012000
1468 Ga0373938_0003442
1469 Ga0373938_0005082
1470 Ga0373926_0000466
1471 Ga0373926_0009931
1472 Ga0373926_0032655
1473 Ga0373926_0055287
1474 Ga0373934_0002514
1475 Ga0373934_0014637
1476 Ga0373940_0000286
1477 Ga0373944_0013974
1478 Ga0373944_0048034
1479 Ga0373949_0010190
1480 Ga0373951_0026521
1481 Ga0373952_0021185
1482 Ga0373923_0006829
1483 Ga0373923_0021375
1484 Ga0373923_0034499
1485 Ga0373932_0060220
1486 Ga0373936_0001343
1487 Ga0373936_0111602
1488 Ga0373939_0002004
1489 Ga0373939_0081131
1490 Ga0373953_0003568
1491 Ga0373953_0007432
1492 Ga0373953_0065435
1493 Ga0373953_0084343
1494 Ga0373954_0153785
1495 Ga0373956_0014216
1496 Ga0373956_0017767
1497 Ga0373956_0034899
1498 Ga0373957_0004472
1499 Ga0373957_0037853
1500 Ga0373957_0072743
1501 Ga0373960_0011533
1502 Ga0373960_0081321
1503 Ga0373943_0025333
1504 Ga0373943_0083906
1505 Ga0373943_0110995
1506 Ga0373946_0004755
1507 Ga0373946_0030978
1508 Ga0373955_0004742
1509 Ga0373955_0007371
1510 Ga0373955_0010229
1511 Ga0373942_0000185
1512 Ga0373942_0042310
1513 Ga0373961_0048573
1514 Ga0373961_0058268
1515 Ga0373961_0096467
1516 Ga0373962_0004291
1517 Ga0373962_0005163
1518 Ga0373924_0004136
1519 Ga0373924_0007133
1520 Ga0373931_0242268
1521 Ga0373931_0401899
1522 Ga0373935_0066945
1523 Ga0373927_0016941
1524 Ga0373927_0066901
1525 Ga0373927_0203365
1526 Ga0373933_0001929
1527 Ga0373933_0014478
1528 Ga0373947_0001176
1529 Ga0373947_0128877
1530 Ga0373947_0148253
1531 Ga0373947_0211998
1532 Ga0373937_0008996
1533 Ga0373937_0022290
1534 Ga0373937_0046720
1535 Ga0373937_0543095
1536 Ga0310109_008703
1537 Ga0373925_0000004
1538 Ga0373925_0013204
1539 Ga0373925_0117981
1540 Ga0373925_0174663
1541 Ga0373925_0641181
1542 Ga0395900_0001388
1543 Ga0395900_0604213
1544 Ga0395898_0007474
1545 Ga0395898_0205064
1546 Ga0395898_0441644
1547 Ga0395905_0001885
1548 Ga0395905_0584492
1549 Ga0436364_0213102
1550 Ga0436364_0969684
1551 Ga0436364_1133930
1552 Ga0436364_1202907
1553 Ga0436364_1377900
1554 Ga0395901_0001402
1555 Ga0395901_0026591
1556 Ga0436365_0567091
1557 Ga0436360_0972388
1558 Ga0436362_0612140
1559 Ga0436362_0804513
1560 Ga0451839_1201347
1561 Ga0451839_1338288
1562 Ga0451843_0226282
1563 Ga0451853_2299179
1564 Ga0439463_006694
1565 Ga0450902_016570
1566 Ga0439459_0032767
1567 Ga0466961_0172666
1568 Ga0466963_0041711
1569 Ga0466963_0169609
1570 Ga0466963_0423629
1571 Ga0466971_0026957
1572 Ga0466960_0233682
1573 Ga0466959_0022068
1574 Ga0466959_0302947
1575 Ga0466958_0213137
1576 Ga0466967_0201516
1577 Ga0466967_0298639
1578 Ga0495592_0026164
1579 Ga0495592_0071886
1580 Ga0495592_0126054
1581 Ga0495603_0011218
1582 Ga0495603_0124763
1583 Ga0495629_0014806
1584 Ga0495629_0015166
1585 Ga0495629_0028216
1586 Ga0495629_0035347
1587 Ga0495629_0040318
1588 Ga0495629_0306855
1589 Ga0495641_0003281
1590 Ga0495641_0009096
1591 Ga0495641_0093238
1592 Ga0495641_0106403
1593 Ga0495651_0015262
1594 Ga0495651_0039521
1595 Ga0495651_0048192
1596 Ga0495651_0078960
1597 Ga0495653_0029952
1598 Ga0495653_0032685
1599 Ga0495653_0121735
1600 Ga0495653_0229116
1601 Ga0495580_0034108
1602 Ga0495580_0203229
1603 Ga0495582_0002234
1604 Ga0495582_0181712
1605 Ga0495639_0110612
1606 Ga0495662_0047270
1607 Ga0495662_0084117
1608 Ga0495662_0130515
1609 Ga0495662_0132884
1610 Ga0495664_0029985
1611 Ga0495594_0216769
1612 Ga0495608_0007212
1613 Ga0495608_0020244
1614 Ga0495608_0037080
1615 Ga0495608_0073934
1616 Ga0495618_0045409
1617 Ga0495618_0058898
1618 Ga0495618_0256209
1619 Ga0495628_0037878
1620 Ga0495630_0016178
1621 Ga0495630_0085626
1622 Ga0495630_0131286
1623 Ga0495666_0068227
1624 Ga0495652_0031017
1625 Ga0495665_0007819
1626 Ga0495665_0017421
1627 Ga0495640_0016525
1628 Ga0495640_0023697
1629 Ga0495640_0210164
1630 Ga0495586_0035950
1631 Ga0495586_0053286
1632 Ga0495587_0000622
1633 Ga0495587_0016344
1634 Ga0495587_0016487
1635 Ga0495645_0020301
1636 Ga0495645_0048532
1637 Ga0495645_0083738
1638 Ga0495622_0075444
1639 Ga0495667_0022172
1640 Ga0495667_0024735
1641 Ga0495667_0032505
1642 Ga0495667_0270609
1643 Ga0495668_0000872
1644 Ga0495634_0002233
1645 Ga0495634_0010992
1646 Ga0495634_0018939
1647 Ga0495634_0037425
1648 Ga0495625_0001540
1649 Ga0495635_0009496
1650 Ga0495635_0017916
1651 Ga0495635_0018484
1652 Ga0495588_0049893
1653 Ga0495588_0059107
1654 Ga0495657_0008676
1655 Ga0495657_0012224
1656 Ga0495657_0018394
1657 Ga0495657_0051922
1658 Ga0495599_0002361
1659 Ga0495599_0033234
1660 Ga0495599_0059564
1661 Ga0495623_0076976
1662 Ga0495646_0006386
1663 Ga0495646_0039563
1664 Ga0495646_0045559
1665 Ga0495646_0261457
1666 Ga0495647_0003697
1667 Ga0495658_0002971
1668 Ga0495658_0003148
1669 Ga0495658_0223885
1670 Ga0495613_0011502
1671 Ga0495613_0031106
1672 Ga0495613_0032336
1673 Ga0495624_0030464
1674 Ga0495624_0037702
1675 Ga0495624_0049971
1676 Ga0495600_0099022
1677 Ga0495600_0131570
1678 Ga0495600_0193721
1679 Ga0495600_0304710
1680 Ga0495581_0006889
1681 Ga0495581_0010234
1682 Ga0495604_0012891
1683 Ga0495604_0019147
1684 Ga0495604_0187039
1685 Ga0495674_0029900
1686 Ga0495674_0073050
1687 Ga0495674_0091846
1688 Ga0495674_0123745
1689 Ga0495680_0015432
1690 Ga0495680_0062167
1691 Ga0495680_0063309
1692 Ga0495680_0078152
1693 Ga0495680_0086308
1694 Ga0495680_0143642
1695 Ga0495680_0218264
1696 Ga0495675_0031940
1697 Ga0495675_0035175
1698 Ga0495675_0088711
1699 Ga0495684_0008153
1700 Ga0495684_0017391
1701 Ga0495684_0018808
1702 Ga0495684_0021849
1703 Ga0495684_0078056
1704 Ga0495684_0104786
1705 Ga0495593_0011104
1706 Ga0495593_0018869
1707 Ga0495593_0030932
1708 Ga0495602_0032954
1709 Ga0495602_0055085
1710 Ga0495602_0066205
1711 Ga0495602_0106935
1712 Ga0495614_0018641
1713 Ga0495614_0021494
1714 Ga0495626_0000116
1715 Ga0496100_0060510
1716 Ga0496100_0066842
1717 Ga0496100_0142289
1718 Ga0496101_0029589
1719 Ga0496101_0047796
1720 Ga0496102_0071383
1721 Ga0496102_0091815
1722 Ga0496102_0120118
1723 Ga0496102_0129343
1724 Ga0496103_0026783
1725 Ga0496103_0106662
1726 Ga0496104_0023870
1727 Ga0496104_0038270
1728 Ga0496104_0043775
1729 Ga0496104_0056957
1730 Ga0496104_0273895
1731 Ga0496105_0003718
1732 Ga0496105_0016938
1733 Ga0496105_0017370
1734 Ga0496105_0110097
1735 Ga0496106_0007783
1736 Ga0496106_0039672
1737 Ga0496106_0173381
1738 Ga0496106_0175660
1739 Ga0496107_0024004
1740 Ga0496108_0000019
1741 Ga0496108_0073796
1742 Ga0496108_0158454
1743 Ga0496108_0202754
1744 Ga0496108_0299137
1745 Ga0496108_0409849
1746 Ga0496109_0017888
1747 Ga0496109_0020481
1748 Ga0496109_0201000
1749 Ga0496109_0216369
1750 Ga0496110_0001540
1751 Ga0496110_0022279
1752 Ga0496110_0051948
1753 Ga0496110_0082705
1754 Ga0496110_0143069
1755 Ga0496110_0178736
1756 Ga0496111_0003334
1757 Ga0496111_0021617
1758 Ga0496111_0043828
1759 Ga0496111_0046373
1760 Ga0496111_0227413
1761 Ga0496112_0002106
1762 Ga0496112_0018658
1763 Ga0496112_0035356
1764 Ga0496113_0013661
1765 Ga0496113_0031326
1766 Ga0496113_0221462
1767 Ga0496113_0256892
1768 Ga0496113_0323940
1769 Ga0496114_0028738
1770 Ga0496114_0097947
1771 Ga0496115_0076563
1772 Ga0496115_0115165
1773 Ga0496119_0054393
1774 Ga0496126_0020690
1775 Ga0496126_0138305
1776 Ga0496126_0404357
1777 Ga0501043_0061450
1778 Ga0501046_0061723
1779 Ga0501081_0043759
1780 Ga0501045_0018148
1781 nmdc:mga05p37_162935_c1
1782 nmdc:mga05p37_263411_c1
1783 nmdc:mga05p37_31122_c1
1784 nmdc:mga05p37_3785_c1
1785 nmdc:mga05p37_509401_c1
1786 nmdc:mga09592_179467_c1
1787 nmdc:mga09592_62_c1
1788 nmdc:mga09592_9038_c1
1789 nmdc:mga0qj67_1407_c1
1790 nmdc:mga0qj67_209857_c1
1791 nmdc:mga0qj67_391269_c1
1792 nmdc:mga0qj67_6584_c1
1793 nmdc:mga0qj67_74169_c1
1794 nmdc:mga06r32_1433_c1
1795 nmdc:mga06r32_17514_c1
1796 nmdc:mga06r32_356718_c1
1797 nmdc:mga08y16_242660_c1
1798 nmdc:mga08y16_26079_c1
1799 nmdc:mga0n895_317576_c1
1800 nmdc:mga0n895_398000_c1
1801 nmdc:mga0n895_676030_c1
1802 nmdc:mga0rr50_11810_c1
1803 nmdc:mga0rr50_30610_c1
1804 nmdc:mga0rr50_52877_c1
1805 nmdc:mga0rr50_571866_c1
1806 nmdc:mga08x19_4526_c1
1807 nmdc:mga0a205_12318_c1
1808 nmdc:mga0a205_16922_c1
1809 nmdc:mga0a205_365030_c1
1810 nmdc:mga0a205_61866_c1
1811 Ga0495601_0060185
1812 Ga0495601_0075230
1813 Ga0495601_0127975
1814 Ga0495612_0044601
1815 Ga0495595_0033403
1816 Ga0495595_0034668
1817 Ga0495619_0027468
1818 Ga0495619_0044520
1819 Ga0495619_0047213
1820 Ga0495619_0103511
1821 Ga0495619_0213170
1822 Ga0500644_0022687
1823 Ga0500569_003268
1824 Ga0500594_0002062
1825 Ga0500652_021506
1826 Ga0500604_0014576
1827 Ga0500616_0004554
1828 Ga0587073_0015736
1829 2501945467
1830 2515495525
1831 2515720284
1832 2515755970
1833 2516084387
1834 2516089692
1835 2623585190
1836 2753272236
1837 2772645528
1838 2832010230
1839 2855673897
1840 2855679495
1841 2855688738
1842 2856859023
1843 2857289429
1844 2858851941
1845 2858887963
1846 2858895370
1847 2858900128
1848 2858902804
1849 2866068358
1850 2867306151
1851 2867323163
1852 2869051489
1853 2869067008
1854 2869071718
1855 2880495050
1856 2880497279
1857 2887486910
1858 2929225847
1859 2929231164
1860 2996222146
1861 649813016
1862 8001785279
1863 8003870827
1864 8054710385
1865 8054731508
1866 8054736142
1867 8055418465
1868 8056062043

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06971

Put_DNA-bind_N

Putative DNA-binding protein N-terminus

33

81

0.98

PF02629

CoA_binding

CoA binding domain

109

207

0.96

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

112

234

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qzl-assembly1.cif.gz_A amine dehydrogenase from cystobacter fuscus (cfusamdh) w145a mutant with nadp+ and pentylamine 0.8025 110 203
3q2k-assembly1.cif.gz_B crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.7853 110 203
6iau-assembly1.cif.gz_B amine dehydrogenase from cystobacter fuscus in complex with nadp+ and cyclohexylamine 0.7813 110 203
5gz1-assembly1.cif.gz_A structure of substrate/cofactor-free d-amino acid dehydrogenase 0.7812 111 203
5zz5-assembly2.cif.gz_C redox-sensing transcriptional repressor rex 0.7782 97 236
ID Description Score Start End Superfamily
1xcbB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9593 35 103 1.10.10.10
1xcbF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9552 34 103 1.10.10.10
1r72C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9498 35 103 1.10.10.10
1xcbG01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9438 35 103 1.10.10.10
1r72G01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9436 35 103 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6G3V9C5-F1-model_v4 deleted 0.9757 33 108
AF-A0A6B3E9K1-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.9725 120 222 GO:0003677
GO:0005737
GO:0045892
GO:0051775
AF-A0A4Q3AVS3-F1-model_v4 deleted 0.9725 31 107
AF-A0A6B3GAM9-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.9653 121 209 GO:0003677
GO:0005737
GO:0045892
GO:0051775
AF-A0A348S577-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.9637 31 108 GO:0045892
GO:0051775

Map