F486059

General Info

Members Datasets Scaffolds Average Seq Length
932 408 1856 69

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10048833|Ga0070709_100488332
Length 83
Sequence MIKIIAVLCSLSTPADCREQIVTTSDFADVSVQSCLMGAPQLAEWMKEHPAERLAAWRCVIGKRDARAAVNRAVGESFTGEPG

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
89 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
90 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
109 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
110 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
111 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
125 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
126 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
127 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
192 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
193 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
194 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
202 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
244 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
318 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
326 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
327 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
335 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
336 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
372 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
373 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
374 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
375 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
376 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
377 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
378 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
385 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
388 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
389 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
390 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
391 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
392 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
393 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
394 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
395 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
396 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
397 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
398 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
399 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
400 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
401 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
402 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
403 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
404 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
405 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
406 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
408 2791355199

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.98
Nodule 1.82
Rhizoplane 5.26
Rhizosphere 73.28
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10048833 3300005434 Bacteria 2642
2 RicEn_FSXC18105_g1 2010549000 Bacteria 798
3 JGI24739J22299_10183714 3300001989 Bacteria 615
4 JGI24737J22298_10156251 3300001990 Bacteria 673
5 JGI24743J22301_10101613 3300001991 Bacteria 620
6 JGI24738J21930_10036512 3300002075 Bacteria 1000
7 JGI24034J26672_10066606 3300002239 Bacteria 640
8 JGI25406J46586_10002470 3300003203 Bacteria 8737
9 JGI25165J46597_1006980 3300003214 Bacteria 1935
10 JGI25153J46596_10048070 3300003215 Bacteria 1249
11 rootH2_10174194 3300003320 Bacteria 1479
12 rootL2_10265413 3300003322 Bacteria 1107
13 JGI25404J52841_10016240 3300003659 Bacteria 1615
14 JGI25404J52841_10017136 3300003659 Bacteria 1571
15 JGI25404J52841_10123283 3300003659 Bacteria 547
16 Ga0055529_1012460 3300003763 Bacteria 1087
17 Ga0070683_100063620 3300005329 Bacteria 3432
18 Ga0070690_101114923 3300005330 Bacteria 626
19 Ga0070670_100205522 3300005331 Bacteria 1711
20 Ga0070666_10085949 3300005335 Bacteria 2155
21 Ga0070666_10714969 3300005335 Bacteria 735
22 Ga0070682_100021394 3300005337 Bacteria 3817
23 Ga0070682_101622074 3300005337 Bacteria 560
24 Ga0068868_100253435 3300005338 Bacteria 1482
25 Ga0070660_100465553 3300005339 Bacteria 1050
26 Ga0070661_100077486 3300005344 Bacteria 2451
27 Ga0070668_100035818 3300005347 Bacteria 3786
28 Ga0070668_100069473 3300005347 Bacteria 2740
29 Ga0070668_100451290 3300005347 Bacteria 1105
30 Ga0070668_101517350 3300005347 Bacteria 613
31 Ga0070669_100062817 3300005353 Bacteria 2732
32 Ga0070669_100336295 3300005353 Bacteria 1222
33 Ga0070671_100066000 3300005355 Bacteria 3015
34 Ga0070671_100357271 3300005355 Bacteria 1247
35 Ga0070671_100768006 3300005355 Bacteria 838
36 Ga0070671_101498204 3300005355 Bacteria 597
37 Ga0070673_100393049 3300005364 Bacteria 1238
38 Ga0070659_100238574 3300005366 Bacteria 1504
39 Ga0070667_100686574 3300005367 Bacteria 947
40 Ga0070714_100001315 3300005435 Bacteria 17947
41 Ga0070714_102057267 3300005435 Bacteria 557
42 Ga0070713_100076677 3300005436 Bacteria 2840
43 Ga0070710_10002649 3300005437 Bacteria 8509
44 Ga0070710_10239994 3300005437 Bacteria 1161
45 Ga0070711_100005142 3300005439 Bacteria 7795
46 Ga0070711_100117903 3300005439 Bacteria 1958
47 Ga0070700_101536917 3300005441 Bacteria 567
48 Ga0070708_100197079 3300005445 Bacteria 1884
49 Ga0070663_100006266 3300005455 Bacteria 7135
50 Ga0070663_100022408 3300005455 Bacteria 4223
51 Ga0070663_100802851 3300005455 Bacteria 807
52 Ga0070662_100809341 3300005457 Bacteria 797
53 Ga0070662_101767902 3300005457 Bacteria 534
54 Ga0070681_10964548 3300005458 Bacteria 772
55 Ga0068867_100625999 3300005459 Bacteria 941
56 Ga0068867_101392886 3300005459 Bacteria 650
57 Ga0070685_10393900 3300005466 Bacteria 958
58 Ga0070706_100082994 3300005467 Bacteria 2969
59 Ga0070706_100390317 3300005467 Bacteria 1296
60 Ga0070707_100116280 3300005468 Bacteria 2596
61 Ga0070707_100200204 3300005468 Bacteria 1946
62 Ga0070698_100028907 3300005471 Bacteria 5755
63 Ga0070698_100041994 3300005471 Bacteria 4692
64 Ga0070698_100072925 3300005471 Bacteria 3440
65 Ga0070698_101219627 3300005471 Bacteria 702
66 Ga0070699_100351973 3300005518 Bacteria 1327
67 Ga0070679_101331019 3300005530 Unclassified 664
68 Ga0070684_100042757 3300005535 Bacteria 3913
69 Ga0070697_100349051 3300005536 Bacteria 1278
70 Ga0070697_100545246 3300005536 Bacteria 1017
71 Ga0068853_100356199 3300005539 Bacteria 1362
72 Ga0068853_100806907 3300005539 Bacteria 899
73 Ga0068853_101139206 3300005539 Bacteria 753
74 Ga0070695_100789864 3300005545 Bacteria 760
75 Ga0070665_100014892 3300005548 Bacteria 7805
76 Ga0070665_100261298 3300005548 Bacteria 1732
77 Ga0070665_100574815 3300005548 Bacteria 1140
78 Ga0070665_101132353 3300005548 Bacteria 794
79 Ga0070665_101758642 3300005548 Bacteria 627
80 Ga0070704_101114911 3300005549 Bacteria 717
81 Ga0068855_100326193 3300005563 Bacteria 1695
82 Ga0070664_100264201 3300005564 Bacteria 1549
83 Ga0068857_100125678 3300005577 Bacteria 2311
84 Ga0068857_100512251 3300005577 Bacteria 1127
85 Ga0068854_100165020 3300005578 Bacteria 1719
86 Ga0068854_101090318 3300005578 Bacteria 711
87 Ga0068856_100301967 3300005614 Bacteria 1619
88 Ga0068856_100433273 3300005614 Bacteria 1335
89 Ga0068856_101195323 3300005614 Bacteria 777
90 Ga0068852_100266639 3300005616 Bacteria 1646
91 Ga0068852_101844070 3300005616 Bacteria 627
92 Ga0068859_100116478 3300005617 Bacteria 2737
93 Ga0068864_100952132 3300005618 Bacteria 850
94 Ga0068861_100017115 3300005719 Bacteria 5139
95 Ga0068861_100044612 3300005719 Bacteria 3335
96 Ga0068861_100256040 3300005719 Bacteria 1496
97 Ga0068861_100416578 3300005719 Bacteria 1196
98 Ga0068861_100773274 3300005719 Bacteria 899
99 Ga0068851_10237347 3300005834 Bacteria 1030
100 Ga0068851_10304558 3300005834 Bacteria 917
101 Ga0068851_10625988 3300005834 Bacteria 657
102 Ga0068863_100167953 3300005841 Bacteria 2104
103 Ga0068863_101117466 3300005841 Bacteria 793
104 Ga0068863_101589698 3300005841 Bacteria 663
105 Ga0068863_101698384 3300005841 Bacteria 641
106 Ga0068858_100075352 3300005842 Bacteria 3134
107 Ga0068858_100127368 3300005842 Bacteria 2385
108 Ga0068858_100183720 3300005842 Bacteria 1975
109 Ga0068858_100500486 3300005842 Bacteria 1174
110 Ga0068860_100061999 3300005843 Bacteria 3553
111 Ga0068860_100145075 3300005843 Bacteria 2283
112 Ga0068860_100790880 3300005843 Bacteria 962
113 Ga0068862_100034556 3300005844 Bacteria 4278
114 Ga0068862_100152051 3300005844 Bacteria 2060
115 Ga0068862_100269098 3300005844 Bacteria 1558
116 Ga0068862_101000075 3300005844 Bacteria 827
117 Ga0068862_101743213 3300005844 Bacteria 631
118 Ga0081455_10002635 3300005937 Bacteria 21263
119 Ga0081455_10038474 3300005937 Bacteria 4237
120 Ga0081455_10071426 3300005937 Bacteria 2878
121 Ga0081455_10089450 3300005937 Bacteria 2499
122 Ga0081455_10798315 3300005937 Bacteria 593
123 Ga0081538_10119744 3300005981 Bacteria 1268
124 Ga0081540_1001277 3300005983 Bacteria 21964
125 Ga0081540_1002364 3300005983 Bacteria 15402
126 Ga0081540_1002383 3300005983 Bacteria 15346
127 Ga0081540_1004480 3300005983 Bacteria 10627
128 Ga0081540_1005556 3300005983 Bacteria 9142
129 Ga0081540_1005938 3300005983 Bacteria 9013
130 Ga0081540_1009646 3300005983 Bacteria 6635
131 Ga0081540_1011712 3300005983 Bacteria 5837
132 Ga0081540_1014103 3300005983 Bacteria 5145
133 Ga0081540_1015892 3300005983 Bacteria 4744
134 Ga0081540_1018125 3300005983 Bacteria 4332
135 Ga0081540_1058266 3300005983 Bacteria 1862
136 Ga0081540_1065716 3300005983 Bacteria 1704
137 Ga0081540_1076345 3300005983 Bacteria 1527
138 Ga0081540_1088777 3300005983 Bacteria 1366
139 Ga0081540_1252185 3300005983 Bacteria 615
140 Ga0081539_10000220 3300005985 Bacteria 133834
141 Ga0081539_10037690 3300005985 Bacteria 2876
142 Ga0081539_10373502 3300005985 Bacteria 596
143 Ga0070717_11485877 3300006028 Bacteria 615
144 Ga0075365_10029823 3300006038 Bacteria 3489
145 Ga0075365_10034442 3300006038 Bacteria 3270
146 Ga0075365_10107312 3300006038 Bacteria 1917
147 Ga0075365_10317694 3300006038 Bacteria 1097
148 Ga0075365_10348192 3300006038 Bacteria 1044
149 Ga0075368_10010465 3300006042 Bacteria 3352
150 Ga0075368_10020246 3300006042 Bacteria 2517
151 Ga0075368_10040840 3300006042 Bacteria 1822
152 Ga0075368_10075472 3300006042 Bacteria 1367
153 Ga0075363_100001679 3300006048 Bacteria 8571
154 Ga0075363_100033439 3300006048 Bacteria 2677
155 Ga0075363_100277923 3300006048 Bacteria 968
156 Ga0075363_100502879 3300006048 Bacteria 720
157 Ga0075364_10116542 3300006051 Bacteria 1786
158 Ga0075364_10148963 3300006051 Bacteria 1576
159 Ga0070715_10003397 3300006163 Bacteria 5054
160 Ga0070715_10451636 3300006163 Bacteria 726
161 Ga0070716_100640720 3300006173 Bacteria 804
162 Ga0070716_100896774 3300006173 Bacteria 694
163 Ga0070712_100219782 3300006175 Bacteria 1503
164 Ga0070712_100268996 3300006175 Bacteria 1368
165 Ga0070712_100315128 3300006175 Bacteria 1270
166 Ga0075362_10329134 3300006177 Bacteria 762
167 Ga0075362_10367358 3300006177 Bacteria 722
168 Ga0075362_10446307 3300006177 Bacteria 657
169 Ga0075367_10005581 3300006178 Bacteria 6265
170 Ga0075367_10034765 3300006178 Bacteria 2913
171 Ga0075367_10098486 3300006178 Bacteria 1785
172 Ga0075367_10124429 3300006178 Bacteria 1591
173 Ga0075367_10438373 3300006178 Bacteria 827
174 Ga0075367_10768772 3300006178 Bacteria 613
175 Ga0075367_10990594 3300006178 Bacteria 537
176 Ga0075367_11056434 3300006178 Bacteria 519
177 Ga0075369_10041513 3300006186 Bacteria 1970
178 Ga0075369_10044018 3300006186 Bacteria 1917
179 Ga0075369_10053113 3300006186 Bacteria 1758
180 Ga0075369_10070211 3300006186 Bacteria 1541
181 Ga0075369_10119874 3300006186 Bacteria 1190
182 Ga0075366_10002137 3300006195 Bacteria 10053
183 Ga0075366_10005681 3300006195 Bacteria 6765
184 Ga0075366_10031875 3300006195 Bacteria 3103
185 Ga0075366_10302378 3300006195 Bacteria 979
186 Ga0097621_100306709 3300006237 Bacteria 1403
187 Ga0075370_10007654 3300006353 Bacteria 5513
188 Ga0075370_10108833 3300006353 Bacteria 1608
189 Ga0075370_10803587 3300006353 Bacteria 573
190 Ga0068871_100524770 3300006358 Bacteria 1070
191 Ga0075428_101078333 3300006844 Bacteria 849
192 Ga0075433_10530203 3300006852 Bacteria 1036
193 Ga0075434_100743925 3300006871 Bacteria 997
194 Ga0097620_100116478 3300006931 Bacteria 2737
195 Ga0099825_1034966 3300006941 Bacteria 1831
196 Ga0099824_1031306 3300006942 Bacteria 2032
197 Ga0099823_1000409 3300006944 Bacteria 27729
198 Ga0099794_10047740 3300007265 Bacteria 2053
199 Ga0099794_10777359 3300007265 Bacteria 512
200 Ga0099795_10021328 3300007788 Bacteria 2123
201 Ga0105251_10523143 3300009011 Bacteria 556
202 Ga0105250_10029341 3300009092 Bacteria 2213
203 Ga0105240_10001242 3300009093 Bacteria 44196
204 Ga0105240_10355837 3300009093 Bacteria 1660
205 Ga0105240_11689806 3300009093 Bacteria 661
206 Ga0105245_10145626 3300009098 Bacteria 2235
207 Ga0105245_10341639 3300009098 Bacteria 1481
208 Ga0105245_11004517 3300009098 Bacteria 879
209 Ga0105245_11714863 3300009098 Bacteria 681
210 Ga0105247_10036987 3300009101 Bacteria 2977
211 Ga0105247_10175949 3300009101 Bacteria 1425
212 Ga0105247_10196278 3300009101 Bacteria 1354
213 Ga0105247_10224210 3300009101 Bacteria 1274
214 Ga0105243_10077988 3300009148 Bacteria 2696
215 Ga0105243_10247875 3300009148 Bacteria 1589
216 Ga0105243_10889969 3300009148 Bacteria 885
217 Ga0105243_10943913 3300009148 Bacteria 861
218 Ga0105243_12445351 3300009148 Bacteria 561
219 Ga0105243_12712070 3300009148 Bacteria 536
220 Ga0105241_10055144 3300009174 Bacteria 3045
221 Ga0105241_10063429 3300009174 Bacteria 2851
222 Ga0105241_10160723 3300009174 Bacteria 1846
223 Ga0105241_11272746 3300009174 Bacteria 699
224 Ga0105242_11215500 3300009176 Bacteria 773
225 Ga0105242_12847570 3300009176 Bacteria 534
226 Ga0105248_10034657 3300009177 Bacteria 5647
227 Ga0105248_10180473 3300009177 Bacteria 2379
228 Ga0105248_10366065 3300009177 Bacteria 1623
229 Ga0105248_10677747 3300009177 Bacteria 1163
230 Ga0105248_10784625 3300009177 Bacteria 1075
231 Ga0105248_11306767 3300009177 Bacteria 820
232 Ga0105237_10016458 3300009545 Bacteria 7681
233 Ga0105237_10056145 3300009545 Bacteria 3942
234 Ga0105237_10394825 3300009545 Bacteria 1388
235 Ga0105237_10453809 3300009545 Bacteria 1288
236 Ga0105237_10829967 3300009545 Bacteria 931
237 Ga0105238_10256208 3300009551 Bacteria 1729
238 Ga0105238_10458031 3300009551 Bacteria 1273
239 Ga0105249_10182034 3300009553 Bacteria 2045
240 Ga0105249_11264751 3300009553 Bacteria 809
241 Ga0105249_12364140 3300009553 Bacteria 604
242 Ga0099796_10120497 3300010159 Bacteria 1007
243 Ga0099796_10295098 3300010159 Bacteria 685
244 Ga0105239_10094197 3300010375 Bacteria 3307
245 Ga0105239_10190333 3300010375 Bacteria 2297
246 Ga0105239_10524913 3300010375 Bacteria 1347
247 Ga0105239_10789220 3300010375 Bacteria 1088
248 Ga0105239_11022531 3300010375 Bacteria 950
249 Ga0105239_11716044 3300010375 Bacteria 727
250 Ga0105239_13231709 3300010375 Bacteria 531
251 Ga0105246_10107273 3300011119 Bacteria 2045
252 Ga0105246_10181807 3300011119 Bacteria 1620
253 Ga0105246_10223033 3300011119 Bacteria 1479
254 Ga0157343_1029861 3300012488 Bacteria 544
255 Ga0157314_1006530 3300012500 Bacteria 917
256 Ga0157315_1072801 3300012508 Bacteria 509
257 Ga0157338_1020011 3300012515 Bacteria 771
258 Ga0157369_10314198 3300013105 Bacteria 1629
259 Ga0157374_10086988 3300013296 Bacteria 2974
260 Ga0157374_10496206 3300013296 Bacteria 1225
261 Ga0157378_11029310 3300013297 Bacteria 859
262 Ga0163162_10081810 3300013306 Bacteria 3300
263 Ga0163162_10216087 3300013306 Bacteria 2047
264 Ga0163162_10769359 3300013306 Bacteria 1081
265 Ga0163162_11268990 3300013306 Bacteria 837
266 Ga0163162_11988757 3300013306 Bacteria 666
267 Ga0163162_12220550 3300013306 Bacteria 630
268 Ga0157375_10222713 3300013308 Bacteria 2045
269 Ga0163163_10017883 3300014325 Bacteria 6620
270 Ga0163163_10082247 3300014325 Bacteria 3223
271 Ga0163163_11013379 3300014325 Bacteria 894
272 Ga0163163_11414860 3300014325 Bacteria 757
273 Ga0157380_10431796 3300014326 Bacteria 1259
274 Ga0157380_10444309 3300014326 Bacteria 1243
275 Ga0182008_10286380 3300014497 Bacteria 859
276 Ga0157377_10206152 3300014745 Bacteria 1251
277 Ga0157379_10221910 3300014968 Bacteria 1713
278 Ga0157376_10031320 3300014969 Bacteria 4257
279 Ga0157376_10757805 3300014969 Bacteria 980
280 Ga0157376_10768836 3300014969 Bacteria 974
281 Ga0157376_10920625 3300014969 Bacteria 893
282 Ga0163161_10330554 3300017792 Bacteria 1207
283 Ga0163161_10378786 3300017792 Bacteria 1130
284 Ga0214544_1000003 3300021320 Bacteria 643752
285 Ga0214542_1000003 3300021321 Bacteria 435700
286 Ga0214545_1000004 3300021324 Bacteria 453352
287 Ga0214543_1000007 3300021327 Bacteria 414744
288 Ga0213872_10030568 3300021361 Bacteria 2468
289 Ga0213872_10083141 3300021361 Bacteria 1437
290 Ga0213872_10132409 3300021361 Bacteria 1098
291 Ga0213872_10333556 3300021361 Bacteria 625
292 Ga0213874_10086402 3300021377 Bacteria 1024
293 Ga0213874_10234480 3300021377 Bacteria 671
294 Ga0213876_10264351 3300021384 Bacteria 914
295 Ga0213871_10000774 3300021441 Bacteria 4737
296 Ga0213871_10026659 3300021441 Bacteria 1480
297 Ga0209233_1006781 3300025261 Bacteria 3665
298 Ga0209233_1036842 3300025261 Bacteria 1092
299 Ga0209455_1002647 3300025272 Bacteria 6770
300 Ga0209758_1023912 3300025297 Bacteria 2743
301 Ga0209758_1142230 3300025297 Bacteria 620
302 Ga0209256_1102516 3300025299 Bacteria 590
303 Ga0207426_1005759 3300025302 Bacteria 5569
304 Ga0207426_1017576 3300025302 Bacteria 2539
305 Ga0207697_10078647 3300025315 Bacteria 1388
306 Ga0207656_10297242 3300025321 Bacteria 799
307 Ga0207692_10000199 3300025898 Bacteria 20003
308 Ga0207692_10279037 3300025898 Bacteria 1010
309 Ga0207710_10046574 3300025900 Bacteria 1936
310 Ga0207710_10211726 3300025900 Bacteria 960
311 Ga0207710_10510491 3300025900 Bacteria 624
312 Ga0207710_10723599 3300025900 Bacteria 522
313 Ga0207688_11081087 3300025901 Bacteria 506
314 Ga0207680_10398751 3300025903 Bacteria 972
315 Ga0207647_10003170 3300025904 Bacteria 12340
316 Ga0207685_10507308 3300025905 Bacteria 636
317 Ga0207645_10543001 3300025907 Bacteria 788
318 Ga0207643_10962609 3300025908 Bacteria 553
319 Ga0207684_10038942 3300025910 Bacteria 4034
320 Ga0207684_10211637 3300025910 Bacteria 1672
321 Ga0207654_11270913 3300025911 Bacteria 537
322 Ga0207707_11395574 3300025912 Unclassified 559
323 Ga0207695_10000059 3300025913 Bacteria 363920
324 Ga0207671_10019058 3300025914 Bacteria 5256
325 Ga0207671_10049486 3300025914 Bacteria 3112
326 Ga0207671_10441090 3300025914 Bacteria 1037
327 Ga0207693_10003610 3300025915 Bacteria 13210
328 Ga0207693_10207969 3300025915 Bacteria 1538
329 Ga0207693_11210676 3300025915 Bacteria 569
330 Ga0207663_10000863 3300025916 Bacteria 13779
331 Ga0207663_10358811 3300025916 Bacteria 1105
332 Ga0207657_10376292 3300025919 Bacteria 1119
333 Ga0207649_10045996 3300025920 Bacteria 2678
334 Ga0207646_10057891 3300025922 Bacteria 3462
335 Ga0207681_10062695 3300025923 Bacteria 2561
336 Ga0207681_10195193 3300025923 Bacteria 1551
337 Ga0207694_10564911 3300025924 Bacteria 955
338 Ga0207650_10017890 3300025925 Bacteria 4966
339 Ga0207687_11402327 3300025927 Bacteria 600
340 Ga0207700_11802781 3300025928 Bacteria 538
341 Ga0207664_10092199 3300025929 Bacteria 2486
342 Ga0207644_10045164 3300025931 Bacteria 3133
343 Ga0207644_10382281 3300025931 Bacteria 1148
344 Ga0207644_10562020 3300025931 Bacteria 945
345 Ga0207644_11273050 3300025931 Bacteria 618
346 Ga0207690_10107345 3300025932 Bacteria 2005
347 Ga0207706_10087965 3300025933 Bacteria 2732
348 Ga0207706_10672865 3300025933 Bacteria 885
349 Ga0207706_11448153 3300025933 Bacteria 562
350 Ga0207709_10099156 3300025935 Bacteria 1922
351 Ga0207709_10155097 3300025935 Bacteria 1590
352 Ga0207704_11857718 3300025938 Bacteria 518
353 Ga0207665_10132531 3300025939 Bacteria 1771
354 Ga0207665_10823013 3300025939 Bacteria 734
355 Ga0207691_10340397 3300025940 Bacteria 1284
356 Ga0207711_10108671 3300025941 Bacteria 2464
357 Ga0207711_10323749 3300025941 Bacteria 1425
358 Ga0207711_12109236 3300025941 Bacteria 506
359 Ga0207711_12111372 3300025941 Bacteria 506
360 Ga0207689_11243332 3300025942 Bacteria 626
361 Ga0207689_11299307 3300025942 Bacteria 611
362 Ga0207689_11720459 3300025942 Bacteria 519
363 Ga0207661_10003502 3300025944 Bacteria 10903
364 Ga0207661_10350664 3300025944 Bacteria 1331
365 Ga0207679_10298331 3300025945 Bacteria 1388
366 Ga0207667_10718317 3300025949 Bacteria 1000
367 Ga0207712_10116320 3300025961 Bacteria 2015
368 Ga0207712_10878783 3300025961 Bacteria 791
369 Ga0207668_10006780 3300025972 Bacteria 6780
370 Ga0207668_10019269 3300025972 Bacteria 4310
371 Ga0207668_10031562 3300025972 Bacteria 3491
372 Ga0207668_10158005 3300025972 Bacteria 1763
373 Ga0207668_10478697 3300025972 Bacteria 1067
374 Ga0207640_10139124 3300025981 Bacteria 1767
375 Ga0207640_11103156 3300025981 Bacteria 702
376 Ga0207658_10055459 3300025986 Bacteria 2937
377 Ga0207658_10611211 3300025986 Bacteria 980
378 Ga0207677_10258827 3300026023 Bacteria 1417
379 Ga0207703_10068597 3300026035 Bacteria 2922
380 Ga0207703_11296618 3300026035 Bacteria 700
381 Ga0207639_10272434 3300026041 Bacteria 1485
382 Ga0207639_10960285 3300026041 Bacteria 800
383 Ga0207639_11048380 3300026041 Bacteria 764
384 Ga0207678_10002747 3300026067 Bacteria 15931
385 Ga0207678_10024264 3300026067 Bacteria 5296
386 Ga0207678_10179188 3300026067 Bacteria 1809
387 Ga0207678_11007666 3300026067 Bacteria 737
388 Ga0207708_11054278 3300026075 Bacteria 708
389 Ga0207702_10061845 3300026078 Bacteria 3195
390 Ga0207702_10460293 3300026078 Bacteria 1235
391 Ga0207702_11007411 3300026078 Bacteria 826
392 Ga0207641_10057037 3300026088 Bacteria 3321
393 Ga0207641_10949527 3300026088 Bacteria 855
394 Ga0207676_10197864 3300026095 Bacteria 1773
395 Ga0207676_10450713 3300026095 Bacteria 1213
396 Ga0207674_10068262 3300026116 Bacteria 3578
397 Ga0207674_10342669 3300026116 Bacteria 1445
398 Ga0207675_100001340 3300026118 Bacteria 24692
399 Ga0207675_100395016 3300026118 Bacteria 1362
400 Ga0207675_100465823 3300026118 Bacteria 1254
401 Ga0207675_100491932 3300026118 Bacteria 1220
402 Ga0207675_100738172 3300026118 Bacteria 995
403 Ga0207683_10315553 3300026121 Bacteria 1431
404 Ga0207683_10506880 3300026121 Bacteria 1115
405 Ga0207698_10463281 3300026142 Bacteria 1226
406 Ga0207698_11280150 3300026142 Bacteria 748
407 Ga0207698_12006917 3300026142 Bacteria 593
408 Ga0209389_1000012 3300027296 Bacteria 213243
409 Ga0209389_1000111 3300027296 Bacteria 72517
410 Ga0209489_100019 3300027361 Bacteria 213243
411 Ga0209489_100220 3300027361 Bacteria 95167
412 Ga0209700_100018 3300027363 Bacteria 238200
413 Ga0209700_100041 3300027363 Bacteria 168380
414 Ga0209179_1049525 3300027512 Bacteria 898
415 Ga0209813_10012405 3300027866 Bacteria 2252
416 Ga0209813_10024642 3300027866 Bacteria 1723
417 Ga0209813_10044267 3300027866 Bacteria 1367
418 Ga0268266_10004233 3300028379 Bacteria 13817
419 Ga0268266_10157256 3300028379 Bacteria 2054
420 Ga0268266_10505116 3300028379 Bacteria 1155
421 Ga0268265_10100104 3300028380 Bacteria 2339
422 Ga0268265_10131177 3300028380 Bacteria 2082
423 Ga0268264_10065485 3300028381 Bacteria 3062
424 Ga0268264_10327995 3300028381 Bacteria 1450
425 Ga0268264_10710602 3300028381 Bacteria 999
426 Ga0268264_11470988 3300028381 Bacteria 692
427 Ga0307517_10083081 3300028786 Bacteria 2712
428 Ga0307515_10703934 3300028794 Bacteria 626
429 Ga0307511_10155114 3300030521 Bacteria 1302
430 Ga0265760_10372167 3300031090 Bacteria 513
431 Ga0265332_10237779 3300031238 Bacteria 754
432 Ga0265328_10379800 3300031239 Bacteria 553
433 Ga0265339_10484961 3300031249 Bacteria 572
434 Ga0265331_10209907 3300031250 Bacteria 876
435 Ga0307509_10004428 3300031507 Bacteria 20293
436 Ga0307509_10186364 3300031507 Bacteria 1933
437 Ga0307509_10249069 3300031507 Bacteria 1562
438 Ga0307408_101244721 3300031548 Bacteria 696
439 Ga0307508_10046085 3300031616 Bacteria 3894
440 Ga0265314_10006822 3300031711 Bacteria 10006
441 Ga0307516_10768098 3300031730 Bacteria 624
442 Ga0307507_10660109 3300033179 Bacteria 529
443 Ga0307510_10010806 3300033180 Bacteria 10853
444 Ga0307510_10229489 3300033180 Bacteria 1360
445 Ga0373949_0211515 3300035090 Bacteria 586
446 Ga0373923_0119681 3300035111 Bacteria 1176
447 Ga0373923_0160705 3300035111 Bacteria 1025
448 Ga0373936_0443242 3300035113 Bacteria 600
449 Ga0373939_0296221 3300035114 Bacteria 644
450 Ga0373954_0039606 3300035118 Bacteria 2194
451 Ga0373954_0195602 3300035118 Bacteria 993
452 Ga0373956_0133053 3300035119 Bacteria 1165
453 Ga0373957_0116596 3300035120 Bacteria 1079
454 Ga0373943_0127612 3300035170 Bacteria 1358
455 Ga0373943_0430962 3300035170 Bacteria 764
456 Ga0373946_0187151 3300035171 Bacteria 985
457 Ga0373955_0097412 3300035172 Bacteria 1684
458 Ga0373924_0067241 3300035410 Bacteria 1507
459 Ga0373935_0157659 3300035692 Bacteria 1545
460 Ga0373935_0268449 3300035692 Bacteria 1198
461 Ga0373927_0110782 3300035695 Bacteria 1788
462 Ga0373927_0791827 3300035695 Bacteria 626
463 Ga0373933_0119344 3300035724 Bacteria 1651
464 Ga0373933_0431981 3300035724 Bacteria 861
465 Ga0373933_0573737 3300035724 Bacteria 740
466 Ga0373947_0334952 3300035725 Bacteria 1013
467 Ga0373947_0382448 3300035725 Bacteria 948
468 Ga0373947_0734823 3300035725 Bacteria 673
469 Ga0373947_1216345 3300035725 Bacteria 513
470 Ga0373937_0029815 3300036401 Bacteria 4941
471 Ga0373937_0880593 3300036401 Bacteria 844
472 Ga0373925_0108052 3300037068 Bacteria 2146
473 Ga0373925_0561229 3300037068 Bacteria 939
474 Ga0373925_0568392 3300037068 Bacteria 933
475 Ga0373925_1361905 3300037068 Bacteria 582
476 Ga0395899_0273242 3300037312 Bacteria 1152
477 Ga0395900_0680919 3300037418 Bacteria 963
478 Ga0395900_0947865 3300037418 Bacteria 782
479 Ga0395898_0026287 3300037466 Bacteria 5860
480 Ga0395898_0319248 3300037466 Bacteria 1482
481 Ga0395898_0482868 3300037466 Bacteria 1179
482 Ga0395905_0014857 3300037471 Bacteria 7427
483 Ga0395905_0021606 3300037471 Bacteria 6086
484 Ga0395905_0255705 3300037471 Bacteria 1636
485 Ga0395905_1626068 3300037471 Bacteria 551
486 Ga0436364_0362385 3300037853 Bacteria 989
487 Ga0395901_1908364 3300038443 Bacteria 541
488 Ga0436365_0139309 3300039437 Bacteria 523
489 Ga0436365_1127033 3300039437 Bacteria 1047
490 Ga0436360_0649694 3300039438 Bacteria 12135
491 Ga0436360_0958245 3300039438 Bacteria 2035
492 Ga0436360_0969859 3300039438 Bacteria 10126
493 Ga0436360_1287672 3300039438 Bacteria 1047
494 Ga0436360_1301948 3300039438 Bacteria 1165
495 Ga0436361_0028876 3300039447 Bacteria 960
496 Ga0436361_0306306 3300039447 Bacteria 780
497 Ga0436361_0376636 3300039447 Bacteria 3467
498 Ga0436361_0549414 3300039447 Bacteria 9146
499 Ga0436361_0750195 3300039447 Bacteria 647
500 Ga0436361_0830682 3300039447 Bacteria 5075
501 Ga0436361_0900112 3300039447 Bacteria 1622
502 Ga0436361_1205934 3300039447 Unclassified 1088
503 Ga0436361_1212561 3300039447 Unclassified 1154
504 Ga0436363_0073280 3300039450 Bacteria 2121
505 Ga0436363_0390681 3300039450 Bacteria 592
506 Ga0436363_0943684 3300039450 Bacteria 1225
507 Ga0436363_1242037 3300039450 Bacteria 1353
508 Ga0436363_1280402 3300039450 Bacteria 1568
509 Ga0436363_1444618 3300039450 Bacteria 793
510 Ga0436363_1663180 3300039450 Bacteria 4920
511 Ga0436362_0017675 3300039453 Bacteria 5052
512 Ga0451853_1608436 3300041512 Bacteria 511
513 Ga0439455_0259911 3300042012 Bacteria 509
514 Ga0466972_0000473 3300044658 Bacteria 20383
515 Ga0466972_0003391 3300044658 Bacteria 7898
516 Ga0466965_0011861 3300044683 Bacteria 4091
517 Ga0466965_0046268 3300044683 Bacteria 2154
518 Ga0466965_0729610 3300044683 Bacteria 570
519 Ga0466966_0002158 3300044684 Bacteria 12761
520 Ga0466961_0000042 3300044693 Bacteria 78589
521 Ga0466964_0135785 3300044706 Bacteria 1125
522 Ga0466964_0265091 3300044706 Bacteria 853
523 Ga0466971_0187100 3300044719 Bacteria 975
524 Ga0466968_0014816 3300044735 Bacteria 3085
525 Ga0466968_0084259 3300044735 Bacteria 1401
526 Ga0466968_0252532 3300044735 Bacteria 838
527 Ga0466960_0081323 3300044901 Bacteria 1633
528 Ga0466960_0095762 3300044901 Bacteria 1520
529 Ga0466959_0000975 3300045049 Bacteria 17017
530 Ga0466967_1581921 3300045976 Bacteria 653
531 Ga0495592_0118583 3300046454 Bacteria 1864
532 Ga0495592_0315469 3300046454 Bacteria 1012
533 Ga0495592_0851471 3300046454 Bacteria 539
534 Ga0495603_0060543 3300046455 Bacteria 2237
535 Ga0495603_0136216 3300046455 Bacteria 1429
536 Ga0495603_0188575 3300046455 Bacteria 1192
537 Ga0495603_0218552 3300046455 Bacteria 1100
538 Ga0495590_0078491 3300046457 Bacteria 1162
539 Ga0495590_0170388 3300046457 Bacteria 793
540 Ga0495590_0413712 3300046457 Bacteria 518
541 Ga0495629_0625958 3300046459 Bacteria 718
542 Ga0495638_0045458 3300046460 Bacteria 2762
543 Ga0495638_0188858 3300046460 Bacteria 1170
544 Ga0495638_0496328 3300046460 Bacteria 616
545 Ga0495641_0072130 3300046461 Bacteria 1550
546 Ga0495641_0180560 3300046461 Bacteria 945
547 Ga0495651_0002020 3300046462 Bacteria 15666
548 Ga0495651_0078376 3300046462 Bacteria 2499
549 Ga0495651_0723582 3300046462 Bacteria 619
550 Ga0495651_0801783 3300046462 Bacteria 581
551 Ga0495653_0123094 3300046463 Bacteria 1845
552 Ga0495653_0661851 3300046463 Bacteria 637
553 Ga0495580_0047890 3300046472 Bacteria 3029
554 Ga0495580_0510452 3300046472 Bacteria 802
555 Ga0495580_0998230 3300046472 Bacteria 534
556 Ga0495582_0071365 3300046473 Bacteria 1922
557 Ga0495582_0215755 3300046473 Bacteria 1097
558 Ga0495582_0286326 3300046473 Bacteria 946
559 Ga0495582_0365731 3300046473 Bacteria 831
560 Ga0495605_0027352 3300046474 Bacteria 2956
561 Ga0495605_0037251 3300046474 Bacteria 2448
562 Ga0495639_0278799 3300046475 Bacteria 830
563 Ga0495662_0086088 3300046476 Bacteria 1531
564 Ga0495664_0054202 3300046477 Bacteria 2384
565 Ga0495664_0192237 3300046477 Bacteria 1237
566 Ga0495664_0214165 3300046477 Bacteria 1167
567 Ga0495664_0235045 3300046477 Bacteria 1109
568 Ga0495584_0115586 3300046491 Bacteria 1358
569 Ga0495584_0534616 3300046491 Bacteria 597
570 Ga0495585_0067707 3300046492 Bacteria 1952
571 Ga0495585_0110767 3300046492 Bacteria 1460
572 Ga0495585_0264199 3300046492 Bacteria 855
573 Ga0495585_0446582 3300046492 Bacteria 619
574 Ga0495585_0468258 3300046492 Bacteria 601
575 Ga0495594_0048600 3300046499 Bacteria 2331
576 Ga0495594_0102160 3300046499 Bacteria 1613
577 Ga0495594_0182101 3300046499 Bacteria 1196
578 Ga0495596_0159080 3300046500 Bacteria 878
579 Ga0495596_0378941 3300046500 Bacteria 551
580 Ga0495583_0063274 3300046506 Bacteria 1645
581 Ga0495583_0104302 3300046506 Bacteria 1207
582 Ga0495583_0216997 3300046506 Bacteria 774
583 Ga0495606_0009172 3300046507 Bacteria 8416
584 Ga0495606_0116814 3300046507 Bacteria 1602
585 Ga0495606_0149220 3300046507 Bacteria 1373
586 Ga0495606_0185473 3300046507 Bacteria 1196
587 Ga0495606_0196186 3300046507 Bacteria 1154
588 Ga0495606_0233360 3300046507 Bacteria 1030
589 Ga0495606_0440494 3300046507 Bacteria 669
590 Ga0495608_0042532 3300046511 Bacteria 3038
591 Ga0495610_0040974 3300046512 Bacteria 2329
592 Ga0495610_0331907 3300046512 Bacteria 578
593 Ga0495616_0171852 3300046513 Bacteria 968
594 Ga0495618_0657347 3300046514 Bacteria 619
595 Ga0495620_0059713 3300046515 Bacteria 1593
596 Ga0495620_0128526 3300046515 Bacteria 995
597 Ga0495628_0033672 3300046516 Bacteria 4127
598 Ga0495628_0157878 3300046516 Bacteria 1725
599 Ga0495628_0234624 3300046516 Bacteria 1374
600 Ga0495628_1174236 3300046516 Bacteria 522
601 Ga0495630_0137011 3300046517 Bacteria 1860
602 Ga0495630_0644640 3300046517 Bacteria 811
603 Ga0495632_0120022 3300046519 Bacteria 1229
604 Ga0495632_0317405 3300046519 Bacteria 689
605 Ga0495637_0281110 3300046520 Bacteria 594
606 Ga0495643_0004469 3300046522 Bacteria 9768
607 Ga0495643_0037458 3300046522 Bacteria 2660
608 Ga0495643_0156975 3300046522 Bacteria 1122
609 Ga0495643_0162783 3300046522 Bacteria 1097
610 Ga0495643_0173943 3300046522 Bacteria 1051
611 Ga0495644_0044658 3300046523 Bacteria 1667
612 Ga0495644_0109159 3300046523 Bacteria 1049
613 Ga0495644_0275711 3300046523 Bacteria 656
614 Ga0495648_0017117 3300046524 Bacteria 5194
615 Ga0495648_0048668 3300046524 Bacteria 2607
616 Ga0495648_0097097 3300046524 Bacteria 1635
617 Ga0495648_0224002 3300046524 Bacteria 925
618 Ga0495648_0246817 3300046524 Bacteria 864
619 Ga0495663_0019565 3300046525 Bacteria 1940
620 Ga0495652_0028907 3300046529 Bacteria 4873
621 Ga0495652_0306871 3300046529 Bacteria 1151
622 Ga0495652_0425291 3300046529 Bacteria 935
623 Ga0495665_0009128 3300046531 Bacteria 5375
624 Ga0495665_0219527 3300046531 Bacteria 983
625 Ga0495640_0636462 3300046533 Bacteria 642
626 Ga0495640_0739727 3300046533 Bacteria 589
627 Ga0495586_0220831 3300046535 Bacteria 1077
628 Ga0495587_0050190 3300046536 Bacteria 2468
629 Ga0495587_0066552 3300046536 Bacteria 2101
630 Ga0495598_0029640 3300046537 Bacteria 1527
631 Ga0495621_0429544 3300046539 Bacteria 563
632 Ga0495597_0050210 3300046542 Bacteria 1842
633 Ga0495645_0013957 3300046543 Bacteria 5693
634 Ga0495645_0236239 3300046543 Bacteria 1222
635 Ga0495645_0633165 3300046543 Bacteria 655
636 Ga0495645_0749378 3300046543 Bacteria 589
637 Ga0495622_0010792 3300046557 Bacteria 4214
638 Ga0495622_0328259 3300046557 Bacteria 664
639 Ga0495633_0145073 3300046558 Bacteria 1097
640 Ga0495633_0331788 3300046558 Bacteria 690
641 Ga0495667_0227371 3300046559 Bacteria 1190
642 Ga0495667_0511467 3300046559 Bacteria 752
643 Ga0495656_0169100 3300046615 Bacteria 1067
644 Ga0495656_0209199 3300046615 Bacteria 971
645 Ga0495656_0368030 3300046615 Bacteria 747
646 Ga0495668_0033143 3300046616 Bacteria 2903
647 Ga0495668_0049141 3300046616 Bacteria 2339
648 Ga0495668_0269717 3300046616 Bacteria 932
649 Ga0495668_0294428 3300046616 Bacteria 889
650 Ga0495634_0337654 3300046642 Bacteria 904
651 Ga0495611_0137691 3300046648 Bacteria 1140
652 Ga0495611_0251764 3300046648 Bacteria 819
653 Ga0495611_0577023 3300046648 Bacteria 509
654 Ga0495625_0019271 3300046660 Bacteria 5298
655 Ga0495625_0058267 3300046660 Bacteria 2745
656 Ga0495625_0218194 3300046660 Bacteria 1251
657 Ga0495625_0411753 3300046660 Bacteria 843
658 Ga0495625_0473811 3300046660 Bacteria 770
659 Ga0495625_0745739 3300046660 Bacteria 574
660 Ga0495635_0017588 3300046663 Bacteria 4993
661 Ga0495635_0239189 3300046663 Bacteria 1225
662 Ga0495659_0023537 3300046664 Bacteria 2094
663 Ga0495659_0341611 3300046664 Bacteria 638
664 Ga0495659_0369282 3300046664 Bacteria 615
665 Ga0495661_0098249 3300046665 Bacteria 1653
666 Ga0495661_0190666 3300046665 Bacteria 1080
667 Ga0495588_0005294 3300046674 Bacteria 5736
668 Ga0495588_0172208 3300046674 Bacteria 1144
669 Ga0495588_0465513 3300046674 Bacteria 663
670 Ga0495657_0004541 3300046675 Bacteria 11089
671 Ga0495657_0181805 3300046675 Bacteria 1290
672 Ga0495657_0267160 3300046675 Bacteria 1026
673 Ga0495599_0002205 3300046678 Bacteria 11329
674 Ga0495599_0391417 3300046678 Bacteria 828
675 Ga0495623_0003771 3300046679 Bacteria 9989
676 Ga0495623_0010474 3300046679 Bacteria 6003
677 Ga0495646_0047497 3300046680 Bacteria 2613
678 Ga0495646_0212283 3300046680 Bacteria 1050
679 Ga0495646_0565519 3300046680 Bacteria 580
680 Ga0495647_0392632 3300046681 Bacteria 636
681 Ga0495647_0631348 3300046681 Bacteria 504
682 Ga0495658_0227906 3300046683 Bacteria 1168
683 Ga0495669_0130846 3300046684 Bacteria 1181
684 Ga0495669_0203395 3300046684 Bacteria 947
685 Ga0495669_0411845 3300046684 Bacteria 655
686 Ga0495613_0815365 3300046689 Bacteria 608
687 Ga0495613_0949970 3300046689 Bacteria 554
688 Ga0495624_0073653 3300046690 Bacteria 2123
689 Ga0495624_0670800 3300046690 Bacteria 616
690 Ga0495624_0680001 3300046690 Bacteria 611
691 Ga0495670_0229499 3300046691 Bacteria 987
692 Ga0495670_0422308 3300046691 Bacteria 721
693 Ga0495671_0079068 3300046692 Bacteria 1612
694 Ga0495671_0120005 3300046692 Bacteria 1283
695 Ga0495671_0137361 3300046692 Bacteria 1192
696 Ga0495671_0199054 3300046692 Bacteria 972
697 Ga0495671_0308399 3300046692 Bacteria 761
698 Ga0495671_0527209 3300046692 Bacteria 563
699 Ga0495649_0137181 3300046694 Bacteria 1289
700 Ga0495649_0183087 3300046694 Bacteria 1092
701 Ga0495649_0273355 3300046694 Bacteria 864
702 Ga0495649_0321508 3300046694 Bacteria 785
703 Ga0495649_0394318 3300046694 Bacteria 695
704 Ga0495649_0532506 3300046694 Bacteria 583
705 Ga0495589_0133748 3300046794 Bacteria 1190
706 Ga0495589_0271833 3300046794 Bacteria 789
707 Ga0495589_0445556 3300046794 Bacteria 593
708 Ga0495600_0025216 3300046809 Bacteria 3831
709 Ga0495600_0038641 3300046809 Bacteria 3106
710 Ga0495600_0117333 3300046809 Bacteria 1732
711 Ga0495600_0295177 3300046809 Bacteria 1023
712 Ga0495660_0233786 3300046810 Bacteria 860
713 Ga0495581_0130169 3300047315 Bacteria 1466
714 Ga0495581_0238988 3300047315 Bacteria 1062
715 Ga0495581_0240106 3300047315 Bacteria 1059
716 Ga0495581_0597305 3300047315 Bacteria 639
717 Ga0495604_0003460 3300047317 Bacteria 12589
718 Ga0495604_0017839 3300047317 Bacteria 5678
719 Ga0495604_0392519 3300047317 Bacteria 915
720 Ga0495604_0790219 3300047317 Bacteria 598
721 Ga0495636_0108904 3300047318 Bacteria 1218
722 Ga0495636_0648624 3300047318 Bacteria 518
723 Ga0495636_0657571 3300047318 Bacteria 515
724 Ga0495674_0036222 3300047319 Bacteria 4444
725 Ga0495674_0066962 3300047319 Bacteria 3113
726 Ga0495674_0482086 3300047319 Bacteria 994
727 Ga0495674_0879176 3300047319 Bacteria 693
728 Ga0495672_0200799 3300047320 Bacteria 997
729 Ga0495672_0240623 3300047320 Bacteria 884
730 Ga0495672_0283868 3300047320 Bacteria 790
731 Ga0495672_0486706 3300047320 Bacteria 551
732 Ga0495676_0188922 3300047321 Bacteria 1438
733 Ga0495676_0230578 3300047321 Bacteria 1272
734 Ga0495680_0003547 3300047322 Bacteria 15289
735 Ga0495683_0092606 3300047323 Bacteria 1462
736 Ga0495683_0192928 3300047323 Bacteria 923
737 Ga0495683_0445382 3300047323 Bacteria 532
738 Ga0495687_026543 3300047443 Bacteria 2724
739 Ga0495675_0049362 3300047444 Bacteria 2676
740 Ga0495675_0396332 3300047444 Bacteria 805
741 Ga0495677_0097024 3300047445 Bacteria 1114
742 Ga0495673_0128454 3300047469 Bacteria 998
743 Ga0495681_0188317 3300047470 Bacteria 844
744 Ga0495684_0044303 3300047471 Bacteria 3406
745 Ga0495684_0449817 3300047471 Bacteria 895
746 Ga0495686_0093254 3300047472 Bacteria 1826
747 Ga0495686_0497182 3300047472 Bacteria 643
748 Ga0495686_0513740 3300047472 Bacteria 629
749 Ga0495593_0116170 3300047673 Bacteria 1364
750 Ga0495593_0142706 3300047673 Bacteria 1213
751 Ga0495593_0414458 3300047673 Bacteria 674
752 Ga0495593_0580765 3300047673 Bacteria 562
753 Ga0495602_0041761 3300048088 Bacteria 4186
754 Ga0495602_0079521 3300048088 Bacteria 2765
755 Ga0495626_0080779 3300048091 Bacteria 1445
756 Ga0495626_0086585 3300048091 Bacteria 1384
757 Ga0495626_0265455 3300048091 Bacteria 685
758 Ga0495626_0440862 3300048091 Bacteria 501
759 Ga0496100_0024942 3300048903 Bacteria 3652
760 Ga0496100_0136546 3300048903 Bacteria 1733
761 Ga0496100_0162938 3300048903 Bacteria 1600
762 Ga0496100_0195810 3300048903 Bacteria 1470
763 Ga0496101_0039486 3300048904 Bacteria 3357
764 Ga0496101_0144618 3300048904 Bacteria 1815
765 Ga0496101_0486195 3300048904 Bacteria 975
766 Ga0496101_1022318 3300048904 Bacteria 650
767 Ga0496102_0009024 3300048905 Bacteria 8558
768 Ga0496102_0055659 3300048905 Bacteria 3607
769 Ga0496102_0122969 3300048905 Bacteria 2424
770 Ga0496102_0578625 3300048905 Bacteria 1046
771 Ga0496102_0820907 3300048905 Bacteria 852
772 Ga0496103_0008019 3300048906 Bacteria 6269
773 Ga0496103_0108221 3300048906 Bacteria 1764
774 Ga0496104_0019449 3300048907 Bacteria 6213
775 Ga0496104_0118130 3300048907 Bacteria 2545
776 Ga0496105_0051160 3300048908 Bacteria 3413
777 Ga0496105_0071336 3300048908 Bacteria 2871
778 Ga0496105_0251461 3300048908 Bacteria 1432
779 Ga0496106_0013794 3300048909 Bacteria 5970
780 Ga0496106_0060818 3300048909 Bacteria 2864
781 Ga0496106_0304043 3300048909 Bacteria 1279
782 Ga0496106_0368667 3300048909 Bacteria 1154
783 Ga0496107_0662470 3300048910 Bacteria 769
784 Ga0496107_0662996 3300048910 Bacteria 769
785 Ga0496108_0010323 3300048911 Bacteria 7585
786 Ga0496108_1426613 3300048911 Bacteria 578
787 Ga0496109_0063835 3300048912 Bacteria 3369
788 Ga0496109_0144731 3300048912 Bacteria 2223
789 Ga0496110_0051010 3300048913 Bacteria 3635
790 Ga0496110_0059747 3300048913 Bacteria 3361
791 Ga0496110_0063887 3300048913 Bacteria 3253
792 Ga0496110_1278800 3300048913 Bacteria 643
793 Ga0496111_0094126 3300048914 Bacteria 2197
794 Ga0496111_0141852 3300048914 Bacteria 1780
795 Ga0496111_0360530 3300048914 Bacteria 1076
796 Ga0496111_0531684 3300048914 Bacteria 864
797 Ga0496112_0019585 3300048915 Bacteria 6390
798 Ga0496112_0208823 3300048915 Bacteria 1910
799 Ga0496112_0828511 3300048915 Bacteria 849
800 Ga0496113_0022434 3300048916 Bacteria 4465
801 Ga0496113_0319151 3300048916 Bacteria 1245
802 Ga0496114_0158535 3300048917 Bacteria 1966
803 Ga0496114_0806954 3300048917 Bacteria 817
804 Ga0496115_0049174 3300048918 Bacteria 3374
805 Ga0496115_0089419 3300048918 Bacteria 2515
806 Ga0496115_1212421 3300048918 Bacteria 566
807 Ga0496115_1389667 3300048918 Bacteria 519
808 Ga0496116_0023305 3300048919 Bacteria 4612
809 Ga0496116_0035341 3300048919 Bacteria 3511
810 Ga0496117_0073259 3300048920 Bacteria 2286
811 Ga0496117_0157185 3300048920 Bacteria 1337
812 Ga0496118_0014514 3300048921 Bacteria 7368
813 Ga0496118_0051163 3300048921 Bacteria 3162
814 Ga0496118_0243474 3300048921 Bacteria 1028
815 Ga0496118_0247536 3300048921 Bacteria 1015
816 Ga0496118_0460149 3300048921 Bacteria 643
817 Ga0496119_0110215 3300048922 Bacteria 1529
818 Ga0496119_0128125 3300048922 Bacteria 1386
819 Ga0496119_0149059 3300048922 Bacteria 1255
820 Ga0496120_0200331 3300048923 Bacteria 967
821 Ga0496120_0215725 3300048923 Bacteria 920
822 Ga0496120_0249472 3300048923 Bacteria 834
823 Ga0496120_0294662 3300048923 Bacteria 745
824 Ga0496121_0000578 3300048924 Bacteria 68826
825 Ga0496121_0000754 3300048924 Bacteria 59457
826 Ga0496121_0105498 3300048924 Bacteria 2162
827 Ga0496121_0105737 3300048924 Bacteria 2159
828 Ga0496121_0177936 3300048924 Bacteria 1538
829 Ga0496121_0267734 3300048924 Bacteria 1176
830 Ga0496121_0294932 3300048924 Bacteria 1103
831 Ga0496123_0348248 3300048926 Bacteria 690
832 Ga0496124_0529366 3300048927 Bacteria 783
833 Ga0496125_0094839 3300048928 Bacteria 2222
834 Ga0496125_0154569 3300048928 Bacteria 1569
835 Ga0496126_0000602 3300048929 Bacteria 67975
836 Ga0496126_0015626 3300048929 Bacteria 7627
837 Ga0496126_0086022 3300048929 Bacteria 2771
838 Ga0496126_0131404 3300048929 Bacteria 2163
839 Ga0496126_0230712 3300048929 Bacteria 1551
840 Ga0496126_0537676 3300048929 Bacteria 929
841 Ga0496126_1200776 3300048929 Bacteria 558
842 Ga0495682_0011270 3300049460 Bacteria 3441
843 Ga0495682_0090695 3300049460 Bacteria 1098
844 Ga0501067_0670121 3300049583 Bacteria 583
845 Ga0501068_0890160 3300049584 Bacteria 585
846 Ga0501071_0220360 3300049587 Bacteria 1428
847 nmdc:mga03683_330365_c1 3300050489 Bacteria 719
848 nmdc:mga03683_350053_c1 3300050489 Bacteria 699
849 nmdc:mga03683_522089_c1 3300050489 Bacteria 576
850 nmdc:mga03n38_2830_c1 3300050490 Bacteria 5458
851 nmdc:mga03n38_524_c1 3300050490 Bacteria 7307
852 nmdc:mga03n38_530910_c1 3300050490 Bacteria 663
853 nmdc:mga03n38_697409_c1 3300050490 Bacteria 585
854 nmdc:mga00v17_1007302_c1 3300050491 Bacteria 524
855 nmdc:mga00v17_43533_c1 3300050491 Bacteria 2704
856 nmdc:mga00v17_744662_c1 3300050491 Bacteria 627
857 nmdc:mga0yw44_1096983_c1 3300050492 Bacteria 538
858 nmdc:mga0yw44_19665_c1 3300050492 Bacteria 3729
859 nmdc:mga0yw44_506098_c1 3300050492 Bacteria 820
860 nmdc:mga0yw44_59098_c1 3300050492 Bacteria 2345
861 nmdc:mga0yw44_650069_c1 3300050492 Bacteria 717
862 nmdc:mga0k408_258974_c1 3300050493 Bacteria 1039
863 nmdc:mga0k408_347087_c1 3300050493 Bacteria 885
864 nmdc:mga0k408_6369_c1 3300050493 Bacteria 6300
865 nmdc:mga0k408_69353_c1 3300050493 Bacteria 2057
866 nmdc:mga06z11_14458_c1 3300050494 Bacteria 3496
867 nmdc:mga06z11_697163_c1 3300050494 Bacteria 618
868 nmdc:mga06z11_745_c1 3300050494 Bacteria 11859
869 nmdc:mga06z11_88946_c1 3300050494 Bacteria 1673
870 nmdc:mga06z11_975012_c1 3300050494 Bacteria 517
871 nmdc:mga04h51_136645_c1 3300050495 Bacteria 926
872 nmdc:mga04h51_17618_c1 3300050495 Bacteria 2092
873 nmdc:mga04h51_24962_c1 3300050495 Bacteria 1836
874 nmdc:mga04h51_29310_c1 3300050495 Bacteria 1723
875 nmdc:mga07m45_1559_c1 3300050496 Bacteria 10546
876 nmdc:mga07m45_236535_c1 3300050496 Bacteria 571
877 nmdc:mga07m45_9041_c1 3300050496 Bacteria 5147
878 nmdc:mga0n895_591417_c1 3300050512 Bacteria 1113
879 nmdc:mga0n895_889479_c1 3300050512 Bacteria 876
880 nmdc:mga0a205_1020930_c1 3300050515 Bacteria 674
881 nmdc:mga0sz30_131739_c1 3300050516 Bacteria 1102
882 nmdc:mga0sz30_14734_c1 3300050516 Bacteria 3083
883 nmdc:mga0sz30_163038_c1 3300050516 Bacteria 988
884 nmdc:mga0sz30_16307_c2 3300050516 Bacteria 1840
885 nmdc:mga0sz30_21080_c1 3300050516 Bacteria 2634
886 nmdc:mga0sz30_300763_c1 3300050516 Bacteria 715
887 nmdc:mga0sz30_31957_c1 3300050516 Bacteria 2180
888 nmdc:mga0sz30_55661_c1 3300050516 Bacteria 1684
889 nmdc:mga0sz30_558060_c1 3300050516 Bacteria 517
890 Ga0495601_0433616 3300053077 Bacteria 851
891 Ga0495612_0490855 3300053078 Bacteria 563
892 Ga0495655_0006061 3300053083 Bacteria 2175
893 Ga0495655_0126765 3300053083 Bacteria 782
894 Ga0495655_0163108 3300053083 Bacteria 709
895 Ga0495595_0246111 3300053084 Bacteria 895
896 Ga0495595_0414064 3300053084 Bacteria 683
897 Ga0495619_0295540 3300053085 Bacteria 1122
898 Ga0500578_0074745 3300053086 Bacteria 2159
899 Ga0500578_0291985 3300053086 Bacteria 969
900 Ga0500643_000077 3300053087 Bacteria 105070
901 Ga0500647_0411618 3300053091 Bacteria 545
902 Ga0500583_0149698 3300053092 Bacteria 1161
903 Ga0500651_0027154 3300053093 Bacteria 3598
904 Ga0500650_0275964 3300053098 Bacteria 748
905 Ga0500555_006933 3300053103 Bacteria 3221
906 Ga0500562_201673 3300053108 Bacteria 539
907 Ga0500595_000794 3300053119 Bacteria 18361
908 Ga0500595_005012 3300053119 Bacteria 5835
909 Ga0500595_015486 3300053119 Bacteria 2860
910 Ga0500595_022167 3300053119 Bacteria 2254
911 Ga0500642_0023634 3300053130 Bacteria 2471
912 Ga0500658_0110761 3300053134 Bacteria 1208
913 Ga0500658_0153248 3300053134 Bacteria 1040
914 Ga0500568_0021271 3300053139 Bacteria 2793
915 Ga0500568_0048781 3300053139 Bacteria 1673
916 Ga0500577_0074325 3300053142 Bacteria 1340
917 Ga0500588_0255508 3300053146 Bacteria 659
918 Ga0500636_0004048 3300053177 Bacteria 8272
919 Ga0500636_0024396 3300053177 Bacteria 3577
920 Ga0500636_0083945 3300053177 Bacteria 1832
921 Ga0500636_0174266 3300053177 Bacteria 1161
922 Ga0500637_0056906 3300053178 Bacteria 2234
923 Ga0500645_210251 3300053730 Bacteria 523
924 Ga0500601_028489 3300053737 Bacteria 658
925 Ga0500661_009438 3300055283 Bacteria 1785
926 Ga0587080_096451 3300059503 Bacteria 627
927 Ga0501082_0950088 3300060353 Bacteria 752
928 2793077937
929 Ga0070709_10048833
930 RicEn_FSXC18105_g1
931 JGI24739J22299_10183714
932 JGI24737J22298_10156251
933 JGI24743J22301_10101613
934 JGI24738J21930_10036512
935 JGI24034J26672_10066606
936 JGI25406J46586_10002470
937 JGI25165J46597_1006980
938 JGI25153J46596_10048070
939 rootH2_10174194
940 rootL2_10265413
941 JGI25404J52841_10016240
942 JGI25404J52841_10017136
943 JGI25404J52841_10123283
944 Ga0055529_1012460
945 Ga0070683_100063620
946 Ga0070690_101114923
947 Ga0070670_100205522
948 Ga0070666_10085949
949 Ga0070666_10714969
950 Ga0070682_100021394
951 Ga0070682_101622074
952 Ga0068868_100253435
953 Ga0070660_100465553
954 Ga0070661_100077486
955 Ga0070668_100035818
956 Ga0070668_100069473
957 Ga0070668_100451290
958 Ga0070668_101517350
959 Ga0070669_100062817
960 Ga0070669_100336295
961 Ga0070671_100066000
962 Ga0070671_100357271
963 Ga0070671_100768006
964 Ga0070671_101498204
965 Ga0070673_100393049
966 Ga0070659_100238574
967 Ga0070667_100686574
968 Ga0070714_100001315
969 Ga0070714_102057267
970 Ga0070713_100076677
971 Ga0070710_10002649
972 Ga0070710_10239994
973 Ga0070711_100005142
974 Ga0070711_100117903
975 Ga0070700_101536917
976 Ga0070708_100197079
977 Ga0070663_100006266
978 Ga0070663_100022408
979 Ga0070663_100802851
980 Ga0070662_100809341
981 Ga0070662_101767902
982 Ga0070681_10964548
983 Ga0068867_100625999
984 Ga0068867_101392886
985 Ga0070685_10393900
986 Ga0070706_100082994
987 Ga0070706_100390317
988 Ga0070707_100116280
989 Ga0070707_100200204
990 Ga0070698_100028907
991 Ga0070698_100041994
992 Ga0070698_100072925
993 Ga0070698_101219627
994 Ga0070699_100351973
995 Ga0070679_101331019
996 Ga0070684_100042757
997 Ga0070697_100349051
998 Ga0070697_100545246
999 Ga0068853_100356199
1000 Ga0068853_100806907
1001 Ga0068853_101139206
1002 Ga0070695_100789864
1003 Ga0070665_100014892
1004 Ga0070665_100261298
1005 Ga0070665_100574815
1006 Ga0070665_101132353
1007 Ga0070665_101758642
1008 Ga0070704_101114911
1009 Ga0068855_100326193
1010 Ga0070664_100264201
1011 Ga0068857_100125678
1012 Ga0068857_100512251
1013 Ga0068854_100165020
1014 Ga0068854_101090318
1015 Ga0068856_100301967
1016 Ga0068856_100433273
1017 Ga0068856_101195323
1018 Ga0068852_100266639
1019 Ga0068852_101844070
1020 Ga0068859_100116478
1021 Ga0068864_100952132
1022 Ga0068861_100017115
1023 Ga0068861_100044612
1024 Ga0068861_100256040
1025 Ga0068861_100416578
1026 Ga0068861_100773274
1027 Ga0068851_10237347
1028 Ga0068851_10304558
1029 Ga0068851_10625988
1030 Ga0068863_100167953
1031 Ga0068863_101117466
1032 Ga0068863_101589698
1033 Ga0068863_101698384
1034 Ga0068858_100075352
1035 Ga0068858_100127368
1036 Ga0068858_100183720
1037 Ga0068858_100500486
1038 Ga0068860_100061999
1039 Ga0068860_100145075
1040 Ga0068860_100790880
1041 Ga0068862_100034556
1042 Ga0068862_100152051
1043 Ga0068862_100269098
1044 Ga0068862_101000075
1045 Ga0068862_101743213
1046 Ga0081455_10002635
1047 Ga0081455_10038474
1048 Ga0081455_10071426
1049 Ga0081455_10089450
1050 Ga0081455_10798315
1051 Ga0081538_10119744
1052 Ga0081540_1001277
1053 Ga0081540_1002364
1054 Ga0081540_1002383
1055 Ga0081540_1004480
1056 Ga0081540_1005556
1057 Ga0081540_1005938
1058 Ga0081540_1009646
1059 Ga0081540_1011712
1060 Ga0081540_1014103
1061 Ga0081540_1015892
1062 Ga0081540_1018125
1063 Ga0081540_1058266
1064 Ga0081540_1065716
1065 Ga0081540_1076345
1066 Ga0081540_1088777
1067 Ga0081540_1252185
1068 Ga0081539_10000220
1069 Ga0081539_10037690
1070 Ga0081539_10373502
1071 Ga0070717_11485877
1072 Ga0075365_10029823
1073 Ga0075365_10034442
1074 Ga0075365_10107312
1075 Ga0075365_10317694
1076 Ga0075365_10348192
1077 Ga0075368_10010465
1078 Ga0075368_10020246
1079 Ga0075368_10040840
1080 Ga0075368_10075472
1081 Ga0075363_100001679
1082 Ga0075363_100033439
1083 Ga0075363_100277923
1084 Ga0075363_100502879
1085 Ga0075364_10116542
1086 Ga0075364_10148963
1087 Ga0070715_10003397
1088 Ga0070715_10451636
1089 Ga0070716_100640720
1090 Ga0070716_100896774
1091 Ga0070712_100219782
1092 Ga0070712_100268996
1093 Ga0070712_100315128
1094 Ga0075362_10329134
1095 Ga0075362_10367358
1096 Ga0075362_10446307
1097 Ga0075367_10005581
1098 Ga0075367_10034765
1099 Ga0075367_10098486
1100 Ga0075367_10124429
1101 Ga0075367_10438373
1102 Ga0075367_10768772
1103 Ga0075367_10990594
1104 Ga0075367_11056434
1105 Ga0075369_10041513
1106 Ga0075369_10044018
1107 Ga0075369_10053113
1108 Ga0075369_10070211
1109 Ga0075369_10119874
1110 Ga0075366_10002137
1111 Ga0075366_10005681
1112 Ga0075366_10031875
1113 Ga0075366_10302378
1114 Ga0097621_100306709
1115 Ga0075370_10007654
1116 Ga0075370_10108833
1117 Ga0075370_10803587
1118 Ga0068871_100524770
1119 Ga0075428_101078333
1120 Ga0075433_10530203
1121 Ga0075434_100743925
1122 Ga0097620_100116478
1123 Ga0099825_1034966
1124 Ga0099824_1031306
1125 Ga0099823_1000409
1126 Ga0099794_10047740
1127 Ga0099794_10777359
1128 Ga0099795_10021328
1129 Ga0105251_10523143
1130 Ga0105250_10029341
1131 Ga0105240_10001242
1132 Ga0105240_10355837
1133 Ga0105240_11689806
1134 Ga0105245_10145626
1135 Ga0105245_10341639
1136 Ga0105245_11004517
1137 Ga0105245_11714863
1138 Ga0105247_10036987
1139 Ga0105247_10175949
1140 Ga0105247_10196278
1141 Ga0105247_10224210
1142 Ga0105243_10077988
1143 Ga0105243_10247875
1144 Ga0105243_10889969
1145 Ga0105243_10943913
1146 Ga0105243_12445351
1147 Ga0105243_12712070
1148 Ga0105241_10055144
1149 Ga0105241_10063429
1150 Ga0105241_10160723
1151 Ga0105241_11272746
1152 Ga0105242_11215500
1153 Ga0105242_12847570
1154 Ga0105248_10034657
1155 Ga0105248_10180473
1156 Ga0105248_10366065
1157 Ga0105248_10677747
1158 Ga0105248_10784625
1159 Ga0105248_11306767
1160 Ga0105237_10016458
1161 Ga0105237_10056145
1162 Ga0105237_10394825
1163 Ga0105237_10453809
1164 Ga0105237_10829967
1165 Ga0105238_10256208
1166 Ga0105238_10458031
1167 Ga0105249_10182034
1168 Ga0105249_11264751
1169 Ga0105249_12364140
1170 Ga0099796_10120497
1171 Ga0099796_10295098
1172 Ga0105239_10094197
1173 Ga0105239_10190333
1174 Ga0105239_10524913
1175 Ga0105239_10789220
1176 Ga0105239_11022531
1177 Ga0105239_11716044
1178 Ga0105239_13231709
1179 Ga0105246_10107273
1180 Ga0105246_10181807
1181 Ga0105246_10223033
1182 Ga0157343_1029861
1183 Ga0157314_1006530
1184 Ga0157315_1072801
1185 Ga0157338_1020011
1186 Ga0157369_10314198
1187 Ga0157374_10086988
1188 Ga0157374_10496206
1189 Ga0157378_11029310
1190 Ga0163162_10081810
1191 Ga0163162_10216087
1192 Ga0163162_10769359
1193 Ga0163162_11268990
1194 Ga0163162_11988757
1195 Ga0163162_12220550
1196 Ga0157375_10222713
1197 Ga0163163_10017883
1198 Ga0163163_10082247
1199 Ga0163163_11013379
1200 Ga0163163_11414860
1201 Ga0157380_10431796
1202 Ga0157380_10444309
1203 Ga0182008_10286380
1204 Ga0157377_10206152
1205 Ga0157379_10221910
1206 Ga0157376_10031320
1207 Ga0157376_10757805
1208 Ga0157376_10768836
1209 Ga0157376_10920625
1210 Ga0163161_10330554
1211 Ga0163161_10378786
1212 Ga0214544_1000003
1213 Ga0214542_1000003
1214 Ga0214545_1000004
1215 Ga0214543_1000007
1216 Ga0213872_10030568
1217 Ga0213872_10083141
1218 Ga0213872_10132409
1219 Ga0213872_10333556
1220 Ga0213874_10086402
1221 Ga0213874_10234480
1222 Ga0213876_10264351
1223 Ga0213871_10000774
1224 Ga0213871_10026659
1225 Ga0209233_1006781
1226 Ga0209233_1036842
1227 Ga0209455_1002647
1228 Ga0209758_1023912
1229 Ga0209758_1142230
1230 Ga0209256_1102516
1231 Ga0207426_1005759
1232 Ga0207426_1017576
1233 Ga0207697_10078647
1234 Ga0207656_10297242
1235 Ga0207692_10000199
1236 Ga0207692_10279037
1237 Ga0207710_10046574
1238 Ga0207710_10211726
1239 Ga0207710_10510491
1240 Ga0207710_10723599
1241 Ga0207688_11081087
1242 Ga0207680_10398751
1243 Ga0207647_10003170
1244 Ga0207685_10507308
1245 Ga0207645_10543001
1246 Ga0207643_10962609
1247 Ga0207684_10038942
1248 Ga0207684_10211637
1249 Ga0207654_11270913
1250 Ga0207707_11395574
1251 Ga0207695_10000059
1252 Ga0207671_10019058
1253 Ga0207671_10049486
1254 Ga0207671_10441090
1255 Ga0207693_10003610
1256 Ga0207693_10207969
1257 Ga0207693_11210676
1258 Ga0207663_10000863
1259 Ga0207663_10358811
1260 Ga0207657_10376292
1261 Ga0207649_10045996
1262 Ga0207646_10057891
1263 Ga0207681_10062695
1264 Ga0207681_10195193
1265 Ga0207694_10564911
1266 Ga0207650_10017890
1267 Ga0207687_11402327
1268 Ga0207700_11802781
1269 Ga0207664_10092199
1270 Ga0207644_10045164
1271 Ga0207644_10382281
1272 Ga0207644_10562020
1273 Ga0207644_11273050
1274 Ga0207690_10107345
1275 Ga0207706_10087965
1276 Ga0207706_10672865
1277 Ga0207706_11448153
1278 Ga0207709_10099156
1279 Ga0207709_10155097
1280 Ga0207704_11857718
1281 Ga0207665_10132531
1282 Ga0207665_10823013
1283 Ga0207691_10340397
1284 Ga0207711_10108671
1285 Ga0207711_10323749
1286 Ga0207711_12109236
1287 Ga0207711_12111372
1288 Ga0207689_11243332
1289 Ga0207689_11299307
1290 Ga0207689_11720459
1291 Ga0207661_10003502
1292 Ga0207661_10350664
1293 Ga0207679_10298331
1294 Ga0207667_10718317
1295 Ga0207712_10116320
1296 Ga0207712_10878783
1297 Ga0207668_10006780
1298 Ga0207668_10019269
1299 Ga0207668_10031562
1300 Ga0207668_10158005
1301 Ga0207668_10478697
1302 Ga0207640_10139124
1303 Ga0207640_11103156
1304 Ga0207658_10055459
1305 Ga0207658_10611211
1306 Ga0207677_10258827
1307 Ga0207703_10068597
1308 Ga0207703_11296618
1309 Ga0207639_10272434
1310 Ga0207639_10960285
1311 Ga0207639_11048380
1312 Ga0207678_10002747
1313 Ga0207678_10024264
1314 Ga0207678_10179188
1315 Ga0207678_11007666
1316 Ga0207708_11054278
1317 Ga0207702_10061845
1318 Ga0207702_10460293
1319 Ga0207702_11007411
1320 Ga0207641_10057037
1321 Ga0207641_10949527
1322 Ga0207676_10197864
1323 Ga0207676_10450713
1324 Ga0207674_10068262
1325 Ga0207674_10342669
1326 Ga0207675_100001340
1327 Ga0207675_100395016
1328 Ga0207675_100465823
1329 Ga0207675_100491932
1330 Ga0207675_100738172
1331 Ga0207683_10315553
1332 Ga0207683_10506880
1333 Ga0207698_10463281
1334 Ga0207698_11280150
1335 Ga0207698_12006917
1336 Ga0209389_1000012
1337 Ga0209389_1000111
1338 Ga0209489_100019
1339 Ga0209489_100220
1340 Ga0209700_100018
1341 Ga0209700_100041
1342 Ga0209179_1049525
1343 Ga0209813_10012405
1344 Ga0209813_10024642
1345 Ga0209813_10044267
1346 Ga0268266_10004233
1347 Ga0268266_10157256
1348 Ga0268266_10505116
1349 Ga0268265_10100104
1350 Ga0268265_10131177
1351 Ga0268264_10065485
1352 Ga0268264_10327995
1353 Ga0268264_10710602
1354 Ga0268264_11470988
1355 Ga0307517_10083081
1356 Ga0307515_10703934
1357 Ga0307511_10155114
1358 Ga0265760_10372167
1359 Ga0265332_10237779
1360 Ga0265328_10379800
1361 Ga0265339_10484961
1362 Ga0265331_10209907
1363 Ga0307509_10004428
1364 Ga0307509_10186364
1365 Ga0307509_10249069
1366 Ga0307408_101244721
1367 Ga0307508_10046085
1368 Ga0265314_10006822
1369 Ga0307516_10768098
1370 Ga0307507_10660109
1371 Ga0307510_10010806
1372 Ga0307510_10229489
1373 Ga0373949_0211515
1374 Ga0373923_0119681
1375 Ga0373923_0160705
1376 Ga0373936_0443242
1377 Ga0373939_0296221
1378 Ga0373954_0039606
1379 Ga0373954_0195602
1380 Ga0373956_0133053
1381 Ga0373957_0116596
1382 Ga0373943_0127612
1383 Ga0373943_0430962
1384 Ga0373946_0187151
1385 Ga0373955_0097412
1386 Ga0373924_0067241
1387 Ga0373935_0157659
1388 Ga0373935_0268449
1389 Ga0373927_0110782
1390 Ga0373927_0791827
1391 Ga0373933_0119344
1392 Ga0373933_0431981
1393 Ga0373933_0573737
1394 Ga0373947_0334952
1395 Ga0373947_0382448
1396 Ga0373947_0734823
1397 Ga0373947_1216345
1398 Ga0373937_0029815
1399 Ga0373937_0880593
1400 Ga0373925_0108052
1401 Ga0373925_0561229
1402 Ga0373925_0568392
1403 Ga0373925_1361905
1404 Ga0395899_0273242
1405 Ga0395900_0680919
1406 Ga0395900_0947865
1407 Ga0395898_0026287
1408 Ga0395898_0319248
1409 Ga0395898_0482868
1410 Ga0395905_0014857
1411 Ga0395905_0021606
1412 Ga0395905_0255705
1413 Ga0395905_1626068
1414 Ga0436364_0362385
1415 Ga0395901_1908364
1416 Ga0436365_0139309
1417 Ga0436365_1127033
1418 Ga0436360_0649694
1419 Ga0436360_0958245
1420 Ga0436360_0969859
1421 Ga0436360_1287672
1422 Ga0436360_1301948
1423 Ga0436361_0028876
1424 Ga0436361_0306306
1425 Ga0436361_0376636
1426 Ga0436361_0549414
1427 Ga0436361_0750195
1428 Ga0436361_0830682
1429 Ga0436361_0900112
1430 Ga0436361_1205934
1431 Ga0436361_1212561
1432 Ga0436363_0073280
1433 Ga0436363_0390681
1434 Ga0436363_0943684
1435 Ga0436363_1242037
1436 Ga0436363_1280402
1437 Ga0436363_1444618
1438 Ga0436363_1663180
1439 Ga0436362_0017675
1440 Ga0451853_1608436
1441 Ga0439455_0259911
1442 Ga0466972_0000473
1443 Ga0466972_0003391
1444 Ga0466965_0011861
1445 Ga0466965_0046268
1446 Ga0466965_0729610
1447 Ga0466966_0002158
1448 Ga0466961_0000042
1449 Ga0466964_0135785
1450 Ga0466964_0265091
1451 Ga0466971_0187100
1452 Ga0466968_0014816
1453 Ga0466968_0084259
1454 Ga0466968_0252532
1455 Ga0466960_0081323
1456 Ga0466960_0095762
1457 Ga0466959_0000975
1458 Ga0466967_1581921
1459 Ga0495592_0118583
1460 Ga0495592_0315469
1461 Ga0495592_0851471
1462 Ga0495603_0060543
1463 Ga0495603_0136216
1464 Ga0495603_0188575
1465 Ga0495603_0218552
1466 Ga0495590_0078491
1467 Ga0495590_0170388
1468 Ga0495590_0413712
1469 Ga0495629_0625958
1470 Ga0495638_0045458
1471 Ga0495638_0188858
1472 Ga0495638_0496328
1473 Ga0495641_0072130
1474 Ga0495641_0180560
1475 Ga0495651_0002020
1476 Ga0495651_0078376
1477 Ga0495651_0723582
1478 Ga0495651_0801783
1479 Ga0495653_0123094
1480 Ga0495653_0661851
1481 Ga0495580_0047890
1482 Ga0495580_0510452
1483 Ga0495580_0998230
1484 Ga0495582_0071365
1485 Ga0495582_0215755
1486 Ga0495582_0286326
1487 Ga0495582_0365731
1488 Ga0495605_0027352
1489 Ga0495605_0037251
1490 Ga0495639_0278799
1491 Ga0495662_0086088
1492 Ga0495664_0054202
1493 Ga0495664_0192237
1494 Ga0495664_0214165
1495 Ga0495664_0235045
1496 Ga0495584_0115586
1497 Ga0495584_0534616
1498 Ga0495585_0067707
1499 Ga0495585_0110767
1500 Ga0495585_0264199
1501 Ga0495585_0446582
1502 Ga0495585_0468258
1503 Ga0495594_0048600
1504 Ga0495594_0102160
1505 Ga0495594_0182101
1506 Ga0495596_0159080
1507 Ga0495596_0378941
1508 Ga0495583_0063274
1509 Ga0495583_0104302
1510 Ga0495583_0216997
1511 Ga0495606_0009172
1512 Ga0495606_0116814
1513 Ga0495606_0149220
1514 Ga0495606_0185473
1515 Ga0495606_0196186
1516 Ga0495606_0233360
1517 Ga0495606_0440494
1518 Ga0495608_0042532
1519 Ga0495610_0040974
1520 Ga0495610_0331907
1521 Ga0495616_0171852
1522 Ga0495618_0657347
1523 Ga0495620_0059713
1524 Ga0495620_0128526
1525 Ga0495628_0033672
1526 Ga0495628_0157878
1527 Ga0495628_0234624
1528 Ga0495628_1174236
1529 Ga0495630_0137011
1530 Ga0495630_0644640
1531 Ga0495632_0120022
1532 Ga0495632_0317405
1533 Ga0495637_0281110
1534 Ga0495643_0004469
1535 Ga0495643_0037458
1536 Ga0495643_0156975
1537 Ga0495643_0162783
1538 Ga0495643_0173943
1539 Ga0495644_0044658
1540 Ga0495644_0109159
1541 Ga0495644_0275711
1542 Ga0495648_0017117
1543 Ga0495648_0048668
1544 Ga0495648_0097097
1545 Ga0495648_0224002
1546 Ga0495648_0246817
1547 Ga0495663_0019565
1548 Ga0495652_0028907
1549 Ga0495652_0306871
1550 Ga0495652_0425291
1551 Ga0495665_0009128
1552 Ga0495665_0219527
1553 Ga0495640_0636462
1554 Ga0495640_0739727
1555 Ga0495586_0220831
1556 Ga0495587_0050190
1557 Ga0495587_0066552
1558 Ga0495598_0029640
1559 Ga0495621_0429544
1560 Ga0495597_0050210
1561 Ga0495645_0013957
1562 Ga0495645_0236239
1563 Ga0495645_0633165
1564 Ga0495645_0749378
1565 Ga0495622_0010792
1566 Ga0495622_0328259
1567 Ga0495633_0145073
1568 Ga0495633_0331788
1569 Ga0495667_0227371
1570 Ga0495667_0511467
1571 Ga0495656_0169100
1572 Ga0495656_0209199
1573 Ga0495656_0368030
1574 Ga0495668_0033143
1575 Ga0495668_0049141
1576 Ga0495668_0269717
1577 Ga0495668_0294428
1578 Ga0495634_0337654
1579 Ga0495611_0137691
1580 Ga0495611_0251764
1581 Ga0495611_0577023
1582 Ga0495625_0019271
1583 Ga0495625_0058267
1584 Ga0495625_0218194
1585 Ga0495625_0411753
1586 Ga0495625_0473811
1587 Ga0495625_0745739
1588 Ga0495635_0017588
1589 Ga0495635_0239189
1590 Ga0495659_0023537
1591 Ga0495659_0341611
1592 Ga0495659_0369282
1593 Ga0495661_0098249
1594 Ga0495661_0190666
1595 Ga0495588_0005294
1596 Ga0495588_0172208
1597 Ga0495588_0465513
1598 Ga0495657_0004541
1599 Ga0495657_0181805
1600 Ga0495657_0267160
1601 Ga0495599_0002205
1602 Ga0495599_0391417
1603 Ga0495623_0003771
1604 Ga0495623_0010474
1605 Ga0495646_0047497
1606 Ga0495646_0212283
1607 Ga0495646_0565519
1608 Ga0495647_0392632
1609 Ga0495647_0631348
1610 Ga0495658_0227906
1611 Ga0495669_0130846
1612 Ga0495669_0203395
1613 Ga0495669_0411845
1614 Ga0495613_0815365
1615 Ga0495613_0949970
1616 Ga0495624_0073653
1617 Ga0495624_0670800
1618 Ga0495624_0680001
1619 Ga0495670_0229499
1620 Ga0495670_0422308
1621 Ga0495671_0079068
1622 Ga0495671_0120005
1623 Ga0495671_0137361
1624 Ga0495671_0199054
1625 Ga0495671_0308399
1626 Ga0495671_0527209
1627 Ga0495649_0137181
1628 Ga0495649_0183087
1629 Ga0495649_0273355
1630 Ga0495649_0321508
1631 Ga0495649_0394318
1632 Ga0495649_0532506
1633 Ga0495589_0133748
1634 Ga0495589_0271833
1635 Ga0495589_0445556
1636 Ga0495600_0025216
1637 Ga0495600_0038641
1638 Ga0495600_0117333
1639 Ga0495600_0295177
1640 Ga0495660_0233786
1641 Ga0495581_0130169
1642 Ga0495581_0238988
1643 Ga0495581_0240106
1644 Ga0495581_0597305
1645 Ga0495604_0003460
1646 Ga0495604_0017839
1647 Ga0495604_0392519
1648 Ga0495604_0790219
1649 Ga0495636_0108904
1650 Ga0495636_0648624
1651 Ga0495636_0657571
1652 Ga0495674_0036222
1653 Ga0495674_0066962
1654 Ga0495674_0482086
1655 Ga0495674_0879176
1656 Ga0495672_0200799
1657 Ga0495672_0240623
1658 Ga0495672_0283868
1659 Ga0495672_0486706
1660 Ga0495676_0188922
1661 Ga0495676_0230578
1662 Ga0495680_0003547
1663 Ga0495683_0092606
1664 Ga0495683_0192928
1665 Ga0495683_0445382
1666 Ga0495687_026543
1667 Ga0495675_0049362
1668 Ga0495675_0396332
1669 Ga0495677_0097024
1670 Ga0495673_0128454
1671 Ga0495681_0188317
1672 Ga0495684_0044303
1673 Ga0495684_0449817
1674 Ga0495686_0093254
1675 Ga0495686_0497182
1676 Ga0495686_0513740
1677 Ga0495593_0116170
1678 Ga0495593_0142706
1679 Ga0495593_0414458
1680 Ga0495593_0580765
1681 Ga0495602_0041761
1682 Ga0495602_0079521
1683 Ga0495626_0080779
1684 Ga0495626_0086585
1685 Ga0495626_0265455
1686 Ga0495626_0440862
1687 Ga0496100_0024942
1688 Ga0496100_0136546
1689 Ga0496100_0162938
1690 Ga0496100_0195810
1691 Ga0496101_0039486
1692 Ga0496101_0144618
1693 Ga0496101_0486195
1694 Ga0496101_1022318
1695 Ga0496102_0009024
1696 Ga0496102_0055659
1697 Ga0496102_0122969
1698 Ga0496102_0578625
1699 Ga0496102_0820907
1700 Ga0496103_0008019
1701 Ga0496103_0108221
1702 Ga0496104_0019449
1703 Ga0496104_0118130
1704 Ga0496105_0051160
1705 Ga0496105_0071336
1706 Ga0496105_0251461
1707 Ga0496106_0013794
1708 Ga0496106_0060818
1709 Ga0496106_0304043
1710 Ga0496106_0368667
1711 Ga0496107_0662470
1712 Ga0496107_0662996
1713 Ga0496108_0010323
1714 Ga0496108_1426613
1715 Ga0496109_0063835
1716 Ga0496109_0144731
1717 Ga0496110_0051010
1718 Ga0496110_0059747
1719 Ga0496110_0063887
1720 Ga0496110_1278800
1721 Ga0496111_0094126
1722 Ga0496111_0141852
1723 Ga0496111_0360530
1724 Ga0496111_0531684
1725 Ga0496112_0019585
1726 Ga0496112_0208823
1727 Ga0496112_0828511
1728 Ga0496113_0022434
1729 Ga0496113_0319151
1730 Ga0496114_0158535
1731 Ga0496114_0806954
1732 Ga0496115_0049174
1733 Ga0496115_0089419
1734 Ga0496115_1212421
1735 Ga0496115_1389667
1736 Ga0496116_0023305
1737 Ga0496116_0035341
1738 Ga0496117_0073259
1739 Ga0496117_0157185
1740 Ga0496118_0014514
1741 Ga0496118_0051163
1742 Ga0496118_0243474
1743 Ga0496118_0247536
1744 Ga0496118_0460149
1745 Ga0496119_0110215
1746 Ga0496119_0128125
1747 Ga0496119_0149059
1748 Ga0496120_0200331
1749 Ga0496120_0215725
1750 Ga0496120_0249472
1751 Ga0496120_0294662
1752 Ga0496121_0000578
1753 Ga0496121_0000754
1754 Ga0496121_0105498
1755 Ga0496121_0105737
1756 Ga0496121_0177936
1757 Ga0496121_0267734
1758 Ga0496121_0294932
1759 Ga0496123_0348248
1760 Ga0496124_0529366
1761 Ga0496125_0094839
1762 Ga0496125_0154569
1763 Ga0496126_0000602
1764 Ga0496126_0015626
1765 Ga0496126_0086022
1766 Ga0496126_0131404
1767 Ga0496126_0230712
1768 Ga0496126_0537676
1769 Ga0496126_1200776
1770 Ga0495682_0011270
1771 Ga0495682_0090695
1772 Ga0501067_0670121
1773 Ga0501068_0890160
1774 Ga0501071_0220360
1775 nmdc:mga03683_330365_c1
1776 nmdc:mga03683_350053_c1
1777 nmdc:mga03683_522089_c1
1778 nmdc:mga03n38_2830_c1
1779 nmdc:mga03n38_524_c1
1780 nmdc:mga03n38_530910_c1
1781 nmdc:mga03n38_697409_c1
1782 nmdc:mga00v17_1007302_c1
1783 nmdc:mga00v17_43533_c1
1784 nmdc:mga00v17_744662_c1
1785 nmdc:mga0yw44_1096983_c1
1786 nmdc:mga0yw44_19665_c1
1787 nmdc:mga0yw44_506098_c1
1788 nmdc:mga0yw44_59098_c1
1789 nmdc:mga0yw44_650069_c1
1790 nmdc:mga0k408_258974_c1
1791 nmdc:mga0k408_347087_c1
1792 nmdc:mga0k408_6369_c1
1793 nmdc:mga0k408_69353_c1
1794 nmdc:mga06z11_14458_c1
1795 nmdc:mga06z11_697163_c1
1796 nmdc:mga06z11_745_c1
1797 nmdc:mga06z11_88946_c1
1798 nmdc:mga06z11_975012_c1
1799 nmdc:mga04h51_136645_c1
1800 nmdc:mga04h51_17618_c1
1801 nmdc:mga04h51_24962_c1
1802 nmdc:mga04h51_29310_c1
1803 nmdc:mga07m45_1559_c1
1804 nmdc:mga07m45_236535_c1
1805 nmdc:mga07m45_9041_c1
1806 nmdc:mga0n895_591417_c1
1807 nmdc:mga0n895_889479_c1
1808 nmdc:mga0a205_1020930_c1
1809 nmdc:mga0sz30_131739_c1
1810 nmdc:mga0sz30_14734_c1
1811 nmdc:mga0sz30_163038_c1
1812 nmdc:mga0sz30_16307_c2
1813 nmdc:mga0sz30_21080_c1
1814 nmdc:mga0sz30_300763_c1
1815 nmdc:mga0sz30_31957_c1
1816 nmdc:mga0sz30_55661_c1
1817 nmdc:mga0sz30_558060_c1
1818 Ga0495601_0433616
1819 Ga0495612_0490855
1820 Ga0495655_0006061
1821 Ga0495655_0126765
1822 Ga0495655_0163108
1823 Ga0495595_0246111
1824 Ga0495595_0414064
1825 Ga0495619_0295540
1826 Ga0500578_0074745
1827 Ga0500578_0291985
1828 Ga0500643_000077
1829 Ga0500647_0411618
1830 Ga0500583_0149698
1831 Ga0500651_0027154
1832 Ga0500650_0275964
1833 Ga0500555_006933
1834 Ga0500562_201673
1835 Ga0500595_000794
1836 Ga0500595_005012
1837 Ga0500595_015486
1838 Ga0500595_022167
1839 Ga0500642_0023634
1840 Ga0500658_0110761
1841 Ga0500658_0153248
1842 Ga0500568_0021271
1843 Ga0500568_0048781
1844 Ga0500577_0074325
1845 Ga0500588_0255508
1846 Ga0500636_0004048
1847 Ga0500636_0024396
1848 Ga0500636_0083945
1849 Ga0500636_0174266
1850 Ga0500637_0056906
1851 Ga0500645_210251
1852 Ga0500601_028489
1853 Ga0500661_009438
1854 Ga0587080_096451
1855 Ga0501082_0950088
1856 2793077937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map