F486134
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 934 | 420 | 1868 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0001354|Ga0495606_0001354_17127_18038 |
| Length | 303 |
| Sequence | MSQQRTGHEAGITGRVGAVTPSAALGSQPDFPDLPEATVARLPEYLRALHHLAETGHDTVSSEGLATAAGVNSAKLRKDLSHLGSYGTRGVGYDIEPLVGQIEYILGLNKRRAVALVGVGNLGHALAGYAGFASRGFRIAALFDADLTRVGELINGLAVRHISDIPEVVKSEAISIAVLATPAGAAQAVADQLVAAGVTSILNFAPVVLNLPEQVDVRKVDLAVELQILSFHEHRKSARGAELAKAVALAGDQATSAAPAALNGAEPVRPVARAAGRGRVARVIAEAGGAVNGSPAARGEVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 106 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 107 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 127 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 211 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 239 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 276 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 277 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 278 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 279 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 280 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 281 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 282 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 285 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 286 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 287 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 356 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 357 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 376 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 378 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 379 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 380 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 382 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 383 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 384 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 385 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 386 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 387 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 388 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 389 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 390 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 391 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 392 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 393 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 394 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 395 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 396 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 397 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 398 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 399 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 400 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 401 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 402 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 403 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 404 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 405 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 406 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 407 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 408 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 409 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 410 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 411 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 412 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 413 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 414 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 415 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 416 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 417 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 418 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 419 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 420 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.36 |
| Metatranscriptomes | 2.36 |
| Isolates | 4.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.64 |
| Nodule | 0.64 |
| Rhizoplane | 6.21 |
| Rhizosphere | 86.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495606_0001354 | 3300046507 | Bacteria | 33260 |
| 2 | JGI24751J29686_10005593 | 3300002459 | Bacteria | 2559 |
| 3 | JGI25406J46586_10001930 | 3300003203 | Bacteria | 9779 |
| 4 | JGI25406J46586_10043530 | 3300003203 | Bacteria | 1562 |
| 5 | rootL2_10009411 | 3300003322 | Bacteria | 1199 |
| 6 | JGI25404J52841_10024113 | 3300003659 | Bacteria | 1311 |
| 7 | Ga0070658_10022159 | 3300005327 | Bacteria | 5096 |
| 8 | Ga0070658_10166820 | 3300005327 | Bacteria | 1849 |
| 9 | Ga0070676_10025161 | 3300005328 | Bacteria | 3362 |
| 10 | Ga0070676_10269124 | 3300005328 | Bacteria | 1144 |
| 11 | Ga0070683_100079237 | 3300005329 | Bacteria | 3074 |
| 12 | Ga0070683_100198596 | 3300005329 | Bacteria | 1905 |
| 13 | Ga0070683_100277135 | 3300005329 | Bacteria | 1595 |
| 14 | Ga0070683_100484768 | 3300005329 | Bacteria | 1181 |
| 15 | Ga0070690_100108690 | 3300005330 | Bacteria | 1848 |
| 16 | Ga0068869_100044797 | 3300005334 | Bacteria | 3182 |
| 17 | Ga0070666_10029152 | 3300005335 | Bacteria | 3626 |
| 18 | Ga0070666_10141599 | 3300005335 | Bacteria | 1675 |
| 19 | Ga0070680_100270183 | 3300005336 | Bacteria | 1439 |
| 20 | Ga0070680_100296607 | 3300005336 | Bacteria | 1370 |
| 21 | Ga0070682_100001383 | 3300005337 | Bacteria | 13697 |
| 22 | Ga0068868_100015236 | 3300005338 | Bacteria | 5683 |
| 23 | Ga0070660_100057728 | 3300005339 | Bacteria | 3008 |
| 24 | Ga0070689_100221380 | 3300005340 | Bacteria | 1552 |
| 25 | Ga0070691_10047770 | 3300005341 | Bacteria | 2036 |
| 26 | Ga0070691_10082568 | 3300005341 | Bacteria | 1575 |
| 27 | Ga0070691_10100572 | 3300005341 | Bacteria | 1435 |
| 28 | Ga0070687_100058055 | 3300005343 | Bacteria | 2031 |
| 29 | Ga0070661_100039242 | 3300005344 | Bacteria | 3451 |
| 30 | Ga0070668_100002088 | 3300005347 | Bacteria | 14615 |
| 31 | Ga0070668_100162646 | 3300005347 | Bacteria | 1812 |
| 32 | Ga0070669_100158943 | 3300005353 | Bacteria | 1755 |
| 33 | Ga0070675_100012505 | 3300005354 | Bacteria | 6653 |
| 34 | Ga0070671_100003212 | 3300005355 | Bacteria | 12745 |
| 35 | Ga0070671_100118916 | 3300005355 | Bacteria | 2223 |
| 36 | Ga0070671_100345265 | 3300005355 | Bacteria | 1270 |
| 37 | Ga0070674_100166770 | 3300005356 | Bacteria | 1676 |
| 38 | Ga0070673_100103833 | 3300005364 | Bacteria | 2345 |
| 39 | Ga0070673_100802550 | 3300005364 | Bacteria | 869 |
| 40 | Ga0070688_100171172 | 3300005365 | Bacteria | 1499 |
| 41 | Ga0070659_100167668 | 3300005366 | Bacteria | 1797 |
| 42 | Ga0070667_100361439 | 3300005367 | Bacteria | 1316 |
| 43 | Ga0070709_10005585 | 3300005434 | Bacteria | 6809 |
| 44 | Ga0070709_10013118 | 3300005434 | Bacteria | 4651 |
| 45 | Ga0070709_10020792 | 3300005434 | Bacteria | 3816 |
| 46 | Ga0070709_10416908 | 3300005434 | Bacteria | 1005 |
| 47 | Ga0070709_10427722 | 3300005434 | Bacteria | 993 |
| 48 | Ga0070714_100000241 | 3300005435 | Bacteria | 42677 |
| 49 | Ga0070714_100001408 | 3300005435 | Bacteria | 17443 |
| 50 | Ga0070714_100017345 | 3300005435 | Bacteria | 5831 |
| 51 | Ga0070714_100179800 | 3300005435 | Bacteria | 1924 |
| 52 | Ga0070713_100017737 | 3300005436 | Bacteria | 5395 |
| 53 | Ga0070713_100028459 | 3300005436 | Bacteria | 4413 |
| 54 | Ga0070713_100095336 | 3300005436 | Bacteria | 2567 |
| 55 | Ga0070713_100177665 | 3300005436 | Bacteria | 1911 |
| 56 | Ga0070713_100352547 | 3300005436 | Bacteria | 1366 |
| 57 | Ga0070710_10043408 | 3300005437 | Bacteria | 2490 |
| 58 | Ga0070710_10118384 | 3300005437 | Bacteria | 1600 |
| 59 | Ga0070701_10036294 | 3300005438 | Bacteria | 2483 |
| 60 | Ga0070701_10038602 | 3300005438 | Bacteria | 2418 |
| 61 | Ga0070711_100037656 | 3300005439 | Bacteria | 3246 |
| 62 | Ga0070711_100052032 | 3300005439 | Bacteria | 2817 |
| 63 | Ga0070711_100157095 | 3300005439 | Bacteria | 1721 |
| 64 | Ga0070711_100181203 | 3300005439 | Bacteria | 1613 |
| 65 | Ga0070711_100192828 | 3300005439 | Bacteria | 1567 |
| 66 | Ga0070711_100260195 | 3300005439 | Bacteria | 1365 |
| 67 | Ga0070705_100062618 | 3300005440 | Bacteria | 2216 |
| 68 | Ga0070700_100042188 | 3300005441 | Bacteria | 2800 |
| 69 | Ga0070694_100052088 | 3300005444 | Bacteria | 2766 |
| 70 | Ga0070708_100176822 | 3300005445 | Bacteria | 1994 |
| 71 | Ga0070663_100010629 | 3300005455 | Bacteria | 5742 |
| 72 | Ga0070663_100036070 | 3300005455 | Bacteria | 3434 |
| 73 | Ga0070663_100332357 | 3300005455 | Bacteria | 1225 |
| 74 | Ga0070663_100436160 | 3300005455 | Bacteria | 1077 |
| 75 | Ga0070678_100143587 | 3300005456 | Bacteria | 1913 |
| 76 | Ga0070678_100402776 | 3300005456 | Bacteria | 1189 |
| 77 | Ga0070681_10006696 | 3300005458 | Bacteria | 11211 |
| 78 | Ga0070681_10033020 | 3300005458 | Bacteria | 5195 |
| 79 | Ga0070681_10080851 | 3300005458 | Bacteria | 3205 |
| 80 | Ga0068867_100493125 | 3300005459 | Bacteria | 1052 |
| 81 | Ga0070706_100015280 | 3300005467 | Bacteria | 7087 |
| 82 | Ga0070706_100200598 | 3300005467 | Bacteria | 1863 |
| 83 | Ga0070707_100012139 | 3300005468 | Bacteria | 8042 |
| 84 | Ga0070698_100001093 | 3300005471 | Bacteria | 29814 |
| 85 | Ga0070698_100004321 | 3300005471 | Bacteria | 15616 |
| 86 | Ga0070698_100036536 | 3300005471 | Bacteria | 5073 |
| 87 | Ga0070698_100074116 | 3300005471 | Bacteria | 3409 |
| 88 | Ga0070699_100335904 | 3300005518 | Bacteria | 1359 |
| 89 | Ga0070679_100067907 | 3300005530 | Bacteria | 3556 |
| 90 | Ga0070684_100036900 | 3300005535 | Bacteria | 4190 |
| 91 | Ga0070684_100063933 | 3300005535 | Bacteria | 3227 |
| 92 | Ga0070684_100069485 | 3300005535 | Bacteria | 3097 |
| 93 | Ga0070697_100011045 | 3300005536 | Bacteria | 7057 |
| 94 | Ga0070697_100182251 | 3300005536 | Bacteria | 1780 |
| 95 | Ga0070697_100308991 | 3300005536 | Bacteria | 1360 |
| 96 | Ga0068853_100061332 | 3300005539 | Bacteria | 3252 |
| 97 | Ga0068853_100312281 | 3300005539 | Bacteria | 1455 |
| 98 | Ga0070672_100091873 | 3300005543 | Bacteria | 2449 |
| 99 | Ga0070686_100078946 | 3300005544 | Bacteria | 2175 |
| 100 | Ga0070695_100246443 | 3300005545 | Bacteria | 1298 |
| 101 | Ga0070696_100037527 | 3300005546 | Bacteria | 3343 |
| 102 | Ga0070696_100090801 | 3300005546 | Bacteria | 2174 |
| 103 | Ga0070693_100000312 | 3300005547 | Bacteria | 22443 |
| 104 | Ga0070693_100085068 | 3300005547 | Bacteria | 1894 |
| 105 | Ga0070665_100080607 | 3300005548 | Bacteria | 3261 |
| 106 | Ga0070665_100111058 | 3300005548 | Bacteria | 2744 |
| 107 | Ga0070665_100153500 | 3300005548 | Bacteria | 2305 |
| 108 | Ga0070665_100453265 | 3300005548 | Bacteria | 1292 |
| 109 | Ga0070704_100498604 | 3300005549 | Bacteria | 1056 |
| 110 | Ga0068855_100004544 | 3300005563 | Bacteria | 16945 |
| 111 | Ga0068855_100061299 | 3300005563 | Bacteria | 4395 |
| 112 | Ga0068855_100190945 | 3300005563 | Bacteria | 2310 |
| 113 | Ga0068855_100201719 | 3300005563 | Bacteria | 2239 |
| 114 | Ga0068855_100306487 | 3300005563 | Bacteria | 1758 |
| 115 | Ga0070664_100099016 | 3300005564 | Bacteria | 2533 |
| 116 | Ga0068857_100069826 | 3300005577 | Bacteria | 3128 |
| 117 | Ga0068857_100145969 | 3300005577 | Bacteria | 2141 |
| 118 | Ga0068854_100067344 | 3300005578 | Bacteria | 2608 |
| 119 | Ga0068856_100238557 | 3300005614 | Bacteria | 1834 |
| 120 | Ga0068856_100412226 | 3300005614 | Bacteria | 1371 |
| 121 | Ga0070702_100000170 | 3300005615 | Bacteria | 20754 |
| 122 | Ga0070702_100014942 | 3300005615 | Bacteria | 3951 |
| 123 | Ga0068852_100012422 | 3300005616 | Bacteria | 6467 |
| 124 | Ga0068852_100401464 | 3300005616 | Bacteria | 1348 |
| 125 | Ga0068859_100065132 | 3300005617 | Bacteria | 3678 |
| 126 | Ga0068859_100091690 | 3300005617 | Bacteria | 3090 |
| 127 | Ga0068859_100377677 | 3300005617 | Bacteria | 1513 |
| 128 | Ga0068864_100003646 | 3300005618 | Bacteria | 12733 |
| 129 | Ga0068864_100189888 | 3300005618 | Bacteria | 1883 |
| 130 | Ga0068864_100384004 | 3300005618 | Bacteria | 1331 |
| 131 | Ga0068864_100444756 | 3300005618 | Bacteria | 1239 |
| 132 | Ga0068866_10068389 | 3300005718 | Bacteria | 1867 |
| 133 | Ga0068861_100106971 | 3300005719 | Bacteria | 2235 |
| 134 | Ga0068861_100319769 | 3300005719 | Bacteria | 1351 |
| 135 | Ga0068851_10024989 | 3300005834 | Bacteria | 2928 |
| 136 | Ga0068870_10001077 | 3300005840 | Bacteria | 10846 |
| 137 | Ga0068870_10229878 | 3300005840 | Bacteria | 1140 |
| 138 | Ga0068863_100008790 | 3300005841 | Bacteria | 9863 |
| 139 | Ga0068863_100031057 | 3300005841 | Bacteria | 5101 |
| 140 | Ga0068863_100037714 | 3300005841 | Bacteria | 4600 |
| 141 | Ga0068863_100091883 | 3300005841 | Bacteria | 2879 |
| 142 | Ga0068863_100266623 | 3300005841 | Bacteria | 1657 |
| 143 | Ga0068863_100305567 | 3300005841 | Bacteria | 1543 |
| 144 | Ga0068863_100753901 | 3300005841 | Bacteria | 969 |
| 145 | Ga0068858_100028228 | 3300005842 | Bacteria | 5214 |
| 146 | Ga0068858_100092053 | 3300005842 | Bacteria | 2822 |
| 147 | Ga0068858_100152083 | 3300005842 | Bacteria | 2176 |
| 148 | Ga0068860_100103529 | 3300005843 | Bacteria | 2717 |
| 149 | Ga0068860_100428845 | 3300005843 | Bacteria | 1312 |
| 150 | Ga0068862_100030107 | 3300005844 | Bacteria | 4574 |
| 151 | Ga0081540_1000097 | 3300005983 | Bacteria | 92047 |
| 152 | Ga0081540_1013035 | 3300005983 | Bacteria | 5427 |
| 153 | Ga0081540_1071784 | 3300005983 | Bacteria | 1598 |
| 154 | Ga0081540_1118498 | 3300005983 | Bacteria | 1104 |
| 155 | Ga0081539_10000362 | 3300005985 | Bacteria | 99991 |
| 156 | Ga0081539_10000717 | 3300005985 | Bacteria | 66511 |
| 157 | Ga0081539_10003779 | 3300005985 | Bacteria | 17898 |
| 158 | Ga0081539_10008025 | 3300005985 | Bacteria | 9361 |
| 159 | Ga0081539_10018199 | 3300005985 | Bacteria | 4889 |
| 160 | Ga0070717_10013206 | 3300006028 | Bacteria | 6318 |
| 161 | Ga0070717_10020853 | 3300006028 | Bacteria | 5159 |
| 162 | Ga0070717_10044157 | 3300006028 | Bacteria | 3639 |
| 163 | Ga0070717_10050070 | 3300006028 | Bacteria | 3431 |
| 164 | Ga0070717_10173178 | 3300006028 | Bacteria | 1878 |
| 165 | Ga0070717_10579219 | 3300006028 | Bacteria | 1017 |
| 166 | Ga0075432_10070917 | 3300006058 | Bacteria | 1252 |
| 167 | Ga0070715_10067132 | 3300006163 | Bacteria | 1592 |
| 168 | Ga0070715_10070915 | 3300006163 | Bacteria | 1556 |
| 169 | Ga0070715_10100774 | 3300006163 | Bacteria | 1347 |
| 170 | Ga0070715_10262595 | 3300006163 | Bacteria | 907 |
| 171 | Ga0070716_100004930 | 3300006173 | Bacteria | 6425 |
| 172 | Ga0070716_100012743 | 3300006173 | Bacteria | 4268 |
| 173 | Ga0070716_100080197 | 3300006173 | Bacteria | 1945 |
| 174 | Ga0070716_100181962 | 3300006173 | Bacteria | 1381 |
| 175 | Ga0070712_100016169 | 3300006175 | Bacteria | 4816 |
| 176 | Ga0070712_100054161 | 3300006175 | Bacteria | 2804 |
| 177 | Ga0070712_100083229 | 3300006175 | Bacteria | 2323 |
| 178 | Ga0097621_100026472 | 3300006237 | Bacteria | 4550 |
| 179 | Ga0097621_100037503 | 3300006237 | Bacteria | 3884 |
| 180 | Ga0097621_100530504 | 3300006237 | Bacteria | 1070 |
| 181 | Ga0068871_100133340 | 3300006358 | Bacteria | 2108 |
| 182 | Ga0068871_100268267 | 3300006358 | Bacteria | 1491 |
| 183 | Ga0075428_100000285 | 3300006844 | Bacteria | 49638 |
| 184 | Ga0075428_100001086 | 3300006844 | Bacteria | 28950 |
| 185 | Ga0075428_100295248 | 3300006844 | Bacteria | 1743 |
| 186 | Ga0075428_100320786 | 3300006844 | Bacteria | 1665 |
| 187 | Ga0075430_100011110 | 3300006846 | Bacteria | 7633 |
| 188 | Ga0075430_100018929 | 3300006846 | Bacteria | 5859 |
| 189 | Ga0075431_100010461 | 3300006847 | Bacteria | 9331 |
| 190 | Ga0075431_100039635 | 3300006847 | Bacteria | 4853 |
| 191 | Ga0075431_100071337 | 3300006847 | Bacteria | 3584 |
| 192 | Ga0075431_100446959 | 3300006847 | Bacteria | 1289 |
| 193 | Ga0075433_10015321 | 3300006852 | Bacteria | 6283 |
| 194 | Ga0075433_10026693 | 3300006852 | Bacteria | 4894 |
| 195 | Ga0075433_10051383 | 3300006852 | Bacteria | 3589 |
| 196 | Ga0075433_10162875 | 3300006852 | Bacteria | 1985 |
| 197 | Ga0075434_100074892 | 3300006871 | Bacteria | 3378 |
| 198 | Ga0075434_100143855 | 3300006871 | Bacteria | 2405 |
| 199 | Ga0075429_100011961 | 3300006880 | Bacteria | 7524 |
| 200 | Ga0075436_100046516 | 3300006914 | Bacteria | 2992 |
| 201 | Ga0075436_100062594 | 3300006914 | Bacteria | 2571 |
| 202 | Ga0097620_100065132 | 3300006931 | Bacteria | 3678 |
| 203 | Ga0097620_100091682 | 3300006931 | Bacteria | 3090 |
| 204 | Ga0097620_100377657 | 3300006931 | Bacteria | 1513 |
| 205 | Ga0075435_100036424 | 3300007076 | Bacteria | 3910 |
| 206 | Ga0075435_100658089 | 3300007076 | Bacteria | 909 |
| 207 | Ga0105251_10035236 | 3300009011 | Bacteria | 2470 |
| 208 | Ga0105240_10096263 | 3300009093 | Bacteria | 3608 |
| 209 | Ga0105240_10132202 | 3300009093 | Bacteria | 2992 |
| 210 | Ga0105240_10175492 | 3300009093 | Bacteria | 2534 |
| 211 | Ga0111539_10301104 | 3300009094 | Bacteria | 1866 |
| 212 | Ga0111539_11082833 | 3300009094 | Bacteria | 931 |
| 213 | Ga0105245_10038978 | 3300009098 | Bacteria | 4229 |
| 214 | Ga0105245_10395074 | 3300009098 | Bacteria | 1380 |
| 215 | Ga0105247_10002988 | 3300009101 | Bacteria | 11217 |
| 216 | Ga0105247_10023763 | 3300009101 | Bacteria | 3694 |
| 217 | Ga0105247_10113109 | 3300009101 | Bacteria | 1750 |
| 218 | Ga0105247_10118037 | 3300009101 | Bacteria | 1715 |
| 219 | Ga0114129_10000585 | 3300009147 | Bacteria | 44984 |
| 220 | Ga0114129_10001404 | 3300009147 | Bacteria | 32492 |
| 221 | Ga0114129_10020050 | 3300009147 | Bacteria | 9515 |
| 222 | Ga0114129_10169304 | 3300009147 | Bacteria | 2979 |
| 223 | Ga0114129_10247729 | 3300009147 | Bacteria | 2393 |
| 224 | Ga0114129_10380441 | 3300009147 | Bacteria | 1864 |
| 225 | Ga0114129_10502901 | 3300009147 | Bacteria | 1583 |
| 226 | Ga0105243_10367277 | 3300009148 | Bacteria | 1326 |
| 227 | Ga0105241_10056186 | 3300009174 | Bacteria | 3018 |
| 228 | Ga0105241_10096145 | 3300009174 | Bacteria | 2346 |
| 229 | Ga0105248_10009836 | 3300009177 | Bacteria | 10536 |
| 230 | Ga0105248_10030112 | 3300009177 | Bacteria | 6058 |
| 231 | Ga0105248_10220471 | 3300009177 | Bacteria | 2135 |
| 232 | Ga0105248_10365179 | 3300009177 | Bacteria | 1625 |
| 233 | Ga0105248_10408363 | 3300009177 | Bacteria | 1529 |
| 234 | Ga0105238_10139918 | 3300009551 | Bacteria | 2397 |
| 235 | Ga0105238_10153501 | 3300009551 | Bacteria | 2278 |
| 236 | Ga0105238_10289739 | 3300009551 | Bacteria | 1619 |
| 237 | Ga0105239_10470371 | 3300010375 | Bacteria | 1427 |
| 238 | Ga0105239_10550717 | 3300010375 | Bacteria | 1314 |
| 239 | Ga0105246_10009862 | 3300011119 | Bacteria | 5890 |
| 240 | Ga0105246_10031721 | 3300011119 | Bacteria | 3498 |
| 241 | Ga0105246_10304781 | 3300011119 | Bacteria | 1288 |
| 242 | Ga0157346_1003394 | 3300012480 | Bacteria | 887 |
| 243 | Ga0157335_1002624 | 3300012492 | Bacteria | 1098 |
| 244 | Ga0157341_1000300 | 3300012494 | Bacteria | 2347 |
| 245 | Ga0157373_10039274 | 3300013100 | Bacteria | 3389 |
| 246 | Ga0157373_10113560 | 3300013100 | Bacteria | 1904 |
| 247 | Ga0157371_10170664 | 3300013102 | Bacteria | 1554 |
| 248 | Ga0157370_10227721 | 3300013104 | Bacteria | 1726 |
| 249 | Ga0157369_10036634 | 3300013105 | Bacteria | 5373 |
| 250 | Ga0157369_10123499 | 3300013105 | Bacteria | 2746 |
| 251 | Ga0157369_10300238 | 3300013105 | Bacteria | 1671 |
| 252 | Ga0157369_10312716 | 3300013105 | Bacteria | 1633 |
| 253 | Ga0157374_10143396 | 3300013296 | Bacteria | 2319 |
| 254 | Ga0157378_10292443 | 3300013297 | Bacteria | 1574 |
| 255 | Ga0163162_10224648 | 3300013306 | Bacteria | 2007 |
| 256 | Ga0163162_10369275 | 3300013306 | Bacteria | 1568 |
| 257 | Ga0157372_10018413 | 3300013307 | Bacteria | 7507 |
| 258 | Ga0157372_10181727 | 3300013307 | Bacteria | 2435 |
| 259 | Ga0157372_10533262 | 3300013307 | Bacteria | 1368 |
| 260 | Ga0157375_10033480 | 3300013308 | Bacteria | 4884 |
| 261 | Ga0157375_10474650 | 3300013308 | Bacteria | 1416 |
| 262 | Ga0163163_10005527 | 3300014325 | Bacteria | 10942 |
| 263 | Ga0163163_10066983 | 3300014325 | Bacteria | 3568 |
| 264 | Ga0163163_10084893 | 3300014325 | Bacteria | 3173 |
| 265 | Ga0163163_10085666 | 3300014325 | Bacteria | 3159 |
| 266 | Ga0163163_10233703 | 3300014325 | Bacteria | 1888 |
| 267 | Ga0157380_10049550 | 3300014326 | Bacteria | 3313 |
| 268 | Ga0157380_10071988 | 3300014326 | Bacteria | 2798 |
| 269 | Ga0182008_10111921 | 3300014497 | Bacteria | 1353 |
| 270 | Ga0157377_10029761 | 3300014745 | Bacteria | 2952 |
| 271 | Ga0157377_10068253 | 3300014745 | Bacteria | 2049 |
| 272 | Ga0157379_10046736 | 3300014968 | Bacteria | 3862 |
| 273 | Ga0157379_10609083 | 3300014968 | Bacteria | 1020 |
| 274 | Ga0157376_10028563 | 3300014969 | Bacteria | 4434 |
| 275 | Ga0157376_10238907 | 3300014969 | Bacteria | 1692 |
| 276 | Ga0157376_10712627 | 3300014969 | Bacteria | 1010 |
| 277 | Ga0163161_10040904 | 3300017792 | Bacteria | 3330 |
| 278 | Ga0197907_10762344 | 3300020069 | Bacteria | 1225 |
| 279 | Ga0197907_11015168 | 3300020069 | Bacteria | 1829 |
| 280 | Ga0206356_10405628 | 3300020070 | Bacteria | 4042 |
| 281 | Ga0206356_10489382 | 3300020070 | Bacteria | 2280 |
| 282 | Ga0206356_10723889 | 3300020070 | Bacteria | 866 |
| 283 | Ga0206356_10728356 | 3300020070 | Bacteria | 1545 |
| 284 | Ga0206355_1368205 | 3300020076 | Bacteria | 1628 |
| 285 | Ga0206355_1397913 | 3300020076 | Bacteria | 1137 |
| 286 | Ga0206351_10506233 | 3300020077 | Bacteria | 2473 |
| 287 | Ga0206350_10116847 | 3300020080 | Bacteria | 2230 |
| 288 | Ga0206350_10544556 | 3300020080 | Bacteria | 1099 |
| 289 | Ga0206350_11470673 | 3300020080 | Bacteria | 1398 |
| 290 | Ga0206354_10072260 | 3300020081 | Bacteria | 1941 |
| 291 | Ga0206354_11430440 | 3300020081 | Bacteria | 3961 |
| 292 | Ga0206353_10430671 | 3300020082 | Bacteria | 3559 |
| 293 | Ga0206353_10653977 | 3300020082 | Bacteria | 3453 |
| 294 | Ga0213876_10001874 | 3300021384 | Bacteria | 12658 |
| 295 | Ga0213875_10000781 | 3300021388 | Bacteria | 23756 |
| 296 | Ga0224712_10104987 | 3300022467 | Bacteria | 1204 |
| 297 | Ga0224712_10139492 | 3300022467 | Bacteria | 1066 |
| 298 | Ga0224712_10150291 | 3300022467 | Bacteria | 1031 |
| 299 | Ga0207656_10034157 | 3300025321 | Bacteria | 2122 |
| 300 | Ga0207713_1050646 | 3300025735 | Bacteria | 1656 |
| 301 | Ga0207713_1060396 | 3300025735 | Bacteria | 1449 |
| 302 | Ga0207653_10030488 | 3300025885 | Bacteria | 1740 |
| 303 | Ga0207692_10022951 | 3300025898 | Bacteria | 2879 |
| 304 | Ga0207692_10033058 | 3300025898 | Bacteria | 2491 |
| 305 | Ga0207692_10040234 | 3300025898 | Bacteria | 2306 |
| 306 | Ga0207692_10073282 | 3300025898 | Bacteria | 1811 |
| 307 | Ga0207710_10021043 | 3300025900 | Bacteria | 2793 |
| 308 | Ga0207710_10058324 | 3300025900 | Bacteria | 1745 |
| 309 | Ga0207688_10007394 | 3300025901 | Bacteria | 5981 |
| 310 | Ga0207688_10007902 | 3300025901 | Bacteria | 5790 |
| 311 | Ga0207688_10248991 | 3300025901 | Bacteria | 1076 |
| 312 | Ga0207680_10040798 | 3300025903 | Bacteria | 2704 |
| 313 | Ga0207647_10169197 | 3300025904 | Bacteria | 1273 |
| 314 | Ga0207685_10039708 | 3300025905 | Bacteria | 1749 |
| 315 | Ga0207699_10003669 | 3300025906 | Bacteria | 7332 |
| 316 | Ga0207699_10004669 | 3300025906 | Bacteria | 6549 |
| 317 | Ga0207699_10019293 | 3300025906 | Bacteria | 3633 |
| 318 | Ga0207699_10098857 | 3300025906 | Bacteria | 1847 |
| 319 | Ga0207699_10132956 | 3300025906 | Bacteria | 1625 |
| 320 | Ga0207699_10137033 | 3300025906 | Bacteria | 1604 |
| 321 | Ga0207699_10220016 | 3300025906 | Bacteria | 1296 |
| 322 | Ga0207699_10270608 | 3300025906 | Bacteria | 1177 |
| 323 | Ga0207645_10105047 | 3300025907 | Bacteria | 1824 |
| 324 | Ga0207643_10000062 | 3300025908 | Bacteria | 71074 |
| 325 | Ga0207705_10018746 | 3300025909 | Bacteria | 4951 |
| 326 | Ga0207705_10172805 | 3300025909 | Bacteria | 1627 |
| 327 | Ga0207684_10009273 | 3300025910 | Bacteria | 8692 |
| 328 | Ga0207684_10080045 | 3300025910 | Bacteria | 2779 |
| 329 | Ga0207654_10009696 | 3300025911 | Bacteria | 4899 |
| 330 | Ga0207654_10197261 | 3300025911 | Bacteria | 1323 |
| 331 | Ga0207707_10009697 | 3300025912 | Bacteria | 8354 |
| 332 | Ga0207707_10147957 | 3300025912 | Bacteria | 2053 |
| 333 | Ga0207707_10223166 | 3300025912 | Bacteria | 1640 |
| 334 | Ga0207695_10151778 | 3300025913 | Bacteria | 2255 |
| 335 | Ga0207695_10245111 | 3300025913 | Bacteria | 1692 |
| 336 | Ga0207671_10030740 | 3300025914 | Bacteria | 4003 |
| 337 | Ga0207671_10220119 | 3300025914 | Bacteria | 1487 |
| 338 | Ga0207693_10024639 | 3300025915 | Bacteria | 4773 |
| 339 | Ga0207693_10155645 | 3300025915 | Bacteria | 1797 |
| 340 | Ga0207663_10012326 | 3300025916 | Bacteria | 4621 |
| 341 | Ga0207663_10038321 | 3300025916 | Bacteria | 2896 |
| 342 | Ga0207663_10061230 | 3300025916 | Bacteria | 2388 |
| 343 | Ga0207663_10135441 | 3300025916 | Bacteria | 1708 |
| 344 | Ga0207663_10182722 | 3300025916 | Bacteria | 1499 |
| 345 | Ga0207663_10290786 | 3300025916 | Bacteria | 1217 |
| 346 | Ga0207660_10002954 | 3300025917 | Bacteria | 11120 |
| 347 | Ga0207662_10016531 | 3300025918 | Bacteria | 4166 |
| 348 | Ga0207662_10032585 | 3300025918 | Bacteria | 3035 |
| 349 | Ga0207657_10003435 | 3300025919 | Bacteria | 16892 |
| 350 | Ga0207657_10042175 | 3300025919 | Bacteria | 4028 |
| 351 | Ga0207649_10023459 | 3300025920 | Bacteria | 3574 |
| 352 | Ga0207652_10014743 | 3300025921 | Bacteria | 6334 |
| 353 | Ga0207652_10015959 | 3300025921 | Bacteria | 6123 |
| 354 | Ga0207646_10006542 | 3300025922 | Bacteria | 12028 |
| 355 | Ga0207646_10016172 | 3300025922 | Bacteria | 7011 |
| 356 | Ga0207646_10029899 | 3300025922 | Bacteria | 4945 |
| 357 | Ga0207681_10102720 | 3300025923 | Bacteria | 2065 |
| 358 | Ga0207681_10206640 | 3300025923 | Bacteria | 1511 |
| 359 | Ga0207694_10180105 | 3300025924 | Bacteria | 1714 |
| 360 | Ga0207650_10008989 | 3300025925 | Bacteria | 6830 |
| 361 | Ga0207659_10043962 | 3300025926 | Bacteria | 3141 |
| 362 | Ga0207687_10120646 | 3300025927 | Bacteria | 1960 |
| 363 | Ga0207687_10148187 | 3300025927 | Bacteria | 1788 |
| 364 | Ga0207700_10003757 | 3300025928 | Bacteria | 8863 |
| 365 | Ga0207700_10003804 | 3300025928 | Bacteria | 8816 |
| 366 | Ga0207700_10012466 | 3300025928 | Bacteria | 5484 |
| 367 | Ga0207700_10020572 | 3300025928 | Bacteria | 4486 |
| 368 | Ga0207700_10064383 | 3300025928 | Bacteria | 2792 |
| 369 | Ga0207700_10070758 | 3300025928 | Bacteria | 2683 |
| 370 | Ga0207700_10071822 | 3300025928 | Bacteria | 2666 |
| 371 | Ga0207700_10152645 | 3300025928 | Bacteria | 1910 |
| 372 | Ga0207700_10499220 | 3300025928 | Bacteria | 1077 |
| 373 | Ga0207664_10000171 | 3300025929 | Bacteria | 51218 |
| 374 | Ga0207664_10006127 | 3300025929 | Bacteria | 8242 |
| 375 | Ga0207664_10063189 | 3300025929 | Bacteria | 2958 |
| 376 | Ga0207664_10066010 | 3300025929 | Bacteria | 2899 |
| 377 | Ga0207664_10130710 | 3300025929 | Bacteria | 2113 |
| 378 | Ga0207664_10177209 | 3300025929 | Bacteria | 1828 |
| 379 | Ga0207664_10187700 | 3300025929 | Bacteria | 1778 |
| 380 | Ga0207664_10194628 | 3300025929 | Bacteria | 1747 |
| 381 | Ga0207644_10008563 | 3300025931 | Bacteria | 6692 |
| 382 | Ga0207644_10220983 | 3300025931 | Bacteria | 1501 |
| 383 | Ga0207644_10234310 | 3300025931 | Bacteria | 1460 |
| 384 | Ga0207644_10260818 | 3300025931 | Bacteria | 1386 |
| 385 | Ga0207644_10297315 | 3300025931 | Bacteria | 1300 |
| 386 | Ga0207690_10111096 | 3300025932 | Bacteria | 1974 |
| 387 | Ga0207706_10033968 | 3300025933 | Bacteria | 4539 |
| 388 | Ga0207706_10383004 | 3300025933 | Bacteria | 1220 |
| 389 | Ga0207709_10082602 | 3300025935 | Bacteria | 2075 |
| 390 | Ga0207670_10011841 | 3300025936 | Bacteria | 5078 |
| 391 | Ga0207670_10211328 | 3300025936 | Bacteria | 1480 |
| 392 | Ga0207704_10086544 | 3300025938 | Bacteria | 2044 |
| 393 | Ga0207665_10002702 | 3300025939 | Bacteria | 11894 |
| 394 | Ga0207665_10017100 | 3300025939 | Bacteria | 4763 |
| 395 | Ga0207665_10023353 | 3300025939 | Bacteria | 4074 |
| 396 | Ga0207665_10094888 | 3300025939 | Bacteria | 2072 |
| 397 | Ga0207665_10140297 | 3300025939 | Bacteria | 1723 |
| 398 | Ga0207691_10077602 | 3300025940 | Bacteria | 2992 |
| 399 | Ga0207711_10027183 | 3300025941 | Bacteria | 4806 |
| 400 | Ga0207711_10037065 | 3300025941 | Bacteria | 4140 |
| 401 | Ga0207711_10173550 | 3300025941 | Bacteria | 1957 |
| 402 | Ga0207711_10180498 | 3300025941 | Bacteria | 1919 |
| 403 | Ga0207711_10221171 | 3300025941 | Bacteria | 1732 |
| 404 | Ga0207689_10002952 | 3300025942 | Bacteria | 15710 |
| 405 | Ga0207689_10025596 | 3300025942 | Bacteria | 4944 |
| 406 | Ga0207689_10152742 | 3300025942 | Bacteria | 1903 |
| 407 | Ga0207661_10008496 | 3300025944 | Bacteria | 7338 |
| 408 | Ga0207661_10055821 | 3300025944 | Bacteria | 3169 |
| 409 | Ga0207661_10293647 | 3300025944 | Bacteria | 1455 |
| 410 | Ga0207661_10588014 | 3300025944 | Bacteria | 1021 |
| 411 | Ga0207679_10000826 | 3300025945 | Bacteria | 19925 |
| 412 | Ga0207679_10058132 | 3300025945 | Bacteria | 2864 |
| 413 | Ga0207679_10064875 | 3300025945 | Bacteria | 2731 |
| 414 | Ga0207679_10171473 | 3300025945 | Bacteria | 1787 |
| 415 | Ga0207667_10024240 | 3300025949 | Bacteria | 6666 |
| 416 | Ga0207667_10398985 | 3300025949 | Bacteria | 1400 |
| 417 | Ga0207668_10013862 | 3300025972 | Bacteria | 4978 |
| 418 | Ga0207668_10348923 | 3300025972 | Bacteria | 1237 |
| 419 | Ga0207668_10397576 | 3300025972 | Bacteria | 1164 |
| 420 | Ga0207658_10100687 | 3300025986 | Bacteria | 2263 |
| 421 | Ga0207658_10322334 | 3300025986 | Bacteria | 1338 |
| 422 | Ga0207677_10028617 | 3300026023 | Bacteria | 3527 |
| 423 | Ga0207677_10183556 | 3300026023 | Bacteria | 1648 |
| 424 | Ga0207677_10199777 | 3300026023 | Bacteria | 1588 |
| 425 | Ga0207703_10011442 | 3300026035 | Bacteria | 6899 |
| 426 | Ga0207703_10084387 | 3300026035 | Bacteria | 2656 |
| 427 | Ga0207703_10155232 | 3300026035 | Bacteria | 1999 |
| 428 | Ga0207703_10362963 | 3300026035 | Bacteria | 1336 |
| 429 | Ga0207639_10092005 | 3300026041 | Bacteria | 2430 |
| 430 | Ga0207639_10140916 | 3300026041 | Bacteria | 2008 |
| 431 | Ga0207639_10157404 | 3300026041 | Bacteria | 1910 |
| 432 | Ga0207678_10000510 | 3300026067 | Bacteria | 35197 |
| 433 | Ga0207678_10028460 | 3300026067 | Bacteria | 4879 |
| 434 | Ga0207678_10042446 | 3300026067 | Bacteria | 3940 |
| 435 | Ga0207678_10571972 | 3300026067 | Bacteria | 989 |
| 436 | Ga0207708_10017836 | 3300026075 | Bacteria | 5342 |
| 437 | Ga0207708_10033271 | 3300026075 | Bacteria | 3916 |
| 438 | Ga0207702_10012078 | 3300026078 | Bacteria | 7183 |
| 439 | Ga0207702_10013722 | 3300026078 | Bacteria | 6731 |
| 440 | Ga0207702_10018909 | 3300026078 | Bacteria | 5700 |
| 441 | Ga0207702_10019774 | 3300026078 | Bacteria | 5575 |
| 442 | Ga0207702_10106123 | 3300026078 | Bacteria | 2489 |
| 443 | Ga0207641_10013718 | 3300026088 | Bacteria | 6648 |
| 444 | Ga0207641_10024995 | 3300026088 | Bacteria | 4926 |
| 445 | Ga0207641_10040646 | 3300026088 | Bacteria | 3894 |
| 446 | Ga0207641_10084564 | 3300026088 | Bacteria | 2762 |
| 447 | Ga0207641_10132404 | 3300026088 | Bacteria | 2240 |
| 448 | Ga0207641_10283187 | 3300026088 | Bacteria | 1560 |
| 449 | Ga0207648_10210422 | 3300026089 | Bacteria | 1726 |
| 450 | Ga0207676_10001571 | 3300026095 | Bacteria | 16806 |
| 451 | Ga0207676_10013516 | 3300026095 | Bacteria | 5862 |
| 452 | Ga0207676_10108732 | 3300026095 | Bacteria | 2315 |
| 453 | Ga0207676_10134752 | 3300026095 | Bacteria | 2105 |
| 454 | Ga0207676_10213943 | 3300026095 | Bacteria | 1712 |
| 455 | Ga0207674_10004920 | 3300026116 | Bacteria | 15972 |
| 456 | Ga0207674_10005169 | 3300026116 | Bacteria | 15556 |
| 457 | Ga0207674_10042275 | 3300026116 | Bacteria | 4709 |
| 458 | Ga0207674_10065447 | 3300026116 | Bacteria | 3663 |
| 459 | Ga0207675_100296946 | 3300026118 | Bacteria | 1573 |
| 460 | Ga0207683_10000214 | 3300026121 | Bacteria | 50433 |
| 461 | Ga0207683_10185636 | 3300026121 | Bacteria | 1886 |
| 462 | Ga0207698_10059237 | 3300026142 | Bacteria | 2972 |
| 463 | Ga0207698_10133347 | 3300026142 | Bacteria | 2127 |
| 464 | Ga0207698_10218808 | 3300026142 | Bacteria | 1719 |
| 465 | Ga0207428_10001830 | 3300027907 | Bacteria | 21763 |
| 466 | Ga0207428_10217547 | 3300027907 | Bacteria | 1433 |
| 467 | Ga0268266_10025741 | 3300028379 | Bacteria | 5006 |
| 468 | Ga0268266_10159713 | 3300028379 | Bacteria | 2038 |
| 469 | Ga0268266_10296479 | 3300028379 | Bacteria | 1507 |
| 470 | Ga0268266_10357724 | 3300028379 | Bacteria | 1373 |
| 471 | Ga0268266_10412019 | 3300028379 | Bacteria | 1279 |
| 472 | Ga0268265_10159519 | 3300028380 | Bacteria | 1914 |
| 473 | Ga0268265_10237713 | 3300028380 | Bacteria | 1605 |
| 474 | Ga0268264_10032660 | 3300028381 | Bacteria | 4271 |
| 475 | Ga0265337_1003185 | 3300028556 | Bacteria | 7208 |
| 476 | Ga0265326_10001914 | 3300028558 | Bacteria | 7127 |
| 477 | Ga0265319_1000682 | 3300028563 | Bacteria | 22125 |
| 478 | Ga0265334_10000160 | 3300028573 | Bacteria | 41820 |
| 479 | Ga0265318_10037650 | 3300028577 | Bacteria | 1852 |
| 480 | Ga0265323_10004706 | 3300028653 | Bacteria | 5853 |
| 481 | Ga0265322_10007027 | 3300028654 | Bacteria | 3301 |
| 482 | Ga0265336_10003919 | 3300028666 | Bacteria | 5703 |
| 483 | Ga0265336_10007367 | 3300028666 | Bacteria | 3913 |
| 484 | Ga0307515_10000119 | 3300028794 | Bacteria | 189566 |
| 485 | Ga0307515_10105711 | 3300028794 | Bacteria | 3348 |
| 486 | Ga0265338_10000148 | 3300028800 | Bacteria | 128839 |
| 487 | Ga0265338_10033277 | 3300028800 | Bacteria | 5006 |
| 488 | Ga0265338_10082736 | 3300028800 | Bacteria | 2687 |
| 489 | Ga0265338_10093736 | 3300028800 | Bacteria | 2472 |
| 490 | Ga0265324_10035197 | 3300029957 | Bacteria | 1743 |
| 491 | Ga0307512_10003144 | 3300030522 | Bacteria | 19632 |
| 492 | Ga0307512_10145633 | 3300030522 | Bacteria | 1434 |
| 493 | Ga0265760_10020983 | 3300031090 | Bacteria | 1887 |
| 494 | Ga0265332_10000443 | 3300031238 | Bacteria | 29217 |
| 495 | Ga0265320_10001651 | 3300031240 | Bacteria | 15876 |
| 496 | Ga0265320_10079171 | 3300031240 | Bacteria | 1536 |
| 497 | Ga0265325_10002380 | 3300031241 | Bacteria | 12708 |
| 498 | Ga0265325_10017046 | 3300031241 | Bacteria | 4043 |
| 499 | Ga0265340_10018256 | 3300031247 | Bacteria | 3619 |
| 500 | Ga0265339_10009430 | 3300031249 | Bacteria | 6138 |
| 501 | Ga0265339_10113975 | 3300031249 | Bacteria | 1396 |
| 502 | Ga0265316_10126499 | 3300031344 | Bacteria | 1926 |
| 503 | Ga0307513_10007579 | 3300031456 | Bacteria | 14029 |
| 504 | Ga0307509_10017954 | 3300031507 | Bacteria | 8123 |
| 505 | Ga0265313_10043819 | 3300031595 | Bacteria | 2188 |
| 506 | Ga0307508_10134404 | 3300031616 | Bacteria | 2076 |
| 507 | Ga0265314_10005926 | 3300031711 | Bacteria | 10933 |
| 508 | Ga0265314_10059181 | 3300031711 | Bacteria | 2622 |
| 509 | Ga0265342_10003642 | 3300031712 | Bacteria | 12532 |
| 510 | Ga0307516_10000149 | 3300031730 | Bacteria | 86821 |
| 511 | Ga0307516_10039888 | 3300031730 | Bacteria | 4677 |
| 512 | Ga0307516_10061367 | 3300031730 | Bacteria | 3648 |
| 513 | Ga0307405_10465876 | 3300031731 | Bacteria | 1005 |
| 514 | Ga0307413_10027446 | 3300031824 | Bacteria | 3155 |
| 515 | Ga0307413_10250284 | 3300031824 | Bacteria | 1314 |
| 516 | Ga0307410_10038849 | 3300031852 | Bacteria | 3121 |
| 517 | Ga0307410_10297849 | 3300031852 | Bacteria | 1271 |
| 518 | Ga0307406_10008662 | 3300031901 | Bacteria | 5683 |
| 519 | Ga0307406_10530278 | 3300031901 | Bacteria | 960 |
| 520 | Ga0307407_10037722 | 3300031903 | Bacteria | 2672 |
| 521 | Ga0307409_100003817 | 3300031995 | Bacteria | 8312 |
| 522 | Ga0307409_100444259 | 3300031995 | Bacteria | 1250 |
| 523 | Ga0307409_100738338 | 3300031995 | Bacteria | 987 |
| 524 | Ga0307416_100005302 | 3300032002 | Bacteria | 7903 |
| 525 | Ga0307411_10257437 | 3300032005 | Bacteria | 1376 |
| 526 | Ga0307415_100027971 | 3300032126 | Bacteria | 3580 |
| 527 | Ga0307415_100378280 | 3300032126 | Bacteria | 1201 |
| 528 | Ga0307415_100556073 | 3300032126 | Bacteria | 1013 |
| 529 | Ga0307415_100783391 | 3300032126 | Bacteria | 869 |
| 530 | Ga0307507_10172226 | 3300033179 | Bacteria | 1570 |
| 531 | Ga0307510_10163330 | 3300033180 | Bacteria | 1820 |
| 532 | Ga0307510_10257558 | 3300033180 | Bacteria | 1228 |
| 533 | Ga0373959_0012000 | 3300034820 | Bacteria | 1540 |
| 534 | Ga0373938_0003442 | 3300034957 | Bacteria | 2596 |
| 535 | Ga0373938_0005082 | 3300034957 | Bacteria | 2224 |
| 536 | Ga0373926_0000466 | 3300035083 | Bacteria | 10642 |
| 537 | Ga0373926_0009931 | 3300035083 | Bacteria | 3186 |
| 538 | Ga0373926_0032655 | 3300035083 | Bacteria | 1837 |
| 539 | Ga0373926_0055287 | 3300035083 | Bacteria | 1438 |
| 540 | Ga0373934_0002514 | 3300035086 | Bacteria | 6739 |
| 541 | Ga0373934_0014637 | 3300035086 | Bacteria | 2972 |
| 542 | Ga0373940_0000286 | 3300035088 | Bacteria | 7291 |
| 543 | Ga0373944_0013974 | 3300035089 | Bacteria | 2235 |
| 544 | Ga0373944_0048034 | 3300035089 | Bacteria | 1338 |
| 545 | Ga0373949_0010190 | 3300035090 | Bacteria | 2059 |
| 546 | Ga0373951_0026521 | 3300035091 | Bacteria | 1350 |
| 547 | Ga0373952_0021185 | 3300035092 | Bacteria | 1370 |
| 548 | Ga0373923_0006829 | 3300035111 | Bacteria | 3970 |
| 549 | Ga0373923_0021375 | 3300035111 | Bacteria | 2525 |
| 550 | Ga0373923_0034499 | 3300035111 | Bacteria | 2054 |
| 551 | Ga0373932_0060220 | 3300035112 | Bacteria | 1151 |
| 552 | Ga0373936_0001343 | 3300035113 | Bacteria | 8932 |
| 553 | Ga0373936_0111602 | 3300035113 | Bacteria | 1161 |
| 554 | Ga0373939_0002004 | 3300035114 | Bacteria | 4862 |
| 555 | Ga0373939_0081131 | 3300035114 | Bacteria | 1077 |
| 556 | Ga0373953_0003568 | 3300035117 | Bacteria | 4867 |
| 557 | Ga0373953_0007432 | 3300035117 | Bacteria | 3669 |
| 558 | Ga0373953_0065435 | 3300035117 | Bacteria | 1492 |
| 559 | Ga0373953_0084343 | 3300035117 | Bacteria | 1324 |
| 560 | Ga0373954_0153785 | 3300035118 | Bacteria | 1124 |
| 561 | Ga0373956_0014216 | 3300035119 | Bacteria | 3323 |
| 562 | Ga0373956_0017767 | 3300035119 | Bacteria | 3003 |
| 563 | Ga0373956_0034899 | 3300035119 | Bacteria | 2216 |
| 564 | Ga0373957_0004472 | 3300035120 | Bacteria | 4254 |
| 565 | Ga0373957_0037853 | 3300035120 | Bacteria | 1803 |
| 566 | Ga0373957_0072743 | 3300035120 | Bacteria | 1347 |
| 567 | Ga0373960_0011533 | 3300035121 | Bacteria | 2178 |
| 568 | Ga0373960_0081321 | 3300035121 | Bacteria | 1020 |
| 569 | Ga0373943_0025333 | 3300035170 | Bacteria | 2772 |
| 570 | Ga0373943_0083906 | 3300035170 | Bacteria | 1638 |
| 571 | Ga0373943_0110995 | 3300035170 | Bacteria | 1446 |
| 572 | Ga0373946_0004755 | 3300035171 | Bacteria | 4883 |
| 573 | Ga0373946_0030978 | 3300035171 | Bacteria | 2138 |
| 574 | Ga0373955_0004742 | 3300035172 | Bacteria | 6047 |
| 575 | Ga0373955_0007371 | 3300035172 | Bacteria | 5053 |
| 576 | Ga0373955_0010229 | 3300035172 | Bacteria | 4423 |
| 577 | Ga0373942_0000185 | 3300035207 | Bacteria | 15769 |
| 578 | Ga0373942_0042310 | 3300035207 | Bacteria | 1248 |
| 579 | Ga0373961_0048573 | 3300035241 | Bacteria | 1251 |
| 580 | Ga0373961_0058268 | 3300035241 | Bacteria | 1164 |
| 581 | Ga0373961_0096467 | 3300035241 | Bacteria | 952 |
| 582 | Ga0373962_0004291 | 3300035242 | Bacteria | 3442 |
| 583 | Ga0373962_0005163 | 3300035242 | Bacteria | 3156 |
| 584 | Ga0373924_0004136 | 3300035410 | Bacteria | 5048 |
| 585 | Ga0373924_0007133 | 3300035410 | Bacteria | 4028 |
| 586 | Ga0373931_0242268 | 3300035691 | Bacteria | 1093 |
| 587 | Ga0373931_0401899 | 3300035691 | Bacteria | 867 |
| 588 | Ga0373935_0066945 | 3300035692 | Bacteria | 2308 |
| 589 | Ga0373927_0016941 | 3300035695 | Bacteria | 4802 |
| 590 | Ga0373927_0066901 | 3300035695 | Bacteria | 2325 |
| 591 | Ga0373927_0203365 | 3300035695 | Bacteria | 1300 |
| 592 | Ga0373933_0001929 | 3300035724 | Bacteria | 11965 |
| 593 | Ga0373933_0014478 | 3300035724 | Bacteria | 4388 |
| 594 | Ga0373947_0001176 | 3300035725 | Bacteria | 16097 |
| 595 | Ga0373947_0128877 | 3300035725 | Bacteria | 1613 |
| 596 | Ga0373947_0148253 | 3300035725 | Bacteria | 1509 |
| 597 | Ga0373947_0211998 | 3300035725 | Bacteria | 1271 |
| 598 | Ga0373937_0008996 | 3300036401 | Bacteria | 8671 |
| 599 | Ga0373937_0022290 | 3300036401 | Bacteria | 5694 |
| 600 | Ga0373937_0046720 | 3300036401 | Bacteria | 3959 |
| 601 | Ga0373937_0543095 | 3300036401 | Bacteria | 1104 |
| 602 | Ga0310109_008703 | 3300036534 | Bacteria | 1353 |
| 603 | Ga0373925_0000004 | 3300037068 | Bacteria | 361597 |
| 604 | Ga0373925_0013204 | 3300037068 | Bacteria | 5978 |
| 605 | Ga0373925_0117981 | 3300037068 | Bacteria | 2057 |
| 606 | Ga0373925_0174663 | 3300037068 | Bacteria | 1697 |
| 607 | Ga0373925_0641181 | 3300037068 | Bacteria | 875 |
| 608 | Ga0395900_0001388 | 3300037418 | Bacteria | 29031 |
| 609 | Ga0395900_0604213 | 3300037418 | Bacteria | 1037 |
| 610 | Ga0395898_0007474 | 3300037466 | Bacteria | 11603 |
| 611 | Ga0395898_0205064 | 3300037466 | Bacteria | 1881 |
| 612 | Ga0395898_0441644 | 3300037466 | Bacteria | 1239 |
| 613 | Ga0395905_0001885 | 3300037471 | Bacteria | 24168 |
| 614 | Ga0395905_0584492 | 3300037471 | Bacteria | 1018 |
| 615 | Ga0436364_0213102 | 3300037853 | Bacteria | 3798 |
| 616 | Ga0436364_0969684 | 3300037853 | Bacteria | 2354 |
| 617 | Ga0436364_1133930 | 3300037853 | Bacteria | 44830 |
| 618 | Ga0436364_1202907 | 3300037853 | Bacteria | 10551 |
| 619 | Ga0436364_1377900 | 3300037853 | Bacteria | 3398 |
| 620 | Ga0395901_0001402 | 3300038443 | Bacteria | 25176 |
| 621 | Ga0395901_0026591 | 3300038443 | Bacteria | 5942 |
| 622 | Ga0436365_0567091 | 3300039437 | Bacteria | 46375 |
| 623 | Ga0436360_0972388 | 3300039438 | Bacteria | 1010 |
| 624 | Ga0436362_0612140 | 3300039453 | Bacteria | 1137 |
| 625 | Ga0436362_0804513 | 3300039453 | Bacteria | 894 |
| 626 | Ga0451839_1201347 | 3300041496 | Bacteria | 1129 |
| 627 | Ga0451839_1338288 | 3300041496 | Bacteria | 894 |
| 628 | Ga0451843_0226282 | 3300041509 | Bacteria | 1643 |
| 629 | Ga0451853_2299179 | 3300041512 | Bacteria | 2211 |
| 630 | Ga0439463_006694 | 3300042016 | Bacteria | 2851 |
| 631 | Ga0450902_016570 | 3300042137 | Bacteria | 1201 |
| 632 | Ga0439459_0032767 | 3300042438 | Bacteria | 1067 |
| 633 | Ga0466961_0172666 | 3300044693 | Bacteria | 1344 |
| 634 | Ga0466963_0041711 | 3300044694 | Bacteria | 3011 |
| 635 | Ga0466963_0169609 | 3300044694 | Bacteria | 1521 |
| 636 | Ga0466963_0423629 | 3300044694 | Bacteria | 939 |
| 637 | Ga0466971_0026957 | 3300044719 | Bacteria | 2572 |
| 638 | Ga0466960_0233682 | 3300044901 | Bacteria | 1015 |
| 639 | Ga0466959_0022068 | 3300045049 | Bacteria | 4702 |
| 640 | Ga0466959_0302947 | 3300045049 | Bacteria | 1094 |
| 641 | Ga0466958_0213137 | 3300045836 | Bacteria | 1231 |
| 642 | Ga0466967_0201516 | 3300045976 | Bacteria | 1885 |
| 643 | Ga0466967_0298639 | 3300045976 | Bacteria | 1549 |
| 644 | Ga0495592_0026164 | 3300046454 | Bacteria | 4426 |
| 645 | Ga0495592_0071886 | 3300046454 | Bacteria | 2517 |
| 646 | Ga0495592_0126054 | 3300046454 | Bacteria | 1796 |
| 647 | Ga0495603_0011218 | 3300046455 | Bacteria | 5429 |
| 648 | Ga0495603_0124763 | 3300046455 | Bacteria | 1500 |
| 649 | Ga0495629_0014806 | 3300046459 | Bacteria | 5609 |
| 650 | Ga0495629_0015166 | 3300046459 | Bacteria | 5539 |
| 651 | Ga0495629_0028216 | 3300046459 | Bacteria | 3985 |
| 652 | Ga0495629_0035347 | 3300046459 | Bacteria | 3531 |
| 653 | Ga0495629_0040318 | 3300046459 | Bacteria | 3284 |
| 654 | Ga0495629_0306855 | 3300046459 | Bacteria | 1086 |
| 655 | Ga0495641_0003281 | 3300046461 | Bacteria | 12216 |
| 656 | Ga0495641_0009096 | 3300046461 | Bacteria | 5949 |
| 657 | Ga0495641_0093238 | 3300046461 | Bacteria | 1345 |
| 658 | Ga0495641_0106403 | 3300046461 | Bacteria | 1251 |
| 659 | Ga0495651_0015262 | 3300046462 | Bacteria | 5938 |
| 660 | Ga0495651_0039521 | 3300046462 | Bacteria | 3672 |
| 661 | Ga0495651_0048192 | 3300046462 | Bacteria | 3291 |
| 662 | Ga0495651_0078960 | 3300046462 | Bacteria | 2488 |
| 663 | Ga0495653_0029952 | 3300046463 | Bacteria | 4337 |
| 664 | Ga0495653_0032685 | 3300046463 | Bacteria | 4129 |
| 665 | Ga0495653_0121735 | 3300046463 | Bacteria | 1858 |
| 666 | Ga0495653_0229116 | 3300046463 | Bacteria | 1244 |
| 667 | Ga0495580_0034108 | 3300046472 | Bacteria | 3664 |
| 668 | Ga0495580_0203229 | 3300046472 | Bacteria | 1364 |
| 669 | Ga0495582_0002234 | 3300046473 | Bacteria | 10842 |
| 670 | Ga0495582_0181712 | 3300046473 | Bacteria | 1198 |
| 671 | Ga0495639_0110612 | 3300046475 | Bacteria | 1303 |
| 672 | Ga0495662_0047270 | 3300046476 | Bacteria | 2077 |
| 673 | Ga0495662_0084117 | 3300046476 | Bacteria | 1548 |
| 674 | Ga0495662_0130515 | 3300046476 | Bacteria | 1235 |
| 675 | Ga0495662_0132884 | 3300046476 | Bacteria | 1224 |
| 676 | Ga0495664_0029985 | 3300046477 | Bacteria | 3184 |
| 677 | Ga0495594_0216769 | 3300046499 | Bacteria | 1091 |
| 678 | Ga0495608_0007212 | 3300046511 | Bacteria | 7863 |
| 679 | Ga0495608_0020244 | 3300046511 | Bacteria | 4573 |
| 680 | Ga0495608_0037080 | 3300046511 | Bacteria | 3279 |
| 681 | Ga0495608_0073934 | 3300046511 | Bacteria | 2221 |
| 682 | Ga0495618_0045409 | 3300046514 | Bacteria | 2771 |
| 683 | Ga0495618_0058898 | 3300046514 | Bacteria | 2433 |
| 684 | Ga0495618_0256209 | 3300046514 | Bacteria | 1096 |
| 685 | Ga0495628_0037878 | 3300046516 | Bacteria | 3863 |
| 686 | Ga0495630_0016178 | 3300046517 | Bacteria | 5450 |
| 687 | Ga0495630_0085626 | 3300046517 | Bacteria | 2379 |
| 688 | Ga0495630_0131286 | 3300046517 | Bacteria | 1902 |
| 689 | Ga0495666_0068227 | 3300046526 | Bacteria | 1693 |
| 690 | Ga0495652_0031017 | 3300046529 | Bacteria | 4683 |
| 691 | Ga0495665_0007819 | 3300046531 | Bacteria | 5784 |
| 692 | Ga0495665_0017421 | 3300046531 | Bacteria | 3864 |
| 693 | Ga0495640_0016525 | 3300046533 | Bacteria | 5519 |
| 694 | Ga0495640_0023697 | 3300046533 | Bacteria | 4467 |
| 695 | Ga0495640_0210164 | 3300046533 | Bacteria | 1230 |
| 696 | Ga0495586_0035950 | 3300046535 | Bacteria | 2660 |
| 697 | Ga0495586_0053286 | 3300046535 | Bacteria | 2191 |
| 698 | Ga0495587_0000622 | 3300046536 | Bacteria | 23992 |
| 699 | Ga0495587_0016344 | 3300046536 | Bacteria | 4617 |
| 700 | Ga0495587_0016487 | 3300046536 | Bacteria | 4595 |
| 701 | Ga0495645_0020301 | 3300046543 | Bacteria | 4791 |
| 702 | Ga0495645_0048532 | 3300046543 | Bacteria | 3092 |
| 703 | Ga0495645_0083738 | 3300046543 | Bacteria | 2285 |
| 704 | Ga0495622_0075444 | 3300046557 | Bacteria | 1554 |
| 705 | Ga0495667_0022172 | 3300046559 | Bacteria | 4279 |
| 706 | Ga0495667_0024735 | 3300046559 | Bacteria | 4044 |
| 707 | Ga0495667_0032505 | 3300046559 | Bacteria | 3496 |
| 708 | Ga0495667_0270609 | 3300046559 | Bacteria | 1079 |
| 709 | Ga0495668_0000872 | 3300046616 | Bacteria | 33998 |
| 710 | Ga0495634_0002233 | 3300046642 | Bacteria | 16223 |
| 711 | Ga0495634_0010992 | 3300046642 | Bacteria | 6606 |
| 712 | Ga0495634_0018939 | 3300046642 | Bacteria | 4895 |
| 713 | Ga0495634_0037425 | 3300046642 | Bacteria | 3315 |
| 714 | Ga0495625_0001540 | 3300046660 | Bacteria | 27551 |
| 715 | Ga0495635_0009496 | 3300046663 | Bacteria | 6798 |
| 716 | Ga0495635_0017916 | 3300046663 | Bacteria | 4946 |
| 717 | Ga0495635_0018484 | 3300046663 | Bacteria | 4862 |
| 718 | Ga0495588_0049893 | 3300046674 | Bacteria | 2153 |
| 719 | Ga0495588_0059107 | 3300046674 | Bacteria | 1982 |
| 720 | Ga0495657_0008676 | 3300046675 | Bacteria | 7759 |
| 721 | Ga0495657_0012224 | 3300046675 | Bacteria | 6383 |
| 722 | Ga0495657_0018394 | 3300046675 | Bacteria | 5059 |
| 723 | Ga0495657_0051922 | 3300046675 | Bacteria | 2751 |
| 724 | Ga0495599_0002361 | 3300046678 | Bacteria | 10962 |
| 725 | Ga0495599_0033234 | 3300046678 | Bacteria | 3240 |
| 726 | Ga0495599_0059564 | 3300046678 | Bacteria | 2388 |
| 727 | Ga0495623_0076976 | 3300046679 | Bacteria | 2069 |
| 728 | Ga0495646_0006386 | 3300046680 | Bacteria | 7476 |
| 729 | Ga0495646_0039563 | 3300046680 | Bacteria | 2906 |
| 730 | Ga0495646_0045559 | 3300046680 | Bacteria | 2678 |
| 731 | Ga0495646_0261457 | 3300046680 | Bacteria | 924 |
| 732 | Ga0495647_0003697 | 3300046681 | Bacteria | 4913 |
| 733 | Ga0495658_0002971 | 3300046683 | Bacteria | 8490 |
| 734 | Ga0495658_0003148 | 3300046683 | Bacteria | 8224 |
| 735 | Ga0495658_0223885 | 3300046683 | Bacteria | 1178 |
| 736 | Ga0495613_0011502 | 3300046689 | Bacteria | 6583 |
| 737 | Ga0495613_0031106 | 3300046689 | Bacteria | 3964 |
| 738 | Ga0495613_0032336 | 3300046689 | Bacteria | 3886 |
| 739 | Ga0495624_0030464 | 3300046690 | Bacteria | 3514 |
| 740 | Ga0495624_0037702 | 3300046690 | Bacteria | 3108 |
| 741 | Ga0495624_0049971 | 3300046690 | Bacteria | 2650 |
| 742 | Ga0495600_0099022 | 3300046809 | Bacteria | 1900 |
| 743 | Ga0495600_0131570 | 3300046809 | Bacteria | 1626 |
| 744 | Ga0495600_0193721 | 3300046809 | Bacteria | 1306 |
| 745 | Ga0495600_0304710 | 3300046809 | Bacteria | 1004 |
| 746 | Ga0495581_0006889 | 3300047315 | Bacteria | 6588 |
| 747 | Ga0495581_0010234 | 3300047315 | Bacteria | 5425 |
| 748 | Ga0495604_0012891 | 3300047317 | Bacteria | 6659 |
| 749 | Ga0495604_0019147 | 3300047317 | Bacteria | 5482 |
| 750 | Ga0495604_0187039 | 3300047317 | Bacteria | 1445 |
| 751 | Ga0495674_0029900 | 3300047319 | Bacteria | 4956 |
| 752 | Ga0495674_0073050 | 3300047319 | Bacteria | 2957 |
| 753 | Ga0495674_0091846 | 3300047319 | Bacteria | 2592 |
| 754 | Ga0495674_0123745 | 3300047319 | Bacteria | 2183 |
| 755 | Ga0495680_0015432 | 3300047322 | Bacteria | 6591 |
| 756 | Ga0495680_0062167 | 3300047322 | Bacteria | 2871 |
| 757 | Ga0495680_0063309 | 3300047322 | Bacteria | 2840 |
| 758 | Ga0495680_0078152 | 3300047322 | Bacteria | 2504 |
| 759 | Ga0495680_0086308 | 3300047322 | Bacteria | 2361 |
| 760 | Ga0495680_0143642 | 3300047322 | Bacteria | 1744 |
| 761 | Ga0495680_0218264 | 3300047322 | Bacteria | 1362 |
| 762 | Ga0495675_0031940 | 3300047444 | Bacteria | 3362 |
| 763 | Ga0495675_0035175 | 3300047444 | Bacteria | 3199 |
| 764 | Ga0495675_0088711 | 3300047444 | Bacteria | 1942 |
| 765 | Ga0495684_0008153 | 3300047471 | Bacteria | 8104 |
| 766 | Ga0495684_0017391 | 3300047471 | Bacteria | 5534 |
| 767 | Ga0495684_0018808 | 3300047471 | Bacteria | 5322 |
| 768 | Ga0495684_0021849 | 3300047471 | Bacteria | 4925 |
| 769 | Ga0495684_0078056 | 3300047471 | Bacteria | 2512 |
| 770 | Ga0495684_0104786 | 3300047471 | Bacteria | 2137 |
| 771 | Ga0495593_0011104 | 3300047673 | Bacteria | 5181 |
| 772 | Ga0495593_0018869 | 3300047673 | Bacteria | 3870 |
| 773 | Ga0495593_0030932 | 3300047673 | Bacteria | 2927 |
| 774 | Ga0495602_0032954 | 3300048088 | Bacteria | 4869 |
| 775 | Ga0495602_0055085 | 3300048088 | Bacteria | 3504 |
| 776 | Ga0495602_0066205 | 3300048088 | Bacteria | 3114 |
| 777 | Ga0495602_0106935 | 3300048088 | Bacteria | 2282 |
| 778 | Ga0495614_0018641 | 3300048089 | Bacteria | 3006 |
| 779 | Ga0495614_0021494 | 3300048089 | Bacteria | 2786 |
| 780 | Ga0495626_0000116 | 3300048091 | Bacteria | 104938 |
| 781 | Ga0496100_0060510 | 3300048903 | Bacteria | 2493 |
| 782 | Ga0496100_0066842 | 3300048903 | Bacteria | 2386 |
| 783 | Ga0496100_0142289 | 3300048903 | Bacteria | 1701 |
| 784 | Ga0496101_0029589 | 3300048904 | Bacteria | 3831 |
| 785 | Ga0496101_0047796 | 3300048904 | Bacteria | 3073 |
| 786 | Ga0496102_0071383 | 3300048905 | Bacteria | 3188 |
| 787 | Ga0496102_0091815 | 3300048905 | Bacteria | 2811 |
| 788 | Ga0496102_0120118 | 3300048905 | Bacteria | 2454 |
| 789 | Ga0496102_0129343 | 3300048905 | Bacteria | 2362 |
| 790 | Ga0496103_0026783 | 3300048906 | Bacteria | 3489 |
| 791 | Ga0496103_0106662 | 3300048906 | Bacteria | 1777 |
| 792 | Ga0496104_0023870 | 3300048907 | Bacteria | 5624 |
| 793 | Ga0496104_0038270 | 3300048907 | Bacteria | 4488 |
| 794 | Ga0496104_0043775 | 3300048907 | Bacteria | 4205 |
| 795 | Ga0496104_0056957 | 3300048907 | Bacteria | 3698 |
| 796 | Ga0496104_0273895 | 3300048907 | Bacteria | 1600 |
| 797 | Ga0496105_0003718 | 3300048908 | Bacteria | 11358 |
| 798 | Ga0496105_0016938 | 3300048908 | Bacteria | 5831 |
| 799 | Ga0496105_0017370 | 3300048908 | Bacteria | 5766 |
| 800 | Ga0496105_0110097 | 3300048908 | Bacteria | 2273 |
| 801 | Ga0496106_0007783 | 3300048909 | Bacteria | 7928 |
| 802 | Ga0496106_0039672 | 3300048909 | Bacteria | 3526 |
| 803 | Ga0496106_0173381 | 3300048909 | Bacteria | 1710 |
| 804 | Ga0496106_0175660 | 3300048909 | Bacteria | 1699 |
| 805 | Ga0496107_0024004 | 3300048910 | Bacteria | 4310 |
| 806 | Ga0496108_0000019 | 3300048911 | Bacteria | 234657 |
| 807 | Ga0496108_0073796 | 3300048911 | Bacteria | 2880 |
| 808 | Ga0496108_0158454 | 3300048911 | Bacteria | 1955 |
| 809 | Ga0496108_0202754 | 3300048911 | Bacteria | 1721 |
| 810 | Ga0496108_0299137 | 3300048911 | Bacteria | 1401 |
| 811 | Ga0496108_0409849 | 3300048911 | Bacteria | 1184 |
| 812 | Ga0496109_0017888 | 3300048912 | Bacteria | 6220 |
| 813 | Ga0496109_0020481 | 3300048912 | Bacteria | 5842 |
| 814 | Ga0496109_0201000 | 3300048912 | Bacteria | 1873 |
| 815 | Ga0496109_0216369 | 3300048912 | Bacteria | 1801 |
| 816 | Ga0496110_0001540 | 3300048913 | Bacteria | 16770 |
| 817 | Ga0496110_0022279 | 3300048913 | Bacteria | 5377 |
| 818 | Ga0496110_0051948 | 3300048913 | Bacteria | 3602 |
| 819 | Ga0496110_0082705 | 3300048913 | Bacteria | 2863 |
| 820 | Ga0496110_0143069 | 3300048913 | Bacteria | 2162 |
| 821 | Ga0496110_0178736 | 3300048913 | Bacteria | 1927 |
| 822 | Ga0496111_0003334 | 3300048914 | Bacteria | 9928 |
| 823 | Ga0496111_0021617 | 3300048914 | Bacteria | 4496 |
| 824 | Ga0496111_0043828 | 3300048914 | Bacteria | 3216 |
| 825 | Ga0496111_0046373 | 3300048914 | Bacteria | 3129 |
| 826 | Ga0496111_0227413 | 3300048914 | Bacteria | 1385 |
| 827 | Ga0496112_0002106 | 3300048915 | Bacteria | 15786 |
| 828 | Ga0496112_0018658 | 3300048915 | Bacteria | 6537 |
| 829 | Ga0496112_0035356 | 3300048915 | Bacteria | 4866 |
| 830 | Ga0496113_0013661 | 3300048916 | Bacteria | 5512 |
| 831 | Ga0496113_0031326 | 3300048916 | Bacteria | 3858 |
| 832 | Ga0496113_0221462 | 3300048916 | Bacteria | 1508 |
| 833 | Ga0496113_0256892 | 3300048916 | Bacteria | 1395 |
| 834 | Ga0496113_0323940 | 3300048916 | Bacteria | 1235 |
| 835 | Ga0496114_0028738 | 3300048917 | Bacteria | 4565 |
| 836 | Ga0496114_0097947 | 3300048917 | Bacteria | 2499 |
| 837 | Ga0496115_0076563 | 3300048918 | Bacteria | 2719 |
| 838 | Ga0496115_0115165 | 3300048918 | Bacteria | 2210 |
| 839 | Ga0496119_0054393 | 3300048922 | Bacteria | 2437 |
| 840 | Ga0496126_0020690 | 3300048929 | Bacteria | 6444 |
| 841 | Ga0496126_0138305 | 3300048929 | Bacteria | 2098 |
| 842 | Ga0496126_0404357 | 3300048929 | Bacteria | 1107 |
| 843 | Ga0501043_0061450 | 3300049579 | Bacteria | 2951 |
| 844 | Ga0501046_0061723 | 3300049580 | Bacteria | 2929 |
| 845 | Ga0501081_0043759 | 3300049743 | Bacteria | 3072 |
| 846 | Ga0501045_0018148 | 3300049824 | Bacteria | 5000 |
| 847 | nmdc:mga05p37_162935_c1 | 3300050507 | Bacteria | 2723 |
| 848 | nmdc:mga05p37_263411_c1 | 3300050507 | Bacteria | 2062 |
| 849 | nmdc:mga05p37_31122_c1 | 3300050507 | Bacteria | 6517 |
| 850 | nmdc:mga05p37_3785_c1 | 3300050507 | Bacteria | 17712 |
| 851 | nmdc:mga05p37_509401_c1 | 3300050507 | Bacteria | 1379 |
| 852 | nmdc:mga09592_179467_c1 | 3300050508 | Bacteria | 1831 |
| 853 | nmdc:mga09592_62_c1 | 3300050508 | Bacteria | 60818 |
| 854 | nmdc:mga09592_9038_c1 | 3300050508 | Bacteria | 8098 |
| 855 | nmdc:mga0qj67_1407_c1 | 3300050509 | Bacteria | 16843 |
| 856 | nmdc:mga0qj67_209857_c1 | 3300050509 | Bacteria | 1582 |
| 857 | nmdc:mga0qj67_391269_c1 | 3300050509 | Bacteria | 1122 |
| 858 | nmdc:mga0qj67_6584_c1 | 3300050509 | Bacteria | 8534 |
| 859 | nmdc:mga0qj67_74169_c1 | 3300050509 | Bacteria | 2719 |
| 860 | nmdc:mga06r32_1433_c1 | 3300050510 | Bacteria | 21539 |
| 861 | nmdc:mga06r32_17514_c1 | 3300050510 | Bacteria | 6540 |
| 862 | nmdc:mga06r32_356718_c1 | 3300050510 | Bacteria | 1446 |
| 863 | nmdc:mga08y16_242660_c1 | 3300050511 | Bacteria | 1862 |
| 864 | nmdc:mga08y16_26079_c1 | 3300050511 | Bacteria | 6165 |
| 865 | nmdc:mga0n895_317576_c1 | 3300050512 | Bacteria | 1579 |
| 866 | nmdc:mga0n895_398000_c1 | 3300050512 | Bacteria | 1393 |
| 867 | nmdc:mga0n895_676030_c1 | 3300050512 | Bacteria | 1030 |
| 868 | nmdc:mga0rr50_11810_c1 | 3300050513 | Bacteria | 5609 |
| 869 | nmdc:mga0rr50_30610_c1 | 3300050513 | Bacteria | 3813 |
| 870 | nmdc:mga0rr50_52877_c1 | 3300050513 | Bacteria | 3020 |
| 871 | nmdc:mga0rr50_571866_c1 | 3300050513 | Bacteria | 963 |
| 872 | nmdc:mga08x19_4526_c1 | 3300050514 | Bacteria | 8240 |
| 873 | nmdc:mga0a205_12318_c1 | 3300050515 | Bacteria | 7909 |
| 874 | nmdc:mga0a205_16922_c1 | 3300050515 | Bacteria | 6827 |
| 875 | nmdc:mga0a205_365030_c1 | 3300050515 | Bacteria | 1310 |
| 876 | nmdc:mga0a205_61866_c1 | 3300050515 | Bacteria | 3617 |
| 877 | Ga0495601_0060185 | 3300053077 | Bacteria | 2409 |
| 878 | Ga0495601_0075230 | 3300053077 | Bacteria | 2161 |
| 879 | Ga0495601_0127975 | 3300053077 | Bacteria | 1653 |
| 880 | Ga0495612_0044601 | 3300053078 | Bacteria | 1814 |
| 881 | Ga0495595_0033403 | 3300053084 | Bacteria | 2321 |
| 882 | Ga0495595_0034668 | 3300053084 | Bacteria | 2283 |
| 883 | Ga0495619_0027468 | 3300053085 | Bacteria | 3665 |
| 884 | Ga0495619_0044520 | 3300053085 | Bacteria | 2913 |
| 885 | Ga0495619_0047213 | 3300053085 | Bacteria | 2835 |
| 886 | Ga0495619_0103511 | 3300053085 | Bacteria | 1939 |
| 887 | Ga0495619_0213170 | 3300053085 | Bacteria | 1337 |
| 888 | Ga0500644_0022687 | 3300053088 | Bacteria | 1896 |
| 889 | Ga0500569_003268 | 3300053109 | Bacteria | 3292 |
| 890 | Ga0500594_0002062 | 3300053118 | Bacteria | 4344 |
| 891 | Ga0500652_021506 | 3300053131 | Bacteria | 2431 |
| 892 | Ga0500604_0014576 | 3300053151 | Bacteria | 2142 |
| 893 | Ga0500616_0004554 | 3300053153 | Bacteria | 9816 |
| 894 | Ga0587073_0015736 | 3300059492 | Bacteria | 1369 |
| 895 | 2501945467 | 2501939600 | Bacteria | 6907073 |
| 896 | 2515495525 | 2515154088 | Bacteria | 5526283 |
| 897 | 2515720284 | 2515154129 | Bacteria | 5584369 |
| 898 | 2515755970 | 2515154137 | Bacteria | 5711575 |
| 899 | 2516084387 | 2515154202 | Bacteria | 5471270 |
| 900 | 2516089692 | 2515154203 | Bacteria | 5458536 |
| 901 | 2623585190 | 2622736626 | Bacteria | 7181580 |
| 902 | 2753272236 | 2751185782 | Bacteria | 11227053 |
| 903 | 2772645528 | 2772190715 | Bacteria | 6959372 |
| 904 | 2832010230 | 2832004796 | Bacteria | 6538017 |
| 905 | 2855673897 | 2855670206 | Bacteria | 7120389 |
| 906 | 2855679495 | 2855676851 | Bacteria | 7063653 |
| 907 | 2855688738 | 2855683550 | Bacteria | 7134265 |
| 908 | 2856859023 | 2856858025 | Bacteria | 7255264 |
| 909 | 2857289429 | 2857288857 | Bacteria | 7189066 |
| 910 | 2858851941 | 2858848962 | Bacteria | 6963058 |
| 911 | 2858887963 | 2858882152 | Bacteria | 7230291 |
| 912 | 2858895370 | 2858888857 | Bacteria | 7060307 |
| 913 | 2858900128 | 2858895516 | Bacteria | 7378898 |
| 914 | 2858902804 | 2858902515 | Bacteria | 7086037 |
| 915 | 2866068358 | 2866065130 | Bacteria | 6518152 |
| 916 | 2867306151 | 2867302475 | Bacteria | 7087181 |
| 917 | 2867323163 | 2867319477 | Bacteria | 7069771 |
| 918 | 2869051489 | 2869048445 | Bacteria | 6875584 |
| 919 | 2869067008 | 2869061728 | Bacteria | 7112407 |
| 920 | 2869071718 | 2869068681 | Bacteria | 7205615 |
| 921 | 2880495050 | 2880489317 | Bacteria | 7096270 |
| 922 | 2880497279 | 2880495981 | Bacteria | 7340502 |
| 923 | 2887486910 | 2887478801 | Bacteria | 8972725 |
| 924 | 2929225847 | 2929219909 | Bacteria | 6984360 |
| 925 | 2929231164 | 2929226422 | Bacteria | 7248583 |
| 926 | 2996222146 | 2996221748 | Bacteria | 6799777 |
| 927 | 649813016 | 649633069 | Bacteria | 6962533 |
| 928 | 8001785279 | 8001781756 | Bacteria | 9586736 |
| 929 | 8003870827 | 8003870546 | Bacteria | 7396674 |
| 930 | 8054710385 | 8054704163 | Bacteria | 7247792 |
| 931 | 8054731508 | 8054727385 | Bacteria | 7558670 |
| 932 | 8054736142 | 8054734606 | Bacteria | 6947278 |
| 933 | 8055418465 | 8055412473 | Bacteria | 6257500 |
| 934 | 8056062043 | 8056060235 | Bacteria | 7259403 |
| 935 | Ga0495606_0001354 | |||
| 936 | JGI24751J29686_10005593 | |||
| 937 | JGI25406J46586_10001930 | |||
| 938 | JGI25406J46586_10043530 | |||
| 939 | rootL2_10009411 | |||
| 940 | JGI25404J52841_10024113 | |||
| 941 | Ga0070658_10022159 | |||
| 942 | Ga0070658_10166820 | |||
| 943 | Ga0070676_10025161 | |||
| 944 | Ga0070676_10269124 | |||
| 945 | Ga0070683_100079237 | |||
| 946 | Ga0070683_100198596 | |||
| 947 | Ga0070683_100277135 | |||
| 948 | Ga0070683_100484768 | |||
| 949 | Ga0070690_100108690 | |||
| 950 | Ga0068869_100044797 | |||
| 951 | Ga0070666_10029152 | |||
| 952 | Ga0070666_10141599 | |||
| 953 | Ga0070680_100270183 | |||
| 954 | Ga0070680_100296607 | |||
| 955 | Ga0070682_100001383 | |||
| 956 | Ga0068868_100015236 | |||
| 957 | Ga0070660_100057728 | |||
| 958 | Ga0070689_100221380 | |||
| 959 | Ga0070691_10047770 | |||
| 960 | Ga0070691_10082568 | |||
| 961 | Ga0070691_10100572 | |||
| 962 | Ga0070687_100058055 | |||
| 963 | Ga0070661_100039242 | |||
| 964 | Ga0070668_100002088 | |||
| 965 | Ga0070668_100162646 | |||
| 966 | Ga0070669_100158943 | |||
| 967 | Ga0070675_100012505 | |||
| 968 | Ga0070671_100003212 | |||
| 969 | Ga0070671_100118916 | |||
| 970 | Ga0070671_100345265 | |||
| 971 | Ga0070674_100166770 | |||
| 972 | Ga0070673_100103833 | |||
| 973 | Ga0070673_100802550 | |||
| 974 | Ga0070688_100171172 | |||
| 975 | Ga0070659_100167668 | |||
| 976 | Ga0070667_100361439 | |||
| 977 | Ga0070709_10005585 | |||
| 978 | Ga0070709_10013118 | |||
| 979 | Ga0070709_10020792 | |||
| 980 | Ga0070709_10416908 | |||
| 981 | Ga0070709_10427722 | |||
| 982 | Ga0070714_100000241 | |||
| 983 | Ga0070714_100001408 | |||
| 984 | Ga0070714_100017345 | |||
| 985 | Ga0070714_100179800 | |||
| 986 | Ga0070713_100017737 | |||
| 987 | Ga0070713_100028459 | |||
| 988 | Ga0070713_100095336 | |||
| 989 | Ga0070713_100177665 | |||
| 990 | Ga0070713_100352547 | |||
| 991 | Ga0070710_10043408 | |||
| 992 | Ga0070710_10118384 | |||
| 993 | Ga0070701_10036294 | |||
| 994 | Ga0070701_10038602 | |||
| 995 | Ga0070711_100037656 | |||
| 996 | Ga0070711_100052032 | |||
| 997 | Ga0070711_100157095 | |||
| 998 | Ga0070711_100181203 | |||
| 999 | Ga0070711_100192828 | |||
| 1000 | Ga0070711_100260195 | |||
| 1001 | Ga0070705_100062618 | |||
| 1002 | Ga0070700_100042188 | |||
| 1003 | Ga0070694_100052088 | |||
| 1004 | Ga0070708_100176822 | |||
| 1005 | Ga0070663_100010629 | |||
| 1006 | Ga0070663_100036070 | |||
| 1007 | Ga0070663_100332357 | |||
| 1008 | Ga0070663_100436160 | |||
| 1009 | Ga0070678_100143587 | |||
| 1010 | Ga0070678_100402776 | |||
| 1011 | Ga0070681_10006696 | |||
| 1012 | Ga0070681_10033020 | |||
| 1013 | Ga0070681_10080851 | |||
| 1014 | Ga0068867_100493125 | |||
| 1015 | Ga0070706_100015280 | |||
| 1016 | Ga0070706_100200598 | |||
| 1017 | Ga0070707_100012139 | |||
| 1018 | Ga0070698_100001093 | |||
| 1019 | Ga0070698_100004321 | |||
| 1020 | Ga0070698_100036536 | |||
| 1021 | Ga0070698_100074116 | |||
| 1022 | Ga0070699_100335904 | |||
| 1023 | Ga0070679_100067907 | |||
| 1024 | Ga0070684_100036900 | |||
| 1025 | Ga0070684_100063933 | |||
| 1026 | Ga0070684_100069485 | |||
| 1027 | Ga0070697_100011045 | |||
| 1028 | Ga0070697_100182251 | |||
| 1029 | Ga0070697_100308991 | |||
| 1030 | Ga0068853_100061332 | |||
| 1031 | Ga0068853_100312281 | |||
| 1032 | Ga0070672_100091873 | |||
| 1033 | Ga0070686_100078946 | |||
| 1034 | Ga0070695_100246443 | |||
| 1035 | Ga0070696_100037527 | |||
| 1036 | Ga0070696_100090801 | |||
| 1037 | Ga0070693_100000312 | |||
| 1038 | Ga0070693_100085068 | |||
| 1039 | Ga0070665_100080607 | |||
| 1040 | Ga0070665_100111058 | |||
| 1041 | Ga0070665_100153500 | |||
| 1042 | Ga0070665_100453265 | |||
| 1043 | Ga0070704_100498604 | |||
| 1044 | Ga0068855_100004544 | |||
| 1045 | Ga0068855_100061299 | |||
| 1046 | Ga0068855_100190945 | |||
| 1047 | Ga0068855_100201719 | |||
| 1048 | Ga0068855_100306487 | |||
| 1049 | Ga0070664_100099016 | |||
| 1050 | Ga0068857_100069826 | |||
| 1051 | Ga0068857_100145969 | |||
| 1052 | Ga0068854_100067344 | |||
| 1053 | Ga0068856_100238557 | |||
| 1054 | Ga0068856_100412226 | |||
| 1055 | Ga0070702_100000170 | |||
| 1056 | Ga0070702_100014942 | |||
| 1057 | Ga0068852_100012422 | |||
| 1058 | Ga0068852_100401464 | |||
| 1059 | Ga0068859_100065132 | |||
| 1060 | Ga0068859_100091690 | |||
| 1061 | Ga0068859_100377677 | |||
| 1062 | Ga0068864_100003646 | |||
| 1063 | Ga0068864_100189888 | |||
| 1064 | Ga0068864_100384004 | |||
| 1065 | Ga0068864_100444756 | |||
| 1066 | Ga0068866_10068389 | |||
| 1067 | Ga0068861_100106971 | |||
| 1068 | Ga0068861_100319769 | |||
| 1069 | Ga0068851_10024989 | |||
| 1070 | Ga0068870_10001077 | |||
| 1071 | Ga0068870_10229878 | |||
| 1072 | Ga0068863_100008790 | |||
| 1073 | Ga0068863_100031057 | |||
| 1074 | Ga0068863_100037714 | |||
| 1075 | Ga0068863_100091883 | |||
| 1076 | Ga0068863_100266623 | |||
| 1077 | Ga0068863_100305567 | |||
| 1078 | Ga0068863_100753901 | |||
| 1079 | Ga0068858_100028228 | |||
| 1080 | Ga0068858_100092053 | |||
| 1081 | Ga0068858_100152083 | |||
| 1082 | Ga0068860_100103529 | |||
| 1083 | Ga0068860_100428845 | |||
| 1084 | Ga0068862_100030107 | |||
| 1085 | Ga0081540_1000097 | |||
| 1086 | Ga0081540_1013035 | |||
| 1087 | Ga0081540_1071784 | |||
| 1088 | Ga0081540_1118498 | |||
| 1089 | Ga0081539_10000362 | |||
| 1090 | Ga0081539_10000717 | |||
| 1091 | Ga0081539_10003779 | |||
| 1092 | Ga0081539_10008025 | |||
| 1093 | Ga0081539_10018199 | |||
| 1094 | Ga0070717_10013206 | |||
| 1095 | Ga0070717_10020853 | |||
| 1096 | Ga0070717_10044157 | |||
| 1097 | Ga0070717_10050070 | |||
| 1098 | Ga0070717_10173178 | |||
| 1099 | Ga0070717_10579219 | |||
| 1100 | Ga0075432_10070917 | |||
| 1101 | Ga0070715_10067132 | |||
| 1102 | Ga0070715_10070915 | |||
| 1103 | Ga0070715_10100774 | |||
| 1104 | Ga0070715_10262595 | |||
| 1105 | Ga0070716_100004930 | |||
| 1106 | Ga0070716_100012743 | |||
| 1107 | Ga0070716_100080197 | |||
| 1108 | Ga0070716_100181962 | |||
| 1109 | Ga0070712_100016169 | |||
| 1110 | Ga0070712_100054161 | |||
| 1111 | Ga0070712_100083229 | |||
| 1112 | Ga0097621_100026472 | |||
| 1113 | Ga0097621_100037503 | |||
| 1114 | Ga0097621_100530504 | |||
| 1115 | Ga0068871_100133340 | |||
| 1116 | Ga0068871_100268267 | |||
| 1117 | Ga0075428_100000285 | |||
| 1118 | Ga0075428_100001086 | |||
| 1119 | Ga0075428_100295248 | |||
| 1120 | Ga0075428_100320786 | |||
| 1121 | Ga0075430_100011110 | |||
| 1122 | Ga0075430_100018929 | |||
| 1123 | Ga0075431_100010461 | |||
| 1124 | Ga0075431_100039635 | |||
| 1125 | Ga0075431_100071337 | |||
| 1126 | Ga0075431_100446959 | |||
| 1127 | Ga0075433_10015321 | |||
| 1128 | Ga0075433_10026693 | |||
| 1129 | Ga0075433_10051383 | |||
| 1130 | Ga0075433_10162875 | |||
| 1131 | Ga0075434_100074892 | |||
| 1132 | Ga0075434_100143855 | |||
| 1133 | Ga0075429_100011961 | |||
| 1134 | Ga0075436_100046516 | |||
| 1135 | Ga0075436_100062594 | |||
| 1136 | Ga0097620_100065132 | |||
| 1137 | Ga0097620_100091682 | |||
| 1138 | Ga0097620_100377657 | |||
| 1139 | Ga0075435_100036424 | |||
| 1140 | Ga0075435_100658089 | |||
| 1141 | Ga0105251_10035236 | |||
| 1142 | Ga0105240_10096263 | |||
| 1143 | Ga0105240_10132202 | |||
| 1144 | Ga0105240_10175492 | |||
| 1145 | Ga0111539_10301104 | |||
| 1146 | Ga0111539_11082833 | |||
| 1147 | Ga0105245_10038978 | |||
| 1148 | Ga0105245_10395074 | |||
| 1149 | Ga0105247_10002988 | |||
| 1150 | Ga0105247_10023763 | |||
| 1151 | Ga0105247_10113109 | |||
| 1152 | Ga0105247_10118037 | |||
| 1153 | Ga0114129_10000585 | |||
| 1154 | Ga0114129_10001404 | |||
| 1155 | Ga0114129_10020050 | |||
| 1156 | Ga0114129_10169304 | |||
| 1157 | Ga0114129_10247729 | |||
| 1158 | Ga0114129_10380441 | |||
| 1159 | Ga0114129_10502901 | |||
| 1160 | Ga0105243_10367277 | |||
| 1161 | Ga0105241_10056186 | |||
| 1162 | Ga0105241_10096145 | |||
| 1163 | Ga0105248_10009836 | |||
| 1164 | Ga0105248_10030112 | |||
| 1165 | Ga0105248_10220471 | |||
| 1166 | Ga0105248_10365179 | |||
| 1167 | Ga0105248_10408363 | |||
| 1168 | Ga0105238_10139918 | |||
| 1169 | Ga0105238_10153501 | |||
| 1170 | Ga0105238_10289739 | |||
| 1171 | Ga0105239_10470371 | |||
| 1172 | Ga0105239_10550717 | |||
| 1173 | Ga0105246_10009862 | |||
| 1174 | Ga0105246_10031721 | |||
| 1175 | Ga0105246_10304781 | |||
| 1176 | Ga0157346_1003394 | |||
| 1177 | Ga0157335_1002624 | |||
| 1178 | Ga0157341_1000300 | |||
| 1179 | Ga0157373_10039274 | |||
| 1180 | Ga0157373_10113560 | |||
| 1181 | Ga0157371_10170664 | |||
| 1182 | Ga0157370_10227721 | |||
| 1183 | Ga0157369_10036634 | |||
| 1184 | Ga0157369_10123499 | |||
| 1185 | Ga0157369_10300238 | |||
| 1186 | Ga0157369_10312716 | |||
| 1187 | Ga0157374_10143396 | |||
| 1188 | Ga0157378_10292443 | |||
| 1189 | Ga0163162_10224648 | |||
| 1190 | Ga0163162_10369275 | |||
| 1191 | Ga0157372_10018413 | |||
| 1192 | Ga0157372_10181727 | |||
| 1193 | Ga0157372_10533262 | |||
| 1194 | Ga0157375_10033480 | |||
| 1195 | Ga0157375_10474650 | |||
| 1196 | Ga0163163_10005527 | |||
| 1197 | Ga0163163_10066983 | |||
| 1198 | Ga0163163_10084893 | |||
| 1199 | Ga0163163_10085666 | |||
| 1200 | Ga0163163_10233703 | |||
| 1201 | Ga0157380_10049550 | |||
| 1202 | Ga0157380_10071988 | |||
| 1203 | Ga0182008_10111921 | |||
| 1204 | Ga0157377_10029761 | |||
| 1205 | Ga0157377_10068253 | |||
| 1206 | Ga0157379_10046736 | |||
| 1207 | Ga0157379_10609083 | |||
| 1208 | Ga0157376_10028563 | |||
| 1209 | Ga0157376_10238907 | |||
| 1210 | Ga0157376_10712627 | |||
| 1211 | Ga0163161_10040904 | |||
| 1212 | Ga0197907_10762344 | |||
| 1213 | Ga0197907_11015168 | |||
| 1214 | Ga0206356_10405628 | |||
| 1215 | Ga0206356_10489382 | |||
| 1216 | Ga0206356_10723889 | |||
| 1217 | Ga0206356_10728356 | |||
| 1218 | Ga0206355_1368205 | |||
| 1219 | Ga0206355_1397913 | |||
| 1220 | Ga0206351_10506233 | |||
| 1221 | Ga0206350_10116847 | |||
| 1222 | Ga0206350_10544556 | |||
| 1223 | Ga0206350_11470673 | |||
| 1224 | Ga0206354_10072260 | |||
| 1225 | Ga0206354_11430440 | |||
| 1226 | Ga0206353_10430671 | |||
| 1227 | Ga0206353_10653977 | |||
| 1228 | Ga0213876_10001874 | |||
| 1229 | Ga0213875_10000781 | |||
| 1230 | Ga0224712_10104987 | |||
| 1231 | Ga0224712_10139492 | |||
| 1232 | Ga0224712_10150291 | |||
| 1233 | Ga0207656_10034157 | |||
| 1234 | Ga0207713_1050646 | |||
| 1235 | Ga0207713_1060396 | |||
| 1236 | Ga0207653_10030488 | |||
| 1237 | Ga0207692_10022951 | |||
| 1238 | Ga0207692_10033058 | |||
| 1239 | Ga0207692_10040234 | |||
| 1240 | Ga0207692_10073282 | |||
| 1241 | Ga0207710_10021043 | |||
| 1242 | Ga0207710_10058324 | |||
| 1243 | Ga0207688_10007394 | |||
| 1244 | Ga0207688_10007902 | |||
| 1245 | Ga0207688_10248991 | |||
| 1246 | Ga0207680_10040798 | |||
| 1247 | Ga0207647_10169197 | |||
| 1248 | Ga0207685_10039708 | |||
| 1249 | Ga0207699_10003669 | |||
| 1250 | Ga0207699_10004669 | |||
| 1251 | Ga0207699_10019293 | |||
| 1252 | Ga0207699_10098857 | |||
| 1253 | Ga0207699_10132956 | |||
| 1254 | Ga0207699_10137033 | |||
| 1255 | Ga0207699_10220016 | |||
| 1256 | Ga0207699_10270608 | |||
| 1257 | Ga0207645_10105047 | |||
| 1258 | Ga0207643_10000062 | |||
| 1259 | Ga0207705_10018746 | |||
| 1260 | Ga0207705_10172805 | |||
| 1261 | Ga0207684_10009273 | |||
| 1262 | Ga0207684_10080045 | |||
| 1263 | Ga0207654_10009696 | |||
| 1264 | Ga0207654_10197261 | |||
| 1265 | Ga0207707_10009697 | |||
| 1266 | Ga0207707_10147957 | |||
| 1267 | Ga0207707_10223166 | |||
| 1268 | Ga0207695_10151778 | |||
| 1269 | Ga0207695_10245111 | |||
| 1270 | Ga0207671_10030740 | |||
| 1271 | Ga0207671_10220119 | |||
| 1272 | Ga0207693_10024639 | |||
| 1273 | Ga0207693_10155645 | |||
| 1274 | Ga0207663_10012326 | |||
| 1275 | Ga0207663_10038321 | |||
| 1276 | Ga0207663_10061230 | |||
| 1277 | Ga0207663_10135441 | |||
| 1278 | Ga0207663_10182722 | |||
| 1279 | Ga0207663_10290786 | |||
| 1280 | Ga0207660_10002954 | |||
| 1281 | Ga0207662_10016531 | |||
| 1282 | Ga0207662_10032585 | |||
| 1283 | Ga0207657_10003435 | |||
| 1284 | Ga0207657_10042175 | |||
| 1285 | Ga0207649_10023459 | |||
| 1286 | Ga0207652_10014743 | |||
| 1287 | Ga0207652_10015959 | |||
| 1288 | Ga0207646_10006542 | |||
| 1289 | Ga0207646_10016172 | |||
| 1290 | Ga0207646_10029899 | |||
| 1291 | Ga0207681_10102720 | |||
| 1292 | Ga0207681_10206640 | |||
| 1293 | Ga0207694_10180105 | |||
| 1294 | Ga0207650_10008989 | |||
| 1295 | Ga0207659_10043962 | |||
| 1296 | Ga0207687_10120646 | |||
| 1297 | Ga0207687_10148187 | |||
| 1298 | Ga0207700_10003757 | |||
| 1299 | Ga0207700_10003804 | |||
| 1300 | Ga0207700_10012466 | |||
| 1301 | Ga0207700_10020572 | |||
| 1302 | Ga0207700_10064383 | |||
| 1303 | Ga0207700_10070758 | |||
| 1304 | Ga0207700_10071822 | |||
| 1305 | Ga0207700_10152645 | |||
| 1306 | Ga0207700_10499220 | |||
| 1307 | Ga0207664_10000171 | |||
| 1308 | Ga0207664_10006127 | |||
| 1309 | Ga0207664_10063189 | |||
| 1310 | Ga0207664_10066010 | |||
| 1311 | Ga0207664_10130710 | |||
| 1312 | Ga0207664_10177209 | |||
| 1313 | Ga0207664_10187700 | |||
| 1314 | Ga0207664_10194628 | |||
| 1315 | Ga0207644_10008563 | |||
| 1316 | Ga0207644_10220983 | |||
| 1317 | Ga0207644_10234310 | |||
| 1318 | Ga0207644_10260818 | |||
| 1319 | Ga0207644_10297315 | |||
| 1320 | Ga0207690_10111096 | |||
| 1321 | Ga0207706_10033968 | |||
| 1322 | Ga0207706_10383004 | |||
| 1323 | Ga0207709_10082602 | |||
| 1324 | Ga0207670_10011841 | |||
| 1325 | Ga0207670_10211328 | |||
| 1326 | Ga0207704_10086544 | |||
| 1327 | Ga0207665_10002702 | |||
| 1328 | Ga0207665_10017100 | |||
| 1329 | Ga0207665_10023353 | |||
| 1330 | Ga0207665_10094888 | |||
| 1331 | Ga0207665_10140297 | |||
| 1332 | Ga0207691_10077602 | |||
| 1333 | Ga0207711_10027183 | |||
| 1334 | Ga0207711_10037065 | |||
| 1335 | Ga0207711_10173550 | |||
| 1336 | Ga0207711_10180498 | |||
| 1337 | Ga0207711_10221171 | |||
| 1338 | Ga0207689_10002952 | |||
| 1339 | Ga0207689_10025596 | |||
| 1340 | Ga0207689_10152742 | |||
| 1341 | Ga0207661_10008496 | |||
| 1342 | Ga0207661_10055821 | |||
| 1343 | Ga0207661_10293647 | |||
| 1344 | Ga0207661_10588014 | |||
| 1345 | Ga0207679_10000826 | |||
| 1346 | Ga0207679_10058132 | |||
| 1347 | Ga0207679_10064875 | |||
| 1348 | Ga0207679_10171473 | |||
| 1349 | Ga0207667_10024240 | |||
| 1350 | Ga0207667_10398985 | |||
| 1351 | Ga0207668_10013862 | |||
| 1352 | Ga0207668_10348923 | |||
| 1353 | Ga0207668_10397576 | |||
| 1354 | Ga0207658_10100687 | |||
| 1355 | Ga0207658_10322334 | |||
| 1356 | Ga0207677_10028617 | |||
| 1357 | Ga0207677_10183556 | |||
| 1358 | Ga0207677_10199777 | |||
| 1359 | Ga0207703_10011442 | |||
| 1360 | Ga0207703_10084387 | |||
| 1361 | Ga0207703_10155232 | |||
| 1362 | Ga0207703_10362963 | |||
| 1363 | Ga0207639_10092005 | |||
| 1364 | Ga0207639_10140916 | |||
| 1365 | Ga0207639_10157404 | |||
| 1366 | Ga0207678_10000510 | |||
| 1367 | Ga0207678_10028460 | |||
| 1368 | Ga0207678_10042446 | |||
| 1369 | Ga0207678_10571972 | |||
| 1370 | Ga0207708_10017836 | |||
| 1371 | Ga0207708_10033271 | |||
| 1372 | Ga0207702_10012078 | |||
| 1373 | Ga0207702_10013722 | |||
| 1374 | Ga0207702_10018909 | |||
| 1375 | Ga0207702_10019774 | |||
| 1376 | Ga0207702_10106123 | |||
| 1377 | Ga0207641_10013718 | |||
| 1378 | Ga0207641_10024995 | |||
| 1379 | Ga0207641_10040646 | |||
| 1380 | Ga0207641_10084564 | |||
| 1381 | Ga0207641_10132404 | |||
| 1382 | Ga0207641_10283187 | |||
| 1383 | Ga0207648_10210422 | |||
| 1384 | Ga0207676_10001571 | |||
| 1385 | Ga0207676_10013516 | |||
| 1386 | Ga0207676_10108732 | |||
| 1387 | Ga0207676_10134752 | |||
| 1388 | Ga0207676_10213943 | |||
| 1389 | Ga0207674_10004920 | |||
| 1390 | Ga0207674_10005169 | |||
| 1391 | Ga0207674_10042275 | |||
| 1392 | Ga0207674_10065447 | |||
| 1393 | Ga0207675_100296946 | |||
| 1394 | Ga0207683_10000214 | |||
| 1395 | Ga0207683_10185636 | |||
| 1396 | Ga0207698_10059237 | |||
| 1397 | Ga0207698_10133347 | |||
| 1398 | Ga0207698_10218808 | |||
| 1399 | Ga0207428_10001830 | |||
| 1400 | Ga0207428_10217547 | |||
| 1401 | Ga0268266_10025741 | |||
| 1402 | Ga0268266_10159713 | |||
| 1403 | Ga0268266_10296479 | |||
| 1404 | Ga0268266_10357724 | |||
| 1405 | Ga0268266_10412019 | |||
| 1406 | Ga0268265_10159519 | |||
| 1407 | Ga0268265_10237713 | |||
| 1408 | Ga0268264_10032660 | |||
| 1409 | Ga0265337_1003185 | |||
| 1410 | Ga0265326_10001914 | |||
| 1411 | Ga0265319_1000682 | |||
| 1412 | Ga0265334_10000160 | |||
| 1413 | Ga0265318_10037650 | |||
| 1414 | Ga0265323_10004706 | |||
| 1415 | Ga0265322_10007027 | |||
| 1416 | Ga0265336_10003919 | |||
| 1417 | Ga0265336_10007367 | |||
| 1418 | Ga0307515_10000119 | |||
| 1419 | Ga0307515_10105711 | |||
| 1420 | Ga0265338_10000148 | |||
| 1421 | Ga0265338_10033277 | |||
| 1422 | Ga0265338_10082736 | |||
| 1423 | Ga0265338_10093736 | |||
| 1424 | Ga0265324_10035197 | |||
| 1425 | Ga0307512_10003144 | |||
| 1426 | Ga0307512_10145633 | |||
| 1427 | Ga0265760_10020983 | |||
| 1428 | Ga0265332_10000443 | |||
| 1429 | Ga0265320_10001651 | |||
| 1430 | Ga0265320_10079171 | |||
| 1431 | Ga0265325_10002380 | |||
| 1432 | Ga0265325_10017046 | |||
| 1433 | Ga0265340_10018256 | |||
| 1434 | Ga0265339_10009430 | |||
| 1435 | Ga0265339_10113975 | |||
| 1436 | Ga0265316_10126499 | |||
| 1437 | Ga0307513_10007579 | |||
| 1438 | Ga0307509_10017954 | |||
| 1439 | Ga0265313_10043819 | |||
| 1440 | Ga0307508_10134404 | |||
| 1441 | Ga0265314_10005926 | |||
| 1442 | Ga0265314_10059181 | |||
| 1443 | Ga0265342_10003642 | |||
| 1444 | Ga0307516_10000149 | |||
| 1445 | Ga0307516_10039888 | |||
| 1446 | Ga0307516_10061367 | |||
| 1447 | Ga0307405_10465876 | |||
| 1448 | Ga0307413_10027446 | |||
| 1449 | Ga0307413_10250284 | |||
| 1450 | Ga0307410_10038849 | |||
| 1451 | Ga0307410_10297849 | |||
| 1452 | Ga0307406_10008662 | |||
| 1453 | Ga0307406_10530278 | |||
| 1454 | Ga0307407_10037722 | |||
| 1455 | Ga0307409_100003817 | |||
| 1456 | Ga0307409_100444259 | |||
| 1457 | Ga0307409_100738338 | |||
| 1458 | Ga0307416_100005302 | |||
| 1459 | Ga0307411_10257437 | |||
| 1460 | Ga0307415_100027971 | |||
| 1461 | Ga0307415_100378280 | |||
| 1462 | Ga0307415_100556073 | |||
| 1463 | Ga0307415_100783391 | |||
| 1464 | Ga0307507_10172226 | |||
| 1465 | Ga0307510_10163330 | |||
| 1466 | Ga0307510_10257558 | |||
| 1467 | Ga0373959_0012000 | |||
| 1468 | Ga0373938_0003442 | |||
| 1469 | Ga0373938_0005082 | |||
| 1470 | Ga0373926_0000466 | |||
| 1471 | Ga0373926_0009931 | |||
| 1472 | Ga0373926_0032655 | |||
| 1473 | Ga0373926_0055287 | |||
| 1474 | Ga0373934_0002514 | |||
| 1475 | Ga0373934_0014637 | |||
| 1476 | Ga0373940_0000286 | |||
| 1477 | Ga0373944_0013974 | |||
| 1478 | Ga0373944_0048034 | |||
| 1479 | Ga0373949_0010190 | |||
| 1480 | Ga0373951_0026521 | |||
| 1481 | Ga0373952_0021185 | |||
| 1482 | Ga0373923_0006829 | |||
| 1483 | Ga0373923_0021375 | |||
| 1484 | Ga0373923_0034499 | |||
| 1485 | Ga0373932_0060220 | |||
| 1486 | Ga0373936_0001343 | |||
| 1487 | Ga0373936_0111602 | |||
| 1488 | Ga0373939_0002004 | |||
| 1489 | Ga0373939_0081131 | |||
| 1490 | Ga0373953_0003568 | |||
| 1491 | Ga0373953_0007432 | |||
| 1492 | Ga0373953_0065435 | |||
| 1493 | Ga0373953_0084343 | |||
| 1494 | Ga0373954_0153785 | |||
| 1495 | Ga0373956_0014216 | |||
| 1496 | Ga0373956_0017767 | |||
| 1497 | Ga0373956_0034899 | |||
| 1498 | Ga0373957_0004472 | |||
| 1499 | Ga0373957_0037853 | |||
| 1500 | Ga0373957_0072743 | |||
| 1501 | Ga0373960_0011533 | |||
| 1502 | Ga0373960_0081321 | |||
| 1503 | Ga0373943_0025333 | |||
| 1504 | Ga0373943_0083906 | |||
| 1505 | Ga0373943_0110995 | |||
| 1506 | Ga0373946_0004755 | |||
| 1507 | Ga0373946_0030978 | |||
| 1508 | Ga0373955_0004742 | |||
| 1509 | Ga0373955_0007371 | |||
| 1510 | Ga0373955_0010229 | |||
| 1511 | Ga0373942_0000185 | |||
| 1512 | Ga0373942_0042310 | |||
| 1513 | Ga0373961_0048573 | |||
| 1514 | Ga0373961_0058268 | |||
| 1515 | Ga0373961_0096467 | |||
| 1516 | Ga0373962_0004291 | |||
| 1517 | Ga0373962_0005163 | |||
| 1518 | Ga0373924_0004136 | |||
| 1519 | Ga0373924_0007133 | |||
| 1520 | Ga0373931_0242268 | |||
| 1521 | Ga0373931_0401899 | |||
| 1522 | Ga0373935_0066945 | |||
| 1523 | Ga0373927_0016941 | |||
| 1524 | Ga0373927_0066901 | |||
| 1525 | Ga0373927_0203365 | |||
| 1526 | Ga0373933_0001929 | |||
| 1527 | Ga0373933_0014478 | |||
| 1528 | Ga0373947_0001176 | |||
| 1529 | Ga0373947_0128877 | |||
| 1530 | Ga0373947_0148253 | |||
| 1531 | Ga0373947_0211998 | |||
| 1532 | Ga0373937_0008996 | |||
| 1533 | Ga0373937_0022290 | |||
| 1534 | Ga0373937_0046720 | |||
| 1535 | Ga0373937_0543095 | |||
| 1536 | Ga0310109_008703 | |||
| 1537 | Ga0373925_0000004 | |||
| 1538 | Ga0373925_0013204 | |||
| 1539 | Ga0373925_0117981 | |||
| 1540 | Ga0373925_0174663 | |||
| 1541 | Ga0373925_0641181 | |||
| 1542 | Ga0395900_0001388 | |||
| 1543 | Ga0395900_0604213 | |||
| 1544 | Ga0395898_0007474 | |||
| 1545 | Ga0395898_0205064 | |||
| 1546 | Ga0395898_0441644 | |||
| 1547 | Ga0395905_0001885 | |||
| 1548 | Ga0395905_0584492 | |||
| 1549 | Ga0436364_0213102 | |||
| 1550 | Ga0436364_0969684 | |||
| 1551 | Ga0436364_1133930 | |||
| 1552 | Ga0436364_1202907 | |||
| 1553 | Ga0436364_1377900 | |||
| 1554 | Ga0395901_0001402 | |||
| 1555 | Ga0395901_0026591 | |||
| 1556 | Ga0436365_0567091 | |||
| 1557 | Ga0436360_0972388 | |||
| 1558 | Ga0436362_0612140 | |||
| 1559 | Ga0436362_0804513 | |||
| 1560 | Ga0451839_1201347 | |||
| 1561 | Ga0451839_1338288 | |||
| 1562 | Ga0451843_0226282 | |||
| 1563 | Ga0451853_2299179 | |||
| 1564 | Ga0439463_006694 | |||
| 1565 | Ga0450902_016570 | |||
| 1566 | Ga0439459_0032767 | |||
| 1567 | Ga0466961_0172666 | |||
| 1568 | Ga0466963_0041711 | |||
| 1569 | Ga0466963_0169609 | |||
| 1570 | Ga0466963_0423629 | |||
| 1571 | Ga0466971_0026957 | |||
| 1572 | Ga0466960_0233682 | |||
| 1573 | Ga0466959_0022068 | |||
| 1574 | Ga0466959_0302947 | |||
| 1575 | Ga0466958_0213137 | |||
| 1576 | Ga0466967_0201516 | |||
| 1577 | Ga0466967_0298639 | |||
| 1578 | Ga0495592_0026164 | |||
| 1579 | Ga0495592_0071886 | |||
| 1580 | Ga0495592_0126054 | |||
| 1581 | Ga0495603_0011218 | |||
| 1582 | Ga0495603_0124763 | |||
| 1583 | Ga0495629_0014806 | |||
| 1584 | Ga0495629_0015166 | |||
| 1585 | Ga0495629_0028216 | |||
| 1586 | Ga0495629_0035347 | |||
| 1587 | Ga0495629_0040318 | |||
| 1588 | Ga0495629_0306855 | |||
| 1589 | Ga0495641_0003281 | |||
| 1590 | Ga0495641_0009096 | |||
| 1591 | Ga0495641_0093238 | |||
| 1592 | Ga0495641_0106403 | |||
| 1593 | Ga0495651_0015262 | |||
| 1594 | Ga0495651_0039521 | |||
| 1595 | Ga0495651_0048192 | |||
| 1596 | Ga0495651_0078960 | |||
| 1597 | Ga0495653_0029952 | |||
| 1598 | Ga0495653_0032685 | |||
| 1599 | Ga0495653_0121735 | |||
| 1600 | Ga0495653_0229116 | |||
| 1601 | Ga0495580_0034108 | |||
| 1602 | Ga0495580_0203229 | |||
| 1603 | Ga0495582_0002234 | |||
| 1604 | Ga0495582_0181712 | |||
| 1605 | Ga0495639_0110612 | |||
| 1606 | Ga0495662_0047270 | |||
| 1607 | Ga0495662_0084117 | |||
| 1608 | Ga0495662_0130515 | |||
| 1609 | Ga0495662_0132884 | |||
| 1610 | Ga0495664_0029985 | |||
| 1611 | Ga0495594_0216769 | |||
| 1612 | Ga0495608_0007212 | |||
| 1613 | Ga0495608_0020244 | |||
| 1614 | Ga0495608_0037080 | |||
| 1615 | Ga0495608_0073934 | |||
| 1616 | Ga0495618_0045409 | |||
| 1617 | Ga0495618_0058898 | |||
| 1618 | Ga0495618_0256209 | |||
| 1619 | Ga0495628_0037878 | |||
| 1620 | Ga0495630_0016178 | |||
| 1621 | Ga0495630_0085626 | |||
| 1622 | Ga0495630_0131286 | |||
| 1623 | Ga0495666_0068227 | |||
| 1624 | Ga0495652_0031017 | |||
| 1625 | Ga0495665_0007819 | |||
| 1626 | Ga0495665_0017421 | |||
| 1627 | Ga0495640_0016525 | |||
| 1628 | Ga0495640_0023697 | |||
| 1629 | Ga0495640_0210164 | |||
| 1630 | Ga0495586_0035950 | |||
| 1631 | Ga0495586_0053286 | |||
| 1632 | Ga0495587_0000622 | |||
| 1633 | Ga0495587_0016344 | |||
| 1634 | Ga0495587_0016487 | |||
| 1635 | Ga0495645_0020301 | |||
| 1636 | Ga0495645_0048532 | |||
| 1637 | Ga0495645_0083738 | |||
| 1638 | Ga0495622_0075444 | |||
| 1639 | Ga0495667_0022172 | |||
| 1640 | Ga0495667_0024735 | |||
| 1641 | Ga0495667_0032505 | |||
| 1642 | Ga0495667_0270609 | |||
| 1643 | Ga0495668_0000872 | |||
| 1644 | Ga0495634_0002233 | |||
| 1645 | Ga0495634_0010992 | |||
| 1646 | Ga0495634_0018939 | |||
| 1647 | Ga0495634_0037425 | |||
| 1648 | Ga0495625_0001540 | |||
| 1649 | Ga0495635_0009496 | |||
| 1650 | Ga0495635_0017916 | |||
| 1651 | Ga0495635_0018484 | |||
| 1652 | Ga0495588_0049893 | |||
| 1653 | Ga0495588_0059107 | |||
| 1654 | Ga0495657_0008676 | |||
| 1655 | Ga0495657_0012224 | |||
| 1656 | Ga0495657_0018394 | |||
| 1657 | Ga0495657_0051922 | |||
| 1658 | Ga0495599_0002361 | |||
| 1659 | Ga0495599_0033234 | |||
| 1660 | Ga0495599_0059564 | |||
| 1661 | Ga0495623_0076976 | |||
| 1662 | Ga0495646_0006386 | |||
| 1663 | Ga0495646_0039563 | |||
| 1664 | Ga0495646_0045559 | |||
| 1665 | Ga0495646_0261457 | |||
| 1666 | Ga0495647_0003697 | |||
| 1667 | Ga0495658_0002971 | |||
| 1668 | Ga0495658_0003148 | |||
| 1669 | Ga0495658_0223885 | |||
| 1670 | Ga0495613_0011502 | |||
| 1671 | Ga0495613_0031106 | |||
| 1672 | Ga0495613_0032336 | |||
| 1673 | Ga0495624_0030464 | |||
| 1674 | Ga0495624_0037702 | |||
| 1675 | Ga0495624_0049971 | |||
| 1676 | Ga0495600_0099022 | |||
| 1677 | Ga0495600_0131570 | |||
| 1678 | Ga0495600_0193721 | |||
| 1679 | Ga0495600_0304710 | |||
| 1680 | Ga0495581_0006889 | |||
| 1681 | Ga0495581_0010234 | |||
| 1682 | Ga0495604_0012891 | |||
| 1683 | Ga0495604_0019147 | |||
| 1684 | Ga0495604_0187039 | |||
| 1685 | Ga0495674_0029900 | |||
| 1686 | Ga0495674_0073050 | |||
| 1687 | Ga0495674_0091846 | |||
| 1688 | Ga0495674_0123745 | |||
| 1689 | Ga0495680_0015432 | |||
| 1690 | Ga0495680_0062167 | |||
| 1691 | Ga0495680_0063309 | |||
| 1692 | Ga0495680_0078152 | |||
| 1693 | Ga0495680_0086308 | |||
| 1694 | Ga0495680_0143642 | |||
| 1695 | Ga0495680_0218264 | |||
| 1696 | Ga0495675_0031940 | |||
| 1697 | Ga0495675_0035175 | |||
| 1698 | Ga0495675_0088711 | |||
| 1699 | Ga0495684_0008153 | |||
| 1700 | Ga0495684_0017391 | |||
| 1701 | Ga0495684_0018808 | |||
| 1702 | Ga0495684_0021849 | |||
| 1703 | Ga0495684_0078056 | |||
| 1704 | Ga0495684_0104786 | |||
| 1705 | Ga0495593_0011104 | |||
| 1706 | Ga0495593_0018869 | |||
| 1707 | Ga0495593_0030932 | |||
| 1708 | Ga0495602_0032954 | |||
| 1709 | Ga0495602_0055085 | |||
| 1710 | Ga0495602_0066205 | |||
| 1711 | Ga0495602_0106935 | |||
| 1712 | Ga0495614_0018641 | |||
| 1713 | Ga0495614_0021494 | |||
| 1714 | Ga0495626_0000116 | |||
| 1715 | Ga0496100_0060510 | |||
| 1716 | Ga0496100_0066842 | |||
| 1717 | Ga0496100_0142289 | |||
| 1718 | Ga0496101_0029589 | |||
| 1719 | Ga0496101_0047796 | |||
| 1720 | Ga0496102_0071383 | |||
| 1721 | Ga0496102_0091815 | |||
| 1722 | Ga0496102_0120118 | |||
| 1723 | Ga0496102_0129343 | |||
| 1724 | Ga0496103_0026783 | |||
| 1725 | Ga0496103_0106662 | |||
| 1726 | Ga0496104_0023870 | |||
| 1727 | Ga0496104_0038270 | |||
| 1728 | Ga0496104_0043775 | |||
| 1729 | Ga0496104_0056957 | |||
| 1730 | Ga0496104_0273895 | |||
| 1731 | Ga0496105_0003718 | |||
| 1732 | Ga0496105_0016938 | |||
| 1733 | Ga0496105_0017370 | |||
| 1734 | Ga0496105_0110097 | |||
| 1735 | Ga0496106_0007783 | |||
| 1736 | Ga0496106_0039672 | |||
| 1737 | Ga0496106_0173381 | |||
| 1738 | Ga0496106_0175660 | |||
| 1739 | Ga0496107_0024004 | |||
| 1740 | Ga0496108_0000019 | |||
| 1741 | Ga0496108_0073796 | |||
| 1742 | Ga0496108_0158454 | |||
| 1743 | Ga0496108_0202754 | |||
| 1744 | Ga0496108_0299137 | |||
| 1745 | Ga0496108_0409849 | |||
| 1746 | Ga0496109_0017888 | |||
| 1747 | Ga0496109_0020481 | |||
| 1748 | Ga0496109_0201000 | |||
| 1749 | Ga0496109_0216369 | |||
| 1750 | Ga0496110_0001540 | |||
| 1751 | Ga0496110_0022279 | |||
| 1752 | Ga0496110_0051948 | |||
| 1753 | Ga0496110_0082705 | |||
| 1754 | Ga0496110_0143069 | |||
| 1755 | Ga0496110_0178736 | |||
| 1756 | Ga0496111_0003334 | |||
| 1757 | Ga0496111_0021617 | |||
| 1758 | Ga0496111_0043828 | |||
| 1759 | Ga0496111_0046373 | |||
| 1760 | Ga0496111_0227413 | |||
| 1761 | Ga0496112_0002106 | |||
| 1762 | Ga0496112_0018658 | |||
| 1763 | Ga0496112_0035356 | |||
| 1764 | Ga0496113_0013661 | |||
| 1765 | Ga0496113_0031326 | |||
| 1766 | Ga0496113_0221462 | |||
| 1767 | Ga0496113_0256892 | |||
| 1768 | Ga0496113_0323940 | |||
| 1769 | Ga0496114_0028738 | |||
| 1770 | Ga0496114_0097947 | |||
| 1771 | Ga0496115_0076563 | |||
| 1772 | Ga0496115_0115165 | |||
| 1773 | Ga0496119_0054393 | |||
| 1774 | Ga0496126_0020690 | |||
| 1775 | Ga0496126_0138305 | |||
| 1776 | Ga0496126_0404357 | |||
| 1777 | Ga0501043_0061450 | |||
| 1778 | Ga0501046_0061723 | |||
| 1779 | Ga0501081_0043759 | |||
| 1780 | Ga0501045_0018148 | |||
| 1781 | nmdc:mga05p37_162935_c1 | |||
| 1782 | nmdc:mga05p37_263411_c1 | |||
| 1783 | nmdc:mga05p37_31122_c1 | |||
| 1784 | nmdc:mga05p37_3785_c1 | |||
| 1785 | nmdc:mga05p37_509401_c1 | |||
| 1786 | nmdc:mga09592_179467_c1 | |||
| 1787 | nmdc:mga09592_62_c1 | |||
| 1788 | nmdc:mga09592_9038_c1 | |||
| 1789 | nmdc:mga0qj67_1407_c1 | |||
| 1790 | nmdc:mga0qj67_209857_c1 | |||
| 1791 | nmdc:mga0qj67_391269_c1 | |||
| 1792 | nmdc:mga0qj67_6584_c1 | |||
| 1793 | nmdc:mga0qj67_74169_c1 | |||
| 1794 | nmdc:mga06r32_1433_c1 | |||
| 1795 | nmdc:mga06r32_17514_c1 | |||
| 1796 | nmdc:mga06r32_356718_c1 | |||
| 1797 | nmdc:mga08y16_242660_c1 | |||
| 1798 | nmdc:mga08y16_26079_c1 | |||
| 1799 | nmdc:mga0n895_317576_c1 | |||
| 1800 | nmdc:mga0n895_398000_c1 | |||
| 1801 | nmdc:mga0n895_676030_c1 | |||
| 1802 | nmdc:mga0rr50_11810_c1 | |||
| 1803 | nmdc:mga0rr50_30610_c1 | |||
| 1804 | nmdc:mga0rr50_52877_c1 | |||
| 1805 | nmdc:mga0rr50_571866_c1 | |||
| 1806 | nmdc:mga08x19_4526_c1 | |||
| 1807 | nmdc:mga0a205_12318_c1 | |||
| 1808 | nmdc:mga0a205_16922_c1 | |||
| 1809 | nmdc:mga0a205_365030_c1 | |||
| 1810 | nmdc:mga0a205_61866_c1 | |||
| 1811 | Ga0495601_0060185 | |||
| 1812 | Ga0495601_0075230 | |||
| 1813 | Ga0495601_0127975 | |||
| 1814 | Ga0495612_0044601 | |||
| 1815 | Ga0495595_0033403 | |||
| 1816 | Ga0495595_0034668 | |||
| 1817 | Ga0495619_0027468 | |||
| 1818 | Ga0495619_0044520 | |||
| 1819 | Ga0495619_0047213 | |||
| 1820 | Ga0495619_0103511 | |||
| 1821 | Ga0495619_0213170 | |||
| 1822 | Ga0500644_0022687 | |||
| 1823 | Ga0500569_003268 | |||
| 1824 | Ga0500594_0002062 | |||
| 1825 | Ga0500652_021506 | |||
| 1826 | Ga0500604_0014576 | |||
| 1827 | Ga0500616_0004554 | |||
| 1828 | Ga0587073_0015736 | |||
| 1829 | 2501945467 | |||
| 1830 | 2515495525 | |||
| 1831 | 2515720284 | |||
| 1832 | 2515755970 | |||
| 1833 | 2516084387 | |||
| 1834 | 2516089692 | |||
| 1835 | 2623585190 | |||
| 1836 | 2753272236 | |||
| 1837 | 2772645528 | |||
| 1838 | 2832010230 | |||
| 1839 | 2855673897 | |||
| 1840 | 2855679495 | |||
| 1841 | 2855688738 | |||
| 1842 | 2856859023 | |||
| 1843 | 2857289429 | |||
| 1844 | 2858851941 | |||
| 1845 | 2858887963 | |||
| 1846 | 2858895370 | |||
| 1847 | 2858900128 | |||
| 1848 | 2858902804 | |||
| 1849 | 2866068358 | |||
| 1850 | 2867306151 | |||
| 1851 | 2867323163 | |||
| 1852 | 2869051489 | |||
| 1853 | 2869067008 | |||
| 1854 | 2869071718 | |||
| 1855 | 2880495050 | |||
| 1856 | 2880497279 | |||
| 1857 | 2887486910 | |||
| 1858 | 2929225847 | |||
| 1859 | 2929231164 | |||
| 1860 | 2996222146 | |||
| 1861 | 649813016 | |||
| 1862 | 8001785279 | |||
| 1863 | 8003870827 | |||
| 1864 | 8054710385 | |||
| 1865 | 8054731508 | |||
| 1866 | 8054736142 | |||
| 1867 | 8055418465 | |||
| 1868 | 8056062043 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qzl-assembly1.cif.gz_A | amine dehydrogenase from cystobacter fuscus (cfusamdh) w145a mutant with nadp+ and pentylamine | 0.8025 | 110 | 203 |
| 3q2k-assembly1.cif.gz_B | crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca | 0.7853 | 110 | 203 |
| 6iau-assembly1.cif.gz_B | amine dehydrogenase from cystobacter fuscus in complex with nadp+ and cyclohexylamine | 0.7813 | 110 | 203 |
| 5gz1-assembly1.cif.gz_A | structure of substrate/cofactor-free d-amino acid dehydrogenase | 0.7812 | 111 | 203 |
| 5zz5-assembly2.cif.gz_C | redox-sensing transcriptional repressor rex | 0.7782 | 97 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xcbB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9593 | 35 | 103 | 1.10.10.10 |
| 1xcbF01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9552 | 34 | 103 | 1.10.10.10 |
| 1r72C01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9498 | 35 | 103 | 1.10.10.10 |
| 1xcbG01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9438 | 35 | 103 | 1.10.10.10 |
| 1r72G01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9436 | 35 | 103 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G3V9C5-F1-model_v4 | deleted | 0.9757 | 33 | 108 |
|
| AF-A0A6B3E9K1-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.9725 | 120 | 222 |
GO:0003677
GO:0005737 GO:0045892 GO:0051775 |
| AF-A0A4Q3AVS3-F1-model_v4 | deleted | 0.9725 | 31 | 107 |
|
| AF-A0A6B3GAM9-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.9653 | 121 | 209 |
GO:0003677
GO:0005737 GO:0045892 GO:0051775 |
| AF-A0A348S577-F1-model_v4 | Redox-sensing transcriptional repressor Rex | 0.9637 | 31 | 108 |
GO:0045892
GO:0051775 |