F486060

General Info

Members Datasets Scaffolds Average Seq Length
932 280 1864 107

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100612543|Ga0070713_1006125432
Length 125
Sequence MFINRRGMFLGEIASKMPGAMAVQVTIYLNEADQWHHRPLHMEILNYLRKENAYAATAIHCVAGFLGRHRVETAHLVEAGGKLPVIIVFVDTDEHVNRVLPTLKEMAAHRLIVRENVVLEQGNLD

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
166 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.47
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 28.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100612543 3300005436 Bacteria 1035
2 LJNas_1000206 3300000546 Bacteria 10013
3 rootH1_10200571 3300003323 Bacteria 1455
4 Ga0065704_10652891 3300005289 Unclassified 582
5 Ga0065712_10164499 3300005290 Bacteria 1281
6 Ga0065712_10679101 3300005290 Unclassified 555
7 Ga0065715_10246143 3300005293 Bacteria 1183
8 Ga0070658_10859216 3300005327 Bacteria 789
9 Ga0070683_100212022 3300005329 Bacteria 1840
10 Ga0070683_101135179 3300005329 Unclassified 751
11 Ga0070690_100033150 3300005330 Unclassified 3231
12 Ga0070690_101507809 3300005330 Unclassified 543
13 Ga0070670_100282565 3300005331 Bacteria 1449
14 Ga0070670_100847058 3300005331 Bacteria 827
15 Ga0070670_101046804 3300005331 Bacteria 743
16 Ga0068869_100016525 3300005334 Unclassified 4976
17 Ga0068869_100489440 3300005334 Bacteria 1025
18 Ga0070680_101471809 3300005336 Unclassified 590
19 Ga0068868_100004274 3300005338 Bacteria 9999
20 Ga0068868_100010136 3300005338 Bacteria 6809
21 Ga0068868_100015485 3300005338 Bacteria 5641
22 Ga0068868_100067612 3300005338 Bacteria 2844
23 Ga0068868_100233080 3300005338 Bacteria 1545
24 Ga0068868_101547983 3300005338 Bacteria 622
25 Ga0070660_100182966 3300005339 Unclassified 1696
26 Ga0070660_100226820 3300005339 Bacteria 1519
27 Ga0070689_100347447 3300005340 Bacteria 1243
28 Ga0070691_10023427 3300005341 Bacteria 2867
29 Ga0070661_100111181 3300005344 Bacteria 2046
30 Ga0070671_100036167 3300005355 Bacteria 4094
31 Ga0070671_100150911 3300005355 Unclassified 1962
32 Ga0070671_100432105 3300005355 Unclassified 1128
33 Ga0070673_100148050 3300005364 Bacteria 1986
34 Ga0070673_100259368 3300005364 Bacteria 1518
35 Ga0070673_101018997 3300005364 Bacteria 771
36 Ga0070688_100195036 3300005365 Unclassified 1413
37 Ga0070688_101610823 3300005365 Unclassified 530
38 Ga0070659_100019631 3300005366 Bacteria 5126
39 Ga0070709_10003985 3300005434 Bacteria 7968
40 Ga0070709_10012423 3300005434 Unclassified 4768
41 Ga0070709_10020202 3300005434 Bacteria 3861
42 Ga0070709_10021039 3300005434 Bacteria 3797
43 Ga0070709_10024221 3300005434 Bacteria 3571
44 Ga0070709_10035156 3300005434 Bacteria 3043
45 Ga0070709_10206659 3300005434 Unclassified 1393
46 Ga0070709_10298093 3300005434 Unclassified 1177
47 Ga0070709_10556611 3300005434 Unclassified 878
48 Ga0070709_11227128 3300005434 Unclassified 603
49 Ga0070709_11400587 3300005434 Unclassified 566
50 Ga0070714_100000027 3300005435 Bacteria 141750
51 Ga0070714_100002201 3300005435 Bacteria 14355
52 Ga0070714_100076096 3300005435 Bacteria 2913
53 Ga0070714_100127151 3300005435 Bacteria 2274
54 Ga0070714_100146116 3300005435 Unclassified 2127
55 Ga0070714_100296172 3300005435 Bacteria 1507
56 Ga0070714_100411638 3300005435 Unclassified 1280
57 Ga0070714_100462397 3300005435 Bacteria 1206
58 Ga0070714_100464821 3300005435 Unclassified 1203
59 Ga0070714_100509808 3300005435 Bacteria 1148
60 Ga0070714_100585092 3300005435 Bacteria 1071
61 Ga0070714_101068032 3300005435 Unclassified 786
62 Ga0070714_101325331 3300005435 Bacteria 703
63 Ga0070714_101394115 3300005435 Bacteria 684
64 Ga0070714_101688715 3300005435 Unclassified 618
65 Ga0070713_100001584 3300005436 Bacteria 14570
66 Ga0070713_100003636 3300005436 Bacteria 10200
67 Ga0070713_100005353 3300005436 Bacteria 8763
68 Ga0070713_100008775 3300005436 Bacteria 7193
69 Ga0070713_100039400 3300005436 Bacteria 3834
70 Ga0070713_100039484 3300005436 Bacteria 3831
71 Ga0070713_100051079 3300005436 Bacteria 3419
72 Ga0070713_100078460 3300005436 Bacteria 2811
73 Ga0070713_100082259 3300005436 Unclassified 2749
74 Ga0070713_100123309 3300005436 Bacteria 2275
75 Ga0070713_100157404 3300005436 Bacteria 2026
76 Ga0070713_100228002 3300005436 Bacteria 1692
77 Ga0070713_100253563 3300005436 Bacteria 1606
78 Ga0070713_100430554 3300005436 Bacteria 1236
79 Ga0070713_101630353 3300005436 Unclassified 626
80 Ga0070713_101944420 3300005436 Unclassified 571
81 Ga0070713_101996851 3300005436 Unclassified 563
82 Ga0070713_102247332 3300005436 Unclassified 528
83 Ga0070710_10006613 3300005437 Bacteria 5573
84 Ga0070710_10007134 3300005437 Bacteria 5398
85 Ga0070710_10077685 3300005437 Bacteria 1930
86 Ga0070710_10136498 3300005437 Bacteria 1500
87 Ga0070710_10162166 3300005437 Bacteria 1387
88 Ga0070710_10399702 3300005437 Unclassified 921
89 Ga0070710_10539284 3300005437 Bacteria 804
90 Ga0070711_100000304 3300005439 Bacteria 25467
91 Ga0070711_100002768 3300005439 Bacteria 10061
92 Ga0070711_100044735 3300005439 Bacteria 3006
93 Ga0070711_100064703 3300005439 Bacteria 2556
94 Ga0070711_100089806 3300005439 Unclassified 2211
95 Ga0070711_100122763 3300005439 Bacteria 1923
96 Ga0070711_100193356 3300005439 Bacteria 1565
97 Ga0070711_100251176 3300005439 Unclassified 1387
98 Ga0070711_101316109 3300005439 Unclassified 627
99 Ga0070700_100500026 3300005441 Bacteria 935
100 Ga0070708_100017677 3300005445 Bacteria 5953
101 Ga0070708_100043504 3300005445 Unclassified 3946
102 Ga0070708_100326076 3300005445 Bacteria 1446
103 Ga0070708_101031473 3300005445 Bacteria 771
104 Ga0070708_101402442 3300005445 Unclassified 652
105 Ga0070663_100642416 3300005455 Bacteria 897
106 Ga0070678_100927794 3300005456 Unclassified 797
107 Ga0070678_101797695 3300005456 Unclassified 578
108 Ga0070662_100009607 3300005457 Bacteria 6327
109 Ga0070681_10003101 3300005458 Bacteria 15440
110 Ga0070681_10010702 3300005458 Bacteria 9065
111 Ga0070681_10212272 3300005458 Bacteria 1851
112 Ga0070681_10306699 3300005458 Bacteria 1497
113 Ga0070681_10680775 3300005458 Bacteria 944
114 Ga0070681_10747938 3300005458 Bacteria 894
115 Ga0070681_11885225 3300005458 Unclassified 525
116 Ga0068867_100558673 3300005459 Unclassified 992
117 Ga0068867_100641111 3300005459 Unclassified 931
118 Ga0070685_10004730 3300005466 Bacteria 6893
119 Ga0070706_100007974 3300005467 Bacteria 9882
120 Ga0070706_100040422 3300005467 Bacteria 4305
121 Ga0070706_100474403 3300005467 Unclassified 1164
122 Ga0070707_100036019 3300005468 Bacteria 4721
123 Ga0070707_100330457 3300005468 Bacteria 1481
124 Ga0070707_101821524 3300005468 Bacteria 576
125 Ga0070707_101824681 3300005468 Unclassified 575
126 Ga0070698_100030970 3300005471 Bacteria 5548
127 Ga0070698_100114500 3300005471 Bacteria 2661
128 Ga0070699_100073333 3300005518 Bacteria 2978
129 Ga0070699_100236302 3300005518 Bacteria 1630
130 Ga0070699_100769605 3300005518 Unclassified 881
131 Ga0070699_100789537 3300005518 Bacteria 869
132 Ga0070679_100090869 3300005530 Bacteria 3041
133 Ga0070679_100143641 3300005530 Bacteria 2365
134 Ga0070679_100233122 3300005530 Bacteria 1800
135 Ga0070679_100263807 3300005530 Bacteria 1677
136 Ga0070679_100284058 3300005530 Bacteria 1607
137 Ga0070679_100322477 3300005530 Bacteria 1494
138 Ga0070684_100041877 3300005535 Bacteria 3951
139 Ga0070684_100168299 3300005535 Unclassified 1990
140 Ga0070684_100281358 3300005535 Bacteria 1524
141 Ga0070684_100938285 3300005535 Unclassified 811
142 Ga0070684_101249744 3300005535 Unclassified 699
143 Ga0070697_100003817 3300005536 Bacteria 11573
144 Ga0070697_100396846 3300005536 Unclassified 1196
145 Ga0070697_100606679 3300005536 Unclassified 962
146 Ga0070697_100699579 3300005536 Unclassified 894
147 Ga0070697_101199804 3300005536 Unclassified 676
148 Ga0068853_100043786 3300005539 Bacteria 3829
149 Ga0068853_100193876 3300005539 Bacteria 1847
150 Ga0068853_100492169 3300005539 Bacteria 1157
151 Ga0068853_101645966 3300005539 Unclassified 622
152 Ga0070672_101932136 3300005543 Unclassified 531
153 Ga0070695_100099058 3300005545 Unclassified 1960
154 Ga0070695_100550550 3300005545 Bacteria 899
155 Ga0070695_100980734 3300005545 Bacteria 686
156 Ga0070696_100373562 3300005546 Unclassified 1109
157 Ga0070696_101207436 3300005546 Bacteria 639
158 Ga0070693_100076861 3300005547 Bacteria 1980
159 Ga0070693_100132887 3300005547 Bacteria 1558
160 Ga0070665_100410887 3300005548 Bacteria 1362
161 Ga0070665_101632492 3300005548 Bacteria 652
162 Ga0070704_100804846 3300005549 Bacteria 840
163 Ga0070704_100933335 3300005549 Bacteria 782
164 Ga0068855_100000972 3300005563 Bacteria 35721
165 Ga0068855_100005186 3300005563 Bacteria 15894
166 Ga0068855_100009464 3300005563 Bacteria 11768
167 Ga0068855_100033636 3300005563 Bacteria 6116
168 Ga0068855_100153038 3300005563 Unclassified 2622
169 Ga0068855_100483881 3300005563 Bacteria 1347
170 Ga0068855_100485769 3300005563 Unclassified 1344
171 Ga0068855_100945639 3300005563 Bacteria 908
172 Ga0068855_102575346 3300005563 Bacteria 505
173 Ga0070664_100143476 3300005564 Bacteria 2104
174 Ga0070664_100160933 3300005564 Bacteria 1986
175 Ga0070664_100234733 3300005564 Unclassified 1645
176 Ga0068857_100002605 3300005577 Bacteria 14798
177 Ga0068857_100274174 3300005577 Bacteria 1551
178 Ga0068854_100205476 3300005578 Bacteria 1551
179 Ga0068854_100279676 3300005578 Bacteria 1343
180 Ga0068854_100755248 3300005578 Unclassified 844
181 Ga0068856_100004248 3300005614 Bacteria 14304
182 Ga0068856_100020096 3300005614 Bacteria 6486
183 Ga0068856_100025521 3300005614 Bacteria 5763
184 Ga0068856_100088690 3300005614 Bacteria 3075
185 Ga0068856_100586059 3300005614 Unclassified 1136
186 Ga0070702_100019200 3300005615 Bacteria 3560
187 Ga0068852_100075447 3300005616 Bacteria 2974
188 Ga0068852_100262758 3300005616 Bacteria 1658
189 Ga0068852_101612984 3300005616 Unclassified 671
190 Ga0068859_100003437 3300005617 Bacteria 16100
191 Ga0068864_100020480 3300005618 Bacteria 5534
192 Ga0068864_100408820 3300005618 Bacteria 1291
193 Ga0068864_101446899 3300005618 Unclassified 689
194 Ga0068866_10131457 3300005718 Bacteria 1424
195 Ga0068866_10777272 3300005718 Bacteria 664
196 Ga0068861_100034627 3300005719 Bacteria 3735
197 Ga0068851_10034400 3300005834 Bacteria 2530
198 Ga0068851_10416199 3300005834 Bacteria 793
199 Ga0068863_100029798 3300005841 Bacteria 5211
200 Ga0068863_100047816 3300005841 Unclassified 4057
201 Ga0068863_100115709 3300005841 Bacteria 2555
202 Ga0068863_100204477 3300005841 Bacteria 1900
203 Ga0068863_100389164 3300005841 Bacteria 1362
204 Ga0068863_100606111 3300005841 Bacteria 1084
205 Ga0068863_100886200 3300005841 Bacteria 892
206 Ga0068863_102129930 3300005841 Bacteria 571
207 Ga0068858_100005022 3300005842 Bacteria 12966
208 Ga0068858_100011419 3300005842 Bacteria 8385
209 Ga0068858_100031518 3300005842 Unclassified 4925
210 Ga0068858_101765582 3300005842 Unclassified 611
211 Ga0068860_100067480 3300005843 Bacteria 3399
212 Ga0068860_100755515 3300005843 Bacteria 984
213 Ga0068860_100895013 3300005843 Bacteria 903
214 Ga0068862_100037543 3300005844 Bacteria 4106
215 Ga0068862_100482861 3300005844 Bacteria 1173
216 Ga0081540_1078030 3300005983 Unclassified 1503
217 Ga0070717_10000295 3300006028 Bacteria 33556
218 Ga0070717_10004957 3300006028 Bacteria 9683
219 Ga0070717_10015542 3300006028 Bacteria 5884
220 Ga0070717_10017181 3300006028 Bacteria 5623
221 Ga0070717_10031549 3300006028 Bacteria 4264
222 Ga0070717_10045714 3300006028 Bacteria 3580
223 Ga0070717_10050470 3300006028 Bacteria 3420
224 Ga0070717_10066155 3300006028 Bacteria 3006
225 Ga0070717_10096973 3300006028 Bacteria 2498
226 Ga0070717_10103290 3300006028 Bacteria 2423
227 Ga0070717_10148951 3300006028 Bacteria 2023
228 Ga0070717_10180570 3300006028 Bacteria 1839
229 Ga0070717_10214751 3300006028 Unclassified 1689
230 Ga0070717_10229455 3300006028 Unclassified 1634
231 Ga0070717_10302501 3300006028 Bacteria 1422
232 Ga0070717_10307428 3300006028 Bacteria 1410
233 Ga0070717_10376897 3300006028 Bacteria 1272
234 Ga0070717_10456622 3300006028 Bacteria 1152
235 Ga0070717_10470271 3300006028 Unclassified 1134
236 Ga0070717_10647345 3300006028 Bacteria 959
237 Ga0070717_11279944 3300006028 Unclassified 667
238 Ga0070715_10002640 3300006163 Bacteria 5549
239 Ga0070715_10011180 3300006163 Bacteria 3225
240 Ga0070715_10199317 3300006163 Bacteria 1016
241 Ga0070716_100001322 3300006173 Bacteria 10959
242 Ga0070716_100002474 3300006173 Bacteria 8528
243 Ga0070716_100027878 3300006173 Bacteria 3039
244 Ga0070716_100027945 3300006173 Unclassified 3036
245 Ga0070716_100034245 3300006173 Bacteria 2783
246 Ga0070716_100112130 3300006173 Unclassified 1692
247 Ga0070716_100155142 3300006173 Bacteria 1477
248 Ga0070716_100185494 3300006173 Unclassified 1370
249 Ga0070716_100219910 3300006173 Unclassified 1275
250 Ga0070716_100250737 3300006173 Bacteria 1206
251 Ga0070716_100288895 3300006173 Bacteria 1135
252 Ga0070716_100295895 3300006173 Bacteria 1124
253 Ga0070716_100308263 3300006173 Bacteria 1104
254 Ga0070716_100486881 3300006173 Bacteria 907
255 Ga0070712_100000223 3300006175 Bacteria 31964
256 Ga0070712_100000236 3300006175 Bacteria 30874
257 Ga0070712_100011319 3300006175 Bacteria 5652
258 Ga0070712_100021122 3300006175 Unclassified 4270
259 Ga0070712_100050450 3300006175 Bacteria 2895
260 Ga0070712_100134729 3300006175 Bacteria 1876
261 Ga0070712_100492917 3300006175 Bacteria 1026
262 Ga0070712_100603930 3300006175 Bacteria 929
263 Ga0070712_100908932 3300006175 Unclassified 759
264 Ga0070712_101045555 3300006175 Bacteria 708
265 Ga0070712_101921951 3300006175 Unclassified 518
266 Ga0097621_100000044 3300006237 Bacteria 65368
267 Ga0097621_100002742 3300006237 Bacteria 12046
268 Ga0097621_100040523 3300006237 Bacteria 3745
269 Ga0097621_100377672 3300006237 Bacteria 1265
270 Ga0097621_100490618 3300006237 Unclassified 1111
271 Ga0097621_101222235 3300006237 Unclassified 708
272 Ga0068871_100000175 3300006358 Bacteria 43254
273 Ga0068871_100001719 3300006358 Bacteria 14733
274 Ga0068871_100026987 3300006358 Bacteria 4487
275 Ga0068871_100219307 3300006358 Bacteria 1647
276 Ga0068871_100283558 3300006358 Unclassified 1450
277 Ga0068871_101815748 3300006358 Unclassified 579
278 Ga0075433_10260520 3300006852 Bacteria 1537
279 Ga0075434_100000335 3300006871 Bacteria 33966
280 Ga0075434_100369517 3300006871 Bacteria 1455
281 Ga0068865_100056792 3300006881 Bacteria 2728
282 Ga0068865_100074255 3300006881 Bacteria 2421
283 Ga0075436_100001801 3300006914 Bacteria 14685
284 Ga0075436_100003920 3300006914 Bacteria 10199
285 Ga0075436_100239753 3300006914 Bacteria 1289
286 Ga0075436_100304335 3300006914 Bacteria 1143
287 Ga0075436_100323296 3300006914 Bacteria 1108
288 Ga0075436_101114708 3300006914 Bacteria 594
289 Ga0097620_100003437 3300006931 Bacteria 16100
290 Ga0075435_100048840 3300007076 Unclassified 3401
291 Ga0075435_100495168 3300007076 Bacteria 1056
292 Ga0075435_100752283 3300007076 Bacteria 848
293 Ga0099794_10124970 3300007265 Bacteria 1296
294 Ga0099795_10018840 3300007788 Bacteria 2225
295 Ga0105250_10107831 3300009092 Unclassified 1139
296 Ga0105240_10027257 3300009093 Bacteria 7483
297 Ga0105240_10035113 3300009093 Bacteria 6465
298 Ga0105240_10036142 3300009093 Bacteria 6357
299 Ga0105240_10040220 3300009093 Bacteria 5983
300 Ga0105240_10054904 3300009093 Bacteria 4990
301 Ga0105240_10142982 3300009093 Bacteria 2858
302 Ga0105240_10148860 3300009093 Bacteria 2790
303 Ga0105240_10164426 3300009093 Bacteria 2633
304 Ga0105240_10207914 3300009093 Bacteria 2289
305 Ga0105240_10251254 3300009093 Bacteria 2045
306 Ga0105245_10092053 3300009098 Bacteria 2792
307 Ga0105245_10118472 3300009098 Unclassified 2471
308 Ga0105245_10470252 3300009098 Bacteria 1269
309 Ga0105245_10500769 3300009098 Bacteria 1231
310 Ga0105245_12945637 3300009098 Bacteria 528
311 Ga0105245_13209565 3300009098 Bacteria 507
312 Ga0105247_10101509 3300009101 Bacteria 1840
313 Ga0105247_10834597 3300009101 Bacteria 706
314 Ga0105243_12646587 3300009148 Bacteria 542
315 Ga0105241_10019404 3300009174 Bacteria 5013
316 Ga0105241_10023082 3300009174 Bacteria 4612
317 Ga0105241_10110450 3300009174 Bacteria 2200
318 Ga0105241_10242171 3300009174 Bacteria 1525
319 Ga0105241_10256801 3300009174 Bacteria 1484
320 Ga0105241_10363584 3300009174 Unclassified 1260
321 Ga0105241_10637764 3300009174 Bacteria 966
322 Ga0105242_10135087 3300009176 Bacteria 2134
323 Ga0105248_10010020 3300009177 Bacteria 10433
324 Ga0105248_10021037 3300009177 Bacteria 7229
325 Ga0105248_10294208 3300009177 Bacteria 1828
326 Ga0105248_10588635 3300009177 Bacteria 1255
327 Ga0105248_10664063 3300009177 Bacteria 1176
328 Ga0105248_10933154 3300009177 Unclassified 980
329 Ga0105248_11767795 3300009177 Bacteria 701
330 Ga0105237_10084739 3300009545 Bacteria 3159
331 Ga0105237_10101879 3300009545 Bacteria 2863
332 Ga0105237_10128608 3300009545 Bacteria 2527
333 Ga0105237_10216054 3300009545 Bacteria 1917
334 Ga0105237_10267542 3300009545 Bacteria 1712
335 Ga0105237_10428016 3300009545 Bacteria 1329
336 Ga0105237_10954699 3300009545 Unclassified 864
337 Ga0105237_12541651 3300009545 Unclassified 523
338 Ga0105237_12648114 3300009545 Bacteria 512
339 Ga0105238_10000231 3300009551 Bacteria 62320
340 Ga0105238_10014889 3300009551 Bacteria 7869
341 Ga0105238_10313185 3300009551 Bacteria 1555
342 Ga0105238_10417048 3300009551 Bacteria 1337
343 Ga0105238_10423724 3300009551 Bacteria 1326
344 Ga0105238_10589506 3300009551 Bacteria 1119
345 Ga0105238_10925650 3300009551 Unclassified 891
346 Ga0105249_10014329 3300009553 Bacteria 7012
347 Ga0099796_10032975 3300010159 Bacteria 1701
348 Ga0105239_10031877 3300010375 Bacteria 5792
349 Ga0105239_10039280 3300010375 Bacteria 5185
350 Ga0105239_10067537 3300010375 Unclassified 3928
351 Ga0105239_10101085 3300010375 Bacteria 3190
352 Ga0105239_10129627 3300010375 Bacteria 2804
353 Ga0105239_10803648 3300010375 Bacteria 1078
354 Ga0105239_10866744 3300010375 Bacteria 1036
355 Ga0157373_10020821 3300013100 Bacteria 4761
356 Ga0157373_10055943 3300013100 Bacteria 2802
357 Ga0157373_10180678 3300013100 Bacteria 1485
358 Ga0157373_10184089 3300013100 Bacteria 1471
359 Ga0157371_10027063 3300013102 Bacteria 4162
360 Ga0157371_10512541 3300013102 Bacteria 887
361 Ga0157370_10016753 3300013104 Bacteria 7415
362 Ga0157370_10673529 3300013104 Bacteria 945
363 Ga0157370_10690069 3300013104 Bacteria 932
364 Ga0157369_10000319 3300013105 Bacteria 64594
365 Ga0157369_10049225 3300013105 Bacteria 4569
366 Ga0157369_10104869 3300013105 Bacteria 3010
367 Ga0157369_10217413 3300013105 Bacteria 2001
368 Ga0157369_10243505 3300013105 Bacteria 1878
369 Ga0157369_10358356 3300013105 Bacteria 1514
370 Ga0157369_10361747 3300013105 Bacteria 1506
371 Ga0157369_10514745 3300013105 Unclassified 1238
372 Ga0157374_10000901 3300013296 Bacteria 25896
373 Ga0157374_10001359 3300013296 Bacteria 20821
374 Ga0157374_10007673 3300013296 Bacteria 9212
375 Ga0157374_10019345 3300013296 Bacteria 6027
376 Ga0157374_10056203 3300013296 Bacteria 3674
377 Ga0157374_10111874 3300013296 Unclassified 2627
378 Ga0157374_10131268 3300013296 Bacteria 2425
379 Ga0157374_10297037 3300013296 Bacteria 1597
380 Ga0157374_10605164 3300013296 Unclassified 1106
381 Ga0157374_11039239 3300013296 Unclassified 839
382 Ga0157378_10000222 3300013297 Bacteria 55407
383 Ga0157378_10020356 3300013297 Bacteria 5837
384 Ga0157378_10084164 3300013297 Unclassified 2879
385 Ga0157378_10222787 3300013297 Bacteria 1793
386 Ga0157378_11066131 3300013297 Bacteria 844
387 Ga0157378_11409837 3300013297 Bacteria 740
388 Ga0163162_10005111 3300013306 Bacteria 12649
389 Ga0163162_10147478 3300013306 Bacteria 2469
390 Ga0163162_10308058 3300013306 Unclassified 1716
391 Ga0163162_10667306 3300013306 Unclassified 1163
392 Ga0157372_10000647 3300013307 Bacteria 38212
393 Ga0157372_10000933 3300013307 Bacteria 31896
394 Ga0157372_10001310 3300013307 Bacteria 26936
395 Ga0157372_10046842 3300013307 Bacteria 4801
396 Ga0157372_10088840 3300013307 Bacteria 3510
397 Ga0157372_10123425 3300013307 Bacteria 2977
398 Ga0157372_10172681 3300013307 Bacteria 2501
399 Ga0157372_10177851 3300013307 Bacteria 2463
400 Ga0157372_10184882 3300013307 Bacteria 2413
401 Ga0157372_10207680 3300013307 Bacteria 2269
402 Ga0157372_10268956 3300013307 Bacteria 1980
403 Ga0157372_12120254 3300013307 Bacteria 646
404 Ga0157372_12401381 3300013307 Bacteria 605
405 Ga0157372_12582602 3300013307 Unclassified 583
406 Ga0157372_13369076 3300013307 Unclassified 509
407 Ga0157375_10029397 3300013308 Bacteria 5168
408 Ga0157375_10244260 3300013308 Bacteria 1955
409 Ga0163163_10005018 3300014325 Bacteria 11407
410 Ga0163163_10089030 3300014325 Bacteria 3098
411 Ga0163163_10092447 3300014325 Bacteria 3040
412 Ga0163163_10178013 3300014325 Bacteria 2174
413 Ga0163163_10738919 3300014325 Unclassified 1047
414 Ga0163163_12690392 3300014325 Unclassified 555
415 Ga0157380_10704498 3300014326 Bacteria 1015
416 Ga0182008_10006218 3300014497 Bacteria 6711
417 Ga0182008_10027388 3300014497 Bacteria 2888
418 Ga0157379_10002644 3300014968 Bacteria 15071
419 Ga0157379_10311374 3300014968 Unclassified 1436
420 Ga0157379_10331874 3300014968 Bacteria 1390
421 Ga0157376_10003294 3300014969 Bacteria 11123
422 Ga0157376_10023198 3300014969 Bacteria 4853
423 Ga0157376_10050708 3300014969 Bacteria 3444
424 Ga0157376_10126510 3300014969 Bacteria 2274
425 Ga0157376_10230442 3300014969 Unclassified 1720
426 Ga0157376_10477209 3300014969 Unclassified 1221
427 Ga0182006_1055778 3300015261 Bacteria 1507
428 Ga0182007_10003465 3300015262 Bacteria 7429
429 Ga0182007_10017980 3300015262 Bacteria 2571
430 Ga0182005_1005531 3300015265 Unclassified 3940
431 Ga0163161_11104351 3300017792 Bacteria 682
432 Ga0206356_10337735 3300020070 Bacteria 904
433 Ga0213875_10641175 3300021388 Unclassified 514
434 Ga0224572_1008682 3300024225 Bacteria 1883
435 Ga0228598_1017818 3300024227 Unclassified 1401
436 Ga0207656_10171531 3300025321 Bacteria 1037
437 Ga0207692_10012108 3300025898 Unclassified 3695
438 Ga0207692_10020444 3300025898 Bacteria 3011
439 Ga0207692_10038160 3300025898 Bacteria 2355
440 Ga0207692_10062804 3300025898 Bacteria 1929
441 Ga0207692_10386211 3300025898 Unclassified 870
442 Ga0207692_10391142 3300025898 Unclassified 865
443 Ga0207642_10221924 3300025899 Bacteria 1057
444 Ga0207642_10356527 3300025899 Unclassified 864
445 Ga0207710_10483000 3300025900 Unclassified 642
446 Ga0207647_10002682 3300025904 Bacteria 13425
447 Ga0207647_10318654 3300025904 Unclassified 883
448 Ga0207685_10001253 3300025905 Bacteria 5183
449 Ga0207685_10041711 3300025905 Bacteria 1719
450 Ga0207685_10061050 3300025905 Bacteria 1493
451 Ga0207685_10061675 3300025905 Bacteria 1487
452 Ga0207685_10168868 3300025905 Bacteria 1005
453 Ga0207699_10003226 3300025906 Bacteria 7763
454 Ga0207699_10007415 3300025906 Bacteria 5367
455 Ga0207699_10017610 3300025906 Unclassified 3767
456 Ga0207699_10024181 3300025906 Bacteria 3318
457 Ga0207699_10026450 3300025906 Bacteria 3199
458 Ga0207699_10088796 3300025906 Bacteria 1936
459 Ga0207699_10139651 3300025906 Unclassified 1591
460 Ga0207699_10145547 3300025906 Unclassified 1562
461 Ga0207699_10199619 3300025906 Unclassified 1354
462 Ga0207699_10213350 3300025906 Unclassified 1314
463 Ga0207699_10403968 3300025906 Unclassified 973
464 Ga0207699_10590882 3300025906 Bacteria 808
465 Ga0207699_10672892 3300025906 Bacteria 757
466 Ga0207699_10986158 3300025906 Unclassified 623
467 Ga0207699_11119030 3300025906 Bacteria 583
468 Ga0207699_11163987 3300025906 Bacteria 571
469 Ga0207699_11219850 3300025906 Bacteria 557
470 Ga0207705_10612485 3300025909 Unclassified 847
471 Ga0207684_10007054 3300025910 Bacteria 10162
472 Ga0207684_10035594 3300025910 Bacteria 4228
473 Ga0207684_10393810 3300025910 Unclassified 1191
474 Ga0207684_10668001 3300025910 Unclassified 885
475 Ga0207684_11223001 3300025910 Unclassified 621
476 Ga0207654_10019436 3300025911 Unclassified 3585
477 Ga0207654_10024382 3300025911 Bacteria 3251
478 Ga0207654_10075943 3300025911 Bacteria 2009
479 Ga0207654_10132631 3300025911 Bacteria 1578
480 Ga0207654_10142808 3300025911 Bacteria 1528
481 Ga0207654_10376621 3300025911 Bacteria 982
482 Ga0207654_10608534 3300025911 Bacteria 780
483 Ga0207707_10005917 3300025912 Bacteria 10700
484 Ga0207707_10008015 3300025912 Bacteria 9173
485 Ga0207707_10408234 3300025912 Bacteria 1165
486 Ga0207707_10554077 3300025912 Bacteria 977
487 Ga0207707_10567344 3300025912 Bacteria 963
488 Ga0207707_10577137 3300025912 Unclassified 953
489 Ga0207695_10037976 3300025913 Bacteria 5191
490 Ga0207695_10042469 3300025913 Unclassified 4856
491 Ga0207695_10091428 3300025913 Bacteria 3057
492 Ga0207695_10138422 3300025913 Bacteria 2386
493 Ga0207695_10307675 3300025913 Bacteria 1475
494 Ga0207671_10026369 3300025914 Bacteria 4357
495 Ga0207671_10035109 3300025914 Bacteria 3723
496 Ga0207671_10080424 3300025914 Bacteria 2443
497 Ga0207693_10000004 3300025915 Bacteria 193261
498 Ga0207693_10000661 3300025915 Bacteria 30947
499 Ga0207693_10001237 3300025915 Bacteria 22760
500 Ga0207693_10017281 3300025915 Bacteria 5753
501 Ga0207693_10030654 3300025915 Unclassified 4249
502 Ga0207693_10061416 3300025915 Bacteria 2943
503 Ga0207693_10076849 3300025915 Bacteria 2615
504 Ga0207693_10326881 3300025915 Bacteria 1200
505 Ga0207693_10416193 3300025915 Bacteria 1051
506 Ga0207693_10737439 3300025915 Unclassified 762
507 Ga0207693_11389332 3300025915 Unclassified 522
508 Ga0207663_10002276 3300025916 Bacteria 9188
509 Ga0207663_10013712 3300025916 Bacteria 4413
510 Ga0207663_10014158 3300025916 Bacteria 4360
511 Ga0207663_10035487 3300025916 Bacteria 2992
512 Ga0207663_10050643 3300025916 Bacteria 2582
513 Ga0207663_10081962 3300025916 Unclassified 2115
514 Ga0207663_10087605 3300025916 Bacteria 2057
515 Ga0207663_10162269 3300025916 Bacteria 1579
516 Ga0207663_10209381 3300025916 Unclassified 1412
517 Ga0207663_11044331 3300025916 Unclassified 656
518 Ga0207660_10112881 3300025917 Bacteria 2048
519 Ga0207660_10286991 3300025917 Unclassified 1308
520 Ga0207660_10698111 3300025917 Bacteria 828
521 Ga0207657_10001068 3300025919 Bacteria 29011
522 Ga0207649_10232800 3300025920 Bacteria 1318
523 Ga0207649_10519706 3300025920 Bacteria 907
524 Ga0207652_10117314 3300025921 Bacteria 2365
525 Ga0207652_10259406 3300025921 Bacteria 1568
526 Ga0207652_10367517 3300025921 Unclassified 1298
527 Ga0207652_10458743 3300025921 Unclassified 1149
528 Ga0207652_10528694 3300025921 Unclassified 1061
529 Ga0207652_10618594 3300025921 Bacteria 970
530 Ga0207652_10912213 3300025921 Bacteria 776
531 Ga0207646_10086017 3300025922 Unclassified 2812
532 Ga0207646_10219265 3300025922 Bacteria 1719
533 Ga0207646_10580360 3300025922 Bacteria 1007
534 Ga0207646_11357451 3300025922 Unclassified 619
535 Ga0207646_11674527 3300025922 Bacteria 547
536 Ga0207694_10003398 3300025924 Bacteria 12677
537 Ga0207694_10194955 3300025924 Bacteria 1647
538 Ga0207694_10295630 3300025924 Bacteria 1332
539 Ga0207694_10554072 3300025924 Bacteria 965
540 Ga0207650_11047735 3300025925 Unclassified 694
541 Ga0207650_11191221 3300025925 Unclassified 648
542 Ga0207650_11539198 3300025925 Unclassified 565
543 Ga0207650_11849642 3300025925 Unclassified 510
544 Ga0207687_10085277 3300025927 Unclassified 2291
545 Ga0207687_10128467 3300025927 Unclassified 1906
546 Ga0207687_10348730 3300025927 Bacteria 1205
547 Ga0207687_10690727 3300025927 Unclassified 865
548 Ga0207687_11792659 3300025927 Bacteria 525
549 Ga0207700_10000612 3300025928 Bacteria 20890
550 Ga0207700_10036330 3300025928 Bacteria 3557
551 Ga0207700_10046178 3300025928 Bacteria 3219
552 Ga0207700_10121951 3300025928 Unclassified 2115
553 Ga0207700_10122219 3300025928 Bacteria 2113
554 Ga0207700_10285415 3300025928 Bacteria 1421
555 Ga0207700_10312604 3300025928 Bacteria 1359
556 Ga0207700_10390348 3300025928 Bacteria 1218
557 Ga0207700_10618395 3300025928 Bacteria 965
558 Ga0207700_10632504 3300025928 Unclassified 953
559 Ga0207700_10775013 3300025928 Bacteria 857
560 Ga0207700_10805302 3300025928 Unclassified 840
561 Ga0207700_10862573 3300025928 Unclassified 810
562 Ga0207700_11187755 3300025928 Unclassified 681
563 Ga0207700_11660495 3300025928 Unclassified 564
564 Ga0207664_10011550 3300025929 Bacteria 6285
565 Ga0207664_10012644 3300025929 Bacteria 6038
566 Ga0207664_10028407 3300025929 Bacteria 4250
567 Ga0207664_10038351 3300025929 Bacteria 3715
568 Ga0207664_10072881 3300025929 Bacteria 2770
569 Ga0207664_10079029 3300025929 Bacteria 2669
570 Ga0207664_10102991 3300025929 Bacteria 2361
571 Ga0207664_10180930 3300025929 Unclassified 1810
572 Ga0207664_10783614 3300025929 Unclassified 858
573 Ga0207664_10786122 3300025929 Unclassified 856
574 Ga0207664_11005151 3300025929 Bacteria 747
575 Ga0207664_11299335 3300025929 Bacteria 647
576 Ga0207664_11639429 3300025929 Unclassified 565
577 Ga0207664_11701905 3300025929 Unclassified 553
578 Ga0207644_10101625 3300025931 Bacteria 2161
579 Ga0207644_10424228 3300025931 Unclassified 1090
580 Ga0207690_10111779 3300025932 Bacteria 1969
581 Ga0207706_10018426 3300025933 Bacteria 6281
582 Ga0207709_11583966 3300025935 Bacteria 544
583 Ga0207670_10389670 3300025936 Bacteria 1111
584 Ga0207704_10021989 3300025938 Bacteria 3409
585 Ga0207704_11140935 3300025938 Bacteria 663
586 Ga0207665_10000225 3300025939 Bacteria 38534
587 Ga0207665_10001183 3300025939 Bacteria 17558
588 Ga0207665_10005820 3300025939 Bacteria 8204
589 Ga0207665_10030106 3300025939 Bacteria 3588
590 Ga0207665_10063282 3300025939 Unclassified 2512
591 Ga0207665_10097636 3300025939 Unclassified 2045
592 Ga0207665_10115699 3300025939 Unclassified 1889
593 Ga0207665_10251436 3300025939 Unclassified 1306
594 Ga0207665_10278024 3300025939 Bacteria 1245
595 Ga0207665_10310919 3300025939 Unclassified 1180
596 Ga0207711_10019361 3300025941 Bacteria 5667
597 Ga0207711_10042854 3300025941 Unclassified 3858
598 Ga0207711_10379144 3300025941 Unclassified 1312
599 Ga0207711_11101083 3300025941 Bacteria 735
600 Ga0207689_10002500 3300025942 Bacteria 17076
601 Ga0207661_10025645 3300025944 Bacteria 4484
602 Ga0207661_11867205 3300025944 Unclassified 546
603 Ga0207661_11917373 3300025944 Unclassified 538
604 Ga0207679_10467059 3300025945 Bacteria 1121
605 Ga0207667_10001038 3300025949 Bacteria 35354
606 Ga0207667_10005367 3300025949 Bacteria 15623
607 Ga0207667_10214773 3300025949 Bacteria 1971
608 Ga0207667_10706631 3300025949 Bacteria 1010
609 Ga0207667_10863368 3300025949 Bacteria 899
610 Ga0207651_10884283 3300025960 Bacteria 795
611 Ga0207668_11517745 3300025972 Unclassified 605
612 Ga0207640_10065196 3300025981 Bacteria 2429
613 Ga0207640_10109442 3300025981 Bacteria 1955
614 Ga0207640_10121388 3300025981 Unclassified 1873
615 Ga0207677_10003403 3300026023 Bacteria 8429
616 Ga0207677_10011172 3300026023 Bacteria 5107
617 Ga0207677_10016008 3300026023 Bacteria 4428
618 Ga0207677_10053695 3300026023 Unclassified 2745
619 Ga0207677_10566382 3300026023 Bacteria 992
620 Ga0207677_11280616 3300026023 Unclassified 673
621 Ga0207703_10007924 3300026035 Bacteria 8398
622 Ga0207703_10012076 3300026035 Bacteria 6728
623 Ga0207703_10077756 3300026035 Bacteria 2755
624 Ga0207639_10027116 3300026041 Unclassified 4169
625 Ga0207639_10051364 3300026041 Bacteria 3135
626 Ga0207639_10060353 3300026041 Bacteria 2926
627 Ga0207639_10316948 3300026041 Bacteria 1383
628 Ga0207639_10419839 3300026041 Bacteria 1209
629 Ga0207678_10167831 3300026067 Bacteria 1874
630 Ga0207702_10001933 3300026078 Bacteria 20244
631 Ga0207702_10001993 3300026078 Bacteria 19808
632 Ga0207702_10009683 3300026078 Bacteria 8091
633 Ga0207702_10130692 3300026078 Unclassified 2259
634 Ga0207702_10251402 3300026078 Bacteria 1660
635 Ga0207702_10572116 3300026078 Unclassified 1107
636 Ga0207641_10008199 3300026088 Bacteria 8637
637 Ga0207641_10116722 3300026088 Bacteria 2375
638 Ga0207641_10253215 3300026088 Unclassified 1645
639 Ga0207641_10989605 3300026088 Bacteria 837
640 Ga0207641_11253753 3300026088 Unclassified 741
641 Ga0207641_11788331 3300026088 Unclassified 616
642 Ga0207648_10659938 3300026089 Unclassified 967
643 Ga0207676_10007565 3300026095 Bacteria 7707
644 Ga0207676_10253333 3300026095 Bacteria 1586
645 Ga0207676_10924058 3300026095 Unclassified 857
646 Ga0207676_11121205 3300026095 Unclassified 778
647 Ga0207676_11230420 3300026095 Bacteria 743
648 Ga0207674_10001455 3300026116 Bacteria 30595
649 Ga0207674_10300731 3300026116 Bacteria 1553
650 Ga0207674_10314187 3300026116 Bacteria 1516
651 Ga0207683_12139943 3300026121 Unclassified 508
652 Ga0207698_10150932 3300026142 Bacteria 2017
653 Ga0207698_10237189 3300026142 Bacteria 1660
654 Ga0207698_10529119 3300026142 Bacteria 1152
655 Ga0265354_1003448 3300028016 Unclassified 1770
656 Ga0265356_1005053 3300028017 Bacteria 1590
657 Ga0268266_10291822 3300028379 Bacteria 1519
658 Ga0268266_11520024 3300028379 Bacteria 645
659 Ga0268265_10027037 3300028380 Bacteria 4090
660 Ga0268264_10389398 3300028381 Bacteria 1337
661 Ga0268264_11012424 3300028381 Bacteria 837
662 Ga0268264_11096467 3300028381 Bacteria 804
663 Ga0265338_10030749 3300028800 Bacteria 5280
664 Ga0265338_10073770 3300028800 Unclassified 2906
665 Ga0265338_10256368 3300028800 Unclassified 1288
666 Ga0265338_10318398 3300028800 Bacteria 1126
667 Ga0265338_10480849 3300028800 Bacteria 876
668 Ga0265762_1000408 3300030760 Bacteria 7398
669 Ga0265762_1003554 3300030760 Bacteria 2793
670 Ga0265762_1005006 3300030760 Bacteria 2374
671 Ga0265770_1027763 3300030878 Unclassified 932
672 Ga0265764_114287 3300030882 Unclassified 536
673 Ga0265760_10000213 3300031090 Bacteria 15624
674 Ga0265760_10004205 3300031090 Bacteria 4141
675 Ga0265760_10007276 3300031090 Unclassified 3169
676 Ga0265760_10034612 3300031090 Bacteria 1494
677 Ga0265332_10467778 3300031238 Unclassified 522
678 Ga0265328_10116311 3300031239 Bacteria 996
679 Ga0265325_10005070 3300031241 Bacteria 8197
680 Ga0265340_10055511 3300031247 Bacteria 1908
681 Ga0265340_10143502 3300031247 Bacteria 1091
682 Ga0265339_10024687 3300031249 Unclassified 3460
683 Ga0265339_10181022 3300031249 Bacteria 1049
684 Ga0265316_10015838 3300031344 Bacteria 6566
685 Ga0265314_10094745 3300031711 Bacteria 1934
686 Ga0265342_10039362 3300031712 Bacteria 2873
687 Ga0316212_1038967 3300033547 Unclassified 671
688 Ga0316212_1063699 3300033547 Unclassified 533
689 Ga0373926_0016474 3300035083 Bacteria 2529
690 Ga0373926_0045972 3300035083 Bacteria 1566
691 Ga0373926_0061563 3300035083 Archaea 1369
692 Ga0373934_0097096 3300035086 Unclassified 1190
693 Ga0373934_0122691 3300035086 Bacteria 1057
694 Ga0373923_0122164 3300035111 Bacteria 1164
695 Ga0373936_0009197 3300035113 Bacteria 3723
696 Ga0373936_0037708 3300035113 Unclassified 1931
697 Ga0373941_0444124 3300035115 Unclassified 543
698 Ga0373945_0005782 3300035116 Bacteria 3968
699 Ga0373945_0049127 3300035116 Bacteria 1547
700 Ga0373945_0176729 3300035116 Bacteria 877
701 Ga0373954_0066602 3300035118 Bacteria 1705
702 Ga0373956_0059902 3300035119 Bacteria 1723
703 Ga0373957_0134144 3300035120 Bacteria 1009
704 Ga0373943_0000085 3300035170 Bacteria 33641
705 Ga0373943_0048492 3300035170 Bacteria 2081
706 Ga0373943_0134763 3300035170 Bacteria 1325
707 Ga0373943_0215840 3300035170 Unclassified 1067
708 Ga0373946_0058692 3300035171 Bacteria 1631
709 Ga0373946_0100904 3300035171 Bacteria 1294
710 Ga0373946_0107651 3300035171 Bacteria 1258
711 Ga0373946_0170064 3300035171 Bacteria 1028
712 Ga0373955_0208249 3300035172 Unclassified 1165
713 Ga0373924_0109723 3300035410 Unclassified 1192
714 Ga0373924_0248057 3300035410 Unclassified 788
715 Ga0373931_0318883 3300035691 Unclassified 965
716 Ga0373931_0669179 3300035691 Unclassified 683
717 Ga0373931_1069037 3300035691 Bacteria 548
718 Ga0373935_0001031 3300035692 Bacteria 15142
719 Ga0373935_0015379 3300035692 Bacteria 4625
720 Ga0373935_0309144 3300035692 Unclassified 1119
721 Ga0373935_0379497 3300035692 Bacteria 1012
722 Ga0373935_1116205 3300035692 Unclassified 587
723 Ga0373927_0001082 3300035695 Bacteria 20747
724 Ga0373927_0040505 3300035695 Bacteria 3022
725 Ga0373927_0040613 3300035695 Bacteria 3018
726 Ga0373927_0106298 3300035695 Bacteria 1827
727 Ga0373927_0124732 3300035695 Bacteria 1681
728 Ga0373933_0073289 3300035724 Bacteria 2086
729 Ga0373933_0125327 3300035724 Bacteria 1611
730 Ga0373933_0304677 3300035724 Unclassified 1032
731 Ga0373933_0332315 3300035724 Bacteria 986
732 Ga0373933_0470446 3300035724 Unclassified 823
733 Ga0373933_0747353 3300035724 Bacteria 643
734 Ga0373933_0974300 3300035724 Unclassified 558
735 Ga0373947_0000049 3300035725 Bacteria 60041
736 Ga0373947_0001548 3300035725 Bacteria 14102
737 Ga0373947_0214641 3300035725 Bacteria 1263
738 Ga0373947_0943140 3300035725 Bacteria 589
739 Ga0373947_1213543 3300035725 Unclassified 514
740 Ga0373937_0019523 3300036401 Bacteria 6065
741 Ga0373937_0146471 3300036401 Bacteria 2211
742 Ga0373937_0282869 3300036401 Bacteria 1566
743 Ga0373937_0331159 3300036401 Bacteria 1441
744 Ga0373937_0440287 3300036401 Unclassified 1237
745 Ga0373937_0601758 3300036401 Unclassified 1043
746 Ga0373937_1614317 3300036401 Unclassified 596
747 Ga0373937_1847743 3300036401 Bacteria 550
748 Ga0373925_0005729 3300037068 Bacteria 9237
749 Ga0373925_0014322 3300037068 Bacteria 5737
750 Ga0373925_0044341 3300037068 Unclassified 3302
751 Ga0373925_0160606 3300037068 Unclassified 1770
752 Ga0373925_0178178 3300037068 Bacteria 1681
753 Ga0373925_0211267 3300037068 Bacteria 1546
754 Ga0373925_0243591 3300037068 Bacteria 1441
755 Ga0373925_0333680 3300037068 Unclassified 1229
756 Ga0373925_0784451 3300037068 Unclassified 786
757 Ga0373925_1098723 3300037068 Bacteria 654
758 Ga0395905_0546427 3300037471 Bacteria 1060
759 Ga0395905_0622457 3300037471 Bacteria 981
760 Ga0395905_1473652 3300037471 Unclassified 585
761 Ga0436364_0453284 3300037853 Unclassified 531
762 Ga0395901_1355861 3300038443 Unclassified 671
763 Ga0436365_0198018 3300039437 Unclassified 629
764 Ga0436362_0459014 3300039453 Unclassified 1031
765 Ga0436362_1141864 3300039453 Bacteria 3931
766 Ga0451577_0000969 3300042876 Bacteria 41995
767 Ga0451577_0069818 3300042876 Unclassified 3133
768 Ga0451577_0624243 3300042876 Unclassified 978
769 Ga0453683_0017766 3300044673 Bacteria 4575
770 Ga0453683_0205030 3300044673 Unclassified 1252
771 Ga0466963_0055738 3300044694 Bacteria 2629
772 Ga0466964_0200333 3300044706 Bacteria 958
773 Ga0453684_0000803 3300044712 Bacteria 107106
774 Ga0466971_0039414 3300044719 Bacteria 2120
775 Ga0466968_0539834 3300044735 Unclassified 584
776 Ga0466970_0193949 3300044765 Bacteria 1129
777 Ga0466957_0457233 3300044842 Unclassified 880
778 Ga0466959_0249159 3300045049 Bacteria 1225
779 Ga0451576_0005970 3300045051 Bacteria 15079
780 Ga0451576_0036048 3300045051 Bacteria 5246
781 Ga0451576_0132089 3300045051 Bacteria 2603
782 Ga0451576_0176295 3300045051 Bacteria 2232
783 Ga0451576_0401206 3300045051 Unclassified 1438
784 Ga0451576_1900089 3300045051 Unclassified 614
785 Ga0466958_0064705 3300045836 Bacteria 2231
786 Ga0466967_0092023 3300045976 Bacteria 2757
787 Ga0466967_0478250 3300045976 Bacteria 1220
788 Ga0495592_0637107 3300046454 Bacteria 647
789 Ga0495590_0274944 3300046457 Unclassified 630
790 Ga0495590_0402328 3300046457 Unclassified 525
791 Ga0495629_0044791 3300046459 Bacteria 3105
792 Ga0495651_0442058 3300046462 Bacteria 842
793 Ga0495653_0154602 3300046463 Bacteria 1599
794 Ga0495653_0407453 3300046463 Bacteria 863
795 Ga0495580_0000220 3300046472 Bacteria 44125
796 Ga0495580_0000263 3300046472 Bacteria 42063
797 Ga0495580_0001602 3300046472 Bacteria 19884
798 Ga0495580_0002575 3300046472 Bacteria 15779
799 Ga0495580_0003289 3300046472 Bacteria 13819
800 Ga0495580_0017694 3300046472 Bacteria 5322
801 Ga0495580_0027327 3300046472 Bacteria 4152
802 Ga0495580_0049565 3300046472 Bacteria 2971
803 Ga0495580_0174420 3300046472 Unclassified 1485
804 Ga0495580_0214969 3300046472 Bacteria 1322
805 Ga0495580_0235848 3300046472 Bacteria 1255
806 Ga0495580_0273454 3300046472 Bacteria 1153
807 Ga0495580_0277564 3300046472 Unclassified 1144
808 Ga0495580_0294311 3300046472 Bacteria 1106
809 Ga0495580_0298856 3300046472 Bacteria 1096
810 Ga0495580_0419517 3300046472 Bacteria 900
811 Ga0495580_0703147 3300046472 Bacteria 661
812 Ga0495582_0000514 3300046473 Bacteria 21287
813 Ga0495582_0022061 3300046473 Bacteria 3482
814 Ga0495582_0344639 3300046473 Bacteria 858
815 Ga0495662_0326178 3300046476 Unclassified 755
816 Ga0495584_0029788 3300046491 Bacteria 2766
817 Ga0495594_0132819 3300046499 Unclassified 1410
818 Ga0495608_0323454 3300046511 Bacteria 953
819 Ga0495628_0059400 3300046516 Bacteria 3002
820 Ga0495628_0575916 3300046516 Bacteria 806
821 Ga0495630_0056141 3300046517 Bacteria 2951
822 Ga0495630_0067683 3300046517 Unclassified 2685
823 Ga0495630_0183716 3300046517 Bacteria 1595
824 Ga0495630_0259382 3300046517 Bacteria 1328
825 Ga0495630_0543698 3300046517 Unclassified 891
826 Ga0495665_0073732 3300046531 Bacteria 1797
827 Ga0495665_0185027 3300046531 Bacteria 1082
828 Ga0495665_0208588 3300046531 Unclassified 1012
829 Ga0495665_0577926 3300046531 Unclassified 563
830 Ga0495640_0779097 3300046533 Unclassified 571
831 Ga0495586_0152627 3300046535 Bacteria 1300
832 Ga0495587_0408013 3300046536 Bacteria 755
833 Ga0495587_0481983 3300046536 Unclassified 686
834 Ga0495667_0402436 3300046559 Unclassified 862
835 Ga0495667_0715297 3300046559 Unclassified 620
836 Ga0495635_0121462 3300046663 Bacteria 1782
837 Ga0495635_0239539 3300046663 Unclassified 1224
838 Ga0495659_0109058 3300046664 Bacteria 1079
839 Ga0495599_0104319 3300046678 Bacteria 1766
840 Ga0495623_0107968 3300046679 Bacteria 1690
841 Ga0495623_0274887 3300046679 Bacteria 939
842 Ga0495623_0716922 3300046679 Bacteria 511
843 Ga0495658_0025033 3300046683 Bacteria 3187
844 Ga0495669_0009634 3300046684 Unclassified 4075
845 Ga0495669_0231099 3300046684 Unclassified 887
846 Ga0495669_0474592 3300046684 Unclassified 608
847 Ga0495613_0843373 3300046689 Bacteria 596
848 Ga0495581_0251228 3300047315 Unclassified 1034
849 Ga0495581_0470946 3300047315 Bacteria 731
850 Ga0495674_0003000 3300047319 Bacteria 16446
851 Ga0495674_0012646 3300047319 Bacteria 7953
852 Ga0495674_0170785 3300047319 Unclassified 1815
853 Ga0495676_0656097 3300047321 Bacteria 681
854 Ga0495680_0521540 3300047322 Unclassified 804
855 Ga0495684_0810390 3300047471 Bacteria 611
856 Ga0495684_0987222 3300047471 Unclassified 536
857 Ga0495602_0072611 3300048088 Bacteria 2933
858 Ga0495602_0251730 3300048088 Unclassified 1316
859 Ga0495602_0373851 3300048088 Unclassified 1023
860 Ga0495602_1038662 3300048088 Bacteria 539
861 Ga0496100_0720495 3300048903 Bacteria 779
862 Ga0496101_0042051 3300048904 Bacteria 3262
863 Ga0496101_0076992 3300048904 Bacteria 2458
864 Ga0496101_0193841 3300048904 Bacteria 1569
865 Ga0496101_0965482 3300048904 Unclassified 670
866 Ga0496102_0001130 3300048905 Bacteria 24464
867 Ga0496102_0018819 3300048905 Bacteria 6075
868 Ga0496102_0063214 3300048905 Bacteria 3389
869 Ga0496102_0452841 3300048905 Bacteria 1204
870 Ga0496102_0528760 3300048905 Bacteria 1102
871 Ga0496102_0608861 3300048905 Unclassified 1015
872 Ga0496103_0132462 3300048906 Bacteria 1592
873 Ga0496103_0394144 3300048906 Bacteria 889
874 Ga0496104_0041510 3300048907 Bacteria 4314
875 Ga0496104_0185833 3300048907 Bacteria 1989
876 Ga0496104_0220682 3300048907 Bacteria 1808
877 Ga0496105_0165330 3300048908 Bacteria 1815
878 Ga0496105_0691099 3300048908 Unclassified 784
879 Ga0496105_0696593 3300048908 Unclassified 780
880 Ga0496106_0073256 3300048909 Bacteria 2620
881 Ga0496106_0817712 3300048909 Unclassified 739
882 Ga0496106_1019993 3300048909 Unclassified 650
883 Ga0496106_1331003 3300048909 Unclassified 557
884 Ga0496107_0472374 3300048910 Bacteria 931
885 Ga0496107_0518713 3300048910 Unclassified 884
886 Ga0496108_0067665 3300048911 Bacteria 3013
887 Ga0496108_0214874 3300048911 Bacteria 1670
888 Ga0496108_0969182 3300048911 Unclassified 727
889 Ga0496108_1185965 3300048911 Bacteria 646
890 Ga0496109_0171357 3300048912 Bacteria 2036
891 Ga0496109_0974792 3300048912 Unclassified 785
892 Ga0496109_1307603 3300048912 Bacteria 661
893 Ga0496110_0123632 3300048913 Bacteria 2333
894 Ga0496111_0069793 3300048914 Bacteria 2555
895 Ga0496112_0013920 3300048915 Bacteria 7441
896 Ga0496112_0056580 3300048915 Unclassified 3860
897 Ga0496112_0088725 3300048915 Unclassified 3060
898 Ga0496112_0122496 3300048915 Unclassified 2571
899 Ga0496112_0318216 3300048915 Bacteria 1500
900 Ga0496112_0341361 3300048915 Unclassified 1441
901 Ga0496112_0363564 3300048915 Bacteria 1389
902 Ga0496112_0372351 3300048915 Bacteria 1370
903 Ga0496112_0378184 3300048915 Bacteria 1357
904 Ga0496112_0518669 3300048915 Bacteria 1126
905 Ga0496113_0112321 3300048916 Bacteria 2122
906 Ga0496113_0429341 3300048916 Bacteria 1061
907 Ga0496113_0973295 3300048916 Unclassified 669
908 Ga0496114_0328654 3300048917 Bacteria 1351
909 Ga0496115_0158300 3300048918 Bacteria 1871
910 Ga0496115_0253098 3300048918 Bacteria 1450
911 Ga0496115_0477463 3300048918 Unclassified 1004
912 Ga0501069_0105077 3300049585 Bacteria 1605
913 nmdc:mga0n895_430136_c1 3300050512 Bacteria 1334
914 nmdc:mga0n895_5582_c1 3300050512 Bacteria 10533
915 nmdc:mga0rr50_1070148_c1 3300050513 Unclassified 686
916 nmdc:mga0rr50_357297_c1 3300050513 Bacteria 1229
917 nmdc:mga0rr50_41511_c1 3300050513 Unclassified 3353
918 nmdc:mga0rr50_450683_c1 3300050513 Bacteria 1091
919 nmdc:mga08x19_22909_c1 3300050514 Bacteria 3872
920 nmdc:mga08x19_75917_c1 3300050514 Bacteria 2198
921 nmdc:mga08x19_9368_c1 3300050514 Bacteria 5862
922 nmdc:mga08x19_985335_c1 3300050514 Bacteria 599
923 nmdc:mga0a205_81157_c1 3300050515 Bacteria 3133
924 Ga0495612_0348081 3300053078 Bacteria 669
925 Ga0495612_0486955 3300053078 Unclassified 565
926 Ga0495619_0260355 3300053085 Bacteria 1202
927 Ga0495619_0625759 3300053085 Unclassified 735
928 Ga0587070_179775 3300059491 Unclassified 550
929 Ga0587080_129361 3300059503 Unclassified 567
930 Ga0587088_100257 3300059508 Bacteria 646
931 Ga0587117_092631 3300059627 Bacteria 566
932 Ga0466962_0041521 3300061719 Bacteria 2201
933 Ga0070713_100612543
934 LJNas_1000206
935 rootH1_10200571
936 Ga0065704_10652891
937 Ga0065712_10164499
938 Ga0065712_10679101
939 Ga0065715_10246143
940 Ga0070658_10859216
941 Ga0070683_100212022
942 Ga0070683_101135179
943 Ga0070690_100033150
944 Ga0070690_101507809
945 Ga0070670_100282565
946 Ga0070670_100847058
947 Ga0070670_101046804
948 Ga0068869_100016525
949 Ga0068869_100489440
950 Ga0070680_101471809
951 Ga0068868_100004274
952 Ga0068868_100010136
953 Ga0068868_100015485
954 Ga0068868_100067612
955 Ga0068868_100233080
956 Ga0068868_101547983
957 Ga0070660_100182966
958 Ga0070660_100226820
959 Ga0070689_100347447
960 Ga0070691_10023427
961 Ga0070661_100111181
962 Ga0070671_100036167
963 Ga0070671_100150911
964 Ga0070671_100432105
965 Ga0070673_100148050
966 Ga0070673_100259368
967 Ga0070673_101018997
968 Ga0070688_100195036
969 Ga0070688_101610823
970 Ga0070659_100019631
971 Ga0070709_10003985
972 Ga0070709_10012423
973 Ga0070709_10020202
974 Ga0070709_10021039
975 Ga0070709_10024221
976 Ga0070709_10035156
977 Ga0070709_10206659
978 Ga0070709_10298093
979 Ga0070709_10556611
980 Ga0070709_11227128
981 Ga0070709_11400587
982 Ga0070714_100000027
983 Ga0070714_100002201
984 Ga0070714_100076096
985 Ga0070714_100127151
986 Ga0070714_100146116
987 Ga0070714_100296172
988 Ga0070714_100411638
989 Ga0070714_100462397
990 Ga0070714_100464821
991 Ga0070714_100509808
992 Ga0070714_100585092
993 Ga0070714_101068032
994 Ga0070714_101325331
995 Ga0070714_101394115
996 Ga0070714_101688715
997 Ga0070713_100001584
998 Ga0070713_100003636
999 Ga0070713_100005353
1000 Ga0070713_100008775
1001 Ga0070713_100039400
1002 Ga0070713_100039484
1003 Ga0070713_100051079
1004 Ga0070713_100078460
1005 Ga0070713_100082259
1006 Ga0070713_100123309
1007 Ga0070713_100157404
1008 Ga0070713_100228002
1009 Ga0070713_100253563
1010 Ga0070713_100430554
1011 Ga0070713_101630353
1012 Ga0070713_101944420
1013 Ga0070713_101996851
1014 Ga0070713_102247332
1015 Ga0070710_10006613
1016 Ga0070710_10007134
1017 Ga0070710_10077685
1018 Ga0070710_10136498
1019 Ga0070710_10162166
1020 Ga0070710_10399702
1021 Ga0070710_10539284
1022 Ga0070711_100000304
1023 Ga0070711_100002768
1024 Ga0070711_100044735
1025 Ga0070711_100064703
1026 Ga0070711_100089806
1027 Ga0070711_100122763
1028 Ga0070711_100193356
1029 Ga0070711_100251176
1030 Ga0070711_101316109
1031 Ga0070700_100500026
1032 Ga0070708_100017677
1033 Ga0070708_100043504
1034 Ga0070708_100326076
1035 Ga0070708_101031473
1036 Ga0070708_101402442
1037 Ga0070663_100642416
1038 Ga0070678_100927794
1039 Ga0070678_101797695
1040 Ga0070662_100009607
1041 Ga0070681_10003101
1042 Ga0070681_10010702
1043 Ga0070681_10212272
1044 Ga0070681_10306699
1045 Ga0070681_10680775
1046 Ga0070681_10747938
1047 Ga0070681_11885225
1048 Ga0068867_100558673
1049 Ga0068867_100641111
1050 Ga0070685_10004730
1051 Ga0070706_100007974
1052 Ga0070706_100040422
1053 Ga0070706_100474403
1054 Ga0070707_100036019
1055 Ga0070707_100330457
1056 Ga0070707_101821524
1057 Ga0070707_101824681
1058 Ga0070698_100030970
1059 Ga0070698_100114500
1060 Ga0070699_100073333
1061 Ga0070699_100236302
1062 Ga0070699_100769605
1063 Ga0070699_100789537
1064 Ga0070679_100090869
1065 Ga0070679_100143641
1066 Ga0070679_100233122
1067 Ga0070679_100263807
1068 Ga0070679_100284058
1069 Ga0070679_100322477
1070 Ga0070684_100041877
1071 Ga0070684_100168299
1072 Ga0070684_100281358
1073 Ga0070684_100938285
1074 Ga0070684_101249744
1075 Ga0070697_100003817
1076 Ga0070697_100396846
1077 Ga0070697_100606679
1078 Ga0070697_100699579
1079 Ga0070697_101199804
1080 Ga0068853_100043786
1081 Ga0068853_100193876
1082 Ga0068853_100492169
1083 Ga0068853_101645966
1084 Ga0070672_101932136
1085 Ga0070695_100099058
1086 Ga0070695_100550550
1087 Ga0070695_100980734
1088 Ga0070696_100373562
1089 Ga0070696_101207436
1090 Ga0070693_100076861
1091 Ga0070693_100132887
1092 Ga0070665_100410887
1093 Ga0070665_101632492
1094 Ga0070704_100804846
1095 Ga0070704_100933335
1096 Ga0068855_100000972
1097 Ga0068855_100005186
1098 Ga0068855_100009464
1099 Ga0068855_100033636
1100 Ga0068855_100153038
1101 Ga0068855_100483881
1102 Ga0068855_100485769
1103 Ga0068855_100945639
1104 Ga0068855_102575346
1105 Ga0070664_100143476
1106 Ga0070664_100160933
1107 Ga0070664_100234733
1108 Ga0068857_100002605
1109 Ga0068857_100274174
1110 Ga0068854_100205476
1111 Ga0068854_100279676
1112 Ga0068854_100755248
1113 Ga0068856_100004248
1114 Ga0068856_100020096
1115 Ga0068856_100025521
1116 Ga0068856_100088690
1117 Ga0068856_100586059
1118 Ga0070702_100019200
1119 Ga0068852_100075447
1120 Ga0068852_100262758
1121 Ga0068852_101612984
1122 Ga0068859_100003437
1123 Ga0068864_100020480
1124 Ga0068864_100408820
1125 Ga0068864_101446899
1126 Ga0068866_10131457
1127 Ga0068866_10777272
1128 Ga0068861_100034627
1129 Ga0068851_10034400
1130 Ga0068851_10416199
1131 Ga0068863_100029798
1132 Ga0068863_100047816
1133 Ga0068863_100115709
1134 Ga0068863_100204477
1135 Ga0068863_100389164
1136 Ga0068863_100606111
1137 Ga0068863_100886200
1138 Ga0068863_102129930
1139 Ga0068858_100005022
1140 Ga0068858_100011419
1141 Ga0068858_100031518
1142 Ga0068858_101765582
1143 Ga0068860_100067480
1144 Ga0068860_100755515
1145 Ga0068860_100895013
1146 Ga0068862_100037543
1147 Ga0068862_100482861
1148 Ga0081540_1078030
1149 Ga0070717_10000295
1150 Ga0070717_10004957
1151 Ga0070717_10015542
1152 Ga0070717_10017181
1153 Ga0070717_10031549
1154 Ga0070717_10045714
1155 Ga0070717_10050470
1156 Ga0070717_10066155
1157 Ga0070717_10096973
1158 Ga0070717_10103290
1159 Ga0070717_10148951
1160 Ga0070717_10180570
1161 Ga0070717_10214751
1162 Ga0070717_10229455
1163 Ga0070717_10302501
1164 Ga0070717_10307428
1165 Ga0070717_10376897
1166 Ga0070717_10456622
1167 Ga0070717_10470271
1168 Ga0070717_10647345
1169 Ga0070717_11279944
1170 Ga0070715_10002640
1171 Ga0070715_10011180
1172 Ga0070715_10199317
1173 Ga0070716_100001322
1174 Ga0070716_100002474
1175 Ga0070716_100027878
1176 Ga0070716_100027945
1177 Ga0070716_100034245
1178 Ga0070716_100112130
1179 Ga0070716_100155142
1180 Ga0070716_100185494
1181 Ga0070716_100219910
1182 Ga0070716_100250737
1183 Ga0070716_100288895
1184 Ga0070716_100295895
1185 Ga0070716_100308263
1186 Ga0070716_100486881
1187 Ga0070712_100000223
1188 Ga0070712_100000236
1189 Ga0070712_100011319
1190 Ga0070712_100021122
1191 Ga0070712_100050450
1192 Ga0070712_100134729
1193 Ga0070712_100492917
1194 Ga0070712_100603930
1195 Ga0070712_100908932
1196 Ga0070712_101045555
1197 Ga0070712_101921951
1198 Ga0097621_100000044
1199 Ga0097621_100002742
1200 Ga0097621_100040523
1201 Ga0097621_100377672
1202 Ga0097621_100490618
1203 Ga0097621_101222235
1204 Ga0068871_100000175
1205 Ga0068871_100001719
1206 Ga0068871_100026987
1207 Ga0068871_100219307
1208 Ga0068871_100283558
1209 Ga0068871_101815748
1210 Ga0075433_10260520
1211 Ga0075434_100000335
1212 Ga0075434_100369517
1213 Ga0068865_100056792
1214 Ga0068865_100074255
1215 Ga0075436_100001801
1216 Ga0075436_100003920
1217 Ga0075436_100239753
1218 Ga0075436_100304335
1219 Ga0075436_100323296
1220 Ga0075436_101114708
1221 Ga0097620_100003437
1222 Ga0075435_100048840
1223 Ga0075435_100495168
1224 Ga0075435_100752283
1225 Ga0099794_10124970
1226 Ga0099795_10018840
1227 Ga0105250_10107831
1228 Ga0105240_10027257
1229 Ga0105240_10035113
1230 Ga0105240_10036142
1231 Ga0105240_10040220
1232 Ga0105240_10054904
1233 Ga0105240_10142982
1234 Ga0105240_10148860
1235 Ga0105240_10164426
1236 Ga0105240_10207914
1237 Ga0105240_10251254
1238 Ga0105245_10092053
1239 Ga0105245_10118472
1240 Ga0105245_10470252
1241 Ga0105245_10500769
1242 Ga0105245_12945637
1243 Ga0105245_13209565
1244 Ga0105247_10101509
1245 Ga0105247_10834597
1246 Ga0105243_12646587
1247 Ga0105241_10019404
1248 Ga0105241_10023082
1249 Ga0105241_10110450
1250 Ga0105241_10242171
1251 Ga0105241_10256801
1252 Ga0105241_10363584
1253 Ga0105241_10637764
1254 Ga0105242_10135087
1255 Ga0105248_10010020
1256 Ga0105248_10021037
1257 Ga0105248_10294208
1258 Ga0105248_10588635
1259 Ga0105248_10664063
1260 Ga0105248_10933154
1261 Ga0105248_11767795
1262 Ga0105237_10084739
1263 Ga0105237_10101879
1264 Ga0105237_10128608
1265 Ga0105237_10216054
1266 Ga0105237_10267542
1267 Ga0105237_10428016
1268 Ga0105237_10954699
1269 Ga0105237_12541651
1270 Ga0105237_12648114
1271 Ga0105238_10000231
1272 Ga0105238_10014889
1273 Ga0105238_10313185
1274 Ga0105238_10417048
1275 Ga0105238_10423724
1276 Ga0105238_10589506
1277 Ga0105238_10925650
1278 Ga0105249_10014329
1279 Ga0099796_10032975
1280 Ga0105239_10031877
1281 Ga0105239_10039280
1282 Ga0105239_10067537
1283 Ga0105239_10101085
1284 Ga0105239_10129627
1285 Ga0105239_10803648
1286 Ga0105239_10866744
1287 Ga0157373_10020821
1288 Ga0157373_10055943
1289 Ga0157373_10180678
1290 Ga0157373_10184089
1291 Ga0157371_10027063
1292 Ga0157371_10512541
1293 Ga0157370_10016753
1294 Ga0157370_10673529
1295 Ga0157370_10690069
1296 Ga0157369_10000319
1297 Ga0157369_10049225
1298 Ga0157369_10104869
1299 Ga0157369_10217413
1300 Ga0157369_10243505
1301 Ga0157369_10358356
1302 Ga0157369_10361747
1303 Ga0157369_10514745
1304 Ga0157374_10000901
1305 Ga0157374_10001359
1306 Ga0157374_10007673
1307 Ga0157374_10019345
1308 Ga0157374_10056203
1309 Ga0157374_10111874
1310 Ga0157374_10131268
1311 Ga0157374_10297037
1312 Ga0157374_10605164
1313 Ga0157374_11039239
1314 Ga0157378_10000222
1315 Ga0157378_10020356
1316 Ga0157378_10084164
1317 Ga0157378_10222787
1318 Ga0157378_11066131
1319 Ga0157378_11409837
1320 Ga0163162_10005111
1321 Ga0163162_10147478
1322 Ga0163162_10308058
1323 Ga0163162_10667306
1324 Ga0157372_10000647
1325 Ga0157372_10000933
1326 Ga0157372_10001310
1327 Ga0157372_10046842
1328 Ga0157372_10088840
1329 Ga0157372_10123425
1330 Ga0157372_10172681
1331 Ga0157372_10177851
1332 Ga0157372_10184882
1333 Ga0157372_10207680
1334 Ga0157372_10268956
1335 Ga0157372_12120254
1336 Ga0157372_12401381
1337 Ga0157372_12582602
1338 Ga0157372_13369076
1339 Ga0157375_10029397
1340 Ga0157375_10244260
1341 Ga0163163_10005018
1342 Ga0163163_10089030
1343 Ga0163163_10092447
1344 Ga0163163_10178013
1345 Ga0163163_10738919
1346 Ga0163163_12690392
1347 Ga0157380_10704498
1348 Ga0182008_10006218
1349 Ga0182008_10027388
1350 Ga0157379_10002644
1351 Ga0157379_10311374
1352 Ga0157379_10331874
1353 Ga0157376_10003294
1354 Ga0157376_10023198
1355 Ga0157376_10050708
1356 Ga0157376_10126510
1357 Ga0157376_10230442
1358 Ga0157376_10477209
1359 Ga0182006_1055778
1360 Ga0182007_10003465
1361 Ga0182007_10017980
1362 Ga0182005_1005531
1363 Ga0163161_11104351
1364 Ga0206356_10337735
1365 Ga0213875_10641175
1366 Ga0224572_1008682
1367 Ga0228598_1017818
1368 Ga0207656_10171531
1369 Ga0207692_10012108
1370 Ga0207692_10020444
1371 Ga0207692_10038160
1372 Ga0207692_10062804
1373 Ga0207692_10386211
1374 Ga0207692_10391142
1375 Ga0207642_10221924
1376 Ga0207642_10356527
1377 Ga0207710_10483000
1378 Ga0207647_10002682
1379 Ga0207647_10318654
1380 Ga0207685_10001253
1381 Ga0207685_10041711
1382 Ga0207685_10061050
1383 Ga0207685_10061675
1384 Ga0207685_10168868
1385 Ga0207699_10003226
1386 Ga0207699_10007415
1387 Ga0207699_10017610
1388 Ga0207699_10024181
1389 Ga0207699_10026450
1390 Ga0207699_10088796
1391 Ga0207699_10139651
1392 Ga0207699_10145547
1393 Ga0207699_10199619
1394 Ga0207699_10213350
1395 Ga0207699_10403968
1396 Ga0207699_10590882
1397 Ga0207699_10672892
1398 Ga0207699_10986158
1399 Ga0207699_11119030
1400 Ga0207699_11163987
1401 Ga0207699_11219850
1402 Ga0207705_10612485
1403 Ga0207684_10007054
1404 Ga0207684_10035594
1405 Ga0207684_10393810
1406 Ga0207684_10668001
1407 Ga0207684_11223001
1408 Ga0207654_10019436
1409 Ga0207654_10024382
1410 Ga0207654_10075943
1411 Ga0207654_10132631
1412 Ga0207654_10142808
1413 Ga0207654_10376621
1414 Ga0207654_10608534
1415 Ga0207707_10005917
1416 Ga0207707_10008015
1417 Ga0207707_10408234
1418 Ga0207707_10554077
1419 Ga0207707_10567344
1420 Ga0207707_10577137
1421 Ga0207695_10037976
1422 Ga0207695_10042469
1423 Ga0207695_10091428
1424 Ga0207695_10138422
1425 Ga0207695_10307675
1426 Ga0207671_10026369
1427 Ga0207671_10035109
1428 Ga0207671_10080424
1429 Ga0207693_10000004
1430 Ga0207693_10000661
1431 Ga0207693_10001237
1432 Ga0207693_10017281
1433 Ga0207693_10030654
1434 Ga0207693_10061416
1435 Ga0207693_10076849
1436 Ga0207693_10326881
1437 Ga0207693_10416193
1438 Ga0207693_10737439
1439 Ga0207693_11389332
1440 Ga0207663_10002276
1441 Ga0207663_10013712
1442 Ga0207663_10014158
1443 Ga0207663_10035487
1444 Ga0207663_10050643
1445 Ga0207663_10081962
1446 Ga0207663_10087605
1447 Ga0207663_10162269
1448 Ga0207663_10209381
1449 Ga0207663_11044331
1450 Ga0207660_10112881
1451 Ga0207660_10286991
1452 Ga0207660_10698111
1453 Ga0207657_10001068
1454 Ga0207649_10232800
1455 Ga0207649_10519706
1456 Ga0207652_10117314
1457 Ga0207652_10259406
1458 Ga0207652_10367517
1459 Ga0207652_10458743
1460 Ga0207652_10528694
1461 Ga0207652_10618594
1462 Ga0207652_10912213
1463 Ga0207646_10086017
1464 Ga0207646_10219265
1465 Ga0207646_10580360
1466 Ga0207646_11357451
1467 Ga0207646_11674527
1468 Ga0207694_10003398
1469 Ga0207694_10194955
1470 Ga0207694_10295630
1471 Ga0207694_10554072
1472 Ga0207650_11047735
1473 Ga0207650_11191221
1474 Ga0207650_11539198
1475 Ga0207650_11849642
1476 Ga0207687_10085277
1477 Ga0207687_10128467
1478 Ga0207687_10348730
1479 Ga0207687_10690727
1480 Ga0207687_11792659
1481 Ga0207700_10000612
1482 Ga0207700_10036330
1483 Ga0207700_10046178
1484 Ga0207700_10121951
1485 Ga0207700_10122219
1486 Ga0207700_10285415
1487 Ga0207700_10312604
1488 Ga0207700_10390348
1489 Ga0207700_10618395
1490 Ga0207700_10632504
1491 Ga0207700_10775013
1492 Ga0207700_10805302
1493 Ga0207700_10862573
1494 Ga0207700_11187755
1495 Ga0207700_11660495
1496 Ga0207664_10011550
1497 Ga0207664_10012644
1498 Ga0207664_10028407
1499 Ga0207664_10038351
1500 Ga0207664_10072881
1501 Ga0207664_10079029
1502 Ga0207664_10102991
1503 Ga0207664_10180930
1504 Ga0207664_10783614
1505 Ga0207664_10786122
1506 Ga0207664_11005151
1507 Ga0207664_11299335
1508 Ga0207664_11639429
1509 Ga0207664_11701905
1510 Ga0207644_10101625
1511 Ga0207644_10424228
1512 Ga0207690_10111779
1513 Ga0207706_10018426
1514 Ga0207709_11583966
1515 Ga0207670_10389670
1516 Ga0207704_10021989
1517 Ga0207704_11140935
1518 Ga0207665_10000225
1519 Ga0207665_10001183
1520 Ga0207665_10005820
1521 Ga0207665_10030106
1522 Ga0207665_10063282
1523 Ga0207665_10097636
1524 Ga0207665_10115699
1525 Ga0207665_10251436
1526 Ga0207665_10278024
1527 Ga0207665_10310919
1528 Ga0207711_10019361
1529 Ga0207711_10042854
1530 Ga0207711_10379144
1531 Ga0207711_11101083
1532 Ga0207689_10002500
1533 Ga0207661_10025645
1534 Ga0207661_11867205
1535 Ga0207661_11917373
1536 Ga0207679_10467059
1537 Ga0207667_10001038
1538 Ga0207667_10005367
1539 Ga0207667_10214773
1540 Ga0207667_10706631
1541 Ga0207667_10863368
1542 Ga0207651_10884283
1543 Ga0207668_11517745
1544 Ga0207640_10065196
1545 Ga0207640_10109442
1546 Ga0207640_10121388
1547 Ga0207677_10003403
1548 Ga0207677_10011172
1549 Ga0207677_10016008
1550 Ga0207677_10053695
1551 Ga0207677_10566382
1552 Ga0207677_11280616
1553 Ga0207703_10007924
1554 Ga0207703_10012076
1555 Ga0207703_10077756
1556 Ga0207639_10027116
1557 Ga0207639_10051364
1558 Ga0207639_10060353
1559 Ga0207639_10316948
1560 Ga0207639_10419839
1561 Ga0207678_10167831
1562 Ga0207702_10001933
1563 Ga0207702_10001993
1564 Ga0207702_10009683
1565 Ga0207702_10130692
1566 Ga0207702_10251402
1567 Ga0207702_10572116
1568 Ga0207641_10008199
1569 Ga0207641_10116722
1570 Ga0207641_10253215
1571 Ga0207641_10989605
1572 Ga0207641_11253753
1573 Ga0207641_11788331
1574 Ga0207648_10659938
1575 Ga0207676_10007565
1576 Ga0207676_10253333
1577 Ga0207676_10924058
1578 Ga0207676_11121205
1579 Ga0207676_11230420
1580 Ga0207674_10001455
1581 Ga0207674_10300731
1582 Ga0207674_10314187
1583 Ga0207683_12139943
1584 Ga0207698_10150932
1585 Ga0207698_10237189
1586 Ga0207698_10529119
1587 Ga0265354_1003448
1588 Ga0265356_1005053
1589 Ga0268266_10291822
1590 Ga0268266_11520024
1591 Ga0268265_10027037
1592 Ga0268264_10389398
1593 Ga0268264_11012424
1594 Ga0268264_11096467
1595 Ga0265338_10030749
1596 Ga0265338_10073770
1597 Ga0265338_10256368
1598 Ga0265338_10318398
1599 Ga0265338_10480849
1600 Ga0265762_1000408
1601 Ga0265762_1003554
1602 Ga0265762_1005006
1603 Ga0265770_1027763
1604 Ga0265764_114287
1605 Ga0265760_10000213
1606 Ga0265760_10004205
1607 Ga0265760_10007276
1608 Ga0265760_10034612
1609 Ga0265332_10467778
1610 Ga0265328_10116311
1611 Ga0265325_10005070
1612 Ga0265340_10055511
1613 Ga0265340_10143502
1614 Ga0265339_10024687
1615 Ga0265339_10181022
1616 Ga0265316_10015838
1617 Ga0265314_10094745
1618 Ga0265342_10039362
1619 Ga0316212_1038967
1620 Ga0316212_1063699
1621 Ga0373926_0016474
1622 Ga0373926_0045972
1623 Ga0373926_0061563
1624 Ga0373934_0097096
1625 Ga0373934_0122691
1626 Ga0373923_0122164
1627 Ga0373936_0009197
1628 Ga0373936_0037708
1629 Ga0373941_0444124
1630 Ga0373945_0005782
1631 Ga0373945_0049127
1632 Ga0373945_0176729
1633 Ga0373954_0066602
1634 Ga0373956_0059902
1635 Ga0373957_0134144
1636 Ga0373943_0000085
1637 Ga0373943_0048492
1638 Ga0373943_0134763
1639 Ga0373943_0215840
1640 Ga0373946_0058692
1641 Ga0373946_0100904
1642 Ga0373946_0107651
1643 Ga0373946_0170064
1644 Ga0373955_0208249
1645 Ga0373924_0109723
1646 Ga0373924_0248057
1647 Ga0373931_0318883
1648 Ga0373931_0669179
1649 Ga0373931_1069037
1650 Ga0373935_0001031
1651 Ga0373935_0015379
1652 Ga0373935_0309144
1653 Ga0373935_0379497
1654 Ga0373935_1116205
1655 Ga0373927_0001082
1656 Ga0373927_0040505
1657 Ga0373927_0040613
1658 Ga0373927_0106298
1659 Ga0373927_0124732
1660 Ga0373933_0073289
1661 Ga0373933_0125327
1662 Ga0373933_0304677
1663 Ga0373933_0332315
1664 Ga0373933_0470446
1665 Ga0373933_0747353
1666 Ga0373933_0974300
1667 Ga0373947_0000049
1668 Ga0373947_0001548
1669 Ga0373947_0214641
1670 Ga0373947_0943140
1671 Ga0373947_1213543
1672 Ga0373937_0019523
1673 Ga0373937_0146471
1674 Ga0373937_0282869
1675 Ga0373937_0331159
1676 Ga0373937_0440287
1677 Ga0373937_0601758
1678 Ga0373937_1614317
1679 Ga0373937_1847743
1680 Ga0373925_0005729
1681 Ga0373925_0014322
1682 Ga0373925_0044341
1683 Ga0373925_0160606
1684 Ga0373925_0178178
1685 Ga0373925_0211267
1686 Ga0373925_0243591
1687 Ga0373925_0333680
1688 Ga0373925_0784451
1689 Ga0373925_1098723
1690 Ga0395905_0546427
1691 Ga0395905_0622457
1692 Ga0395905_1473652
1693 Ga0436364_0453284
1694 Ga0395901_1355861
1695 Ga0436365_0198018
1696 Ga0436362_0459014
1697 Ga0436362_1141864
1698 Ga0451577_0000969
1699 Ga0451577_0069818
1700 Ga0451577_0624243
1701 Ga0453683_0017766
1702 Ga0453683_0205030
1703 Ga0466963_0055738
1704 Ga0466964_0200333
1705 Ga0453684_0000803
1706 Ga0466971_0039414
1707 Ga0466968_0539834
1708 Ga0466970_0193949
1709 Ga0466957_0457233
1710 Ga0466959_0249159
1711 Ga0451576_0005970
1712 Ga0451576_0036048
1713 Ga0451576_0132089
1714 Ga0451576_0176295
1715 Ga0451576_0401206
1716 Ga0451576_1900089
1717 Ga0466958_0064705
1718 Ga0466967_0092023
1719 Ga0466967_0478250
1720 Ga0495592_0637107
1721 Ga0495590_0274944
1722 Ga0495590_0402328
1723 Ga0495629_0044791
1724 Ga0495651_0442058
1725 Ga0495653_0154602
1726 Ga0495653_0407453
1727 Ga0495580_0000220
1728 Ga0495580_0000263
1729 Ga0495580_0001602
1730 Ga0495580_0002575
1731 Ga0495580_0003289
1732 Ga0495580_0017694
1733 Ga0495580_0027327
1734 Ga0495580_0049565
1735 Ga0495580_0174420
1736 Ga0495580_0214969
1737 Ga0495580_0235848
1738 Ga0495580_0273454
1739 Ga0495580_0277564
1740 Ga0495580_0294311
1741 Ga0495580_0298856
1742 Ga0495580_0419517
1743 Ga0495580_0703147
1744 Ga0495582_0000514
1745 Ga0495582_0022061
1746 Ga0495582_0344639
1747 Ga0495662_0326178
1748 Ga0495584_0029788
1749 Ga0495594_0132819
1750 Ga0495608_0323454
1751 Ga0495628_0059400
1752 Ga0495628_0575916
1753 Ga0495630_0056141
1754 Ga0495630_0067683
1755 Ga0495630_0183716
1756 Ga0495630_0259382
1757 Ga0495630_0543698
1758 Ga0495665_0073732
1759 Ga0495665_0185027
1760 Ga0495665_0208588
1761 Ga0495665_0577926
1762 Ga0495640_0779097
1763 Ga0495586_0152627
1764 Ga0495587_0408013
1765 Ga0495587_0481983
1766 Ga0495667_0402436
1767 Ga0495667_0715297
1768 Ga0495635_0121462
1769 Ga0495635_0239539
1770 Ga0495659_0109058
1771 Ga0495599_0104319
1772 Ga0495623_0107968
1773 Ga0495623_0274887
1774 Ga0495623_0716922
1775 Ga0495658_0025033
1776 Ga0495669_0009634
1777 Ga0495669_0231099
1778 Ga0495669_0474592
1779 Ga0495613_0843373
1780 Ga0495581_0251228
1781 Ga0495581_0470946
1782 Ga0495674_0003000
1783 Ga0495674_0012646
1784 Ga0495674_0170785
1785 Ga0495676_0656097
1786 Ga0495680_0521540
1787 Ga0495684_0810390
1788 Ga0495684_0987222
1789 Ga0495602_0072611
1790 Ga0495602_0251730
1791 Ga0495602_0373851
1792 Ga0495602_1038662
1793 Ga0496100_0720495
1794 Ga0496101_0042051
1795 Ga0496101_0076992
1796 Ga0496101_0193841
1797 Ga0496101_0965482
1798 Ga0496102_0001130
1799 Ga0496102_0018819
1800 Ga0496102_0063214
1801 Ga0496102_0452841
1802 Ga0496102_0528760
1803 Ga0496102_0608861
1804 Ga0496103_0132462
1805 Ga0496103_0394144
1806 Ga0496104_0041510
1807 Ga0496104_0185833
1808 Ga0496104_0220682
1809 Ga0496105_0165330
1810 Ga0496105_0691099
1811 Ga0496105_0696593
1812 Ga0496106_0073256
1813 Ga0496106_0817712
1814 Ga0496106_1019993
1815 Ga0496106_1331003
1816 Ga0496107_0472374
1817 Ga0496107_0518713
1818 Ga0496108_0067665
1819 Ga0496108_0214874
1820 Ga0496108_0969182
1821 Ga0496108_1185965
1822 Ga0496109_0171357
1823 Ga0496109_0974792
1824 Ga0496109_1307603
1825 Ga0496110_0123632
1826 Ga0496111_0069793
1827 Ga0496112_0013920
1828 Ga0496112_0056580
1829 Ga0496112_0088725
1830 Ga0496112_0122496
1831 Ga0496112_0318216
1832 Ga0496112_0341361
1833 Ga0496112_0363564
1834 Ga0496112_0372351
1835 Ga0496112_0378184
1836 Ga0496112_0518669
1837 Ga0496113_0112321
1838 Ga0496113_0429341
1839 Ga0496113_0973295
1840 Ga0496114_0328654
1841 Ga0496115_0158300
1842 Ga0496115_0253098
1843 Ga0496115_0477463
1844 Ga0501069_0105077
1845 nmdc:mga0n895_430136_c1
1846 nmdc:mga0n895_5582_c1
1847 nmdc:mga0rr50_1070148_c1
1848 nmdc:mga0rr50_357297_c1
1849 nmdc:mga0rr50_41511_c1
1850 nmdc:mga0rr50_450683_c1
1851 nmdc:mga08x19_22909_c1
1852 nmdc:mga08x19_75917_c1
1853 nmdc:mga08x19_9368_c1
1854 nmdc:mga08x19_985335_c1
1855 nmdc:mga0a205_81157_c1
1856 Ga0495612_0348081
1857 Ga0495612_0486955
1858 Ga0495619_0260355
1859 Ga0495619_0625759
1860 Ga0587070_179775
1861 Ga0587080_129361
1862 Ga0587088_100257
1863 Ga0587117_092631
1864 Ga0466962_0041521

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02641

DUF190

Uncharacterized ACR, COG1993

23

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.8975 6 105
2dcl-assembly1.cif.gz_B-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8758 2 107
2dcl-assembly1.cif.gz_C-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.875 5 103
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.8693 6 105
2dcl-assembly1.cif.gz_A-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8543 6 109
ID Description Score Start End Superfamily
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8923 6 105 3.30.70.120
af_P95087_1_117_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8819 3 105 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.875 5 103 3.30.70.120
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.873 6 105 3.30.70.120
af_Q58919_1_108_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8651 6 107 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A2P6WH30-F1-model_v4 Uncharacterized protein 0.947 5 109
AF-A0A7C1NV81-F1-model_v4 Chloride channel protein 0.9315 6 101 GO:0005247
GO:0016020
AF-A0A2V9WHL6-F1-model_v4 DUF190 domain-containing protein 0.9299 1 74
AF-A0A2V9ULK1-F1-model_v4 Uncharacterized protein 0.9297 1 109
AF-A0A378LQY1-F1-model_v4 Uncharacterized ACR, COG1993 0.922 6 103

Map