F486060
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 932 | 280 | 1864 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100612543|Ga0070713_1006125432 |
| Length | 125 |
| Sequence | MFINRRGMFLGEIASKMPGAMAVQVTIYLNEADQWHHRPLHMEILNYLRKENAYAATAIHCVAGFLGRHRVETAHLVEAGGKLPVIIVFVDTDEHVNRVLPTLKEMAAHRLIVRENVVLEQGNLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 113 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 166 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 184 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 185 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 209 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 210 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.5 |
| Metatranscriptomes | 1.5 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.47 |
| Rhizosphere | 93.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 28.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100612543 | 3300005436 | Bacteria | 1035 |
| 2 | LJNas_1000206 | 3300000546 | Bacteria | 10013 |
| 3 | rootH1_10200571 | 3300003323 | Bacteria | 1455 |
| 4 | Ga0065704_10652891 | 3300005289 | Unclassified | 582 |
| 5 | Ga0065712_10164499 | 3300005290 | Bacteria | 1281 |
| 6 | Ga0065712_10679101 | 3300005290 | Unclassified | 555 |
| 7 | Ga0065715_10246143 | 3300005293 | Bacteria | 1183 |
| 8 | Ga0070658_10859216 | 3300005327 | Bacteria | 789 |
| 9 | Ga0070683_100212022 | 3300005329 | Bacteria | 1840 |
| 10 | Ga0070683_101135179 | 3300005329 | Unclassified | 751 |
| 11 | Ga0070690_100033150 | 3300005330 | Unclassified | 3231 |
| 12 | Ga0070690_101507809 | 3300005330 | Unclassified | 543 |
| 13 | Ga0070670_100282565 | 3300005331 | Bacteria | 1449 |
| 14 | Ga0070670_100847058 | 3300005331 | Bacteria | 827 |
| 15 | Ga0070670_101046804 | 3300005331 | Bacteria | 743 |
| 16 | Ga0068869_100016525 | 3300005334 | Unclassified | 4976 |
| 17 | Ga0068869_100489440 | 3300005334 | Bacteria | 1025 |
| 18 | Ga0070680_101471809 | 3300005336 | Unclassified | 590 |
| 19 | Ga0068868_100004274 | 3300005338 | Bacteria | 9999 |
| 20 | Ga0068868_100010136 | 3300005338 | Bacteria | 6809 |
| 21 | Ga0068868_100015485 | 3300005338 | Bacteria | 5641 |
| 22 | Ga0068868_100067612 | 3300005338 | Bacteria | 2844 |
| 23 | Ga0068868_100233080 | 3300005338 | Bacteria | 1545 |
| 24 | Ga0068868_101547983 | 3300005338 | Bacteria | 622 |
| 25 | Ga0070660_100182966 | 3300005339 | Unclassified | 1696 |
| 26 | Ga0070660_100226820 | 3300005339 | Bacteria | 1519 |
| 27 | Ga0070689_100347447 | 3300005340 | Bacteria | 1243 |
| 28 | Ga0070691_10023427 | 3300005341 | Bacteria | 2867 |
| 29 | Ga0070661_100111181 | 3300005344 | Bacteria | 2046 |
| 30 | Ga0070671_100036167 | 3300005355 | Bacteria | 4094 |
| 31 | Ga0070671_100150911 | 3300005355 | Unclassified | 1962 |
| 32 | Ga0070671_100432105 | 3300005355 | Unclassified | 1128 |
| 33 | Ga0070673_100148050 | 3300005364 | Bacteria | 1986 |
| 34 | Ga0070673_100259368 | 3300005364 | Bacteria | 1518 |
| 35 | Ga0070673_101018997 | 3300005364 | Bacteria | 771 |
| 36 | Ga0070688_100195036 | 3300005365 | Unclassified | 1413 |
| 37 | Ga0070688_101610823 | 3300005365 | Unclassified | 530 |
| 38 | Ga0070659_100019631 | 3300005366 | Bacteria | 5126 |
| 39 | Ga0070709_10003985 | 3300005434 | Bacteria | 7968 |
| 40 | Ga0070709_10012423 | 3300005434 | Unclassified | 4768 |
| 41 | Ga0070709_10020202 | 3300005434 | Bacteria | 3861 |
| 42 | Ga0070709_10021039 | 3300005434 | Bacteria | 3797 |
| 43 | Ga0070709_10024221 | 3300005434 | Bacteria | 3571 |
| 44 | Ga0070709_10035156 | 3300005434 | Bacteria | 3043 |
| 45 | Ga0070709_10206659 | 3300005434 | Unclassified | 1393 |
| 46 | Ga0070709_10298093 | 3300005434 | Unclassified | 1177 |
| 47 | Ga0070709_10556611 | 3300005434 | Unclassified | 878 |
| 48 | Ga0070709_11227128 | 3300005434 | Unclassified | 603 |
| 49 | Ga0070709_11400587 | 3300005434 | Unclassified | 566 |
| 50 | Ga0070714_100000027 | 3300005435 | Bacteria | 141750 |
| 51 | Ga0070714_100002201 | 3300005435 | Bacteria | 14355 |
| 52 | Ga0070714_100076096 | 3300005435 | Bacteria | 2913 |
| 53 | Ga0070714_100127151 | 3300005435 | Bacteria | 2274 |
| 54 | Ga0070714_100146116 | 3300005435 | Unclassified | 2127 |
| 55 | Ga0070714_100296172 | 3300005435 | Bacteria | 1507 |
| 56 | Ga0070714_100411638 | 3300005435 | Unclassified | 1280 |
| 57 | Ga0070714_100462397 | 3300005435 | Bacteria | 1206 |
| 58 | Ga0070714_100464821 | 3300005435 | Unclassified | 1203 |
| 59 | Ga0070714_100509808 | 3300005435 | Bacteria | 1148 |
| 60 | Ga0070714_100585092 | 3300005435 | Bacteria | 1071 |
| 61 | Ga0070714_101068032 | 3300005435 | Unclassified | 786 |
| 62 | Ga0070714_101325331 | 3300005435 | Bacteria | 703 |
| 63 | Ga0070714_101394115 | 3300005435 | Bacteria | 684 |
| 64 | Ga0070714_101688715 | 3300005435 | Unclassified | 618 |
| 65 | Ga0070713_100001584 | 3300005436 | Bacteria | 14570 |
| 66 | Ga0070713_100003636 | 3300005436 | Bacteria | 10200 |
| 67 | Ga0070713_100005353 | 3300005436 | Bacteria | 8763 |
| 68 | Ga0070713_100008775 | 3300005436 | Bacteria | 7193 |
| 69 | Ga0070713_100039400 | 3300005436 | Bacteria | 3834 |
| 70 | Ga0070713_100039484 | 3300005436 | Bacteria | 3831 |
| 71 | Ga0070713_100051079 | 3300005436 | Bacteria | 3419 |
| 72 | Ga0070713_100078460 | 3300005436 | Bacteria | 2811 |
| 73 | Ga0070713_100082259 | 3300005436 | Unclassified | 2749 |
| 74 | Ga0070713_100123309 | 3300005436 | Bacteria | 2275 |
| 75 | Ga0070713_100157404 | 3300005436 | Bacteria | 2026 |
| 76 | Ga0070713_100228002 | 3300005436 | Bacteria | 1692 |
| 77 | Ga0070713_100253563 | 3300005436 | Bacteria | 1606 |
| 78 | Ga0070713_100430554 | 3300005436 | Bacteria | 1236 |
| 79 | Ga0070713_101630353 | 3300005436 | Unclassified | 626 |
| 80 | Ga0070713_101944420 | 3300005436 | Unclassified | 571 |
| 81 | Ga0070713_101996851 | 3300005436 | Unclassified | 563 |
| 82 | Ga0070713_102247332 | 3300005436 | Unclassified | 528 |
| 83 | Ga0070710_10006613 | 3300005437 | Bacteria | 5573 |
| 84 | Ga0070710_10007134 | 3300005437 | Bacteria | 5398 |
| 85 | Ga0070710_10077685 | 3300005437 | Bacteria | 1930 |
| 86 | Ga0070710_10136498 | 3300005437 | Bacteria | 1500 |
| 87 | Ga0070710_10162166 | 3300005437 | Bacteria | 1387 |
| 88 | Ga0070710_10399702 | 3300005437 | Unclassified | 921 |
| 89 | Ga0070710_10539284 | 3300005437 | Bacteria | 804 |
| 90 | Ga0070711_100000304 | 3300005439 | Bacteria | 25467 |
| 91 | Ga0070711_100002768 | 3300005439 | Bacteria | 10061 |
| 92 | Ga0070711_100044735 | 3300005439 | Bacteria | 3006 |
| 93 | Ga0070711_100064703 | 3300005439 | Bacteria | 2556 |
| 94 | Ga0070711_100089806 | 3300005439 | Unclassified | 2211 |
| 95 | Ga0070711_100122763 | 3300005439 | Bacteria | 1923 |
| 96 | Ga0070711_100193356 | 3300005439 | Bacteria | 1565 |
| 97 | Ga0070711_100251176 | 3300005439 | Unclassified | 1387 |
| 98 | Ga0070711_101316109 | 3300005439 | Unclassified | 627 |
| 99 | Ga0070700_100500026 | 3300005441 | Bacteria | 935 |
| 100 | Ga0070708_100017677 | 3300005445 | Bacteria | 5953 |
| 101 | Ga0070708_100043504 | 3300005445 | Unclassified | 3946 |
| 102 | Ga0070708_100326076 | 3300005445 | Bacteria | 1446 |
| 103 | Ga0070708_101031473 | 3300005445 | Bacteria | 771 |
| 104 | Ga0070708_101402442 | 3300005445 | Unclassified | 652 |
| 105 | Ga0070663_100642416 | 3300005455 | Bacteria | 897 |
| 106 | Ga0070678_100927794 | 3300005456 | Unclassified | 797 |
| 107 | Ga0070678_101797695 | 3300005456 | Unclassified | 578 |
| 108 | Ga0070662_100009607 | 3300005457 | Bacteria | 6327 |
| 109 | Ga0070681_10003101 | 3300005458 | Bacteria | 15440 |
| 110 | Ga0070681_10010702 | 3300005458 | Bacteria | 9065 |
| 111 | Ga0070681_10212272 | 3300005458 | Bacteria | 1851 |
| 112 | Ga0070681_10306699 | 3300005458 | Bacteria | 1497 |
| 113 | Ga0070681_10680775 | 3300005458 | Bacteria | 944 |
| 114 | Ga0070681_10747938 | 3300005458 | Bacteria | 894 |
| 115 | Ga0070681_11885225 | 3300005458 | Unclassified | 525 |
| 116 | Ga0068867_100558673 | 3300005459 | Unclassified | 992 |
| 117 | Ga0068867_100641111 | 3300005459 | Unclassified | 931 |
| 118 | Ga0070685_10004730 | 3300005466 | Bacteria | 6893 |
| 119 | Ga0070706_100007974 | 3300005467 | Bacteria | 9882 |
| 120 | Ga0070706_100040422 | 3300005467 | Bacteria | 4305 |
| 121 | Ga0070706_100474403 | 3300005467 | Unclassified | 1164 |
| 122 | Ga0070707_100036019 | 3300005468 | Bacteria | 4721 |
| 123 | Ga0070707_100330457 | 3300005468 | Bacteria | 1481 |
| 124 | Ga0070707_101821524 | 3300005468 | Bacteria | 576 |
| 125 | Ga0070707_101824681 | 3300005468 | Unclassified | 575 |
| 126 | Ga0070698_100030970 | 3300005471 | Bacteria | 5548 |
| 127 | Ga0070698_100114500 | 3300005471 | Bacteria | 2661 |
| 128 | Ga0070699_100073333 | 3300005518 | Bacteria | 2978 |
| 129 | Ga0070699_100236302 | 3300005518 | Bacteria | 1630 |
| 130 | Ga0070699_100769605 | 3300005518 | Unclassified | 881 |
| 131 | Ga0070699_100789537 | 3300005518 | Bacteria | 869 |
| 132 | Ga0070679_100090869 | 3300005530 | Bacteria | 3041 |
| 133 | Ga0070679_100143641 | 3300005530 | Bacteria | 2365 |
| 134 | Ga0070679_100233122 | 3300005530 | Bacteria | 1800 |
| 135 | Ga0070679_100263807 | 3300005530 | Bacteria | 1677 |
| 136 | Ga0070679_100284058 | 3300005530 | Bacteria | 1607 |
| 137 | Ga0070679_100322477 | 3300005530 | Bacteria | 1494 |
| 138 | Ga0070684_100041877 | 3300005535 | Bacteria | 3951 |
| 139 | Ga0070684_100168299 | 3300005535 | Unclassified | 1990 |
| 140 | Ga0070684_100281358 | 3300005535 | Bacteria | 1524 |
| 141 | Ga0070684_100938285 | 3300005535 | Unclassified | 811 |
| 142 | Ga0070684_101249744 | 3300005535 | Unclassified | 699 |
| 143 | Ga0070697_100003817 | 3300005536 | Bacteria | 11573 |
| 144 | Ga0070697_100396846 | 3300005536 | Unclassified | 1196 |
| 145 | Ga0070697_100606679 | 3300005536 | Unclassified | 962 |
| 146 | Ga0070697_100699579 | 3300005536 | Unclassified | 894 |
| 147 | Ga0070697_101199804 | 3300005536 | Unclassified | 676 |
| 148 | Ga0068853_100043786 | 3300005539 | Bacteria | 3829 |
| 149 | Ga0068853_100193876 | 3300005539 | Bacteria | 1847 |
| 150 | Ga0068853_100492169 | 3300005539 | Bacteria | 1157 |
| 151 | Ga0068853_101645966 | 3300005539 | Unclassified | 622 |
| 152 | Ga0070672_101932136 | 3300005543 | Unclassified | 531 |
| 153 | Ga0070695_100099058 | 3300005545 | Unclassified | 1960 |
| 154 | Ga0070695_100550550 | 3300005545 | Bacteria | 899 |
| 155 | Ga0070695_100980734 | 3300005545 | Bacteria | 686 |
| 156 | Ga0070696_100373562 | 3300005546 | Unclassified | 1109 |
| 157 | Ga0070696_101207436 | 3300005546 | Bacteria | 639 |
| 158 | Ga0070693_100076861 | 3300005547 | Bacteria | 1980 |
| 159 | Ga0070693_100132887 | 3300005547 | Bacteria | 1558 |
| 160 | Ga0070665_100410887 | 3300005548 | Bacteria | 1362 |
| 161 | Ga0070665_101632492 | 3300005548 | Bacteria | 652 |
| 162 | Ga0070704_100804846 | 3300005549 | Bacteria | 840 |
| 163 | Ga0070704_100933335 | 3300005549 | Bacteria | 782 |
| 164 | Ga0068855_100000972 | 3300005563 | Bacteria | 35721 |
| 165 | Ga0068855_100005186 | 3300005563 | Bacteria | 15894 |
| 166 | Ga0068855_100009464 | 3300005563 | Bacteria | 11768 |
| 167 | Ga0068855_100033636 | 3300005563 | Bacteria | 6116 |
| 168 | Ga0068855_100153038 | 3300005563 | Unclassified | 2622 |
| 169 | Ga0068855_100483881 | 3300005563 | Bacteria | 1347 |
| 170 | Ga0068855_100485769 | 3300005563 | Unclassified | 1344 |
| 171 | Ga0068855_100945639 | 3300005563 | Bacteria | 908 |
| 172 | Ga0068855_102575346 | 3300005563 | Bacteria | 505 |
| 173 | Ga0070664_100143476 | 3300005564 | Bacteria | 2104 |
| 174 | Ga0070664_100160933 | 3300005564 | Bacteria | 1986 |
| 175 | Ga0070664_100234733 | 3300005564 | Unclassified | 1645 |
| 176 | Ga0068857_100002605 | 3300005577 | Bacteria | 14798 |
| 177 | Ga0068857_100274174 | 3300005577 | Bacteria | 1551 |
| 178 | Ga0068854_100205476 | 3300005578 | Bacteria | 1551 |
| 179 | Ga0068854_100279676 | 3300005578 | Bacteria | 1343 |
| 180 | Ga0068854_100755248 | 3300005578 | Unclassified | 844 |
| 181 | Ga0068856_100004248 | 3300005614 | Bacteria | 14304 |
| 182 | Ga0068856_100020096 | 3300005614 | Bacteria | 6486 |
| 183 | Ga0068856_100025521 | 3300005614 | Bacteria | 5763 |
| 184 | Ga0068856_100088690 | 3300005614 | Bacteria | 3075 |
| 185 | Ga0068856_100586059 | 3300005614 | Unclassified | 1136 |
| 186 | Ga0070702_100019200 | 3300005615 | Bacteria | 3560 |
| 187 | Ga0068852_100075447 | 3300005616 | Bacteria | 2974 |
| 188 | Ga0068852_100262758 | 3300005616 | Bacteria | 1658 |
| 189 | Ga0068852_101612984 | 3300005616 | Unclassified | 671 |
| 190 | Ga0068859_100003437 | 3300005617 | Bacteria | 16100 |
| 191 | Ga0068864_100020480 | 3300005618 | Bacteria | 5534 |
| 192 | Ga0068864_100408820 | 3300005618 | Bacteria | 1291 |
| 193 | Ga0068864_101446899 | 3300005618 | Unclassified | 689 |
| 194 | Ga0068866_10131457 | 3300005718 | Bacteria | 1424 |
| 195 | Ga0068866_10777272 | 3300005718 | Bacteria | 664 |
| 196 | Ga0068861_100034627 | 3300005719 | Bacteria | 3735 |
| 197 | Ga0068851_10034400 | 3300005834 | Bacteria | 2530 |
| 198 | Ga0068851_10416199 | 3300005834 | Bacteria | 793 |
| 199 | Ga0068863_100029798 | 3300005841 | Bacteria | 5211 |
| 200 | Ga0068863_100047816 | 3300005841 | Unclassified | 4057 |
| 201 | Ga0068863_100115709 | 3300005841 | Bacteria | 2555 |
| 202 | Ga0068863_100204477 | 3300005841 | Bacteria | 1900 |
| 203 | Ga0068863_100389164 | 3300005841 | Bacteria | 1362 |
| 204 | Ga0068863_100606111 | 3300005841 | Bacteria | 1084 |
| 205 | Ga0068863_100886200 | 3300005841 | Bacteria | 892 |
| 206 | Ga0068863_102129930 | 3300005841 | Bacteria | 571 |
| 207 | Ga0068858_100005022 | 3300005842 | Bacteria | 12966 |
| 208 | Ga0068858_100011419 | 3300005842 | Bacteria | 8385 |
| 209 | Ga0068858_100031518 | 3300005842 | Unclassified | 4925 |
| 210 | Ga0068858_101765582 | 3300005842 | Unclassified | 611 |
| 211 | Ga0068860_100067480 | 3300005843 | Bacteria | 3399 |
| 212 | Ga0068860_100755515 | 3300005843 | Bacteria | 984 |
| 213 | Ga0068860_100895013 | 3300005843 | Bacteria | 903 |
| 214 | Ga0068862_100037543 | 3300005844 | Bacteria | 4106 |
| 215 | Ga0068862_100482861 | 3300005844 | Bacteria | 1173 |
| 216 | Ga0081540_1078030 | 3300005983 | Unclassified | 1503 |
| 217 | Ga0070717_10000295 | 3300006028 | Bacteria | 33556 |
| 218 | Ga0070717_10004957 | 3300006028 | Bacteria | 9683 |
| 219 | Ga0070717_10015542 | 3300006028 | Bacteria | 5884 |
| 220 | Ga0070717_10017181 | 3300006028 | Bacteria | 5623 |
| 221 | Ga0070717_10031549 | 3300006028 | Bacteria | 4264 |
| 222 | Ga0070717_10045714 | 3300006028 | Bacteria | 3580 |
| 223 | Ga0070717_10050470 | 3300006028 | Bacteria | 3420 |
| 224 | Ga0070717_10066155 | 3300006028 | Bacteria | 3006 |
| 225 | Ga0070717_10096973 | 3300006028 | Bacteria | 2498 |
| 226 | Ga0070717_10103290 | 3300006028 | Bacteria | 2423 |
| 227 | Ga0070717_10148951 | 3300006028 | Bacteria | 2023 |
| 228 | Ga0070717_10180570 | 3300006028 | Bacteria | 1839 |
| 229 | Ga0070717_10214751 | 3300006028 | Unclassified | 1689 |
| 230 | Ga0070717_10229455 | 3300006028 | Unclassified | 1634 |
| 231 | Ga0070717_10302501 | 3300006028 | Bacteria | 1422 |
| 232 | Ga0070717_10307428 | 3300006028 | Bacteria | 1410 |
| 233 | Ga0070717_10376897 | 3300006028 | Bacteria | 1272 |
| 234 | Ga0070717_10456622 | 3300006028 | Bacteria | 1152 |
| 235 | Ga0070717_10470271 | 3300006028 | Unclassified | 1134 |
| 236 | Ga0070717_10647345 | 3300006028 | Bacteria | 959 |
| 237 | Ga0070717_11279944 | 3300006028 | Unclassified | 667 |
| 238 | Ga0070715_10002640 | 3300006163 | Bacteria | 5549 |
| 239 | Ga0070715_10011180 | 3300006163 | Bacteria | 3225 |
| 240 | Ga0070715_10199317 | 3300006163 | Bacteria | 1016 |
| 241 | Ga0070716_100001322 | 3300006173 | Bacteria | 10959 |
| 242 | Ga0070716_100002474 | 3300006173 | Bacteria | 8528 |
| 243 | Ga0070716_100027878 | 3300006173 | Bacteria | 3039 |
| 244 | Ga0070716_100027945 | 3300006173 | Unclassified | 3036 |
| 245 | Ga0070716_100034245 | 3300006173 | Bacteria | 2783 |
| 246 | Ga0070716_100112130 | 3300006173 | Unclassified | 1692 |
| 247 | Ga0070716_100155142 | 3300006173 | Bacteria | 1477 |
| 248 | Ga0070716_100185494 | 3300006173 | Unclassified | 1370 |
| 249 | Ga0070716_100219910 | 3300006173 | Unclassified | 1275 |
| 250 | Ga0070716_100250737 | 3300006173 | Bacteria | 1206 |
| 251 | Ga0070716_100288895 | 3300006173 | Bacteria | 1135 |
| 252 | Ga0070716_100295895 | 3300006173 | Bacteria | 1124 |
| 253 | Ga0070716_100308263 | 3300006173 | Bacteria | 1104 |
| 254 | Ga0070716_100486881 | 3300006173 | Bacteria | 907 |
| 255 | Ga0070712_100000223 | 3300006175 | Bacteria | 31964 |
| 256 | Ga0070712_100000236 | 3300006175 | Bacteria | 30874 |
| 257 | Ga0070712_100011319 | 3300006175 | Bacteria | 5652 |
| 258 | Ga0070712_100021122 | 3300006175 | Unclassified | 4270 |
| 259 | Ga0070712_100050450 | 3300006175 | Bacteria | 2895 |
| 260 | Ga0070712_100134729 | 3300006175 | Bacteria | 1876 |
| 261 | Ga0070712_100492917 | 3300006175 | Bacteria | 1026 |
| 262 | Ga0070712_100603930 | 3300006175 | Bacteria | 929 |
| 263 | Ga0070712_100908932 | 3300006175 | Unclassified | 759 |
| 264 | Ga0070712_101045555 | 3300006175 | Bacteria | 708 |
| 265 | Ga0070712_101921951 | 3300006175 | Unclassified | 518 |
| 266 | Ga0097621_100000044 | 3300006237 | Bacteria | 65368 |
| 267 | Ga0097621_100002742 | 3300006237 | Bacteria | 12046 |
| 268 | Ga0097621_100040523 | 3300006237 | Bacteria | 3745 |
| 269 | Ga0097621_100377672 | 3300006237 | Bacteria | 1265 |
| 270 | Ga0097621_100490618 | 3300006237 | Unclassified | 1111 |
| 271 | Ga0097621_101222235 | 3300006237 | Unclassified | 708 |
| 272 | Ga0068871_100000175 | 3300006358 | Bacteria | 43254 |
| 273 | Ga0068871_100001719 | 3300006358 | Bacteria | 14733 |
| 274 | Ga0068871_100026987 | 3300006358 | Bacteria | 4487 |
| 275 | Ga0068871_100219307 | 3300006358 | Bacteria | 1647 |
| 276 | Ga0068871_100283558 | 3300006358 | Unclassified | 1450 |
| 277 | Ga0068871_101815748 | 3300006358 | Unclassified | 579 |
| 278 | Ga0075433_10260520 | 3300006852 | Bacteria | 1537 |
| 279 | Ga0075434_100000335 | 3300006871 | Bacteria | 33966 |
| 280 | Ga0075434_100369517 | 3300006871 | Bacteria | 1455 |
| 281 | Ga0068865_100056792 | 3300006881 | Bacteria | 2728 |
| 282 | Ga0068865_100074255 | 3300006881 | Bacteria | 2421 |
| 283 | Ga0075436_100001801 | 3300006914 | Bacteria | 14685 |
| 284 | Ga0075436_100003920 | 3300006914 | Bacteria | 10199 |
| 285 | Ga0075436_100239753 | 3300006914 | Bacteria | 1289 |
| 286 | Ga0075436_100304335 | 3300006914 | Bacteria | 1143 |
| 287 | Ga0075436_100323296 | 3300006914 | Bacteria | 1108 |
| 288 | Ga0075436_101114708 | 3300006914 | Bacteria | 594 |
| 289 | Ga0097620_100003437 | 3300006931 | Bacteria | 16100 |
| 290 | Ga0075435_100048840 | 3300007076 | Unclassified | 3401 |
| 291 | Ga0075435_100495168 | 3300007076 | Bacteria | 1056 |
| 292 | Ga0075435_100752283 | 3300007076 | Bacteria | 848 |
| 293 | Ga0099794_10124970 | 3300007265 | Bacteria | 1296 |
| 294 | Ga0099795_10018840 | 3300007788 | Bacteria | 2225 |
| 295 | Ga0105250_10107831 | 3300009092 | Unclassified | 1139 |
| 296 | Ga0105240_10027257 | 3300009093 | Bacteria | 7483 |
| 297 | Ga0105240_10035113 | 3300009093 | Bacteria | 6465 |
| 298 | Ga0105240_10036142 | 3300009093 | Bacteria | 6357 |
| 299 | Ga0105240_10040220 | 3300009093 | Bacteria | 5983 |
| 300 | Ga0105240_10054904 | 3300009093 | Bacteria | 4990 |
| 301 | Ga0105240_10142982 | 3300009093 | Bacteria | 2858 |
| 302 | Ga0105240_10148860 | 3300009093 | Bacteria | 2790 |
| 303 | Ga0105240_10164426 | 3300009093 | Bacteria | 2633 |
| 304 | Ga0105240_10207914 | 3300009093 | Bacteria | 2289 |
| 305 | Ga0105240_10251254 | 3300009093 | Bacteria | 2045 |
| 306 | Ga0105245_10092053 | 3300009098 | Bacteria | 2792 |
| 307 | Ga0105245_10118472 | 3300009098 | Unclassified | 2471 |
| 308 | Ga0105245_10470252 | 3300009098 | Bacteria | 1269 |
| 309 | Ga0105245_10500769 | 3300009098 | Bacteria | 1231 |
| 310 | Ga0105245_12945637 | 3300009098 | Bacteria | 528 |
| 311 | Ga0105245_13209565 | 3300009098 | Bacteria | 507 |
| 312 | Ga0105247_10101509 | 3300009101 | Bacteria | 1840 |
| 313 | Ga0105247_10834597 | 3300009101 | Bacteria | 706 |
| 314 | Ga0105243_12646587 | 3300009148 | Bacteria | 542 |
| 315 | Ga0105241_10019404 | 3300009174 | Bacteria | 5013 |
| 316 | Ga0105241_10023082 | 3300009174 | Bacteria | 4612 |
| 317 | Ga0105241_10110450 | 3300009174 | Bacteria | 2200 |
| 318 | Ga0105241_10242171 | 3300009174 | Bacteria | 1525 |
| 319 | Ga0105241_10256801 | 3300009174 | Bacteria | 1484 |
| 320 | Ga0105241_10363584 | 3300009174 | Unclassified | 1260 |
| 321 | Ga0105241_10637764 | 3300009174 | Bacteria | 966 |
| 322 | Ga0105242_10135087 | 3300009176 | Bacteria | 2134 |
| 323 | Ga0105248_10010020 | 3300009177 | Bacteria | 10433 |
| 324 | Ga0105248_10021037 | 3300009177 | Bacteria | 7229 |
| 325 | Ga0105248_10294208 | 3300009177 | Bacteria | 1828 |
| 326 | Ga0105248_10588635 | 3300009177 | Bacteria | 1255 |
| 327 | Ga0105248_10664063 | 3300009177 | Bacteria | 1176 |
| 328 | Ga0105248_10933154 | 3300009177 | Unclassified | 980 |
| 329 | Ga0105248_11767795 | 3300009177 | Bacteria | 701 |
| 330 | Ga0105237_10084739 | 3300009545 | Bacteria | 3159 |
| 331 | Ga0105237_10101879 | 3300009545 | Bacteria | 2863 |
| 332 | Ga0105237_10128608 | 3300009545 | Bacteria | 2527 |
| 333 | Ga0105237_10216054 | 3300009545 | Bacteria | 1917 |
| 334 | Ga0105237_10267542 | 3300009545 | Bacteria | 1712 |
| 335 | Ga0105237_10428016 | 3300009545 | Bacteria | 1329 |
| 336 | Ga0105237_10954699 | 3300009545 | Unclassified | 864 |
| 337 | Ga0105237_12541651 | 3300009545 | Unclassified | 523 |
| 338 | Ga0105237_12648114 | 3300009545 | Bacteria | 512 |
| 339 | Ga0105238_10000231 | 3300009551 | Bacteria | 62320 |
| 340 | Ga0105238_10014889 | 3300009551 | Bacteria | 7869 |
| 341 | Ga0105238_10313185 | 3300009551 | Bacteria | 1555 |
| 342 | Ga0105238_10417048 | 3300009551 | Bacteria | 1337 |
| 343 | Ga0105238_10423724 | 3300009551 | Bacteria | 1326 |
| 344 | Ga0105238_10589506 | 3300009551 | Bacteria | 1119 |
| 345 | Ga0105238_10925650 | 3300009551 | Unclassified | 891 |
| 346 | Ga0105249_10014329 | 3300009553 | Bacteria | 7012 |
| 347 | Ga0099796_10032975 | 3300010159 | Bacteria | 1701 |
| 348 | Ga0105239_10031877 | 3300010375 | Bacteria | 5792 |
| 349 | Ga0105239_10039280 | 3300010375 | Bacteria | 5185 |
| 350 | Ga0105239_10067537 | 3300010375 | Unclassified | 3928 |
| 351 | Ga0105239_10101085 | 3300010375 | Bacteria | 3190 |
| 352 | Ga0105239_10129627 | 3300010375 | Bacteria | 2804 |
| 353 | Ga0105239_10803648 | 3300010375 | Bacteria | 1078 |
| 354 | Ga0105239_10866744 | 3300010375 | Bacteria | 1036 |
| 355 | Ga0157373_10020821 | 3300013100 | Bacteria | 4761 |
| 356 | Ga0157373_10055943 | 3300013100 | Bacteria | 2802 |
| 357 | Ga0157373_10180678 | 3300013100 | Bacteria | 1485 |
| 358 | Ga0157373_10184089 | 3300013100 | Bacteria | 1471 |
| 359 | Ga0157371_10027063 | 3300013102 | Bacteria | 4162 |
| 360 | Ga0157371_10512541 | 3300013102 | Bacteria | 887 |
| 361 | Ga0157370_10016753 | 3300013104 | Bacteria | 7415 |
| 362 | Ga0157370_10673529 | 3300013104 | Bacteria | 945 |
| 363 | Ga0157370_10690069 | 3300013104 | Bacteria | 932 |
| 364 | Ga0157369_10000319 | 3300013105 | Bacteria | 64594 |
| 365 | Ga0157369_10049225 | 3300013105 | Bacteria | 4569 |
| 366 | Ga0157369_10104869 | 3300013105 | Bacteria | 3010 |
| 367 | Ga0157369_10217413 | 3300013105 | Bacteria | 2001 |
| 368 | Ga0157369_10243505 | 3300013105 | Bacteria | 1878 |
| 369 | Ga0157369_10358356 | 3300013105 | Bacteria | 1514 |
| 370 | Ga0157369_10361747 | 3300013105 | Bacteria | 1506 |
| 371 | Ga0157369_10514745 | 3300013105 | Unclassified | 1238 |
| 372 | Ga0157374_10000901 | 3300013296 | Bacteria | 25896 |
| 373 | Ga0157374_10001359 | 3300013296 | Bacteria | 20821 |
| 374 | Ga0157374_10007673 | 3300013296 | Bacteria | 9212 |
| 375 | Ga0157374_10019345 | 3300013296 | Bacteria | 6027 |
| 376 | Ga0157374_10056203 | 3300013296 | Bacteria | 3674 |
| 377 | Ga0157374_10111874 | 3300013296 | Unclassified | 2627 |
| 378 | Ga0157374_10131268 | 3300013296 | Bacteria | 2425 |
| 379 | Ga0157374_10297037 | 3300013296 | Bacteria | 1597 |
| 380 | Ga0157374_10605164 | 3300013296 | Unclassified | 1106 |
| 381 | Ga0157374_11039239 | 3300013296 | Unclassified | 839 |
| 382 | Ga0157378_10000222 | 3300013297 | Bacteria | 55407 |
| 383 | Ga0157378_10020356 | 3300013297 | Bacteria | 5837 |
| 384 | Ga0157378_10084164 | 3300013297 | Unclassified | 2879 |
| 385 | Ga0157378_10222787 | 3300013297 | Bacteria | 1793 |
| 386 | Ga0157378_11066131 | 3300013297 | Bacteria | 844 |
| 387 | Ga0157378_11409837 | 3300013297 | Bacteria | 740 |
| 388 | Ga0163162_10005111 | 3300013306 | Bacteria | 12649 |
| 389 | Ga0163162_10147478 | 3300013306 | Bacteria | 2469 |
| 390 | Ga0163162_10308058 | 3300013306 | Unclassified | 1716 |
| 391 | Ga0163162_10667306 | 3300013306 | Unclassified | 1163 |
| 392 | Ga0157372_10000647 | 3300013307 | Bacteria | 38212 |
| 393 | Ga0157372_10000933 | 3300013307 | Bacteria | 31896 |
| 394 | Ga0157372_10001310 | 3300013307 | Bacteria | 26936 |
| 395 | Ga0157372_10046842 | 3300013307 | Bacteria | 4801 |
| 396 | Ga0157372_10088840 | 3300013307 | Bacteria | 3510 |
| 397 | Ga0157372_10123425 | 3300013307 | Bacteria | 2977 |
| 398 | Ga0157372_10172681 | 3300013307 | Bacteria | 2501 |
| 399 | Ga0157372_10177851 | 3300013307 | Bacteria | 2463 |
| 400 | Ga0157372_10184882 | 3300013307 | Bacteria | 2413 |
| 401 | Ga0157372_10207680 | 3300013307 | Bacteria | 2269 |
| 402 | Ga0157372_10268956 | 3300013307 | Bacteria | 1980 |
| 403 | Ga0157372_12120254 | 3300013307 | Bacteria | 646 |
| 404 | Ga0157372_12401381 | 3300013307 | Bacteria | 605 |
| 405 | Ga0157372_12582602 | 3300013307 | Unclassified | 583 |
| 406 | Ga0157372_13369076 | 3300013307 | Unclassified | 509 |
| 407 | Ga0157375_10029397 | 3300013308 | Bacteria | 5168 |
| 408 | Ga0157375_10244260 | 3300013308 | Bacteria | 1955 |
| 409 | Ga0163163_10005018 | 3300014325 | Bacteria | 11407 |
| 410 | Ga0163163_10089030 | 3300014325 | Bacteria | 3098 |
| 411 | Ga0163163_10092447 | 3300014325 | Bacteria | 3040 |
| 412 | Ga0163163_10178013 | 3300014325 | Bacteria | 2174 |
| 413 | Ga0163163_10738919 | 3300014325 | Unclassified | 1047 |
| 414 | Ga0163163_12690392 | 3300014325 | Unclassified | 555 |
| 415 | Ga0157380_10704498 | 3300014326 | Bacteria | 1015 |
| 416 | Ga0182008_10006218 | 3300014497 | Bacteria | 6711 |
| 417 | Ga0182008_10027388 | 3300014497 | Bacteria | 2888 |
| 418 | Ga0157379_10002644 | 3300014968 | Bacteria | 15071 |
| 419 | Ga0157379_10311374 | 3300014968 | Unclassified | 1436 |
| 420 | Ga0157379_10331874 | 3300014968 | Bacteria | 1390 |
| 421 | Ga0157376_10003294 | 3300014969 | Bacteria | 11123 |
| 422 | Ga0157376_10023198 | 3300014969 | Bacteria | 4853 |
| 423 | Ga0157376_10050708 | 3300014969 | Bacteria | 3444 |
| 424 | Ga0157376_10126510 | 3300014969 | Bacteria | 2274 |
| 425 | Ga0157376_10230442 | 3300014969 | Unclassified | 1720 |
| 426 | Ga0157376_10477209 | 3300014969 | Unclassified | 1221 |
| 427 | Ga0182006_1055778 | 3300015261 | Bacteria | 1507 |
| 428 | Ga0182007_10003465 | 3300015262 | Bacteria | 7429 |
| 429 | Ga0182007_10017980 | 3300015262 | Bacteria | 2571 |
| 430 | Ga0182005_1005531 | 3300015265 | Unclassified | 3940 |
| 431 | Ga0163161_11104351 | 3300017792 | Bacteria | 682 |
| 432 | Ga0206356_10337735 | 3300020070 | Bacteria | 904 |
| 433 | Ga0213875_10641175 | 3300021388 | Unclassified | 514 |
| 434 | Ga0224572_1008682 | 3300024225 | Bacteria | 1883 |
| 435 | Ga0228598_1017818 | 3300024227 | Unclassified | 1401 |
| 436 | Ga0207656_10171531 | 3300025321 | Bacteria | 1037 |
| 437 | Ga0207692_10012108 | 3300025898 | Unclassified | 3695 |
| 438 | Ga0207692_10020444 | 3300025898 | Bacteria | 3011 |
| 439 | Ga0207692_10038160 | 3300025898 | Bacteria | 2355 |
| 440 | Ga0207692_10062804 | 3300025898 | Bacteria | 1929 |
| 441 | Ga0207692_10386211 | 3300025898 | Unclassified | 870 |
| 442 | Ga0207692_10391142 | 3300025898 | Unclassified | 865 |
| 443 | Ga0207642_10221924 | 3300025899 | Bacteria | 1057 |
| 444 | Ga0207642_10356527 | 3300025899 | Unclassified | 864 |
| 445 | Ga0207710_10483000 | 3300025900 | Unclassified | 642 |
| 446 | Ga0207647_10002682 | 3300025904 | Bacteria | 13425 |
| 447 | Ga0207647_10318654 | 3300025904 | Unclassified | 883 |
| 448 | Ga0207685_10001253 | 3300025905 | Bacteria | 5183 |
| 449 | Ga0207685_10041711 | 3300025905 | Bacteria | 1719 |
| 450 | Ga0207685_10061050 | 3300025905 | Bacteria | 1493 |
| 451 | Ga0207685_10061675 | 3300025905 | Bacteria | 1487 |
| 452 | Ga0207685_10168868 | 3300025905 | Bacteria | 1005 |
| 453 | Ga0207699_10003226 | 3300025906 | Bacteria | 7763 |
| 454 | Ga0207699_10007415 | 3300025906 | Bacteria | 5367 |
| 455 | Ga0207699_10017610 | 3300025906 | Unclassified | 3767 |
| 456 | Ga0207699_10024181 | 3300025906 | Bacteria | 3318 |
| 457 | Ga0207699_10026450 | 3300025906 | Bacteria | 3199 |
| 458 | Ga0207699_10088796 | 3300025906 | Bacteria | 1936 |
| 459 | Ga0207699_10139651 | 3300025906 | Unclassified | 1591 |
| 460 | Ga0207699_10145547 | 3300025906 | Unclassified | 1562 |
| 461 | Ga0207699_10199619 | 3300025906 | Unclassified | 1354 |
| 462 | Ga0207699_10213350 | 3300025906 | Unclassified | 1314 |
| 463 | Ga0207699_10403968 | 3300025906 | Unclassified | 973 |
| 464 | Ga0207699_10590882 | 3300025906 | Bacteria | 808 |
| 465 | Ga0207699_10672892 | 3300025906 | Bacteria | 757 |
| 466 | Ga0207699_10986158 | 3300025906 | Unclassified | 623 |
| 467 | Ga0207699_11119030 | 3300025906 | Bacteria | 583 |
| 468 | Ga0207699_11163987 | 3300025906 | Bacteria | 571 |
| 469 | Ga0207699_11219850 | 3300025906 | Bacteria | 557 |
| 470 | Ga0207705_10612485 | 3300025909 | Unclassified | 847 |
| 471 | Ga0207684_10007054 | 3300025910 | Bacteria | 10162 |
| 472 | Ga0207684_10035594 | 3300025910 | Bacteria | 4228 |
| 473 | Ga0207684_10393810 | 3300025910 | Unclassified | 1191 |
| 474 | Ga0207684_10668001 | 3300025910 | Unclassified | 885 |
| 475 | Ga0207684_11223001 | 3300025910 | Unclassified | 621 |
| 476 | Ga0207654_10019436 | 3300025911 | Unclassified | 3585 |
| 477 | Ga0207654_10024382 | 3300025911 | Bacteria | 3251 |
| 478 | Ga0207654_10075943 | 3300025911 | Bacteria | 2009 |
| 479 | Ga0207654_10132631 | 3300025911 | Bacteria | 1578 |
| 480 | Ga0207654_10142808 | 3300025911 | Bacteria | 1528 |
| 481 | Ga0207654_10376621 | 3300025911 | Bacteria | 982 |
| 482 | Ga0207654_10608534 | 3300025911 | Bacteria | 780 |
| 483 | Ga0207707_10005917 | 3300025912 | Bacteria | 10700 |
| 484 | Ga0207707_10008015 | 3300025912 | Bacteria | 9173 |
| 485 | Ga0207707_10408234 | 3300025912 | Bacteria | 1165 |
| 486 | Ga0207707_10554077 | 3300025912 | Bacteria | 977 |
| 487 | Ga0207707_10567344 | 3300025912 | Bacteria | 963 |
| 488 | Ga0207707_10577137 | 3300025912 | Unclassified | 953 |
| 489 | Ga0207695_10037976 | 3300025913 | Bacteria | 5191 |
| 490 | Ga0207695_10042469 | 3300025913 | Unclassified | 4856 |
| 491 | Ga0207695_10091428 | 3300025913 | Bacteria | 3057 |
| 492 | Ga0207695_10138422 | 3300025913 | Bacteria | 2386 |
| 493 | Ga0207695_10307675 | 3300025913 | Bacteria | 1475 |
| 494 | Ga0207671_10026369 | 3300025914 | Bacteria | 4357 |
| 495 | Ga0207671_10035109 | 3300025914 | Bacteria | 3723 |
| 496 | Ga0207671_10080424 | 3300025914 | Bacteria | 2443 |
| 497 | Ga0207693_10000004 | 3300025915 | Bacteria | 193261 |
| 498 | Ga0207693_10000661 | 3300025915 | Bacteria | 30947 |
| 499 | Ga0207693_10001237 | 3300025915 | Bacteria | 22760 |
| 500 | Ga0207693_10017281 | 3300025915 | Bacteria | 5753 |
| 501 | Ga0207693_10030654 | 3300025915 | Unclassified | 4249 |
| 502 | Ga0207693_10061416 | 3300025915 | Bacteria | 2943 |
| 503 | Ga0207693_10076849 | 3300025915 | Bacteria | 2615 |
| 504 | Ga0207693_10326881 | 3300025915 | Bacteria | 1200 |
| 505 | Ga0207693_10416193 | 3300025915 | Bacteria | 1051 |
| 506 | Ga0207693_10737439 | 3300025915 | Unclassified | 762 |
| 507 | Ga0207693_11389332 | 3300025915 | Unclassified | 522 |
| 508 | Ga0207663_10002276 | 3300025916 | Bacteria | 9188 |
| 509 | Ga0207663_10013712 | 3300025916 | Bacteria | 4413 |
| 510 | Ga0207663_10014158 | 3300025916 | Bacteria | 4360 |
| 511 | Ga0207663_10035487 | 3300025916 | Bacteria | 2992 |
| 512 | Ga0207663_10050643 | 3300025916 | Bacteria | 2582 |
| 513 | Ga0207663_10081962 | 3300025916 | Unclassified | 2115 |
| 514 | Ga0207663_10087605 | 3300025916 | Bacteria | 2057 |
| 515 | Ga0207663_10162269 | 3300025916 | Bacteria | 1579 |
| 516 | Ga0207663_10209381 | 3300025916 | Unclassified | 1412 |
| 517 | Ga0207663_11044331 | 3300025916 | Unclassified | 656 |
| 518 | Ga0207660_10112881 | 3300025917 | Bacteria | 2048 |
| 519 | Ga0207660_10286991 | 3300025917 | Unclassified | 1308 |
| 520 | Ga0207660_10698111 | 3300025917 | Bacteria | 828 |
| 521 | Ga0207657_10001068 | 3300025919 | Bacteria | 29011 |
| 522 | Ga0207649_10232800 | 3300025920 | Bacteria | 1318 |
| 523 | Ga0207649_10519706 | 3300025920 | Bacteria | 907 |
| 524 | Ga0207652_10117314 | 3300025921 | Bacteria | 2365 |
| 525 | Ga0207652_10259406 | 3300025921 | Bacteria | 1568 |
| 526 | Ga0207652_10367517 | 3300025921 | Unclassified | 1298 |
| 527 | Ga0207652_10458743 | 3300025921 | Unclassified | 1149 |
| 528 | Ga0207652_10528694 | 3300025921 | Unclassified | 1061 |
| 529 | Ga0207652_10618594 | 3300025921 | Bacteria | 970 |
| 530 | Ga0207652_10912213 | 3300025921 | Bacteria | 776 |
| 531 | Ga0207646_10086017 | 3300025922 | Unclassified | 2812 |
| 532 | Ga0207646_10219265 | 3300025922 | Bacteria | 1719 |
| 533 | Ga0207646_10580360 | 3300025922 | Bacteria | 1007 |
| 534 | Ga0207646_11357451 | 3300025922 | Unclassified | 619 |
| 535 | Ga0207646_11674527 | 3300025922 | Bacteria | 547 |
| 536 | Ga0207694_10003398 | 3300025924 | Bacteria | 12677 |
| 537 | Ga0207694_10194955 | 3300025924 | Bacteria | 1647 |
| 538 | Ga0207694_10295630 | 3300025924 | Bacteria | 1332 |
| 539 | Ga0207694_10554072 | 3300025924 | Bacteria | 965 |
| 540 | Ga0207650_11047735 | 3300025925 | Unclassified | 694 |
| 541 | Ga0207650_11191221 | 3300025925 | Unclassified | 648 |
| 542 | Ga0207650_11539198 | 3300025925 | Unclassified | 565 |
| 543 | Ga0207650_11849642 | 3300025925 | Unclassified | 510 |
| 544 | Ga0207687_10085277 | 3300025927 | Unclassified | 2291 |
| 545 | Ga0207687_10128467 | 3300025927 | Unclassified | 1906 |
| 546 | Ga0207687_10348730 | 3300025927 | Bacteria | 1205 |
| 547 | Ga0207687_10690727 | 3300025927 | Unclassified | 865 |
| 548 | Ga0207687_11792659 | 3300025927 | Bacteria | 525 |
| 549 | Ga0207700_10000612 | 3300025928 | Bacteria | 20890 |
| 550 | Ga0207700_10036330 | 3300025928 | Bacteria | 3557 |
| 551 | Ga0207700_10046178 | 3300025928 | Bacteria | 3219 |
| 552 | Ga0207700_10121951 | 3300025928 | Unclassified | 2115 |
| 553 | Ga0207700_10122219 | 3300025928 | Bacteria | 2113 |
| 554 | Ga0207700_10285415 | 3300025928 | Bacteria | 1421 |
| 555 | Ga0207700_10312604 | 3300025928 | Bacteria | 1359 |
| 556 | Ga0207700_10390348 | 3300025928 | Bacteria | 1218 |
| 557 | Ga0207700_10618395 | 3300025928 | Bacteria | 965 |
| 558 | Ga0207700_10632504 | 3300025928 | Unclassified | 953 |
| 559 | Ga0207700_10775013 | 3300025928 | Bacteria | 857 |
| 560 | Ga0207700_10805302 | 3300025928 | Unclassified | 840 |
| 561 | Ga0207700_10862573 | 3300025928 | Unclassified | 810 |
| 562 | Ga0207700_11187755 | 3300025928 | Unclassified | 681 |
| 563 | Ga0207700_11660495 | 3300025928 | Unclassified | 564 |
| 564 | Ga0207664_10011550 | 3300025929 | Bacteria | 6285 |
| 565 | Ga0207664_10012644 | 3300025929 | Bacteria | 6038 |
| 566 | Ga0207664_10028407 | 3300025929 | Bacteria | 4250 |
| 567 | Ga0207664_10038351 | 3300025929 | Bacteria | 3715 |
| 568 | Ga0207664_10072881 | 3300025929 | Bacteria | 2770 |
| 569 | Ga0207664_10079029 | 3300025929 | Bacteria | 2669 |
| 570 | Ga0207664_10102991 | 3300025929 | Bacteria | 2361 |
| 571 | Ga0207664_10180930 | 3300025929 | Unclassified | 1810 |
| 572 | Ga0207664_10783614 | 3300025929 | Unclassified | 858 |
| 573 | Ga0207664_10786122 | 3300025929 | Unclassified | 856 |
| 574 | Ga0207664_11005151 | 3300025929 | Bacteria | 747 |
| 575 | Ga0207664_11299335 | 3300025929 | Bacteria | 647 |
| 576 | Ga0207664_11639429 | 3300025929 | Unclassified | 565 |
| 577 | Ga0207664_11701905 | 3300025929 | Unclassified | 553 |
| 578 | Ga0207644_10101625 | 3300025931 | Bacteria | 2161 |
| 579 | Ga0207644_10424228 | 3300025931 | Unclassified | 1090 |
| 580 | Ga0207690_10111779 | 3300025932 | Bacteria | 1969 |
| 581 | Ga0207706_10018426 | 3300025933 | Bacteria | 6281 |
| 582 | Ga0207709_11583966 | 3300025935 | Bacteria | 544 |
| 583 | Ga0207670_10389670 | 3300025936 | Bacteria | 1111 |
| 584 | Ga0207704_10021989 | 3300025938 | Bacteria | 3409 |
| 585 | Ga0207704_11140935 | 3300025938 | Bacteria | 663 |
| 586 | Ga0207665_10000225 | 3300025939 | Bacteria | 38534 |
| 587 | Ga0207665_10001183 | 3300025939 | Bacteria | 17558 |
| 588 | Ga0207665_10005820 | 3300025939 | Bacteria | 8204 |
| 589 | Ga0207665_10030106 | 3300025939 | Bacteria | 3588 |
| 590 | Ga0207665_10063282 | 3300025939 | Unclassified | 2512 |
| 591 | Ga0207665_10097636 | 3300025939 | Unclassified | 2045 |
| 592 | Ga0207665_10115699 | 3300025939 | Unclassified | 1889 |
| 593 | Ga0207665_10251436 | 3300025939 | Unclassified | 1306 |
| 594 | Ga0207665_10278024 | 3300025939 | Bacteria | 1245 |
| 595 | Ga0207665_10310919 | 3300025939 | Unclassified | 1180 |
| 596 | Ga0207711_10019361 | 3300025941 | Bacteria | 5667 |
| 597 | Ga0207711_10042854 | 3300025941 | Unclassified | 3858 |
| 598 | Ga0207711_10379144 | 3300025941 | Unclassified | 1312 |
| 599 | Ga0207711_11101083 | 3300025941 | Bacteria | 735 |
| 600 | Ga0207689_10002500 | 3300025942 | Bacteria | 17076 |
| 601 | Ga0207661_10025645 | 3300025944 | Bacteria | 4484 |
| 602 | Ga0207661_11867205 | 3300025944 | Unclassified | 546 |
| 603 | Ga0207661_11917373 | 3300025944 | Unclassified | 538 |
| 604 | Ga0207679_10467059 | 3300025945 | Bacteria | 1121 |
| 605 | Ga0207667_10001038 | 3300025949 | Bacteria | 35354 |
| 606 | Ga0207667_10005367 | 3300025949 | Bacteria | 15623 |
| 607 | Ga0207667_10214773 | 3300025949 | Bacteria | 1971 |
| 608 | Ga0207667_10706631 | 3300025949 | Bacteria | 1010 |
| 609 | Ga0207667_10863368 | 3300025949 | Bacteria | 899 |
| 610 | Ga0207651_10884283 | 3300025960 | Bacteria | 795 |
| 611 | Ga0207668_11517745 | 3300025972 | Unclassified | 605 |
| 612 | Ga0207640_10065196 | 3300025981 | Bacteria | 2429 |
| 613 | Ga0207640_10109442 | 3300025981 | Bacteria | 1955 |
| 614 | Ga0207640_10121388 | 3300025981 | Unclassified | 1873 |
| 615 | Ga0207677_10003403 | 3300026023 | Bacteria | 8429 |
| 616 | Ga0207677_10011172 | 3300026023 | Bacteria | 5107 |
| 617 | Ga0207677_10016008 | 3300026023 | Bacteria | 4428 |
| 618 | Ga0207677_10053695 | 3300026023 | Unclassified | 2745 |
| 619 | Ga0207677_10566382 | 3300026023 | Bacteria | 992 |
| 620 | Ga0207677_11280616 | 3300026023 | Unclassified | 673 |
| 621 | Ga0207703_10007924 | 3300026035 | Bacteria | 8398 |
| 622 | Ga0207703_10012076 | 3300026035 | Bacteria | 6728 |
| 623 | Ga0207703_10077756 | 3300026035 | Bacteria | 2755 |
| 624 | Ga0207639_10027116 | 3300026041 | Unclassified | 4169 |
| 625 | Ga0207639_10051364 | 3300026041 | Bacteria | 3135 |
| 626 | Ga0207639_10060353 | 3300026041 | Bacteria | 2926 |
| 627 | Ga0207639_10316948 | 3300026041 | Bacteria | 1383 |
| 628 | Ga0207639_10419839 | 3300026041 | Bacteria | 1209 |
| 629 | Ga0207678_10167831 | 3300026067 | Bacteria | 1874 |
| 630 | Ga0207702_10001933 | 3300026078 | Bacteria | 20244 |
| 631 | Ga0207702_10001993 | 3300026078 | Bacteria | 19808 |
| 632 | Ga0207702_10009683 | 3300026078 | Bacteria | 8091 |
| 633 | Ga0207702_10130692 | 3300026078 | Unclassified | 2259 |
| 634 | Ga0207702_10251402 | 3300026078 | Bacteria | 1660 |
| 635 | Ga0207702_10572116 | 3300026078 | Unclassified | 1107 |
| 636 | Ga0207641_10008199 | 3300026088 | Bacteria | 8637 |
| 637 | Ga0207641_10116722 | 3300026088 | Bacteria | 2375 |
| 638 | Ga0207641_10253215 | 3300026088 | Unclassified | 1645 |
| 639 | Ga0207641_10989605 | 3300026088 | Bacteria | 837 |
| 640 | Ga0207641_11253753 | 3300026088 | Unclassified | 741 |
| 641 | Ga0207641_11788331 | 3300026088 | Unclassified | 616 |
| 642 | Ga0207648_10659938 | 3300026089 | Unclassified | 967 |
| 643 | Ga0207676_10007565 | 3300026095 | Bacteria | 7707 |
| 644 | Ga0207676_10253333 | 3300026095 | Bacteria | 1586 |
| 645 | Ga0207676_10924058 | 3300026095 | Unclassified | 857 |
| 646 | Ga0207676_11121205 | 3300026095 | Unclassified | 778 |
| 647 | Ga0207676_11230420 | 3300026095 | Bacteria | 743 |
| 648 | Ga0207674_10001455 | 3300026116 | Bacteria | 30595 |
| 649 | Ga0207674_10300731 | 3300026116 | Bacteria | 1553 |
| 650 | Ga0207674_10314187 | 3300026116 | Bacteria | 1516 |
| 651 | Ga0207683_12139943 | 3300026121 | Unclassified | 508 |
| 652 | Ga0207698_10150932 | 3300026142 | Bacteria | 2017 |
| 653 | Ga0207698_10237189 | 3300026142 | Bacteria | 1660 |
| 654 | Ga0207698_10529119 | 3300026142 | Bacteria | 1152 |
| 655 | Ga0265354_1003448 | 3300028016 | Unclassified | 1770 |
| 656 | Ga0265356_1005053 | 3300028017 | Bacteria | 1590 |
| 657 | Ga0268266_10291822 | 3300028379 | Bacteria | 1519 |
| 658 | Ga0268266_11520024 | 3300028379 | Bacteria | 645 |
| 659 | Ga0268265_10027037 | 3300028380 | Bacteria | 4090 |
| 660 | Ga0268264_10389398 | 3300028381 | Bacteria | 1337 |
| 661 | Ga0268264_11012424 | 3300028381 | Bacteria | 837 |
| 662 | Ga0268264_11096467 | 3300028381 | Bacteria | 804 |
| 663 | Ga0265338_10030749 | 3300028800 | Bacteria | 5280 |
| 664 | Ga0265338_10073770 | 3300028800 | Unclassified | 2906 |
| 665 | Ga0265338_10256368 | 3300028800 | Unclassified | 1288 |
| 666 | Ga0265338_10318398 | 3300028800 | Bacteria | 1126 |
| 667 | Ga0265338_10480849 | 3300028800 | Bacteria | 876 |
| 668 | Ga0265762_1000408 | 3300030760 | Bacteria | 7398 |
| 669 | Ga0265762_1003554 | 3300030760 | Bacteria | 2793 |
| 670 | Ga0265762_1005006 | 3300030760 | Bacteria | 2374 |
| 671 | Ga0265770_1027763 | 3300030878 | Unclassified | 932 |
| 672 | Ga0265764_114287 | 3300030882 | Unclassified | 536 |
| 673 | Ga0265760_10000213 | 3300031090 | Bacteria | 15624 |
| 674 | Ga0265760_10004205 | 3300031090 | Bacteria | 4141 |
| 675 | Ga0265760_10007276 | 3300031090 | Unclassified | 3169 |
| 676 | Ga0265760_10034612 | 3300031090 | Bacteria | 1494 |
| 677 | Ga0265332_10467778 | 3300031238 | Unclassified | 522 |
| 678 | Ga0265328_10116311 | 3300031239 | Bacteria | 996 |
| 679 | Ga0265325_10005070 | 3300031241 | Bacteria | 8197 |
| 680 | Ga0265340_10055511 | 3300031247 | Bacteria | 1908 |
| 681 | Ga0265340_10143502 | 3300031247 | Bacteria | 1091 |
| 682 | Ga0265339_10024687 | 3300031249 | Unclassified | 3460 |
| 683 | Ga0265339_10181022 | 3300031249 | Bacteria | 1049 |
| 684 | Ga0265316_10015838 | 3300031344 | Bacteria | 6566 |
| 685 | Ga0265314_10094745 | 3300031711 | Bacteria | 1934 |
| 686 | Ga0265342_10039362 | 3300031712 | Bacteria | 2873 |
| 687 | Ga0316212_1038967 | 3300033547 | Unclassified | 671 |
| 688 | Ga0316212_1063699 | 3300033547 | Unclassified | 533 |
| 689 | Ga0373926_0016474 | 3300035083 | Bacteria | 2529 |
| 690 | Ga0373926_0045972 | 3300035083 | Bacteria | 1566 |
| 691 | Ga0373926_0061563 | 3300035083 | Archaea | 1369 |
| 692 | Ga0373934_0097096 | 3300035086 | Unclassified | 1190 |
| 693 | Ga0373934_0122691 | 3300035086 | Bacteria | 1057 |
| 694 | Ga0373923_0122164 | 3300035111 | Bacteria | 1164 |
| 695 | Ga0373936_0009197 | 3300035113 | Bacteria | 3723 |
| 696 | Ga0373936_0037708 | 3300035113 | Unclassified | 1931 |
| 697 | Ga0373941_0444124 | 3300035115 | Unclassified | 543 |
| 698 | Ga0373945_0005782 | 3300035116 | Bacteria | 3968 |
| 699 | Ga0373945_0049127 | 3300035116 | Bacteria | 1547 |
| 700 | Ga0373945_0176729 | 3300035116 | Bacteria | 877 |
| 701 | Ga0373954_0066602 | 3300035118 | Bacteria | 1705 |
| 702 | Ga0373956_0059902 | 3300035119 | Bacteria | 1723 |
| 703 | Ga0373957_0134144 | 3300035120 | Bacteria | 1009 |
| 704 | Ga0373943_0000085 | 3300035170 | Bacteria | 33641 |
| 705 | Ga0373943_0048492 | 3300035170 | Bacteria | 2081 |
| 706 | Ga0373943_0134763 | 3300035170 | Bacteria | 1325 |
| 707 | Ga0373943_0215840 | 3300035170 | Unclassified | 1067 |
| 708 | Ga0373946_0058692 | 3300035171 | Bacteria | 1631 |
| 709 | Ga0373946_0100904 | 3300035171 | Bacteria | 1294 |
| 710 | Ga0373946_0107651 | 3300035171 | Bacteria | 1258 |
| 711 | Ga0373946_0170064 | 3300035171 | Bacteria | 1028 |
| 712 | Ga0373955_0208249 | 3300035172 | Unclassified | 1165 |
| 713 | Ga0373924_0109723 | 3300035410 | Unclassified | 1192 |
| 714 | Ga0373924_0248057 | 3300035410 | Unclassified | 788 |
| 715 | Ga0373931_0318883 | 3300035691 | Unclassified | 965 |
| 716 | Ga0373931_0669179 | 3300035691 | Unclassified | 683 |
| 717 | Ga0373931_1069037 | 3300035691 | Bacteria | 548 |
| 718 | Ga0373935_0001031 | 3300035692 | Bacteria | 15142 |
| 719 | Ga0373935_0015379 | 3300035692 | Bacteria | 4625 |
| 720 | Ga0373935_0309144 | 3300035692 | Unclassified | 1119 |
| 721 | Ga0373935_0379497 | 3300035692 | Bacteria | 1012 |
| 722 | Ga0373935_1116205 | 3300035692 | Unclassified | 587 |
| 723 | Ga0373927_0001082 | 3300035695 | Bacteria | 20747 |
| 724 | Ga0373927_0040505 | 3300035695 | Bacteria | 3022 |
| 725 | Ga0373927_0040613 | 3300035695 | Bacteria | 3018 |
| 726 | Ga0373927_0106298 | 3300035695 | Bacteria | 1827 |
| 727 | Ga0373927_0124732 | 3300035695 | Bacteria | 1681 |
| 728 | Ga0373933_0073289 | 3300035724 | Bacteria | 2086 |
| 729 | Ga0373933_0125327 | 3300035724 | Bacteria | 1611 |
| 730 | Ga0373933_0304677 | 3300035724 | Unclassified | 1032 |
| 731 | Ga0373933_0332315 | 3300035724 | Bacteria | 986 |
| 732 | Ga0373933_0470446 | 3300035724 | Unclassified | 823 |
| 733 | Ga0373933_0747353 | 3300035724 | Bacteria | 643 |
| 734 | Ga0373933_0974300 | 3300035724 | Unclassified | 558 |
| 735 | Ga0373947_0000049 | 3300035725 | Bacteria | 60041 |
| 736 | Ga0373947_0001548 | 3300035725 | Bacteria | 14102 |
| 737 | Ga0373947_0214641 | 3300035725 | Bacteria | 1263 |
| 738 | Ga0373947_0943140 | 3300035725 | Bacteria | 589 |
| 739 | Ga0373947_1213543 | 3300035725 | Unclassified | 514 |
| 740 | Ga0373937_0019523 | 3300036401 | Bacteria | 6065 |
| 741 | Ga0373937_0146471 | 3300036401 | Bacteria | 2211 |
| 742 | Ga0373937_0282869 | 3300036401 | Bacteria | 1566 |
| 743 | Ga0373937_0331159 | 3300036401 | Bacteria | 1441 |
| 744 | Ga0373937_0440287 | 3300036401 | Unclassified | 1237 |
| 745 | Ga0373937_0601758 | 3300036401 | Unclassified | 1043 |
| 746 | Ga0373937_1614317 | 3300036401 | Unclassified | 596 |
| 747 | Ga0373937_1847743 | 3300036401 | Bacteria | 550 |
| 748 | Ga0373925_0005729 | 3300037068 | Bacteria | 9237 |
| 749 | Ga0373925_0014322 | 3300037068 | Bacteria | 5737 |
| 750 | Ga0373925_0044341 | 3300037068 | Unclassified | 3302 |
| 751 | Ga0373925_0160606 | 3300037068 | Unclassified | 1770 |
| 752 | Ga0373925_0178178 | 3300037068 | Bacteria | 1681 |
| 753 | Ga0373925_0211267 | 3300037068 | Bacteria | 1546 |
| 754 | Ga0373925_0243591 | 3300037068 | Bacteria | 1441 |
| 755 | Ga0373925_0333680 | 3300037068 | Unclassified | 1229 |
| 756 | Ga0373925_0784451 | 3300037068 | Unclassified | 786 |
| 757 | Ga0373925_1098723 | 3300037068 | Bacteria | 654 |
| 758 | Ga0395905_0546427 | 3300037471 | Bacteria | 1060 |
| 759 | Ga0395905_0622457 | 3300037471 | Bacteria | 981 |
| 760 | Ga0395905_1473652 | 3300037471 | Unclassified | 585 |
| 761 | Ga0436364_0453284 | 3300037853 | Unclassified | 531 |
| 762 | Ga0395901_1355861 | 3300038443 | Unclassified | 671 |
| 763 | Ga0436365_0198018 | 3300039437 | Unclassified | 629 |
| 764 | Ga0436362_0459014 | 3300039453 | Unclassified | 1031 |
| 765 | Ga0436362_1141864 | 3300039453 | Bacteria | 3931 |
| 766 | Ga0451577_0000969 | 3300042876 | Bacteria | 41995 |
| 767 | Ga0451577_0069818 | 3300042876 | Unclassified | 3133 |
| 768 | Ga0451577_0624243 | 3300042876 | Unclassified | 978 |
| 769 | Ga0453683_0017766 | 3300044673 | Bacteria | 4575 |
| 770 | Ga0453683_0205030 | 3300044673 | Unclassified | 1252 |
| 771 | Ga0466963_0055738 | 3300044694 | Bacteria | 2629 |
| 772 | Ga0466964_0200333 | 3300044706 | Bacteria | 958 |
| 773 | Ga0453684_0000803 | 3300044712 | Bacteria | 107106 |
| 774 | Ga0466971_0039414 | 3300044719 | Bacteria | 2120 |
| 775 | Ga0466968_0539834 | 3300044735 | Unclassified | 584 |
| 776 | Ga0466970_0193949 | 3300044765 | Bacteria | 1129 |
| 777 | Ga0466957_0457233 | 3300044842 | Unclassified | 880 |
| 778 | Ga0466959_0249159 | 3300045049 | Bacteria | 1225 |
| 779 | Ga0451576_0005970 | 3300045051 | Bacteria | 15079 |
| 780 | Ga0451576_0036048 | 3300045051 | Bacteria | 5246 |
| 781 | Ga0451576_0132089 | 3300045051 | Bacteria | 2603 |
| 782 | Ga0451576_0176295 | 3300045051 | Bacteria | 2232 |
| 783 | Ga0451576_0401206 | 3300045051 | Unclassified | 1438 |
| 784 | Ga0451576_1900089 | 3300045051 | Unclassified | 614 |
| 785 | Ga0466958_0064705 | 3300045836 | Bacteria | 2231 |
| 786 | Ga0466967_0092023 | 3300045976 | Bacteria | 2757 |
| 787 | Ga0466967_0478250 | 3300045976 | Bacteria | 1220 |
| 788 | Ga0495592_0637107 | 3300046454 | Bacteria | 647 |
| 789 | Ga0495590_0274944 | 3300046457 | Unclassified | 630 |
| 790 | Ga0495590_0402328 | 3300046457 | Unclassified | 525 |
| 791 | Ga0495629_0044791 | 3300046459 | Bacteria | 3105 |
| 792 | Ga0495651_0442058 | 3300046462 | Bacteria | 842 |
| 793 | Ga0495653_0154602 | 3300046463 | Bacteria | 1599 |
| 794 | Ga0495653_0407453 | 3300046463 | Bacteria | 863 |
| 795 | Ga0495580_0000220 | 3300046472 | Bacteria | 44125 |
| 796 | Ga0495580_0000263 | 3300046472 | Bacteria | 42063 |
| 797 | Ga0495580_0001602 | 3300046472 | Bacteria | 19884 |
| 798 | Ga0495580_0002575 | 3300046472 | Bacteria | 15779 |
| 799 | Ga0495580_0003289 | 3300046472 | Bacteria | 13819 |
| 800 | Ga0495580_0017694 | 3300046472 | Bacteria | 5322 |
| 801 | Ga0495580_0027327 | 3300046472 | Bacteria | 4152 |
| 802 | Ga0495580_0049565 | 3300046472 | Bacteria | 2971 |
| 803 | Ga0495580_0174420 | 3300046472 | Unclassified | 1485 |
| 804 | Ga0495580_0214969 | 3300046472 | Bacteria | 1322 |
| 805 | Ga0495580_0235848 | 3300046472 | Bacteria | 1255 |
| 806 | Ga0495580_0273454 | 3300046472 | Bacteria | 1153 |
| 807 | Ga0495580_0277564 | 3300046472 | Unclassified | 1144 |
| 808 | Ga0495580_0294311 | 3300046472 | Bacteria | 1106 |
| 809 | Ga0495580_0298856 | 3300046472 | Bacteria | 1096 |
| 810 | Ga0495580_0419517 | 3300046472 | Bacteria | 900 |
| 811 | Ga0495580_0703147 | 3300046472 | Bacteria | 661 |
| 812 | Ga0495582_0000514 | 3300046473 | Bacteria | 21287 |
| 813 | Ga0495582_0022061 | 3300046473 | Bacteria | 3482 |
| 814 | Ga0495582_0344639 | 3300046473 | Bacteria | 858 |
| 815 | Ga0495662_0326178 | 3300046476 | Unclassified | 755 |
| 816 | Ga0495584_0029788 | 3300046491 | Bacteria | 2766 |
| 817 | Ga0495594_0132819 | 3300046499 | Unclassified | 1410 |
| 818 | Ga0495608_0323454 | 3300046511 | Bacteria | 953 |
| 819 | Ga0495628_0059400 | 3300046516 | Bacteria | 3002 |
| 820 | Ga0495628_0575916 | 3300046516 | Bacteria | 806 |
| 821 | Ga0495630_0056141 | 3300046517 | Bacteria | 2951 |
| 822 | Ga0495630_0067683 | 3300046517 | Unclassified | 2685 |
| 823 | Ga0495630_0183716 | 3300046517 | Bacteria | 1595 |
| 824 | Ga0495630_0259382 | 3300046517 | Bacteria | 1328 |
| 825 | Ga0495630_0543698 | 3300046517 | Unclassified | 891 |
| 826 | Ga0495665_0073732 | 3300046531 | Bacteria | 1797 |
| 827 | Ga0495665_0185027 | 3300046531 | Bacteria | 1082 |
| 828 | Ga0495665_0208588 | 3300046531 | Unclassified | 1012 |
| 829 | Ga0495665_0577926 | 3300046531 | Unclassified | 563 |
| 830 | Ga0495640_0779097 | 3300046533 | Unclassified | 571 |
| 831 | Ga0495586_0152627 | 3300046535 | Bacteria | 1300 |
| 832 | Ga0495587_0408013 | 3300046536 | Bacteria | 755 |
| 833 | Ga0495587_0481983 | 3300046536 | Unclassified | 686 |
| 834 | Ga0495667_0402436 | 3300046559 | Unclassified | 862 |
| 835 | Ga0495667_0715297 | 3300046559 | Unclassified | 620 |
| 836 | Ga0495635_0121462 | 3300046663 | Bacteria | 1782 |
| 837 | Ga0495635_0239539 | 3300046663 | Unclassified | 1224 |
| 838 | Ga0495659_0109058 | 3300046664 | Bacteria | 1079 |
| 839 | Ga0495599_0104319 | 3300046678 | Bacteria | 1766 |
| 840 | Ga0495623_0107968 | 3300046679 | Bacteria | 1690 |
| 841 | Ga0495623_0274887 | 3300046679 | Bacteria | 939 |
| 842 | Ga0495623_0716922 | 3300046679 | Bacteria | 511 |
| 843 | Ga0495658_0025033 | 3300046683 | Bacteria | 3187 |
| 844 | Ga0495669_0009634 | 3300046684 | Unclassified | 4075 |
| 845 | Ga0495669_0231099 | 3300046684 | Unclassified | 887 |
| 846 | Ga0495669_0474592 | 3300046684 | Unclassified | 608 |
| 847 | Ga0495613_0843373 | 3300046689 | Bacteria | 596 |
| 848 | Ga0495581_0251228 | 3300047315 | Unclassified | 1034 |
| 849 | Ga0495581_0470946 | 3300047315 | Bacteria | 731 |
| 850 | Ga0495674_0003000 | 3300047319 | Bacteria | 16446 |
| 851 | Ga0495674_0012646 | 3300047319 | Bacteria | 7953 |
| 852 | Ga0495674_0170785 | 3300047319 | Unclassified | 1815 |
| 853 | Ga0495676_0656097 | 3300047321 | Bacteria | 681 |
| 854 | Ga0495680_0521540 | 3300047322 | Unclassified | 804 |
| 855 | Ga0495684_0810390 | 3300047471 | Bacteria | 611 |
| 856 | Ga0495684_0987222 | 3300047471 | Unclassified | 536 |
| 857 | Ga0495602_0072611 | 3300048088 | Bacteria | 2933 |
| 858 | Ga0495602_0251730 | 3300048088 | Unclassified | 1316 |
| 859 | Ga0495602_0373851 | 3300048088 | Unclassified | 1023 |
| 860 | Ga0495602_1038662 | 3300048088 | Bacteria | 539 |
| 861 | Ga0496100_0720495 | 3300048903 | Bacteria | 779 |
| 862 | Ga0496101_0042051 | 3300048904 | Bacteria | 3262 |
| 863 | Ga0496101_0076992 | 3300048904 | Bacteria | 2458 |
| 864 | Ga0496101_0193841 | 3300048904 | Bacteria | 1569 |
| 865 | Ga0496101_0965482 | 3300048904 | Unclassified | 670 |
| 866 | Ga0496102_0001130 | 3300048905 | Bacteria | 24464 |
| 867 | Ga0496102_0018819 | 3300048905 | Bacteria | 6075 |
| 868 | Ga0496102_0063214 | 3300048905 | Bacteria | 3389 |
| 869 | Ga0496102_0452841 | 3300048905 | Bacteria | 1204 |
| 870 | Ga0496102_0528760 | 3300048905 | Bacteria | 1102 |
| 871 | Ga0496102_0608861 | 3300048905 | Unclassified | 1015 |
| 872 | Ga0496103_0132462 | 3300048906 | Bacteria | 1592 |
| 873 | Ga0496103_0394144 | 3300048906 | Bacteria | 889 |
| 874 | Ga0496104_0041510 | 3300048907 | Bacteria | 4314 |
| 875 | Ga0496104_0185833 | 3300048907 | Bacteria | 1989 |
| 876 | Ga0496104_0220682 | 3300048907 | Bacteria | 1808 |
| 877 | Ga0496105_0165330 | 3300048908 | Bacteria | 1815 |
| 878 | Ga0496105_0691099 | 3300048908 | Unclassified | 784 |
| 879 | Ga0496105_0696593 | 3300048908 | Unclassified | 780 |
| 880 | Ga0496106_0073256 | 3300048909 | Bacteria | 2620 |
| 881 | Ga0496106_0817712 | 3300048909 | Unclassified | 739 |
| 882 | Ga0496106_1019993 | 3300048909 | Unclassified | 650 |
| 883 | Ga0496106_1331003 | 3300048909 | Unclassified | 557 |
| 884 | Ga0496107_0472374 | 3300048910 | Bacteria | 931 |
| 885 | Ga0496107_0518713 | 3300048910 | Unclassified | 884 |
| 886 | Ga0496108_0067665 | 3300048911 | Bacteria | 3013 |
| 887 | Ga0496108_0214874 | 3300048911 | Bacteria | 1670 |
| 888 | Ga0496108_0969182 | 3300048911 | Unclassified | 727 |
| 889 | Ga0496108_1185965 | 3300048911 | Bacteria | 646 |
| 890 | Ga0496109_0171357 | 3300048912 | Bacteria | 2036 |
| 891 | Ga0496109_0974792 | 3300048912 | Unclassified | 785 |
| 892 | Ga0496109_1307603 | 3300048912 | Bacteria | 661 |
| 893 | Ga0496110_0123632 | 3300048913 | Bacteria | 2333 |
| 894 | Ga0496111_0069793 | 3300048914 | Bacteria | 2555 |
| 895 | Ga0496112_0013920 | 3300048915 | Bacteria | 7441 |
| 896 | Ga0496112_0056580 | 3300048915 | Unclassified | 3860 |
| 897 | Ga0496112_0088725 | 3300048915 | Unclassified | 3060 |
| 898 | Ga0496112_0122496 | 3300048915 | Unclassified | 2571 |
| 899 | Ga0496112_0318216 | 3300048915 | Bacteria | 1500 |
| 900 | Ga0496112_0341361 | 3300048915 | Unclassified | 1441 |
| 901 | Ga0496112_0363564 | 3300048915 | Bacteria | 1389 |
| 902 | Ga0496112_0372351 | 3300048915 | Bacteria | 1370 |
| 903 | Ga0496112_0378184 | 3300048915 | Bacteria | 1357 |
| 904 | Ga0496112_0518669 | 3300048915 | Bacteria | 1126 |
| 905 | Ga0496113_0112321 | 3300048916 | Bacteria | 2122 |
| 906 | Ga0496113_0429341 | 3300048916 | Bacteria | 1061 |
| 907 | Ga0496113_0973295 | 3300048916 | Unclassified | 669 |
| 908 | Ga0496114_0328654 | 3300048917 | Bacteria | 1351 |
| 909 | Ga0496115_0158300 | 3300048918 | Bacteria | 1871 |
| 910 | Ga0496115_0253098 | 3300048918 | Bacteria | 1450 |
| 911 | Ga0496115_0477463 | 3300048918 | Unclassified | 1004 |
| 912 | Ga0501069_0105077 | 3300049585 | Bacteria | 1605 |
| 913 | nmdc:mga0n895_430136_c1 | 3300050512 | Bacteria | 1334 |
| 914 | nmdc:mga0n895_5582_c1 | 3300050512 | Bacteria | 10533 |
| 915 | nmdc:mga0rr50_1070148_c1 | 3300050513 | Unclassified | 686 |
| 916 | nmdc:mga0rr50_357297_c1 | 3300050513 | Bacteria | 1229 |
| 917 | nmdc:mga0rr50_41511_c1 | 3300050513 | Unclassified | 3353 |
| 918 | nmdc:mga0rr50_450683_c1 | 3300050513 | Bacteria | 1091 |
| 919 | nmdc:mga08x19_22909_c1 | 3300050514 | Bacteria | 3872 |
| 920 | nmdc:mga08x19_75917_c1 | 3300050514 | Bacteria | 2198 |
| 921 | nmdc:mga08x19_9368_c1 | 3300050514 | Bacteria | 5862 |
| 922 | nmdc:mga08x19_985335_c1 | 3300050514 | Bacteria | 599 |
| 923 | nmdc:mga0a205_81157_c1 | 3300050515 | Bacteria | 3133 |
| 924 | Ga0495612_0348081 | 3300053078 | Bacteria | 669 |
| 925 | Ga0495612_0486955 | 3300053078 | Unclassified | 565 |
| 926 | Ga0495619_0260355 | 3300053085 | Bacteria | 1202 |
| 927 | Ga0495619_0625759 | 3300053085 | Unclassified | 735 |
| 928 | Ga0587070_179775 | 3300059491 | Unclassified | 550 |
| 929 | Ga0587080_129361 | 3300059503 | Unclassified | 567 |
| 930 | Ga0587088_100257 | 3300059508 | Bacteria | 646 |
| 931 | Ga0587117_092631 | 3300059627 | Bacteria | 566 |
| 932 | Ga0466962_0041521 | 3300061719 | Bacteria | 2201 |
| 933 | Ga0070713_100612543 | |||
| 934 | LJNas_1000206 | |||
| 935 | rootH1_10200571 | |||
| 936 | Ga0065704_10652891 | |||
| 937 | Ga0065712_10164499 | |||
| 938 | Ga0065712_10679101 | |||
| 939 | Ga0065715_10246143 | |||
| 940 | Ga0070658_10859216 | |||
| 941 | Ga0070683_100212022 | |||
| 942 | Ga0070683_101135179 | |||
| 943 | Ga0070690_100033150 | |||
| 944 | Ga0070690_101507809 | |||
| 945 | Ga0070670_100282565 | |||
| 946 | Ga0070670_100847058 | |||
| 947 | Ga0070670_101046804 | |||
| 948 | Ga0068869_100016525 | |||
| 949 | Ga0068869_100489440 | |||
| 950 | Ga0070680_101471809 | |||
| 951 | Ga0068868_100004274 | |||
| 952 | Ga0068868_100010136 | |||
| 953 | Ga0068868_100015485 | |||
| 954 | Ga0068868_100067612 | |||
| 955 | Ga0068868_100233080 | |||
| 956 | Ga0068868_101547983 | |||
| 957 | Ga0070660_100182966 | |||
| 958 | Ga0070660_100226820 | |||
| 959 | Ga0070689_100347447 | |||
| 960 | Ga0070691_10023427 | |||
| 961 | Ga0070661_100111181 | |||
| 962 | Ga0070671_100036167 | |||
| 963 | Ga0070671_100150911 | |||
| 964 | Ga0070671_100432105 | |||
| 965 | Ga0070673_100148050 | |||
| 966 | Ga0070673_100259368 | |||
| 967 | Ga0070673_101018997 | |||
| 968 | Ga0070688_100195036 | |||
| 969 | Ga0070688_101610823 | |||
| 970 | Ga0070659_100019631 | |||
| 971 | Ga0070709_10003985 | |||
| 972 | Ga0070709_10012423 | |||
| 973 | Ga0070709_10020202 | |||
| 974 | Ga0070709_10021039 | |||
| 975 | Ga0070709_10024221 | |||
| 976 | Ga0070709_10035156 | |||
| 977 | Ga0070709_10206659 | |||
| 978 | Ga0070709_10298093 | |||
| 979 | Ga0070709_10556611 | |||
| 980 | Ga0070709_11227128 | |||
| 981 | Ga0070709_11400587 | |||
| 982 | Ga0070714_100000027 | |||
| 983 | Ga0070714_100002201 | |||
| 984 | Ga0070714_100076096 | |||
| 985 | Ga0070714_100127151 | |||
| 986 | Ga0070714_100146116 | |||
| 987 | Ga0070714_100296172 | |||
| 988 | Ga0070714_100411638 | |||
| 989 | Ga0070714_100462397 | |||
| 990 | Ga0070714_100464821 | |||
| 991 | Ga0070714_100509808 | |||
| 992 | Ga0070714_100585092 | |||
| 993 | Ga0070714_101068032 | |||
| 994 | Ga0070714_101325331 | |||
| 995 | Ga0070714_101394115 | |||
| 996 | Ga0070714_101688715 | |||
| 997 | Ga0070713_100001584 | |||
| 998 | Ga0070713_100003636 | |||
| 999 | Ga0070713_100005353 | |||
| 1000 | Ga0070713_100008775 | |||
| 1001 | Ga0070713_100039400 | |||
| 1002 | Ga0070713_100039484 | |||
| 1003 | Ga0070713_100051079 | |||
| 1004 | Ga0070713_100078460 | |||
| 1005 | Ga0070713_100082259 | |||
| 1006 | Ga0070713_100123309 | |||
| 1007 | Ga0070713_100157404 | |||
| 1008 | Ga0070713_100228002 | |||
| 1009 | Ga0070713_100253563 | |||
| 1010 | Ga0070713_100430554 | |||
| 1011 | Ga0070713_101630353 | |||
| 1012 | Ga0070713_101944420 | |||
| 1013 | Ga0070713_101996851 | |||
| 1014 | Ga0070713_102247332 | |||
| 1015 | Ga0070710_10006613 | |||
| 1016 | Ga0070710_10007134 | |||
| 1017 | Ga0070710_10077685 | |||
| 1018 | Ga0070710_10136498 | |||
| 1019 | Ga0070710_10162166 | |||
| 1020 | Ga0070710_10399702 | |||
| 1021 | Ga0070710_10539284 | |||
| 1022 | Ga0070711_100000304 | |||
| 1023 | Ga0070711_100002768 | |||
| 1024 | Ga0070711_100044735 | |||
| 1025 | Ga0070711_100064703 | |||
| 1026 | Ga0070711_100089806 | |||
| 1027 | Ga0070711_100122763 | |||
| 1028 | Ga0070711_100193356 | |||
| 1029 | Ga0070711_100251176 | |||
| 1030 | Ga0070711_101316109 | |||
| 1031 | Ga0070700_100500026 | |||
| 1032 | Ga0070708_100017677 | |||
| 1033 | Ga0070708_100043504 | |||
| 1034 | Ga0070708_100326076 | |||
| 1035 | Ga0070708_101031473 | |||
| 1036 | Ga0070708_101402442 | |||
| 1037 | Ga0070663_100642416 | |||
| 1038 | Ga0070678_100927794 | |||
| 1039 | Ga0070678_101797695 | |||
| 1040 | Ga0070662_100009607 | |||
| 1041 | Ga0070681_10003101 | |||
| 1042 | Ga0070681_10010702 | |||
| 1043 | Ga0070681_10212272 | |||
| 1044 | Ga0070681_10306699 | |||
| 1045 | Ga0070681_10680775 | |||
| 1046 | Ga0070681_10747938 | |||
| 1047 | Ga0070681_11885225 | |||
| 1048 | Ga0068867_100558673 | |||
| 1049 | Ga0068867_100641111 | |||
| 1050 | Ga0070685_10004730 | |||
| 1051 | Ga0070706_100007974 | |||
| 1052 | Ga0070706_100040422 | |||
| 1053 | Ga0070706_100474403 | |||
| 1054 | Ga0070707_100036019 | |||
| 1055 | Ga0070707_100330457 | |||
| 1056 | Ga0070707_101821524 | |||
| 1057 | Ga0070707_101824681 | |||
| 1058 | Ga0070698_100030970 | |||
| 1059 | Ga0070698_100114500 | |||
| 1060 | Ga0070699_100073333 | |||
| 1061 | Ga0070699_100236302 | |||
| 1062 | Ga0070699_100769605 | |||
| 1063 | Ga0070699_100789537 | |||
| 1064 | Ga0070679_100090869 | |||
| 1065 | Ga0070679_100143641 | |||
| 1066 | Ga0070679_100233122 | |||
| 1067 | Ga0070679_100263807 | |||
| 1068 | Ga0070679_100284058 | |||
| 1069 | Ga0070679_100322477 | |||
| 1070 | Ga0070684_100041877 | |||
| 1071 | Ga0070684_100168299 | |||
| 1072 | Ga0070684_100281358 | |||
| 1073 | Ga0070684_100938285 | |||
| 1074 | Ga0070684_101249744 | |||
| 1075 | Ga0070697_100003817 | |||
| 1076 | Ga0070697_100396846 | |||
| 1077 | Ga0070697_100606679 | |||
| 1078 | Ga0070697_100699579 | |||
| 1079 | Ga0070697_101199804 | |||
| 1080 | Ga0068853_100043786 | |||
| 1081 | Ga0068853_100193876 | |||
| 1082 | Ga0068853_100492169 | |||
| 1083 | Ga0068853_101645966 | |||
| 1084 | Ga0070672_101932136 | |||
| 1085 | Ga0070695_100099058 | |||
| 1086 | Ga0070695_100550550 | |||
| 1087 | Ga0070695_100980734 | |||
| 1088 | Ga0070696_100373562 | |||
| 1089 | Ga0070696_101207436 | |||
| 1090 | Ga0070693_100076861 | |||
| 1091 | Ga0070693_100132887 | |||
| 1092 | Ga0070665_100410887 | |||
| 1093 | Ga0070665_101632492 | |||
| 1094 | Ga0070704_100804846 | |||
| 1095 | Ga0070704_100933335 | |||
| 1096 | Ga0068855_100000972 | |||
| 1097 | Ga0068855_100005186 | |||
| 1098 | Ga0068855_100009464 | |||
| 1099 | Ga0068855_100033636 | |||
| 1100 | Ga0068855_100153038 | |||
| 1101 | Ga0068855_100483881 | |||
| 1102 | Ga0068855_100485769 | |||
| 1103 | Ga0068855_100945639 | |||
| 1104 | Ga0068855_102575346 | |||
| 1105 | Ga0070664_100143476 | |||
| 1106 | Ga0070664_100160933 | |||
| 1107 | Ga0070664_100234733 | |||
| 1108 | Ga0068857_100002605 | |||
| 1109 | Ga0068857_100274174 | |||
| 1110 | Ga0068854_100205476 | |||
| 1111 | Ga0068854_100279676 | |||
| 1112 | Ga0068854_100755248 | |||
| 1113 | Ga0068856_100004248 | |||
| 1114 | Ga0068856_100020096 | |||
| 1115 | Ga0068856_100025521 | |||
| 1116 | Ga0068856_100088690 | |||
| 1117 | Ga0068856_100586059 | |||
| 1118 | Ga0070702_100019200 | |||
| 1119 | Ga0068852_100075447 | |||
| 1120 | Ga0068852_100262758 | |||
| 1121 | Ga0068852_101612984 | |||
| 1122 | Ga0068859_100003437 | |||
| 1123 | Ga0068864_100020480 | |||
| 1124 | Ga0068864_100408820 | |||
| 1125 | Ga0068864_101446899 | |||
| 1126 | Ga0068866_10131457 | |||
| 1127 | Ga0068866_10777272 | |||
| 1128 | Ga0068861_100034627 | |||
| 1129 | Ga0068851_10034400 | |||
| 1130 | Ga0068851_10416199 | |||
| 1131 | Ga0068863_100029798 | |||
| 1132 | Ga0068863_100047816 | |||
| 1133 | Ga0068863_100115709 | |||
| 1134 | Ga0068863_100204477 | |||
| 1135 | Ga0068863_100389164 | |||
| 1136 | Ga0068863_100606111 | |||
| 1137 | Ga0068863_100886200 | |||
| 1138 | Ga0068863_102129930 | |||
| 1139 | Ga0068858_100005022 | |||
| 1140 | Ga0068858_100011419 | |||
| 1141 | Ga0068858_100031518 | |||
| 1142 | Ga0068858_101765582 | |||
| 1143 | Ga0068860_100067480 | |||
| 1144 | Ga0068860_100755515 | |||
| 1145 | Ga0068860_100895013 | |||
| 1146 | Ga0068862_100037543 | |||
| 1147 | Ga0068862_100482861 | |||
| 1148 | Ga0081540_1078030 | |||
| 1149 | Ga0070717_10000295 | |||
| 1150 | Ga0070717_10004957 | |||
| 1151 | Ga0070717_10015542 | |||
| 1152 | Ga0070717_10017181 | |||
| 1153 | Ga0070717_10031549 | |||
| 1154 | Ga0070717_10045714 | |||
| 1155 | Ga0070717_10050470 | |||
| 1156 | Ga0070717_10066155 | |||
| 1157 | Ga0070717_10096973 | |||
| 1158 | Ga0070717_10103290 | |||
| 1159 | Ga0070717_10148951 | |||
| 1160 | Ga0070717_10180570 | |||
| 1161 | Ga0070717_10214751 | |||
| 1162 | Ga0070717_10229455 | |||
| 1163 | Ga0070717_10302501 | |||
| 1164 | Ga0070717_10307428 | |||
| 1165 | Ga0070717_10376897 | |||
| 1166 | Ga0070717_10456622 | |||
| 1167 | Ga0070717_10470271 | |||
| 1168 | Ga0070717_10647345 | |||
| 1169 | Ga0070717_11279944 | |||
| 1170 | Ga0070715_10002640 | |||
| 1171 | Ga0070715_10011180 | |||
| 1172 | Ga0070715_10199317 | |||
| 1173 | Ga0070716_100001322 | |||
| 1174 | Ga0070716_100002474 | |||
| 1175 | Ga0070716_100027878 | |||
| 1176 | Ga0070716_100027945 | |||
| 1177 | Ga0070716_100034245 | |||
| 1178 | Ga0070716_100112130 | |||
| 1179 | Ga0070716_100155142 | |||
| 1180 | Ga0070716_100185494 | |||
| 1181 | Ga0070716_100219910 | |||
| 1182 | Ga0070716_100250737 | |||
| 1183 | Ga0070716_100288895 | |||
| 1184 | Ga0070716_100295895 | |||
| 1185 | Ga0070716_100308263 | |||
| 1186 | Ga0070716_100486881 | |||
| 1187 | Ga0070712_100000223 | |||
| 1188 | Ga0070712_100000236 | |||
| 1189 | Ga0070712_100011319 | |||
| 1190 | Ga0070712_100021122 | |||
| 1191 | Ga0070712_100050450 | |||
| 1192 | Ga0070712_100134729 | |||
| 1193 | Ga0070712_100492917 | |||
| 1194 | Ga0070712_100603930 | |||
| 1195 | Ga0070712_100908932 | |||
| 1196 | Ga0070712_101045555 | |||
| 1197 | Ga0070712_101921951 | |||
| 1198 | Ga0097621_100000044 | |||
| 1199 | Ga0097621_100002742 | |||
| 1200 | Ga0097621_100040523 | |||
| 1201 | Ga0097621_100377672 | |||
| 1202 | Ga0097621_100490618 | |||
| 1203 | Ga0097621_101222235 | |||
| 1204 | Ga0068871_100000175 | |||
| 1205 | Ga0068871_100001719 | |||
| 1206 | Ga0068871_100026987 | |||
| 1207 | Ga0068871_100219307 | |||
| 1208 | Ga0068871_100283558 | |||
| 1209 | Ga0068871_101815748 | |||
| 1210 | Ga0075433_10260520 | |||
| 1211 | Ga0075434_100000335 | |||
| 1212 | Ga0075434_100369517 | |||
| 1213 | Ga0068865_100056792 | |||
| 1214 | Ga0068865_100074255 | |||
| 1215 | Ga0075436_100001801 | |||
| 1216 | Ga0075436_100003920 | |||
| 1217 | Ga0075436_100239753 | |||
| 1218 | Ga0075436_100304335 | |||
| 1219 | Ga0075436_100323296 | |||
| 1220 | Ga0075436_101114708 | |||
| 1221 | Ga0097620_100003437 | |||
| 1222 | Ga0075435_100048840 | |||
| 1223 | Ga0075435_100495168 | |||
| 1224 | Ga0075435_100752283 | |||
| 1225 | Ga0099794_10124970 | |||
| 1226 | Ga0099795_10018840 | |||
| 1227 | Ga0105250_10107831 | |||
| 1228 | Ga0105240_10027257 | |||
| 1229 | Ga0105240_10035113 | |||
| 1230 | Ga0105240_10036142 | |||
| 1231 | Ga0105240_10040220 | |||
| 1232 | Ga0105240_10054904 | |||
| 1233 | Ga0105240_10142982 | |||
| 1234 | Ga0105240_10148860 | |||
| 1235 | Ga0105240_10164426 | |||
| 1236 | Ga0105240_10207914 | |||
| 1237 | Ga0105240_10251254 | |||
| 1238 | Ga0105245_10092053 | |||
| 1239 | Ga0105245_10118472 | |||
| 1240 | Ga0105245_10470252 | |||
| 1241 | Ga0105245_10500769 | |||
| 1242 | Ga0105245_12945637 | |||
| 1243 | Ga0105245_13209565 | |||
| 1244 | Ga0105247_10101509 | |||
| 1245 | Ga0105247_10834597 | |||
| 1246 | Ga0105243_12646587 | |||
| 1247 | Ga0105241_10019404 | |||
| 1248 | Ga0105241_10023082 | |||
| 1249 | Ga0105241_10110450 | |||
| 1250 | Ga0105241_10242171 | |||
| 1251 | Ga0105241_10256801 | |||
| 1252 | Ga0105241_10363584 | |||
| 1253 | Ga0105241_10637764 | |||
| 1254 | Ga0105242_10135087 | |||
| 1255 | Ga0105248_10010020 | |||
| 1256 | Ga0105248_10021037 | |||
| 1257 | Ga0105248_10294208 | |||
| 1258 | Ga0105248_10588635 | |||
| 1259 | Ga0105248_10664063 | |||
| 1260 | Ga0105248_10933154 | |||
| 1261 | Ga0105248_11767795 | |||
| 1262 | Ga0105237_10084739 | |||
| 1263 | Ga0105237_10101879 | |||
| 1264 | Ga0105237_10128608 | |||
| 1265 | Ga0105237_10216054 | |||
| 1266 | Ga0105237_10267542 | |||
| 1267 | Ga0105237_10428016 | |||
| 1268 | Ga0105237_10954699 | |||
| 1269 | Ga0105237_12541651 | |||
| 1270 | Ga0105237_12648114 | |||
| 1271 | Ga0105238_10000231 | |||
| 1272 | Ga0105238_10014889 | |||
| 1273 | Ga0105238_10313185 | |||
| 1274 | Ga0105238_10417048 | |||
| 1275 | Ga0105238_10423724 | |||
| 1276 | Ga0105238_10589506 | |||
| 1277 | Ga0105238_10925650 | |||
| 1278 | Ga0105249_10014329 | |||
| 1279 | Ga0099796_10032975 | |||
| 1280 | Ga0105239_10031877 | |||
| 1281 | Ga0105239_10039280 | |||
| 1282 | Ga0105239_10067537 | |||
| 1283 | Ga0105239_10101085 | |||
| 1284 | Ga0105239_10129627 | |||
| 1285 | Ga0105239_10803648 | |||
| 1286 | Ga0105239_10866744 | |||
| 1287 | Ga0157373_10020821 | |||
| 1288 | Ga0157373_10055943 | |||
| 1289 | Ga0157373_10180678 | |||
| 1290 | Ga0157373_10184089 | |||
| 1291 | Ga0157371_10027063 | |||
| 1292 | Ga0157371_10512541 | |||
| 1293 | Ga0157370_10016753 | |||
| 1294 | Ga0157370_10673529 | |||
| 1295 | Ga0157370_10690069 | |||
| 1296 | Ga0157369_10000319 | |||
| 1297 | Ga0157369_10049225 | |||
| 1298 | Ga0157369_10104869 | |||
| 1299 | Ga0157369_10217413 | |||
| 1300 | Ga0157369_10243505 | |||
| 1301 | Ga0157369_10358356 | |||
| 1302 | Ga0157369_10361747 | |||
| 1303 | Ga0157369_10514745 | |||
| 1304 | Ga0157374_10000901 | |||
| 1305 | Ga0157374_10001359 | |||
| 1306 | Ga0157374_10007673 | |||
| 1307 | Ga0157374_10019345 | |||
| 1308 | Ga0157374_10056203 | |||
| 1309 | Ga0157374_10111874 | |||
| 1310 | Ga0157374_10131268 | |||
| 1311 | Ga0157374_10297037 | |||
| 1312 | Ga0157374_10605164 | |||
| 1313 | Ga0157374_11039239 | |||
| 1314 | Ga0157378_10000222 | |||
| 1315 | Ga0157378_10020356 | |||
| 1316 | Ga0157378_10084164 | |||
| 1317 | Ga0157378_10222787 | |||
| 1318 | Ga0157378_11066131 | |||
| 1319 | Ga0157378_11409837 | |||
| 1320 | Ga0163162_10005111 | |||
| 1321 | Ga0163162_10147478 | |||
| 1322 | Ga0163162_10308058 | |||
| 1323 | Ga0163162_10667306 | |||
| 1324 | Ga0157372_10000647 | |||
| 1325 | Ga0157372_10000933 | |||
| 1326 | Ga0157372_10001310 | |||
| 1327 | Ga0157372_10046842 | |||
| 1328 | Ga0157372_10088840 | |||
| 1329 | Ga0157372_10123425 | |||
| 1330 | Ga0157372_10172681 | |||
| 1331 | Ga0157372_10177851 | |||
| 1332 | Ga0157372_10184882 | |||
| 1333 | Ga0157372_10207680 | |||
| 1334 | Ga0157372_10268956 | |||
| 1335 | Ga0157372_12120254 | |||
| 1336 | Ga0157372_12401381 | |||
| 1337 | Ga0157372_12582602 | |||
| 1338 | Ga0157372_13369076 | |||
| 1339 | Ga0157375_10029397 | |||
| 1340 | Ga0157375_10244260 | |||
| 1341 | Ga0163163_10005018 | |||
| 1342 | Ga0163163_10089030 | |||
| 1343 | Ga0163163_10092447 | |||
| 1344 | Ga0163163_10178013 | |||
| 1345 | Ga0163163_10738919 | |||
| 1346 | Ga0163163_12690392 | |||
| 1347 | Ga0157380_10704498 | |||
| 1348 | Ga0182008_10006218 | |||
| 1349 | Ga0182008_10027388 | |||
| 1350 | Ga0157379_10002644 | |||
| 1351 | Ga0157379_10311374 | |||
| 1352 | Ga0157379_10331874 | |||
| 1353 | Ga0157376_10003294 | |||
| 1354 | Ga0157376_10023198 | |||
| 1355 | Ga0157376_10050708 | |||
| 1356 | Ga0157376_10126510 | |||
| 1357 | Ga0157376_10230442 | |||
| 1358 | Ga0157376_10477209 | |||
| 1359 | Ga0182006_1055778 | |||
| 1360 | Ga0182007_10003465 | |||
| 1361 | Ga0182007_10017980 | |||
| 1362 | Ga0182005_1005531 | |||
| 1363 | Ga0163161_11104351 | |||
| 1364 | Ga0206356_10337735 | |||
| 1365 | Ga0213875_10641175 | |||
| 1366 | Ga0224572_1008682 | |||
| 1367 | Ga0228598_1017818 | |||
| 1368 | Ga0207656_10171531 | |||
| 1369 | Ga0207692_10012108 | |||
| 1370 | Ga0207692_10020444 | |||
| 1371 | Ga0207692_10038160 | |||
| 1372 | Ga0207692_10062804 | |||
| 1373 | Ga0207692_10386211 | |||
| 1374 | Ga0207692_10391142 | |||
| 1375 | Ga0207642_10221924 | |||
| 1376 | Ga0207642_10356527 | |||
| 1377 | Ga0207710_10483000 | |||
| 1378 | Ga0207647_10002682 | |||
| 1379 | Ga0207647_10318654 | |||
| 1380 | Ga0207685_10001253 | |||
| 1381 | Ga0207685_10041711 | |||
| 1382 | Ga0207685_10061050 | |||
| 1383 | Ga0207685_10061675 | |||
| 1384 | Ga0207685_10168868 | |||
| 1385 | Ga0207699_10003226 | |||
| 1386 | Ga0207699_10007415 | |||
| 1387 | Ga0207699_10017610 | |||
| 1388 | Ga0207699_10024181 | |||
| 1389 | Ga0207699_10026450 | |||
| 1390 | Ga0207699_10088796 | |||
| 1391 | Ga0207699_10139651 | |||
| 1392 | Ga0207699_10145547 | |||
| 1393 | Ga0207699_10199619 | |||
| 1394 | Ga0207699_10213350 | |||
| 1395 | Ga0207699_10403968 | |||
| 1396 | Ga0207699_10590882 | |||
| 1397 | Ga0207699_10672892 | |||
| 1398 | Ga0207699_10986158 | |||
| 1399 | Ga0207699_11119030 | |||
| 1400 | Ga0207699_11163987 | |||
| 1401 | Ga0207699_11219850 | |||
| 1402 | Ga0207705_10612485 | |||
| 1403 | Ga0207684_10007054 | |||
| 1404 | Ga0207684_10035594 | |||
| 1405 | Ga0207684_10393810 | |||
| 1406 | Ga0207684_10668001 | |||
| 1407 | Ga0207684_11223001 | |||
| 1408 | Ga0207654_10019436 | |||
| 1409 | Ga0207654_10024382 | |||
| 1410 | Ga0207654_10075943 | |||
| 1411 | Ga0207654_10132631 | |||
| 1412 | Ga0207654_10142808 | |||
| 1413 | Ga0207654_10376621 | |||
| 1414 | Ga0207654_10608534 | |||
| 1415 | Ga0207707_10005917 | |||
| 1416 | Ga0207707_10008015 | |||
| 1417 | Ga0207707_10408234 | |||
| 1418 | Ga0207707_10554077 | |||
| 1419 | Ga0207707_10567344 | |||
| 1420 | Ga0207707_10577137 | |||
| 1421 | Ga0207695_10037976 | |||
| 1422 | Ga0207695_10042469 | |||
| 1423 | Ga0207695_10091428 | |||
| 1424 | Ga0207695_10138422 | |||
| 1425 | Ga0207695_10307675 | |||
| 1426 | Ga0207671_10026369 | |||
| 1427 | Ga0207671_10035109 | |||
| 1428 | Ga0207671_10080424 | |||
| 1429 | Ga0207693_10000004 | |||
| 1430 | Ga0207693_10000661 | |||
| 1431 | Ga0207693_10001237 | |||
| 1432 | Ga0207693_10017281 | |||
| 1433 | Ga0207693_10030654 | |||
| 1434 | Ga0207693_10061416 | |||
| 1435 | Ga0207693_10076849 | |||
| 1436 | Ga0207693_10326881 | |||
| 1437 | Ga0207693_10416193 | |||
| 1438 | Ga0207693_10737439 | |||
| 1439 | Ga0207693_11389332 | |||
| 1440 | Ga0207663_10002276 | |||
| 1441 | Ga0207663_10013712 | |||
| 1442 | Ga0207663_10014158 | |||
| 1443 | Ga0207663_10035487 | |||
| 1444 | Ga0207663_10050643 | |||
| 1445 | Ga0207663_10081962 | |||
| 1446 | Ga0207663_10087605 | |||
| 1447 | Ga0207663_10162269 | |||
| 1448 | Ga0207663_10209381 | |||
| 1449 | Ga0207663_11044331 | |||
| 1450 | Ga0207660_10112881 | |||
| 1451 | Ga0207660_10286991 | |||
| 1452 | Ga0207660_10698111 | |||
| 1453 | Ga0207657_10001068 | |||
| 1454 | Ga0207649_10232800 | |||
| 1455 | Ga0207649_10519706 | |||
| 1456 | Ga0207652_10117314 | |||
| 1457 | Ga0207652_10259406 | |||
| 1458 | Ga0207652_10367517 | |||
| 1459 | Ga0207652_10458743 | |||
| 1460 | Ga0207652_10528694 | |||
| 1461 | Ga0207652_10618594 | |||
| 1462 | Ga0207652_10912213 | |||
| 1463 | Ga0207646_10086017 | |||
| 1464 | Ga0207646_10219265 | |||
| 1465 | Ga0207646_10580360 | |||
| 1466 | Ga0207646_11357451 | |||
| 1467 | Ga0207646_11674527 | |||
| 1468 | Ga0207694_10003398 | |||
| 1469 | Ga0207694_10194955 | |||
| 1470 | Ga0207694_10295630 | |||
| 1471 | Ga0207694_10554072 | |||
| 1472 | Ga0207650_11047735 | |||
| 1473 | Ga0207650_11191221 | |||
| 1474 | Ga0207650_11539198 | |||
| 1475 | Ga0207650_11849642 | |||
| 1476 | Ga0207687_10085277 | |||
| 1477 | Ga0207687_10128467 | |||
| 1478 | Ga0207687_10348730 | |||
| 1479 | Ga0207687_10690727 | |||
| 1480 | Ga0207687_11792659 | |||
| 1481 | Ga0207700_10000612 | |||
| 1482 | Ga0207700_10036330 | |||
| 1483 | Ga0207700_10046178 | |||
| 1484 | Ga0207700_10121951 | |||
| 1485 | Ga0207700_10122219 | |||
| 1486 | Ga0207700_10285415 | |||
| 1487 | Ga0207700_10312604 | |||
| 1488 | Ga0207700_10390348 | |||
| 1489 | Ga0207700_10618395 | |||
| 1490 | Ga0207700_10632504 | |||
| 1491 | Ga0207700_10775013 | |||
| 1492 | Ga0207700_10805302 | |||
| 1493 | Ga0207700_10862573 | |||
| 1494 | Ga0207700_11187755 | |||
| 1495 | Ga0207700_11660495 | |||
| 1496 | Ga0207664_10011550 | |||
| 1497 | Ga0207664_10012644 | |||
| 1498 | Ga0207664_10028407 | |||
| 1499 | Ga0207664_10038351 | |||
| 1500 | Ga0207664_10072881 | |||
| 1501 | Ga0207664_10079029 | |||
| 1502 | Ga0207664_10102991 | |||
| 1503 | Ga0207664_10180930 | |||
| 1504 | Ga0207664_10783614 | |||
| 1505 | Ga0207664_10786122 | |||
| 1506 | Ga0207664_11005151 | |||
| 1507 | Ga0207664_11299335 | |||
| 1508 | Ga0207664_11639429 | |||
| 1509 | Ga0207664_11701905 | |||
| 1510 | Ga0207644_10101625 | |||
| 1511 | Ga0207644_10424228 | |||
| 1512 | Ga0207690_10111779 | |||
| 1513 | Ga0207706_10018426 | |||
| 1514 | Ga0207709_11583966 | |||
| 1515 | Ga0207670_10389670 | |||
| 1516 | Ga0207704_10021989 | |||
| 1517 | Ga0207704_11140935 | |||
| 1518 | Ga0207665_10000225 | |||
| 1519 | Ga0207665_10001183 | |||
| 1520 | Ga0207665_10005820 | |||
| 1521 | Ga0207665_10030106 | |||
| 1522 | Ga0207665_10063282 | |||
| 1523 | Ga0207665_10097636 | |||
| 1524 | Ga0207665_10115699 | |||
| 1525 | Ga0207665_10251436 | |||
| 1526 | Ga0207665_10278024 | |||
| 1527 | Ga0207665_10310919 | |||
| 1528 | Ga0207711_10019361 | |||
| 1529 | Ga0207711_10042854 | |||
| 1530 | Ga0207711_10379144 | |||
| 1531 | Ga0207711_11101083 | |||
| 1532 | Ga0207689_10002500 | |||
| 1533 | Ga0207661_10025645 | |||
| 1534 | Ga0207661_11867205 | |||
| 1535 | Ga0207661_11917373 | |||
| 1536 | Ga0207679_10467059 | |||
| 1537 | Ga0207667_10001038 | |||
| 1538 | Ga0207667_10005367 | |||
| 1539 | Ga0207667_10214773 | |||
| 1540 | Ga0207667_10706631 | |||
| 1541 | Ga0207667_10863368 | |||
| 1542 | Ga0207651_10884283 | |||
| 1543 | Ga0207668_11517745 | |||
| 1544 | Ga0207640_10065196 | |||
| 1545 | Ga0207640_10109442 | |||
| 1546 | Ga0207640_10121388 | |||
| 1547 | Ga0207677_10003403 | |||
| 1548 | Ga0207677_10011172 | |||
| 1549 | Ga0207677_10016008 | |||
| 1550 | Ga0207677_10053695 | |||
| 1551 | Ga0207677_10566382 | |||
| 1552 | Ga0207677_11280616 | |||
| 1553 | Ga0207703_10007924 | |||
| 1554 | Ga0207703_10012076 | |||
| 1555 | Ga0207703_10077756 | |||
| 1556 | Ga0207639_10027116 | |||
| 1557 | Ga0207639_10051364 | |||
| 1558 | Ga0207639_10060353 | |||
| 1559 | Ga0207639_10316948 | |||
| 1560 | Ga0207639_10419839 | |||
| 1561 | Ga0207678_10167831 | |||
| 1562 | Ga0207702_10001933 | |||
| 1563 | Ga0207702_10001993 | |||
| 1564 | Ga0207702_10009683 | |||
| 1565 | Ga0207702_10130692 | |||
| 1566 | Ga0207702_10251402 | |||
| 1567 | Ga0207702_10572116 | |||
| 1568 | Ga0207641_10008199 | |||
| 1569 | Ga0207641_10116722 | |||
| 1570 | Ga0207641_10253215 | |||
| 1571 | Ga0207641_10989605 | |||
| 1572 | Ga0207641_11253753 | |||
| 1573 | Ga0207641_11788331 | |||
| 1574 | Ga0207648_10659938 | |||
| 1575 | Ga0207676_10007565 | |||
| 1576 | Ga0207676_10253333 | |||
| 1577 | Ga0207676_10924058 | |||
| 1578 | Ga0207676_11121205 | |||
| 1579 | Ga0207676_11230420 | |||
| 1580 | Ga0207674_10001455 | |||
| 1581 | Ga0207674_10300731 | |||
| 1582 | Ga0207674_10314187 | |||
| 1583 | Ga0207683_12139943 | |||
| 1584 | Ga0207698_10150932 | |||
| 1585 | Ga0207698_10237189 | |||
| 1586 | Ga0207698_10529119 | |||
| 1587 | Ga0265354_1003448 | |||
| 1588 | Ga0265356_1005053 | |||
| 1589 | Ga0268266_10291822 | |||
| 1590 | Ga0268266_11520024 | |||
| 1591 | Ga0268265_10027037 | |||
| 1592 | Ga0268264_10389398 | |||
| 1593 | Ga0268264_11012424 | |||
| 1594 | Ga0268264_11096467 | |||
| 1595 | Ga0265338_10030749 | |||
| 1596 | Ga0265338_10073770 | |||
| 1597 | Ga0265338_10256368 | |||
| 1598 | Ga0265338_10318398 | |||
| 1599 | Ga0265338_10480849 | |||
| 1600 | Ga0265762_1000408 | |||
| 1601 | Ga0265762_1003554 | |||
| 1602 | Ga0265762_1005006 | |||
| 1603 | Ga0265770_1027763 | |||
| 1604 | Ga0265764_114287 | |||
| 1605 | Ga0265760_10000213 | |||
| 1606 | Ga0265760_10004205 | |||
| 1607 | Ga0265760_10007276 | |||
| 1608 | Ga0265760_10034612 | |||
| 1609 | Ga0265332_10467778 | |||
| 1610 | Ga0265328_10116311 | |||
| 1611 | Ga0265325_10005070 | |||
| 1612 | Ga0265340_10055511 | |||
| 1613 | Ga0265340_10143502 | |||
| 1614 | Ga0265339_10024687 | |||
| 1615 | Ga0265339_10181022 | |||
| 1616 | Ga0265316_10015838 | |||
| 1617 | Ga0265314_10094745 | |||
| 1618 | Ga0265342_10039362 | |||
| 1619 | Ga0316212_1038967 | |||
| 1620 | Ga0316212_1063699 | |||
| 1621 | Ga0373926_0016474 | |||
| 1622 | Ga0373926_0045972 | |||
| 1623 | Ga0373926_0061563 | |||
| 1624 | Ga0373934_0097096 | |||
| 1625 | Ga0373934_0122691 | |||
| 1626 | Ga0373923_0122164 | |||
| 1627 | Ga0373936_0009197 | |||
| 1628 | Ga0373936_0037708 | |||
| 1629 | Ga0373941_0444124 | |||
| 1630 | Ga0373945_0005782 | |||
| 1631 | Ga0373945_0049127 | |||
| 1632 | Ga0373945_0176729 | |||
| 1633 | Ga0373954_0066602 | |||
| 1634 | Ga0373956_0059902 | |||
| 1635 | Ga0373957_0134144 | |||
| 1636 | Ga0373943_0000085 | |||
| 1637 | Ga0373943_0048492 | |||
| 1638 | Ga0373943_0134763 | |||
| 1639 | Ga0373943_0215840 | |||
| 1640 | Ga0373946_0058692 | |||
| 1641 | Ga0373946_0100904 | |||
| 1642 | Ga0373946_0107651 | |||
| 1643 | Ga0373946_0170064 | |||
| 1644 | Ga0373955_0208249 | |||
| 1645 | Ga0373924_0109723 | |||
| 1646 | Ga0373924_0248057 | |||
| 1647 | Ga0373931_0318883 | |||
| 1648 | Ga0373931_0669179 | |||
| 1649 | Ga0373931_1069037 | |||
| 1650 | Ga0373935_0001031 | |||
| 1651 | Ga0373935_0015379 | |||
| 1652 | Ga0373935_0309144 | |||
| 1653 | Ga0373935_0379497 | |||
| 1654 | Ga0373935_1116205 | |||
| 1655 | Ga0373927_0001082 | |||
| 1656 | Ga0373927_0040505 | |||
| 1657 | Ga0373927_0040613 | |||
| 1658 | Ga0373927_0106298 | |||
| 1659 | Ga0373927_0124732 | |||
| 1660 | Ga0373933_0073289 | |||
| 1661 | Ga0373933_0125327 | |||
| 1662 | Ga0373933_0304677 | |||
| 1663 | Ga0373933_0332315 | |||
| 1664 | Ga0373933_0470446 | |||
| 1665 | Ga0373933_0747353 | |||
| 1666 | Ga0373933_0974300 | |||
| 1667 | Ga0373947_0000049 | |||
| 1668 | Ga0373947_0001548 | |||
| 1669 | Ga0373947_0214641 | |||
| 1670 | Ga0373947_0943140 | |||
| 1671 | Ga0373947_1213543 | |||
| 1672 | Ga0373937_0019523 | |||
| 1673 | Ga0373937_0146471 | |||
| 1674 | Ga0373937_0282869 | |||
| 1675 | Ga0373937_0331159 | |||
| 1676 | Ga0373937_0440287 | |||
| 1677 | Ga0373937_0601758 | |||
| 1678 | Ga0373937_1614317 | |||
| 1679 | Ga0373937_1847743 | |||
| 1680 | Ga0373925_0005729 | |||
| 1681 | Ga0373925_0014322 | |||
| 1682 | Ga0373925_0044341 | |||
| 1683 | Ga0373925_0160606 | |||
| 1684 | Ga0373925_0178178 | |||
| 1685 | Ga0373925_0211267 | |||
| 1686 | Ga0373925_0243591 | |||
| 1687 | Ga0373925_0333680 | |||
| 1688 | Ga0373925_0784451 | |||
| 1689 | Ga0373925_1098723 | |||
| 1690 | Ga0395905_0546427 | |||
| 1691 | Ga0395905_0622457 | |||
| 1692 | Ga0395905_1473652 | |||
| 1693 | Ga0436364_0453284 | |||
| 1694 | Ga0395901_1355861 | |||
| 1695 | Ga0436365_0198018 | |||
| 1696 | Ga0436362_0459014 | |||
| 1697 | Ga0436362_1141864 | |||
| 1698 | Ga0451577_0000969 | |||
| 1699 | Ga0451577_0069818 | |||
| 1700 | Ga0451577_0624243 | |||
| 1701 | Ga0453683_0017766 | |||
| 1702 | Ga0453683_0205030 | |||
| 1703 | Ga0466963_0055738 | |||
| 1704 | Ga0466964_0200333 | |||
| 1705 | Ga0453684_0000803 | |||
| 1706 | Ga0466971_0039414 | |||
| 1707 | Ga0466968_0539834 | |||
| 1708 | Ga0466970_0193949 | |||
| 1709 | Ga0466957_0457233 | |||
| 1710 | Ga0466959_0249159 | |||
| 1711 | Ga0451576_0005970 | |||
| 1712 | Ga0451576_0036048 | |||
| 1713 | Ga0451576_0132089 | |||
| 1714 | Ga0451576_0176295 | |||
| 1715 | Ga0451576_0401206 | |||
| 1716 | Ga0451576_1900089 | |||
| 1717 | Ga0466958_0064705 | |||
| 1718 | Ga0466967_0092023 | |||
| 1719 | Ga0466967_0478250 | |||
| 1720 | Ga0495592_0637107 | |||
| 1721 | Ga0495590_0274944 | |||
| 1722 | Ga0495590_0402328 | |||
| 1723 | Ga0495629_0044791 | |||
| 1724 | Ga0495651_0442058 | |||
| 1725 | Ga0495653_0154602 | |||
| 1726 | Ga0495653_0407453 | |||
| 1727 | Ga0495580_0000220 | |||
| 1728 | Ga0495580_0000263 | |||
| 1729 | Ga0495580_0001602 | |||
| 1730 | Ga0495580_0002575 | |||
| 1731 | Ga0495580_0003289 | |||
| 1732 | Ga0495580_0017694 | |||
| 1733 | Ga0495580_0027327 | |||
| 1734 | Ga0495580_0049565 | |||
| 1735 | Ga0495580_0174420 | |||
| 1736 | Ga0495580_0214969 | |||
| 1737 | Ga0495580_0235848 | |||
| 1738 | Ga0495580_0273454 | |||
| 1739 | Ga0495580_0277564 | |||
| 1740 | Ga0495580_0294311 | |||
| 1741 | Ga0495580_0298856 | |||
| 1742 | Ga0495580_0419517 | |||
| 1743 | Ga0495580_0703147 | |||
| 1744 | Ga0495582_0000514 | |||
| 1745 | Ga0495582_0022061 | |||
| 1746 | Ga0495582_0344639 | |||
| 1747 | Ga0495662_0326178 | |||
| 1748 | Ga0495584_0029788 | |||
| 1749 | Ga0495594_0132819 | |||
| 1750 | Ga0495608_0323454 | |||
| 1751 | Ga0495628_0059400 | |||
| 1752 | Ga0495628_0575916 | |||
| 1753 | Ga0495630_0056141 | |||
| 1754 | Ga0495630_0067683 | |||
| 1755 | Ga0495630_0183716 | |||
| 1756 | Ga0495630_0259382 | |||
| 1757 | Ga0495630_0543698 | |||
| 1758 | Ga0495665_0073732 | |||
| 1759 | Ga0495665_0185027 | |||
| 1760 | Ga0495665_0208588 | |||
| 1761 | Ga0495665_0577926 | |||
| 1762 | Ga0495640_0779097 | |||
| 1763 | Ga0495586_0152627 | |||
| 1764 | Ga0495587_0408013 | |||
| 1765 | Ga0495587_0481983 | |||
| 1766 | Ga0495667_0402436 | |||
| 1767 | Ga0495667_0715297 | |||
| 1768 | Ga0495635_0121462 | |||
| 1769 | Ga0495635_0239539 | |||
| 1770 | Ga0495659_0109058 | |||
| 1771 | Ga0495599_0104319 | |||
| 1772 | Ga0495623_0107968 | |||
| 1773 | Ga0495623_0274887 | |||
| 1774 | Ga0495623_0716922 | |||
| 1775 | Ga0495658_0025033 | |||
| 1776 | Ga0495669_0009634 | |||
| 1777 | Ga0495669_0231099 | |||
| 1778 | Ga0495669_0474592 | |||
| 1779 | Ga0495613_0843373 | |||
| 1780 | Ga0495581_0251228 | |||
| 1781 | Ga0495581_0470946 | |||
| 1782 | Ga0495674_0003000 | |||
| 1783 | Ga0495674_0012646 | |||
| 1784 | Ga0495674_0170785 | |||
| 1785 | Ga0495676_0656097 | |||
| 1786 | Ga0495680_0521540 | |||
| 1787 | Ga0495684_0810390 | |||
| 1788 | Ga0495684_0987222 | |||
| 1789 | Ga0495602_0072611 | |||
| 1790 | Ga0495602_0251730 | |||
| 1791 | Ga0495602_0373851 | |||
| 1792 | Ga0495602_1038662 | |||
| 1793 | Ga0496100_0720495 | |||
| 1794 | Ga0496101_0042051 | |||
| 1795 | Ga0496101_0076992 | |||
| 1796 | Ga0496101_0193841 | |||
| 1797 | Ga0496101_0965482 | |||
| 1798 | Ga0496102_0001130 | |||
| 1799 | Ga0496102_0018819 | |||
| 1800 | Ga0496102_0063214 | |||
| 1801 | Ga0496102_0452841 | |||
| 1802 | Ga0496102_0528760 | |||
| 1803 | Ga0496102_0608861 | |||
| 1804 | Ga0496103_0132462 | |||
| 1805 | Ga0496103_0394144 | |||
| 1806 | Ga0496104_0041510 | |||
| 1807 | Ga0496104_0185833 | |||
| 1808 | Ga0496104_0220682 | |||
| 1809 | Ga0496105_0165330 | |||
| 1810 | Ga0496105_0691099 | |||
| 1811 | Ga0496105_0696593 | |||
| 1812 | Ga0496106_0073256 | |||
| 1813 | Ga0496106_0817712 | |||
| 1814 | Ga0496106_1019993 | |||
| 1815 | Ga0496106_1331003 | |||
| 1816 | Ga0496107_0472374 | |||
| 1817 | Ga0496107_0518713 | |||
| 1818 | Ga0496108_0067665 | |||
| 1819 | Ga0496108_0214874 | |||
| 1820 | Ga0496108_0969182 | |||
| 1821 | Ga0496108_1185965 | |||
| 1822 | Ga0496109_0171357 | |||
| 1823 | Ga0496109_0974792 | |||
| 1824 | Ga0496109_1307603 | |||
| 1825 | Ga0496110_0123632 | |||
| 1826 | Ga0496111_0069793 | |||
| 1827 | Ga0496112_0013920 | |||
| 1828 | Ga0496112_0056580 | |||
| 1829 | Ga0496112_0088725 | |||
| 1830 | Ga0496112_0122496 | |||
| 1831 | Ga0496112_0318216 | |||
| 1832 | Ga0496112_0341361 | |||
| 1833 | Ga0496112_0363564 | |||
| 1834 | Ga0496112_0372351 | |||
| 1835 | Ga0496112_0378184 | |||
| 1836 | Ga0496112_0518669 | |||
| 1837 | Ga0496113_0112321 | |||
| 1838 | Ga0496113_0429341 | |||
| 1839 | Ga0496113_0973295 | |||
| 1840 | Ga0496114_0328654 | |||
| 1841 | Ga0496115_0158300 | |||
| 1842 | Ga0496115_0253098 | |||
| 1843 | Ga0496115_0477463 | |||
| 1844 | Ga0501069_0105077 | |||
| 1845 | nmdc:mga0n895_430136_c1 | |||
| 1846 | nmdc:mga0n895_5582_c1 | |||
| 1847 | nmdc:mga0rr50_1070148_c1 | |||
| 1848 | nmdc:mga0rr50_357297_c1 | |||
| 1849 | nmdc:mga0rr50_41511_c1 | |||
| 1850 | nmdc:mga0rr50_450683_c1 | |||
| 1851 | nmdc:mga08x19_22909_c1 | |||
| 1852 | nmdc:mga08x19_75917_c1 | |||
| 1853 | nmdc:mga08x19_9368_c1 | |||
| 1854 | nmdc:mga08x19_985335_c1 | |||
| 1855 | nmdc:mga0a205_81157_c1 | |||
| 1856 | Ga0495612_0348081 | |||
| 1857 | Ga0495612_0486955 | |||
| 1858 | Ga0495619_0260355 | |||
| 1859 | Ga0495619_0625759 | |||
| 1860 | Ga0587070_179775 | |||
| 1861 | Ga0587080_129361 | |||
| 1862 | Ga0587088_100257 | |||
| 1863 | Ga0587117_092631 | |||
| 1864 | Ga0466962_0041521 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o51-assembly1.cif.gz_A | crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution | 0.8975 | 6 | 105 |
| 2dcl-assembly1.cif.gz_B-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.8758 | 2 | 107 |
| 2dcl-assembly1.cif.gz_C-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.875 | 5 | 103 |
| 1o51-assembly1.cif.gz_A | crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution | 0.8693 | 6 | 105 |
| 2dcl-assembly1.cif.gz_A-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.8543 | 6 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o51A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8923 | 6 | 105 | 3.30.70.120 |
| af_P95087_1_117_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8819 | 3 | 105 | 3.30.70.120 |
| 2dclC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.875 | 5 | 103 | 3.30.70.120 |
| 1o51A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.873 | 6 | 105 | 3.30.70.120 |
| af_Q58919_1_108_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8651 | 6 | 107 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P6WH30-F1-model_v4 | Uncharacterized protein | 0.947 | 5 | 109 |
|
| AF-A0A7C1NV81-F1-model_v4 | Chloride channel protein | 0.9315 | 6 | 101 |
GO:0005247
GO:0016020 |
| AF-A0A2V9WHL6-F1-model_v4 | DUF190 domain-containing protein | 0.9299 | 1 | 74 |
|
| AF-A0A2V9ULK1-F1-model_v4 | Uncharacterized protein | 0.9297 | 1 | 109 |
|
| AF-A0A378LQY1-F1-model_v4 | Uncharacterized ACR, COG1993 | 0.922 | 6 | 103 |
|