F486040
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 931 | 387 | 930 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300025907|Ga0207645_10142167|Ga0207645_101421672 |
| Length | 271 |
| Sequence | MDYRDRHVLVTGGTGALGAAVVGALIEAGAICHVPWRDEREAERFAYRDHGQVKLLGPIELTDEAALRQFYEGIPDLWASIHIAGGFAMSPVAKTDKAALMHLLDMNLVSCFLCCSAAVNAIARSGKGGRIVNVAARHALEWRGGAGLVAYTASKAAVAALTLALSEEVAKQDILVNAVAPSIMDTPTNRRDMPKADFDKWVKDSQLGKMDGARKGGAIVVYDFEGNAVKRYKITNAWPKSLEVTSLKAGDTSVLSEKLVLTYEKCEPESA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 8 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 140 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 159 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 160 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 245 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 247 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 280 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 281 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 340 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 343 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 344 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 345 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 346 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 347 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.21 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.04 |
| Nodule | 0 |
| Rhizoplane | 8.81 |
| Rhizosphere | 88.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214928522 | 2209111006 | Bacteria | 1347 |
| 2 | ARcpr5oldR_c000029 | 3300000041 | Bacteria | 29077 |
| 3 | ARcpr5yngRDRAFT_c000051 | 3300000043 | Bacteria | 18515 |
| 4 | ARSoilOldRDRAFT_c000078 | 3300000044 | Bacteria | 18538 |
| 5 | ARCol0yngRDRAFT_1000056 | 3300000652 | Bacteria | 20075 |
| 6 | JGI24032J14994_100417 | 3300001430 | Bacteria | 2225 |
| 7 | JGI24741J21665_1012565 | 3300001915 | Bacteria | 1451 |
| 8 | JGI24752J21851_1004120 | 3300001976 | Bacteria | 1908 |
| 9 | JGI24746J21847_1003746 | 3300001977 | Bacteria | 2402 |
| 10 | JGI24746J21847_1018892 | 3300001977 | Bacteria | 973 |
| 11 | JGI24739J22299_10003115 | 3300001989 | Bacteria | 6328 |
| 12 | JGI24739J22299_10030177 | 3300001989 | Bacteria | 1880 |
| 13 | JGI24737J22298_10000192 | 3300001990 | Bacteria | 19781 |
| 14 | JGI24737J22298_10004940 | 3300001990 | Bacteria | 4619 |
| 15 | JGI24735J21928_10013679 | 3300002067 | Bacteria | 2547 |
| 16 | JGI24750J21931_1000008 | 3300002070 | Bacteria | 23752 |
| 17 | JGI24748J21848_1003980 | 3300002074 | Bacteria | 1694 |
| 18 | JGI24748J21848_1010552 | 3300002074 | Bacteria | 1087 |
| 19 | JGI24738J21930_10000228 | 3300002075 | Bacteria | 15272 |
| 20 | JGI24738J21930_10002997 | 3300002075 | Bacteria | 4314 |
| 21 | JGI24744J21845_10013361 | 3300002077 | Bacteria | 1655 |
| 22 | JGI24035J26624_1000004 | 3300002126 | Bacteria | 15166 |
| 23 | JGI24742J22300_10000704 | 3300002244 | Bacteria | 5056 |
| 24 | JGI24742J22300_10001815 | 3300002244 | Bacteria | 3398 |
| 25 | JGI24751J29686_10002080 | 3300002459 | Bacteria | 4061 |
| 26 | JGI24751J29686_10009787 | 3300002459 | Bacteria | 1975 |
| 27 | JGI25405J52794_10013222 | 3300003911 | Bacteria | 1598 |
| 28 | Ga0058860_12244705 | 3300004801 | Unclassified | 1129 |
| 29 | Ga0065712_10072196 | 3300005290 | Bacteria | 4858 |
| 30 | Ga0065715_10093738 | 3300005293 | Bacteria | 4581 |
| 31 | Ga0070658_10148448 | 3300005327 | Bacteria | 1962 |
| 32 | Ga0070658_10394600 | 3300005327 | Bacteria | 1188 |
| 33 | Ga0070676_10000092 | 3300005328 | Bacteria | 31160 |
| 34 | Ga0070676_10002129 | 3300005328 | Bacteria | 10081 |
| 35 | Ga0070676_10047401 | 3300005328 | Bacteria | 2509 |
| 36 | Ga0070683_100000314 | 3300005329 | Bacteria | 33370 |
| 37 | Ga0070683_100891918 | 3300005329 | Bacteria | 853 |
| 38 | Ga0070690_100001103 | 3300005330 | Bacteria | 13884 |
| 39 | Ga0070690_100006642 | 3300005330 | Bacteria | 6570 |
| 40 | Ga0070690_100019192 | 3300005330 | Bacteria | 4145 |
| 41 | Ga0070690_100057438 | 3300005330 | Bacteria | 2497 |
| 42 | Ga0070690_100187886 | 3300005330 | Bacteria | 1431 |
| 43 | Ga0070670_100004057 | 3300005331 | Bacteria | 12232 |
| 44 | Ga0070670_100006325 | 3300005331 | Bacteria | 10022 |
| 45 | Ga0070670_100038299 | 3300005331 | Bacteria | 4124 |
| 46 | Ga0070670_100290917 | 3300005331 | Bacteria | 1427 |
| 47 | Ga0070677_10000577 | 3300005333 | Bacteria | 12405 |
| 48 | Ga0068869_100006201 | 3300005334 | Bacteria | 7571 |
| 49 | Ga0068869_100014379 | 3300005334 | Bacteria | 5285 |
| 50 | Ga0068869_100174207 | 3300005334 | Bacteria | 1683 |
| 51 | Ga0070666_10100706 | 3300005335 | Bacteria | 1991 |
| 52 | Ga0070666_10241792 | 3300005335 | Bacteria | 1277 |
| 53 | Ga0070680_100000515 | 3300005336 | Bacteria | 26512 |
| 54 | Ga0070680_100008159 | 3300005336 | Bacteria | 8001 |
| 55 | Ga0070680_100029392 | 3300005336 | Bacteria | 4415 |
| 56 | Ga0070680_100160758 | 3300005336 | Bacteria | 1887 |
| 57 | Ga0070680_100308185 | 3300005336 | Bacteria | 1343 |
| 58 | Ga0070682_100000230 | 3300005337 | Bacteria | 40502 |
| 59 | Ga0070682_100015639 | 3300005337 | Bacteria | 4399 |
| 60 | Ga0070682_100441284 | 3300005337 | Bacteria | 994 |
| 61 | Ga0068868_100000973 | 3300005338 | Bacteria | 19502 |
| 62 | Ga0068868_100005613 | 3300005338 | Bacteria | 8827 |
| 63 | Ga0068868_100036974 | 3300005338 | Bacteria | 3783 |
| 64 | Ga0070660_100003630 | 3300005339 | Bacteria | 10663 |
| 65 | Ga0070660_100010815 | 3300005339 | Bacteria | 6459 |
| 66 | Ga0070660_100022222 | 3300005339 | Bacteria | 4688 |
| 67 | Ga0070660_100477695 | 3300005339 | Bacteria | 1035 |
| 68 | Ga0070689_100000145 | 3300005340 | Bacteria | 40970 |
| 69 | Ga0070689_100007489 | 3300005340 | Bacteria | 7639 |
| 70 | Ga0070689_100011582 | 3300005340 | Bacteria | 6321 |
| 71 | Ga0070691_10000107 | 3300005341 | Bacteria | 24697 |
| 72 | Ga0070691_10005289 | 3300005341 | Bacteria | 5863 |
| 73 | Ga0070687_100001052 | 3300005343 | Bacteria | 9437 |
| 74 | Ga0070687_100015721 | 3300005343 | Bacteria | 3429 |
| 75 | Ga0070687_100026522 | 3300005343 | Bacteria | 2791 |
| 76 | Ga0070661_100000808 | 3300005344 | Bacteria | 22497 |
| 77 | Ga0070661_100017368 | 3300005344 | Bacteria | 5104 |
| 78 | Ga0070661_100231185 | 3300005344 | Bacteria | 1421 |
| 79 | Ga0070692_10000115 | 3300005345 | Bacteria | 18618 |
| 80 | Ga0070692_10018977 | 3300005345 | Bacteria | 3314 |
| 81 | Ga0070692_10039154 | 3300005345 | Bacteria | 2419 |
| 82 | Ga0070692_10099585 | 3300005345 | Bacteria | 1591 |
| 83 | Ga0070668_100001616 | 3300005347 | Bacteria | 16309 |
| 84 | Ga0070668_100019523 | 3300005347 | Bacteria | 5101 |
| 85 | Ga0070668_100048646 | 3300005347 | Bacteria | 3261 |
| 86 | Ga0070668_100222333 | 3300005347 | Bacteria | 1558 |
| 87 | Ga0070668_100252680 | 3300005347 | Bacteria | 1464 |
| 88 | Ga0070669_100000343 | 3300005353 | Bacteria | 36254 |
| 89 | Ga0070669_100011278 | 3300005353 | Bacteria | 6345 |
| 90 | Ga0070669_100187813 | 3300005353 | Bacteria | 1620 |
| 91 | Ga0070675_100000210 | 3300005354 | Bacteria | 37423 |
| 92 | Ga0070675_100017011 | 3300005354 | Bacteria | 5779 |
| 93 | Ga0070675_100106638 | 3300005354 | Bacteria | 2365 |
| 94 | Ga0070675_100340097 | 3300005354 | Bacteria | 1329 |
| 95 | Ga0070675_100502423 | 3300005354 | Bacteria | 1093 |
| 96 | Ga0070671_100000396 | 3300005355 | Bacteria | 29967 |
| 97 | Ga0070674_100000733 | 3300005356 | Bacteria | 16737 |
| 98 | Ga0070674_100013318 | 3300005356 | Bacteria | 5081 |
| 99 | Ga0070674_100649252 | 3300005356 | Unclassified | 897 |
| 100 | Ga0070673_100000130 | 3300005364 | Bacteria | 35440 |
| 101 | Ga0070673_100003944 | 3300005364 | Bacteria | 9322 |
| 102 | Ga0070673_100018971 | 3300005364 | Bacteria | 4930 |
| 103 | Ga0070673_100180050 | 3300005364 | Unclassified | 1809 |
| 104 | Ga0070688_100003254 | 3300005365 | Bacteria | 8321 |
| 105 | Ga0070688_100014789 | 3300005365 | Bacteria | 4427 |
| 106 | Ga0070688_100046521 | 3300005365 | Bacteria | 2687 |
| 107 | Ga0070659_100002709 | 3300005366 | Bacteria | 12594 |
| 108 | Ga0070659_100013517 | 3300005366 | Bacteria | 6078 |
| 109 | Ga0070659_100015144 | 3300005366 | Bacteria | 5768 |
| 110 | Ga0070659_100696986 | 3300005366 | Unclassified | 878 |
| 111 | Ga0070667_100001673 | 3300005367 | Bacteria | 19816 |
| 112 | Ga0070667_100013178 | 3300005367 | Bacteria | 6834 |
| 113 | Ga0070667_100043593 | 3300005367 | Bacteria | 3766 |
| 114 | Ga0070703_10001152 | 3300005406 | Bacteria | 8142 |
| 115 | Ga0070709_10006605 | 3300005434 | Bacteria | 6328 |
| 116 | Ga0070714_100027773 | 3300005435 | Bacteria | 4688 |
| 117 | Ga0070714_100191018 | 3300005435 | Bacteria | 1869 |
| 118 | Ga0070714_100992837 | 3300005435 | Bacteria | 817 |
| 119 | Ga0070713_100037677 | 3300005436 | Bacteria | 3910 |
| 120 | Ga0070713_100311927 | 3300005436 | Bacteria | 1451 |
| 121 | Ga0070713_100421322 | 3300005436 | Bacteria | 1250 |
| 122 | Ga0070710_10003341 | 3300005437 | Bacteria | 7603 |
| 123 | Ga0070710_10122089 | 3300005437 | Bacteria | 1578 |
| 124 | Ga0070701_10000012 | 3300005438 | Bacteria | 46531 |
| 125 | Ga0070701_10006970 | 3300005438 | Bacteria | 4794 |
| 126 | Ga0070701_10009117 | 3300005438 | Bacteria | 4334 |
| 127 | Ga0070711_100013443 | 3300005439 | Bacteria | 5142 |
| 128 | Ga0070711_100298801 | 3300005439 | Bacteria | 1280 |
| 129 | Ga0070705_100000341 | 3300005440 | Bacteria | 27488 |
| 130 | Ga0070705_100003401 | 3300005440 | Bacteria | 7799 |
| 131 | Ga0070705_100095309 | 3300005440 | Unclassified | 1866 |
| 132 | Ga0070700_100001057 | 3300005441 | Bacteria | 13636 |
| 133 | Ga0070700_100019859 | 3300005441 | Bacteria | 3882 |
| 134 | Ga0070700_100571608 | 3300005441 | Bacteria | 881 |
| 135 | Ga0070694_100001081 | 3300005444 | Bacteria | 15608 |
| 136 | Ga0070694_100006936 | 3300005444 | Bacteria | 6885 |
| 137 | Ga0070694_100126740 | 3300005444 | Bacteria | 1839 |
| 138 | Ga0070708_100559591 | 3300005445 | Bacteria | 1078 |
| 139 | Ga0070663_100000097 | 3300005455 | Bacteria | 39662 |
| 140 | Ga0070663_100408926 | 3300005455 | Bacteria | 1111 |
| 141 | Ga0070678_100000452 | 3300005456 | Bacteria | 19516 |
| 142 | Ga0070678_100002678 | 3300005456 | Bacteria | 9819 |
| 143 | Ga0070678_100005200 | 3300005456 | Bacteria | 7485 |
| 144 | Ga0070662_100000336 | 3300005457 | Bacteria | 28144 |
| 145 | Ga0070662_100006628 | 3300005457 | Bacteria | 7476 |
| 146 | Ga0070662_100025255 | 3300005457 | Bacteria | 4100 |
| 147 | Ga0070662_100452576 | 3300005457 | Bacteria | 1066 |
| 148 | Ga0070681_10005380 | 3300005458 | Bacteria | 12363 |
| 149 | Ga0070681_10055049 | 3300005458 | Bacteria | 3963 |
| 150 | Ga0070681_10066676 | 3300005458 | Bacteria | 3568 |
| 151 | Ga0070681_10102495 | 3300005458 | Bacteria | 2807 |
| 152 | Ga0070681_10104785 | 3300005458 | Bacteria | 2770 |
| 153 | Ga0070681_10314513 | 3300005458 | Unclassified | 1475 |
| 154 | Ga0070681_10624016 | 3300005458 | Unclassified | 993 |
| 155 | Ga0068867_100000731 | 3300005459 | Bacteria | 22005 |
| 156 | Ga0068867_100016596 | 3300005459 | Bacteria | 5230 |
| 157 | Ga0068867_100046106 | 3300005459 | Bacteria | 3200 |
| 158 | Ga0068867_100272732 | 3300005459 | Bacteria | 1384 |
| 159 | Ga0070685_10001019 | 3300005466 | Bacteria | 15068 |
| 160 | Ga0070685_10043366 | 3300005466 | Bacteria | 2571 |
| 161 | Ga0070685_10075324 | 3300005466 | Bacteria | 2010 |
| 162 | Ga0070685_10138448 | 3300005466 | Bacteria | 1529 |
| 163 | Ga0070706_100165424 | 3300005467 | Bacteria | 2065 |
| 164 | Ga0070707_100026730 | 3300005468 | Bacteria | 5482 |
| 165 | Ga0070698_100167580 | 3300005471 | Bacteria | 2138 |
| 166 | Ga0070699_100003057 | 3300005518 | Bacteria | 14839 |
| 167 | Ga0070699_100034397 | 3300005518 | Bacteria | 4379 |
| 168 | Ga0070699_100228510 | 3300005518 | Bacteria | 1659 |
| 169 | Ga0070699_100514407 | 3300005518 | Bacteria | 1088 |
| 170 | Ga0070679_100017090 | 3300005530 | Bacteria | 7013 |
| 171 | Ga0070679_100045759 | 3300005530 | Bacteria | 4360 |
| 172 | Ga0070679_100058680 | 3300005530 | Bacteria | 3835 |
| 173 | Ga0070684_100000157 | 3300005535 | Bacteria | 46152 |
| 174 | Ga0070684_100006691 | 3300005535 | Bacteria | 8934 |
| 175 | Ga0070684_100143283 | 3300005535 | Bacteria | 2162 |
| 176 | Ga0070684_100316858 | 3300005535 | Bacteria | 1432 |
| 177 | Ga0070697_100041373 | 3300005536 | Bacteria | 3730 |
| 178 | Ga0070697_100067714 | 3300005536 | Bacteria | 2921 |
| 179 | Ga0070697_100078970 | 3300005536 | Bacteria | 2709 |
| 180 | Ga0070697_100106470 | 3300005536 | Bacteria | 2333 |
| 181 | Ga0070697_100286719 | 3300005536 | Bacteria | 1413 |
| 182 | Ga0068853_100000376 | 3300005539 | Bacteria | 30625 |
| 183 | Ga0068853_100001479 | 3300005539 | Bacteria | 17079 |
| 184 | Ga0068853_100584428 | 3300005539 | Bacteria | 1060 |
| 185 | Ga0070672_100001119 | 3300005543 | Bacteria | 16354 |
| 186 | Ga0070672_100009766 | 3300005543 | Bacteria | 6627 |
| 187 | Ga0070672_100092673 | 3300005543 | Bacteria | 2439 |
| 188 | Ga0070686_100000127 | 3300005544 | Bacteria | 53295 |
| 189 | Ga0070686_100010021 | 3300005544 | Bacteria | 5335 |
| 190 | Ga0070686_100062851 | 3300005544 | Bacteria | 2403 |
| 191 | Ga0070686_100135679 | 3300005544 | Unclassified | 1707 |
| 192 | Ga0070695_100007768 | 3300005545 | Bacteria | 6354 |
| 193 | Ga0070695_100019183 | 3300005545 | Bacteria | 4161 |
| 194 | Ga0070695_100020454 | 3300005545 | Bacteria | 4042 |
| 195 | Ga0070696_100000219 | 3300005546 | Bacteria | 34543 |
| 196 | Ga0070696_100022964 | 3300005546 | Bacteria | 4242 |
| 197 | Ga0070696_100053993 | 3300005546 | Bacteria | 2799 |
| 198 | Ga0070696_100067110 | 3300005546 | Bacteria | 2517 |
| 199 | Ga0070693_100000414 | 3300005547 | Bacteria | 19333 |
| 200 | Ga0070693_100003980 | 3300005547 | Bacteria | 6937 |
| 201 | Ga0070693_100295496 | 3300005547 | Unclassified | 1090 |
| 202 | Ga0070665_100042930 | 3300005548 | Bacteria | 4545 |
| 203 | Ga0070665_100139524 | 3300005548 | Bacteria | 2428 |
| 204 | Ga0070665_100164532 | 3300005548 | Bacteria | 2221 |
| 205 | Ga0070704_100001431 | 3300005549 | Bacteria | 12748 |
| 206 | Ga0070704_100081023 | 3300005549 | Bacteria | 2389 |
| 207 | Ga0068855_100004578 | 3300005563 | Bacteria | 16892 |
| 208 | Ga0068855_100067656 | 3300005563 | Bacteria | 4160 |
| 209 | Ga0070664_100000326 | 3300005564 | Bacteria | 34609 |
| 210 | Ga0070664_100047854 | 3300005564 | Bacteria | 3614 |
| 211 | Ga0070664_100103611 | 3300005564 | Unclassified | 2477 |
| 212 | Ga0070664_100104155 | 3300005564 | Bacteria | 2470 |
| 213 | Ga0068857_100000063 | 3300005577 | Bacteria | 60089 |
| 214 | Ga0068857_100023355 | 3300005577 | Bacteria | 5443 |
| 215 | Ga0068857_100518800 | 3300005577 | Bacteria | 1120 |
| 216 | Ga0068854_100000220 | 3300005578 | Bacteria | 38637 |
| 217 | Ga0068854_100003463 | 3300005578 | Bacteria | 9852 |
| 218 | Ga0068854_100064955 | 3300005578 | Bacteria | 2652 |
| 219 | Ga0068856_100000815 | 3300005614 | Bacteria | 33600 |
| 220 | Ga0068856_100042339 | 3300005614 | Bacteria | 4479 |
| 221 | Ga0068856_100272674 | 3300005614 | Bacteria | 1708 |
| 222 | Ga0070702_100002268 | 3300005615 | Bacteria | 8227 |
| 223 | Ga0070702_100003706 | 3300005615 | Bacteria | 6887 |
| 224 | Ga0070702_100023799 | 3300005615 | Bacteria | 3259 |
| 225 | Ga0068852_100001063 | 3300005616 | Bacteria | 18125 |
| 226 | Ga0068852_100029426 | 3300005616 | Bacteria | 4512 |
| 227 | Ga0068852_100033664 | 3300005616 | Bacteria | 4257 |
| 228 | Ga0068852_100273955 | 3300005616 | Bacteria | 1625 |
| 229 | Ga0068859_100010551 | 3300005617 | Bacteria | 9301 |
| 230 | Ga0068859_100079841 | 3300005617 | Bacteria | 3312 |
| 231 | Ga0068859_100114714 | 3300005617 | Bacteria | 2758 |
| 232 | Ga0068859_100392377 | 3300005617 | Bacteria | 1484 |
| 233 | Ga0068859_100720392 | 3300005617 | Bacteria | 1088 |
| 234 | Ga0068859_100734612 | 3300005617 | Unclassified | 1077 |
| 235 | Ga0068864_100000380 | 3300005618 | Bacteria | 38785 |
| 236 | Ga0068864_100069586 | 3300005618 | Bacteria | 3060 |
| 237 | Ga0068864_100082154 | 3300005618 | Bacteria | 2826 |
| 238 | Ga0068866_10000193 | 3300005718 | Bacteria | 28522 |
| 239 | Ga0068866_10078729 | 3300005718 | Bacteria | 1764 |
| 240 | Ga0068866_10101864 | 3300005718 | Bacteria | 1586 |
| 241 | Ga0068866_10186731 | 3300005718 | Bacteria | 1228 |
| 242 | Ga0068861_100000101 | 3300005719 | Bacteria | 42384 |
| 243 | Ga0068861_100006236 | 3300005719 | Bacteria | 8111 |
| 244 | Ga0068861_100153893 | 3300005719 | Bacteria | 1889 |
| 245 | Ga0068861_100466570 | 3300005719 | Bacteria | 1134 |
| 246 | Ga0068870_10000028 | 3300005840 | Bacteria | 45368 |
| 247 | Ga0068870_10006425 | 3300005840 | Bacteria | 5181 |
| 248 | Ga0068863_100000386 | 3300005841 | Bacteria | 44817 |
| 249 | Ga0068863_100018294 | 3300005841 | Bacteria | 6709 |
| 250 | Ga0068863_100513545 | 3300005841 | Bacteria | 1181 |
| 251 | Ga0068858_100034821 | 3300005842 | Bacteria | 4670 |
| 252 | Ga0068858_100035282 | 3300005842 | Bacteria | 4639 |
| 253 | Ga0068858_100098222 | 3300005842 | Bacteria | 2730 |
| 254 | Ga0068858_100208792 | 3300005842 | Bacteria | 1848 |
| 255 | Ga0068860_100001254 | 3300005843 | Bacteria | 27668 |
| 256 | Ga0068860_100016023 | 3300005843 | Bacteria | 7312 |
| 257 | Ga0068860_100063689 | 3300005843 | Bacteria | 3501 |
| 258 | Ga0068860_100747111 | 3300005843 | Unclassified | 990 |
| 259 | Ga0068862_100002105 | 3300005844 | Bacteria | 17935 |
| 260 | Ga0068862_100004930 | 3300005844 | Bacteria | 11235 |
| 261 | Ga0068862_100031507 | 3300005844 | Bacteria | 4477 |
| 262 | Ga0068862_100343665 | 3300005844 | Bacteria | 1383 |
| 263 | Ga0081455_10003621 | 3300005937 | Bacteria | 17706 |
| 264 | Ga0081455_10013398 | 3300005937 | Bacteria | 8109 |
| 265 | Ga0081455_10025326 | 3300005937 | Bacteria | 5479 |
| 266 | Ga0081455_10095805 | 3300005937 | Bacteria | 2395 |
| 267 | Ga0081538_10055925 | 3300005981 | Bacteria | 2317 |
| 268 | Ga0081540_1037632 | 3300005983 | Bacteria | 2561 |
| 269 | Ga0081540_1116838 | 3300005983 | Bacteria | 1115 |
| 270 | Ga0070717_10195444 | 3300006028 | Bacteria | 1769 |
| 271 | Ga0070717_10235082 | 3300006028 | Bacteria | 1614 |
| 272 | Ga0075365_10042900 | 3300006038 | Bacteria | 2959 |
| 273 | Ga0075365_10436465 | 3300006038 | Unclassified | 925 |
| 274 | Ga0075364_10286056 | 3300006051 | Bacteria | 1122 |
| 275 | Ga0070715_10001242 | 3300006163 | Bacteria | 7308 |
| 276 | Ga0070715_10403016 | 3300006163 | Bacteria | 761 |
| 277 | Ga0070716_100015185 | 3300006173 | Bacteria | 3952 |
| 278 | Ga0070712_100063748 | 3300006175 | Bacteria | 2611 |
| 279 | Ga0070712_100114813 | 3300006175 | Bacteria | 2017 |
| 280 | Ga0075367_10012294 | 3300006178 | Bacteria | 4559 |
| 281 | Ga0075367_10070817 | 3300006178 | Bacteria | 2097 |
| 282 | Ga0097621_100000577 | 3300006237 | Bacteria | 25806 |
| 283 | Ga0097621_100008916 | 3300006237 | Bacteria | 7250 |
| 284 | Ga0097621_100108772 | 3300006237 | Bacteria | 2341 |
| 285 | Ga0068871_100000298 | 3300006358 | Bacteria | 34572 |
| 286 | Ga0068871_100222881 | 3300006358 | Bacteria | 1634 |
| 287 | Ga0075428_100054716 | 3300006844 | Bacteria | 4373 |
| 288 | Ga0075428_100061750 | 3300006844 | Bacteria | 4104 |
| 289 | Ga0075428_100079781 | 3300006844 | Bacteria | 3572 |
| 290 | Ga0075428_100476022 | 3300006844 | Bacteria | 1337 |
| 291 | Ga0075428_100502510 | 3300006844 | Bacteria | 1297 |
| 292 | Ga0075430_100253888 | 3300006846 | Bacteria | 1457 |
| 293 | Ga0075430_100466794 | 3300006846 | Bacteria | 1042 |
| 294 | Ga0075430_100755967 | 3300006846 | Bacteria | 801 |
| 295 | Ga0075431_100149005 | 3300006847 | Bacteria | 2410 |
| 296 | Ga0075431_100181948 | 3300006847 | Bacteria | 2157 |
| 297 | Ga0075431_100239256 | 3300006847 | Bacteria | 1847 |
| 298 | Ga0075431_100239673 | 3300006847 | Bacteria | 1845 |
| 299 | Ga0075431_100316153 | 3300006847 | Bacteria | 1575 |
| 300 | Ga0075433_10008685 | 3300006852 | Bacteria | 8105 |
| 301 | Ga0075433_10141955 | 3300006852 | Bacteria | 2134 |
| 302 | Ga0075433_10220248 | 3300006852 | Bacteria | 1686 |
| 303 | Ga0075434_100018218 | 3300006871 | Bacteria | 6781 |
| 304 | Ga0075434_100021970 | 3300006871 | Bacteria | 6210 |
| 305 | Ga0075434_100073924 | 3300006871 | Bacteria | 3402 |
| 306 | Ga0075434_100355260 | 3300006871 | Unclassified | 1486 |
| 307 | Ga0075434_100428612 | 3300006871 | Unclassified | 1344 |
| 308 | Ga0075434_100968539 | 3300006871 | Unclassified | 865 |
| 309 | Ga0075429_100108978 | 3300006880 | Bacteria | 2421 |
| 310 | Ga0075429_100610307 | 3300006880 | Bacteria | 956 |
| 311 | Ga0068865_100000125 | 3300006881 | Bacteria | 39482 |
| 312 | Ga0068865_100006959 | 3300006881 | Bacteria | 6937 |
| 313 | Ga0075436_100153735 | 3300006914 | Bacteria | 1620 |
| 314 | Ga0075436_100190218 | 3300006914 | Bacteria | 1452 |
| 315 | Ga0075436_100334652 | 3300006914 | Bacteria | 1089 |
| 316 | Ga0097620_100010551 | 3300006931 | Bacteria | 9301 |
| 317 | Ga0097620_100079842 | 3300006931 | Bacteria | 3312 |
| 318 | Ga0097620_100114715 | 3300006931 | Bacteria | 2758 |
| 319 | Ga0097620_100392386 | 3300006931 | Bacteria | 1484 |
| 320 | Ga0097620_100720265 | 3300006931 | Bacteria | 1088 |
| 321 | Ga0097620_100734654 | 3300006931 | Unclassified | 1077 |
| 322 | Ga0075435_100167850 | 3300007076 | Bacteria | 1851 |
| 323 | Ga0075435_100179244 | 3300007076 | Bacteria | 1790 |
| 324 | Ga0075435_100213279 | 3300007076 | Bacteria | 1638 |
| 325 | Ga0075435_100291542 | 3300007076 | Unclassified | 1394 |
| 326 | Ga0105251_10021088 | 3300009011 | Bacteria | 3409 |
| 327 | Ga0105251_10135476 | 3300009011 | Bacteria | 1115 |
| 328 | Ga0105244_10246773 | 3300009036 | Bacteria | 833 |
| 329 | Ga0105250_10038616 | 3300009092 | Bacteria | 1914 |
| 330 | Ga0105250_10106985 | 3300009092 | Bacteria | 1144 |
| 331 | Ga0105240_10014048 | 3300009093 | Bacteria | 10952 |
| 332 | Ga0111539_10000548 | 3300009094 | Bacteria | 47926 |
| 333 | Ga0111539_10007739 | 3300009094 | Bacteria | 13721 |
| 334 | Ga0111539_10088301 | 3300009094 | Bacteria | 3643 |
| 335 | Ga0111539_10166482 | 3300009094 | Bacteria | 2577 |
| 336 | Ga0111539_10190904 | 3300009094 | Bacteria | 2390 |
| 337 | Ga0111539_10549428 | 3300009094 | Bacteria | 1345 |
| 338 | Ga0111539_11012060 | 3300009094 | Bacteria | 966 |
| 339 | Ga0105245_10000173 | 3300009098 | Bacteria | 61528 |
| 340 | Ga0105245_10375635 | 3300009098 | Bacteria | 1414 |
| 341 | Ga0105245_10713630 | 3300009098 | Bacteria | 1037 |
| 342 | Ga0105247_10002800 | 3300009101 | Bacteria | 11662 |
| 343 | Ga0105247_10007920 | 3300009101 | Bacteria | 6496 |
| 344 | Ga0105247_10029012 | 3300009101 | Bacteria | 3350 |
| 345 | Ga0105247_10050052 | 3300009101 | Unclassified | 2570 |
| 346 | Ga0114129_10003643 | 3300009147 | Bacteria | 21672 |
| 347 | Ga0114129_11362965 | 3300009147 | Bacteria | 877 |
| 348 | Ga0105243_10000377 | 3300009148 | Bacteria | 47825 |
| 349 | Ga0105243_10017817 | 3300009148 | Bacteria | 5374 |
| 350 | Ga0105243_10120108 | 3300009148 | Bacteria | 2214 |
| 351 | Ga0105243_10254143 | 3300009148 | Bacteria | 1570 |
| 352 | Ga0105241_10001249 | 3300009174 | Bacteria | 19401 |
| 353 | Ga0105241_10010359 | 3300009174 | Bacteria | 6843 |
| 354 | Ga0105242_10000419 | 3300009176 | Bacteria | 33812 |
| 355 | Ga0105242_10599018 | 3300009176 | Bacteria | 1064 |
| 356 | Ga0105248_10000643 | 3300009177 | Bacteria | 39655 |
| 357 | Ga0105248_10008602 | 3300009177 | Bacteria | 11211 |
| 358 | Ga0105248_10080754 | 3300009177 | Bacteria | 3655 |
| 359 | Ga0105248_10094904 | 3300009177 | Bacteria | 3358 |
| 360 | Ga0105237_10007697 | 3300009545 | Bacteria | 11768 |
| 361 | Ga0105237_10021014 | 3300009545 | Bacteria | 6718 |
| 362 | Ga0105237_10031168 | 3300009545 | Bacteria | 5409 |
| 363 | Ga0105237_10291831 | 3300009545 | Bacteria | 1634 |
| 364 | Ga0105237_10401229 | 3300009545 | Bacteria | 1376 |
| 365 | Ga0105238_10046148 | 3300009551 | Bacteria | 4398 |
| 366 | Ga0105238_10065646 | 3300009551 | Bacteria | 3631 |
| 367 | Ga0105249_10006636 | 3300009553 | Bacteria | 10070 |
| 368 | Ga0105249_10016803 | 3300009553 | Bacteria | 6493 |
| 369 | Ga0105249_10017441 | 3300009553 | Bacteria | 6373 |
| 370 | Ga0105249_10361965 | 3300009553 | Bacteria | 1472 |
| 371 | Ga0099796_10055339 | 3300010159 | Bacteria | 1389 |
| 372 | Ga0105239_10009309 | 3300010375 | Bacteria | 11101 |
| 373 | Ga0105239_10018417 | 3300010375 | Bacteria | 7715 |
| 374 | Ga0105239_10058349 | 3300010375 | Bacteria | 4235 |
| 375 | Ga0105239_10852918 | 3300010375 | Bacteria | 1045 |
| 376 | Ga0105246_10000819 | 3300011119 | Bacteria | 17695 |
| 377 | Ga0105246_10020654 | 3300011119 | Bacteria | 4227 |
| 378 | Ga0105246_10285247 | 3300011119 | Bacteria | 1326 |
| 379 | Ga0105246_10289894 | 3300011119 | Unclassified | 1316 |
| 380 | Ga0157326_1021439 | 3300012513 | Bacteria | 801 |
| 381 | Ga0157338_1000385 | 3300012515 | Bacteria | 2512 |
| 382 | Ga0157373_10003113 | 3300013100 | Bacteria | 12536 |
| 383 | Ga0157373_10025646 | 3300013100 | Bacteria | 4262 |
| 384 | Ga0157373_10163244 | 3300013100 | Bacteria | 1567 |
| 385 | Ga0157371_10007096 | 3300013102 | Bacteria | 9107 |
| 386 | Ga0157371_10072538 | 3300013102 | Bacteria | 2438 |
| 387 | Ga0157370_10139565 | 3300013104 | Bacteria | 2258 |
| 388 | Ga0157369_10002471 | 3300013105 | Bacteria | 22151 |
| 389 | Ga0157369_10357613 | 3300013105 | Bacteria | 1516 |
| 390 | Ga0157374_10004172 | 3300013296 | Bacteria | 12134 |
| 391 | Ga0157374_10041948 | 3300013296 | Bacteria | 4219 |
| 392 | Ga0157378_10000993 | 3300013297 | Bacteria | 25998 |
| 393 | Ga0157378_10018527 | 3300013297 | Bacteria | 6119 |
| 394 | Ga0157378_10127919 | 3300013297 | Bacteria | 2348 |
| 395 | Ga0157378_10134727 | 3300013297 | Bacteria | 2289 |
| 396 | Ga0157378_10256495 | 3300013297 | Bacteria | 1676 |
| 397 | Ga0163162_10001508 | 3300013306 | Bacteria | 21697 |
| 398 | Ga0163162_10021249 | 3300013306 | Bacteria | 6388 |
| 399 | Ga0163162_10026452 | 3300013306 | Bacteria | 5733 |
| 400 | Ga0157372_10008930 | 3300013307 | Bacteria | 10651 |
| 401 | Ga0157372_10024481 | 3300013307 | Bacteria | 6559 |
| 402 | Ga0157372_10380283 | 3300013307 | Bacteria | 1645 |
| 403 | Ga0157375_10000283 | 3300013308 | Bacteria | 46225 |
| 404 | Ga0157375_10017827 | 3300013308 | Bacteria | 6422 |
| 405 | Ga0157375_10076749 | 3300013308 | Bacteria | 3369 |
| 406 | Ga0157375_10305601 | 3300013308 | Bacteria | 1755 |
| 407 | Ga0157375_11505486 | 3300013308 | Unclassified | 794 |
| 408 | Ga0163163_10000757 | 3300014325 | Bacteria | 27476 |
| 409 | Ga0163163_10018211 | 3300014325 | Bacteria | 6569 |
| 410 | Ga0163163_10094798 | 3300014325 | Bacteria | 3003 |
| 411 | Ga0163163_10099847 | 3300014325 | Bacteria | 2924 |
| 412 | Ga0157380_10000095 | 3300014326 | Bacteria | 48588 |
| 413 | Ga0157380_10009789 | 3300014326 | Bacteria | 6883 |
| 414 | Ga0182008_10043993 | 3300014497 | Bacteria | 2222 |
| 415 | Ga0157377_10001144 | 3300014745 | Bacteria | 11253 |
| 416 | Ga0157377_10006484 | 3300014745 | Bacteria | 5587 |
| 417 | Ga0157379_10009736 | 3300014968 | Bacteria | 8373 |
| 418 | Ga0157379_10016635 | 3300014968 | Bacteria | 6467 |
| 419 | Ga0157379_10079062 | 3300014968 | Bacteria | 2946 |
| 420 | Ga0157376_10000634 | 3300014969 | Bacteria | 22779 |
| 421 | Ga0157376_10010367 | 3300014969 | Bacteria | 6812 |
| 422 | Ga0163161_10001324 | 3300017792 | Bacteria | 18424 |
| 423 | Ga0163161_10013788 | 3300017792 | Bacteria | 5628 |
| 424 | Ga0163161_10237339 | 3300017792 | Bacteria | 1417 |
| 425 | Ga0206353_10213769 | 3300020082 | Bacteria | 1117 |
| 426 | Ga0213872_10042183 | 3300021361 | Bacteria | 2081 |
| 427 | Ga0213876_10056585 | 3300021384 | Bacteria | 2070 |
| 428 | Ga0207666_1000045 | 3300025271 | Bacteria | 24475 |
| 429 | Ga0207673_1000048 | 3300025290 | Bacteria | 9798 |
| 430 | Ga0207697_10000551 | 3300025315 | Bacteria | 21235 |
| 431 | Ga0207697_10154966 | 3300025315 | Bacteria | 998 |
| 432 | Ga0207656_10130556 | 3300025321 | Unclassified | 1177 |
| 433 | Ga0207696_1016412 | 3300025711 | Bacteria | 2477 |
| 434 | Ga0207653_10003534 | 3300025885 | Bacteria | 4924 |
| 435 | Ga0207653_10038925 | 3300025885 | Bacteria | 1555 |
| 436 | Ga0207682_10000065 | 3300025893 | Bacteria | 46642 |
| 437 | Ga0207642_10227563 | 3300025899 | Bacteria | 1046 |
| 438 | Ga0207710_10002620 | 3300025900 | Bacteria | 8298 |
| 439 | Ga0207710_10003935 | 3300025900 | Bacteria | 6553 |
| 440 | Ga0207688_10000039 | 3300025901 | Bacteria | 44849 |
| 441 | Ga0207688_10007776 | 3300025901 | Bacteria | 5833 |
| 442 | Ga0207688_10008435 | 3300025901 | Bacteria | 5604 |
| 443 | Ga0207688_10052345 | 3300025901 | Bacteria | 2287 |
| 444 | Ga0207680_10010818 | 3300025903 | Bacteria | 4581 |
| 445 | Ga0207680_10042017 | 3300025903 | Bacteria | 2672 |
| 446 | Ga0207680_10139870 | 3300025903 | Unclassified | 1604 |
| 447 | Ga0207647_10001204 | 3300025904 | Bacteria | 19906 |
| 448 | Ga0207647_10014680 | 3300025904 | Bacteria | 5395 |
| 449 | Ga0207647_10024058 | 3300025904 | Bacteria | 4018 |
| 450 | Ga0207647_10029533 | 3300025904 | Bacteria | 3547 |
| 451 | Ga0207685_10003251 | 3300025905 | Bacteria | 3919 |
| 452 | Ga0207645_10000080 | 3300025907 | Bacteria | 68968 |
| 453 | Ga0207645_10007301 | 3300025907 | Bacteria | 7815 |
| 454 | Ga0207645_10044077 | 3300025907 | Bacteria | 2855 |
| 455 | Ga0207645_10056961 | 3300025907 | Bacteria | 2495 |
| 456 | Ga0207645_10142167 | 3300025907 | Bacteria | 1564 |
| 457 | Ga0207643_10000135 | 3300025908 | Bacteria | 49853 |
| 458 | Ga0207643_10001337 | 3300025908 | Bacteria | 14257 |
| 459 | Ga0207705_10051854 | 3300025909 | Bacteria | 2953 |
| 460 | Ga0207684_10021159 | 3300025910 | Bacteria | 5553 |
| 461 | Ga0207684_10169158 | 3300025910 | Bacteria | 1884 |
| 462 | Ga0207684_10170271 | 3300025910 | Bacteria | 1877 |
| 463 | Ga0207684_10553354 | 3300025910 | Unclassified | 984 |
| 464 | Ga0207654_10005870 | 3300025911 | Bacteria | 6187 |
| 465 | Ga0207654_10007959 | 3300025911 | Bacteria | 5344 |
| 466 | Ga0207707_10002157 | 3300025912 | Bacteria | 17788 |
| 467 | Ga0207707_10042863 | 3300025912 | Bacteria | 3949 |
| 468 | Ga0207707_10195623 | 3300025912 | Bacteria | 1764 |
| 469 | Ga0207707_10205781 | 3300025912 | Bacteria | 1715 |
| 470 | Ga0207707_10278001 | 3300025912 | Bacteria | 1450 |
| 471 | Ga0207707_10404492 | 3300025912 | Unclassified | 1172 |
| 472 | Ga0207695_10185434 | 3300025913 | Bacteria | 2000 |
| 473 | Ga0207671_10003900 | 3300025914 | Bacteria | 14541 |
| 474 | Ga0207671_10031657 | 3300025914 | Bacteria | 3942 |
| 475 | Ga0207671_10091047 | 3300025914 | Bacteria | 2298 |
| 476 | Ga0207693_10010373 | 3300025915 | Bacteria | 7562 |
| 477 | Ga0207693_10028298 | 3300025915 | Bacteria | 4428 |
| 478 | Ga0207693_10060332 | 3300025915 | Bacteria | 2971 |
| 479 | Ga0207693_10175100 | 3300025915 | Bacteria | 1689 |
| 480 | Ga0207663_10005810 | 3300025916 | Bacteria | 6252 |
| 481 | Ga0207660_10002445 | 3300025917 | Bacteria | 12199 |
| 482 | Ga0207660_10011111 | 3300025917 | Bacteria | 5853 |
| 483 | Ga0207660_10095630 | 3300025917 | Bacteria | 2210 |
| 484 | Ga0207660_10256790 | 3300025917 | Bacteria | 1381 |
| 485 | Ga0207660_10343904 | 3300025917 | Bacteria | 1194 |
| 486 | Ga0207662_10000336 | 3300025918 | Bacteria | 21233 |
| 487 | Ga0207662_10008664 | 3300025918 | Bacteria | 5579 |
| 488 | Ga0207662_10035336 | 3300025918 | Bacteria | 2919 |
| 489 | Ga0207657_10000186 | 3300025919 | Bacteria | 64342 |
| 490 | Ga0207657_10002336 | 3300025919 | Bacteria | 20569 |
| 491 | Ga0207657_10017486 | 3300025919 | Bacteria | 6872 |
| 492 | Ga0207657_10075800 | 3300025919 | Bacteria | 2838 |
| 493 | Ga0207649_10000571 | 3300025920 | Bacteria | 25261 |
| 494 | Ga0207649_10011692 | 3300025920 | Bacteria | 4849 |
| 495 | Ga0207652_10001096 | 3300025921 | Bacteria | 24512 |
| 496 | Ga0207652_10039714 | 3300025921 | Bacteria | 3994 |
| 497 | Ga0207652_10097434 | 3300025921 | Bacteria | 2592 |
| 498 | Ga0207646_10065570 | 3300025922 | Bacteria | 3243 |
| 499 | Ga0207646_10098788 | 3300025922 | Bacteria | 2616 |
| 500 | Ga0207681_10011812 | 3300025923 | Bacteria | 5373 |
| 501 | Ga0207681_10032843 | 3300025923 | Bacteria | 3400 |
| 502 | Ga0207694_10288847 | 3300025924 | Bacteria | 1348 |
| 503 | Ga0207694_10418040 | 3300025924 | Bacteria | 1117 |
| 504 | Ga0207650_10028311 | 3300025925 | Bacteria | 4016 |
| 505 | Ga0207650_10044073 | 3300025925 | Bacteria | 3277 |
| 506 | Ga0207650_10100950 | 3300025925 | Bacteria | 2221 |
| 507 | Ga0207650_10117429 | 3300025925 | Bacteria | 2067 |
| 508 | Ga0207650_10180325 | 3300025925 | Bacteria | 1683 |
| 509 | Ga0207650_10447848 | 3300025925 | Bacteria | 1074 |
| 510 | Ga0207659_10000127 | 3300025926 | Bacteria | 44761 |
| 511 | Ga0207659_10042756 | 3300025926 | Bacteria | 3178 |
| 512 | Ga0207687_10000334 | 3300025927 | Bacteria | 31485 |
| 513 | Ga0207687_10333703 | 3300025927 | Bacteria | 1231 |
| 514 | Ga0207700_10410430 | 3300025928 | Bacteria | 1188 |
| 515 | Ga0207644_10002918 | 3300025931 | Bacteria | 11013 |
| 516 | Ga0207644_10010543 | 3300025931 | Bacteria | 6092 |
| 517 | Ga0207644_10075355 | 3300025931 | Bacteria | 2479 |
| 518 | Ga0207690_10003358 | 3300025932 | Bacteria | 9570 |
| 519 | Ga0207690_10018543 | 3300025932 | Bacteria | 4268 |
| 520 | Ga0207690_10071987 | 3300025932 | Bacteria | 2386 |
| 521 | Ga0207690_10322211 | 3300025932 | Bacteria | 1215 |
| 522 | Ga0207690_10617743 | 3300025932 | Unclassified | 886 |
| 523 | Ga0207706_10001765 | 3300025933 | Bacteria | 21233 |
| 524 | Ga0207706_10014913 | 3300025933 | Bacteria | 7038 |
| 525 | Ga0207706_10017451 | 3300025933 | Bacteria | 6467 |
| 526 | Ga0207706_10018586 | 3300025933 | Bacteria | 6254 |
| 527 | Ga0207686_10000297 | 3300025934 | Bacteria | 36292 |
| 528 | Ga0207686_10034591 | 3300025934 | Bacteria | 3025 |
| 529 | Ga0207686_10178954 | 3300025934 | Bacteria | 1502 |
| 530 | Ga0207709_10000257 | 3300025935 | Bacteria | 63623 |
| 531 | Ga0207709_10004698 | 3300025935 | Bacteria | 7855 |
| 532 | Ga0207709_10075527 | 3300025935 | Bacteria | 2154 |
| 533 | Ga0207709_10349118 | 3300025935 | Bacteria | 1116 |
| 534 | Ga0207670_10000371 | 3300025936 | Bacteria | 25929 |
| 535 | Ga0207670_10020974 | 3300025936 | Bacteria | 4023 |
| 536 | Ga0207670_10028654 | 3300025936 | Bacteria | 3539 |
| 537 | Ga0207669_10000089 | 3300025937 | Bacteria | 46184 |
| 538 | Ga0207669_10112928 | 3300025937 | Bacteria | 1825 |
| 539 | Ga0207704_10000355 | 3300025938 | Bacteria | 21359 |
| 540 | Ga0207704_10261411 | 3300025938 | Bacteria | 1305 |
| 541 | Ga0207665_10000186 | 3300025939 | Bacteria | 41649 |
| 542 | Ga0207665_10049910 | 3300025939 | Bacteria | 2813 |
| 543 | Ga0207691_10001737 | 3300025940 | Bacteria | 21481 |
| 544 | Ga0207691_10028104 | 3300025940 | Bacteria | 5268 |
| 545 | Ga0207691_10057591 | 3300025940 | Bacteria | 3536 |
| 546 | Ga0207711_10118481 | 3300025941 | Bacteria | 2362 |
| 547 | Ga0207711_10141145 | 3300025941 | Bacteria | 2167 |
| 548 | Ga0207689_10000095 | 3300025942 | Bacteria | 71568 |
| 549 | Ga0207689_10014632 | 3300025942 | Bacteria | 6666 |
| 550 | Ga0207661_10000366 | 3300025944 | Bacteria | 29023 |
| 551 | Ga0207679_10000073 | 3300025945 | Bacteria | 89687 |
| 552 | Ga0207679_10009670 | 3300025945 | Bacteria | 6181 |
| 553 | Ga0207679_10059275 | 3300025945 | Bacteria | 2839 |
| 554 | Ga0207679_10267382 | 3300025945 | Bacteria | 1461 |
| 555 | Ga0207679_10806791 | 3300025945 | Bacteria | 856 |
| 556 | Ga0207667_10010897 | 3300025949 | Bacteria | 10598 |
| 557 | Ga0207667_10046869 | 3300025949 | Bacteria | 4577 |
| 558 | Ga0207667_10547570 | 3300025949 | Bacteria | 1170 |
| 559 | Ga0207651_10001109 | 3300025960 | Bacteria | 11982 |
| 560 | Ga0207651_10016924 | 3300025960 | Bacteria | 4290 |
| 561 | Ga0207712_10000457 | 3300025961 | Bacteria | 34730 |
| 562 | Ga0207712_10012149 | 3300025961 | Bacteria | 5503 |
| 563 | Ga0207668_10000971 | 3300025972 | Bacteria | 17231 |
| 564 | Ga0207668_10035080 | 3300025972 | Bacteria | 3336 |
| 565 | Ga0207640_10001226 | 3300025981 | Bacteria | 13970 |
| 566 | Ga0207640_10025655 | 3300025981 | Bacteria | 3570 |
| 567 | Ga0207658_10003961 | 3300025986 | Bacteria | 10399 |
| 568 | Ga0207658_10016145 | 3300025986 | Bacteria | 5131 |
| 569 | Ga0207658_10043934 | 3300025986 | Bacteria | 3251 |
| 570 | Ga0207658_10748777 | 3300025986 | Bacteria | 885 |
| 571 | Ga0207677_10009833 | 3300026023 | Bacteria | 5390 |
| 572 | Ga0207677_10063120 | 3300026023 | Bacteria | 2573 |
| 573 | Ga0207703_10005066 | 3300026035 | Bacteria | 10666 |
| 574 | Ga0207703_10054180 | 3300026035 | Bacteria | 3261 |
| 575 | Ga0207703_10983607 | 3300026035 | Bacteria | 809 |
| 576 | Ga0207639_10018364 | 3300026041 | Bacteria | 4969 |
| 577 | Ga0207639_10134191 | 3300026041 | Bacteria | 2053 |
| 578 | Ga0207678_10000426 | 3300026067 | Bacteria | 38181 |
| 579 | Ga0207678_10012836 | 3300026067 | Bacteria | 7355 |
| 580 | Ga0207678_10020810 | 3300026067 | Bacteria | 5750 |
| 581 | Ga0207708_10000624 | 3300026075 | Bacteria | 27228 |
| 582 | Ga0207708_10000991 | 3300026075 | Bacteria | 21233 |
| 583 | Ga0207708_10033947 | 3300026075 | Bacteria | 3880 |
| 584 | Ga0207708_10034414 | 3300026075 | Bacteria | 3854 |
| 585 | Ga0207708_10275336 | 3300026075 | Bacteria | 1362 |
| 586 | Ga0207708_10559252 | 3300026075 | Bacteria | 965 |
| 587 | Ga0207702_10008786 | 3300026078 | Bacteria | 8514 |
| 588 | Ga0207702_10095493 | 3300026078 | Bacteria | 2612 |
| 589 | Ga0207641_10001067 | 3300026088 | Bacteria | 27627 |
| 590 | Ga0207641_10024810 | 3300026088 | Bacteria | 4942 |
| 591 | Ga0207641_10033009 | 3300026088 | Bacteria | 4300 |
| 592 | Ga0207648_10000207 | 3300026089 | Bacteria | 62972 |
| 593 | Ga0207648_10001430 | 3300026089 | Bacteria | 26279 |
| 594 | Ga0207648_10051427 | 3300026089 | Bacteria | 3601 |
| 595 | Ga0207676_10000875 | 3300026095 | Bacteria | 23361 |
| 596 | Ga0207676_10007995 | 3300026095 | Bacteria | 7518 |
| 597 | Ga0207676_10067109 | 3300026095 | Bacteria | 2864 |
| 598 | Ga0207676_10152114 | 3300026095 | Bacteria | 1994 |
| 599 | Ga0207674_10001021 | 3300026116 | Bacteria | 36545 |
| 600 | Ga0207674_10032377 | 3300026116 | Bacteria | 5485 |
| 601 | Ga0207674_10519549 | 3300026116 | Bacteria | 1150 |
| 602 | Ga0207675_100000447 | 3300026118 | Bacteria | 40184 |
| 603 | Ga0207675_100001849 | 3300026118 | Bacteria | 21247 |
| 604 | Ga0207675_100008098 | 3300026118 | Bacteria | 9902 |
| 605 | Ga0207675_100150332 | 3300026118 | Bacteria | 2216 |
| 606 | Ga0207675_100494770 | 3300026118 | Bacteria | 1216 |
| 607 | Ga0207683_10000096 | 3300026121 | Bacteria | 71829 |
| 608 | Ga0207683_10013771 | 3300026121 | Bacteria | 6896 |
| 609 | Ga0207683_10046039 | 3300026121 | Bacteria | 3816 |
| 610 | Ga0207683_10284271 | 3300026121 | Bacteria | 1512 |
| 611 | Ga0207698_10002278 | 3300026142 | Bacteria | 11362 |
| 612 | Ga0207698_10452124 | 3300026142 | Bacteria | 1240 |
| 613 | Ga0209179_1007258 | 3300027512 | Bacteria | 1824 |
| 614 | Ga0209966_1002326 | 3300027695 | Bacteria | 3173 |
| 615 | Ga0209998_10001024 | 3300027717 | Bacteria | 7042 |
| 616 | Ga0209998_10001533 | 3300027717 | Bacteria | 5552 |
| 617 | Ga0209974_10001855 | 3300027876 | Bacteria | 7711 |
| 618 | Ga0207428_10000160 | 3300027907 | Bacteria | 92379 |
| 619 | Ga0207428_10014000 | 3300027907 | Bacteria | 6986 |
| 620 | Ga0207428_10061624 | 3300027907 | Bacteria | 2969 |
| 621 | Ga0268266_10082872 | 3300028379 | Bacteria | 2798 |
| 622 | Ga0268266_10181263 | 3300028379 | Bacteria | 1918 |
| 623 | Ga0268265_10003071 | 3300028380 | Bacteria | 12178 |
| 624 | Ga0268265_10061051 | 3300028380 | Bacteria | 2891 |
| 625 | Ga0268264_10002954 | 3300028381 | Bacteria | 14771 |
| 626 | Ga0268264_10032764 | 3300028381 | Bacteria | 4264 |
| 627 | Ga0268264_10089680 | 3300028381 | Bacteria | 2648 |
| 628 | Ga0268264_10119697 | 3300028381 | Bacteria | 2319 |
| 629 | Ga0268264_10556571 | 3300028381 | Bacteria | 1125 |
| 630 | Ga0265318_10075108 | 3300028577 | Bacteria | 1251 |
| 631 | Ga0265325_10003848 | 3300031241 | Bacteria | 9645 |
| 632 | Ga0265316_10296434 | 3300031344 | Bacteria | 1179 |
| 633 | Ga0307513_10103448 | 3300031456 | Bacteria | 2864 |
| 634 | Ga0265313_10000524 | 3300031595 | Bacteria | 40120 |
| 635 | Ga0265313_10076822 | 3300031595 | Bacteria | 1525 |
| 636 | Ga0265314_10001524 | 3300031711 | Bacteria | 25572 |
| 637 | Ga0373930_0000578 | 3300034816 | Bacteria | 5067 |
| 638 | Ga0373948_0009148 | 3300034817 | Bacteria | 1703 |
| 639 | Ga0373958_0001030 | 3300034819 | Bacteria | 3637 |
| 640 | Ga0373959_0004468 | 3300034820 | Bacteria | 2256 |
| 641 | Ga0373959_0009786 | 3300034820 | Bacteria | 1662 |
| 642 | Ga0373938_0000028 | 3300034957 | Bacteria | 18996 |
| 643 | Ga0373938_0000033 | 3300034957 | Bacteria | 17806 |
| 644 | Ga0373928_0019501 | 3300035084 | Bacteria | 1415 |
| 645 | Ga0373928_0030401 | 3300035084 | Bacteria | 1193 |
| 646 | Ga0373929_0025611 | 3300035085 | Bacteria | 1226 |
| 647 | Ga0373940_0010637 | 3300035088 | Bacteria | 2169 |
| 648 | Ga0373940_0020740 | 3300035088 | Bacteria | 1672 |
| 649 | Ga0373949_0003081 | 3300035090 | Bacteria | 4072 |
| 650 | Ga0373951_0000666 | 3300035091 | Bacteria | 9448 |
| 651 | Ga0373951_0004442 | 3300035091 | Bacteria | 3332 |
| 652 | Ga0373952_0006012 | 3300035092 | Bacteria | 2236 |
| 653 | Ga0373932_0000749 | 3300035112 | Bacteria | 9676 |
| 654 | Ga0373932_0000983 | 3300035112 | Bacteria | 8260 |
| 655 | Ga0373936_0107817 | 3300035113 | Bacteria | 1180 |
| 656 | Ga0373939_0000342 | 3300035114 | Bacteria | 11883 |
| 657 | Ga0373953_0002640 | 3300035117 | Bacteria | 5428 |
| 658 | Ga0373954_0003770 | 3300035118 | Bacteria | 6465 |
| 659 | Ga0373960_0000100 | 3300035121 | Bacteria | 13629 |
| 660 | Ga0373946_0005589 | 3300035171 | Bacteria | 4538 |
| 661 | Ga0373946_0053840 | 3300035171 | Bacteria | 1691 |
| 662 | Ga0373946_0311760 | 3300035171 | Unclassified | 780 |
| 663 | Ga0373955_0002025 | 3300035172 | Bacteria | 8719 |
| 664 | Ga0373942_0002640 | 3300035207 | Bacteria | 4310 |
| 665 | Ga0373942_0023984 | 3300035207 | Bacteria | 1561 |
| 666 | Ga0373961_0042708 | 3300035241 | Bacteria | 1315 |
| 667 | Ga0373962_0000272 | 3300035242 | Bacteria | 11145 |
| 668 | Ga0373962_0000881 | 3300035242 | Bacteria | 6853 |
| 669 | Ga0373962_0077043 | 3300035242 | Bacteria | 1006 |
| 670 | Ga0373962_0101582 | 3300035242 | Bacteria | 898 |
| 671 | Ga0373931_0001372 | 3300035691 | Bacteria | 10411 |
| 672 | Ga0373931_0106010 | 3300035691 | Bacteria | 1588 |
| 673 | Ga0373931_0178320 | 3300035691 | Bacteria | 1257 |
| 674 | Ga0373935_0000179 | 3300035692 | Bacteria | 29705 |
| 675 | Ga0373927_0118199 | 3300035695 | Bacteria | 1729 |
| 676 | Ga0373927_0147978 | 3300035695 | Bacteria | 1538 |
| 677 | Ga0373933_0002450 | 3300035724 | Bacteria | 10444 |
| 678 | Ga0373947_0382683 | 3300035725 | Bacteria | 947 |
| 679 | Ga0373937_0000864 | 3300036401 | Bacteria | 26035 |
| 680 | Ga0373937_0172623 | 3300036401 | Bacteria | 2029 |
| 681 | Ga0373925_0000639 | 3300037068 | Bacteria | 32946 |
| 682 | Ga0373925_0004022 | 3300037068 | Bacteria | 11180 |
| 683 | Ga0373925_0197594 | 3300037068 | Bacteria | 1598 |
| 684 | Ga0395899_0368606 | 3300037312 | Bacteria | 957 |
| 685 | Ga0395900_0017207 | 3300037418 | Bacteria | 7378 |
| 686 | Ga0395898_0011333 | 3300037466 | Bacteria | 9268 |
| 687 | Ga0395898_0660310 | 3300037466 | Bacteria | 988 |
| 688 | Ga0395905_0002399 | 3300037471 | Bacteria | 20844 |
| 689 | Ga0395905_0112548 | 3300037471 | Bacteria | 2557 |
| 690 | Ga0436365_1134850 | 3300039437 | Bacteria | 1317 |
| 691 | Ga0436365_1428872 | 3300039437 | Bacteria | 13961 |
| 692 | Ga0436361_0166397 | 3300039447 | Bacteria | 45243 |
| 693 | Ga0439455_0022300 | 3300042012 | Bacteria | 1517 |
| 694 | Ga0451577_0363956 | 3300042876 | Bacteria | 1312 |
| 695 | Ga0453684_0097934 | 3300044712 | Bacteria | 3598 |
| 696 | Ga0451576_0088025 | 3300045051 | Bacteria | 3230 |
| 697 | Ga0495627_079143 | 3300046453 | Bacteria | 954 |
| 698 | Ga0495592_0000348 | 3300046454 | Bacteria | 37669 |
| 699 | Ga0495603_0031637 | 3300046455 | Bacteria | 3185 |
| 700 | Ga0495629_0027169 | 3300046459 | Bacteria | 4065 |
| 701 | Ga0495641_0011562 | 3300046461 | Bacteria | 5016 |
| 702 | Ga0495651_0000781 | 3300046462 | Bacteria | 24676 |
| 703 | Ga0495653_0000030 | 3300046463 | Bacteria | 142668 |
| 704 | Ga0495582_0007216 | 3300046473 | Bacteria | 6165 |
| 705 | Ga0495605_0156414 | 3300046474 | Bacteria | 1014 |
| 706 | Ga0495662_0000776 | 3300046476 | Bacteria | 15446 |
| 707 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 708 | Ga0495584_0012992 | 3300046491 | Bacteria | 4250 |
| 709 | Ga0495584_0036607 | 3300046491 | Bacteria | 2479 |
| 710 | Ga0495584_0235420 | 3300046491 | Bacteria | 931 |
| 711 | Ga0495594_0005256 | 3300046499 | Bacteria | 6657 |
| 712 | Ga0495607_0154444 | 3300046501 | Unclassified | 1172 |
| 713 | Ga0495607_0207849 | 3300046501 | Bacteria | 965 |
| 714 | Ga0495608_0000011 | 3300046511 | Bacteria | 248514 |
| 715 | Ga0495608_0067898 | 3300046511 | Bacteria | 2332 |
| 716 | Ga0495608_0310287 | 3300046511 | Bacteria | 976 |
| 717 | Ga0495618_0000025 | 3300046514 | Bacteria | 116027 |
| 718 | Ga0495618_0109332 | 3300046514 | Bacteria | 1770 |
| 719 | Ga0495620_0192190 | 3300046515 | Bacteria | 787 |
| 720 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 721 | Ga0495632_0056731 | 3300046519 | Bacteria | 1914 |
| 722 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 723 | Ga0495665_0247543 | 3300046531 | Bacteria | 918 |
| 724 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 725 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 726 | Ga0495598_0030664 | 3300046537 | Bacteria | 1508 |
| 727 | Ga0495598_0034323 | 3300046537 | Bacteria | 1446 |
| 728 | Ga0495645_0000276 | 3300046543 | Bacteria | 37763 |
| 729 | Ga0495667_0000004 | 3300046559 | Bacteria | 295297 |
| 730 | Ga0495667_0218223 | 3300046559 | Bacteria | 1218 |
| 731 | Ga0495656_0083987 | 3300046615 | Bacteria | 1443 |
| 732 | Ga0495656_0189389 | 3300046615 | Bacteria | 1015 |
| 733 | Ga0495668_0041609 | 3300046616 | Bacteria | 2559 |
| 734 | Ga0495634_0001327 | 3300046642 | Bacteria | 22545 |
| 735 | Ga0495611_0218112 | 3300046648 | Bacteria | 888 |
| 736 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 737 | Ga0495657_0000190 | 3300046675 | Bacteria | 55153 |
| 738 | Ga0495599_0000212 | 3300046678 | Bacteria | 37642 |
| 739 | Ga0495623_0000043 | 3300046679 | Bacteria | 77839 |
| 740 | Ga0495646_0000009 | 3300046680 | Bacteria | 200698 |
| 741 | Ga0495647_0083832 | 3300046681 | Bacteria | 1296 |
| 742 | Ga0495669_0087917 | 3300046684 | Bacteria | 1432 |
| 743 | Ga0495669_0101789 | 3300046684 | Bacteria | 1335 |
| 744 | Ga0495613_0004409 | 3300046689 | Bacteria | 10541 |
| 745 | Ga0495624_0047828 | 3300046690 | Bacteria | 2717 |
| 746 | Ga0495670_0030357 | 3300046691 | Bacteria | 2685 |
| 747 | Ga0495649_0211030 | 3300046694 | Bacteria | 1006 |
| 748 | Ga0495600_0000017 | 3300046809 | Bacteria | 107635 |
| 749 | Ga0495604_0000008 | 3300047317 | Bacteria | 341160 |
| 750 | Ga0495674_0000016 | 3300047319 | Bacteria | 216763 |
| 751 | Ga0495674_0373878 | 3300047319 | Bacteria | 1154 |
| 752 | Ga0495672_0153062 | 3300047320 | Bacteria | 1194 |
| 753 | Ga0495680_0001034 | 3300047322 | Bacteria | 30822 |
| 754 | Ga0495675_0170972 | 3300047444 | Bacteria | 1334 |
| 755 | Ga0495677_0049527 | 3300047445 | Bacteria | 1544 |
| 756 | Ga0495684_0000002 | 3300047471 | Bacteria | 341216 |
| 757 | Ga0495593_0000458 | 3300047673 | Bacteria | 22861 |
| 758 | Ga0495593_0121463 | 3300047673 | Bacteria | 1329 |
| 759 | Ga0495602_0000024 | 3300048088 | Bacteria | 151162 |
| 760 | Ga0496100_0001377 | 3300048903 | Bacteria | 11912 |
| 761 | Ga0496100_0122050 | 3300048903 | Bacteria | 1824 |
| 762 | Ga0496100_0189248 | 3300048903 | Unclassified | 1493 |
| 763 | Ga0496100_0205235 | 3300048903 | Bacteria | 1438 |
| 764 | Ga0496100_0223587 | 3300048903 | Bacteria | 1382 |
| 765 | Ga0496101_0009219 | 3300048904 | Bacteria | 6479 |
| 766 | Ga0496101_0013564 | 3300048904 | Bacteria | 5463 |
| 767 | Ga0496101_0031294 | 3300048904 | Bacteria | 3739 |
| 768 | Ga0496102_0006717 | 3300048905 | Bacteria | 9828 |
| 769 | Ga0496102_0006945 | 3300048905 | Bacteria | 9657 |
| 770 | Ga0496102_0041360 | 3300048905 | Bacteria | 4172 |
| 771 | Ga0496102_0089329 | 3300048905 | Bacteria | 2850 |
| 772 | Ga0496102_0137624 | 3300048905 | Bacteria | 2288 |
| 773 | Ga0496102_0217998 | 3300048905 | Bacteria | 1798 |
| 774 | Ga0496102_0463771 | 3300048905 | Bacteria | 1188 |
| 775 | Ga0496103_0001472 | 3300048906 | Bacteria | 15759 |
| 776 | Ga0496103_0008971 | 3300048906 | Bacteria | 5928 |
| 777 | Ga0496103_0014262 | 3300048906 | Bacteria | 4719 |
| 778 | Ga0496103_0026372 | 3300048906 | Bacteria | 3518 |
| 779 | Ga0496103_0058259 | 3300048906 | Bacteria | 2399 |
| 780 | Ga0496103_0081282 | 3300048906 | Bacteria | 2038 |
| 781 | Ga0496104_0004766 | 3300048907 | Bacteria | 11811 |
| 782 | Ga0496104_0005758 | 3300048907 | Bacteria | 10847 |
| 783 | Ga0496104_0091102 | 3300048907 | Bacteria | 2914 |
| 784 | Ga0496104_0103147 | 3300048907 | Bacteria | 2732 |
| 785 | Ga0496105_0009176 | 3300048908 | Bacteria | 7720 |
| 786 | Ga0496105_0119096 | 3300048908 | Bacteria | 2178 |
| 787 | Ga0496105_0134402 | 3300048908 | Bacteria | 2038 |
| 788 | Ga0496105_0141999 | 3300048908 | Bacteria | 1976 |
| 789 | Ga0496106_0002903 | 3300048909 | Bacteria | 12747 |
| 790 | Ga0496106_0011116 | 3300048909 | Bacteria | 6657 |
| 791 | Ga0496106_0035803 | 3300048909 | Bacteria | 3712 |
| 792 | Ga0496106_0057065 | 3300048909 | Bacteria | 2952 |
| 793 | Ga0496106_0074645 | 3300048909 | Bacteria | 2596 |
| 794 | Ga0496106_0080753 | 3300048909 | Bacteria | 2497 |
| 795 | Ga0496106_0108814 | 3300048909 | Bacteria | 2156 |
| 796 | Ga0496107_0002783 | 3300048910 | Bacteria | 11534 |
| 797 | Ga0496107_0024972 | 3300048910 | Bacteria | 4229 |
| 798 | Ga0496107_0027697 | 3300048910 | Bacteria | 4025 |
| 799 | Ga0496107_0093441 | 3300048910 | Bacteria | 2199 |
| 800 | Ga0496107_0462188 | 3300048910 | Unclassified | 942 |
| 801 | Ga0496108_0000746 | 3300048911 | Bacteria | 25332 |
| 802 | Ga0496108_0001712 | 3300048911 | Bacteria | 17379 |
| 803 | Ga0496108_0022767 | 3300048911 | Bacteria | 5154 |
| 804 | Ga0496108_0082105 | 3300048911 | Bacteria | 2732 |
| 805 | Ga0496108_0130145 | 3300048911 | Bacteria | 2163 |
| 806 | Ga0496109_0001064 | 3300048912 | Bacteria | 22726 |
| 807 | Ga0496109_0003828 | 3300048912 | Bacteria | 12569 |
| 808 | Ga0496109_0005286 | 3300048912 | Bacteria | 10788 |
| 809 | Ga0496109_0018504 | 3300048912 | Bacteria | 6118 |
| 810 | Ga0496109_0183921 | 3300048912 | Bacteria | 1963 |
| 811 | Ga0496110_0004442 | 3300048913 | Bacteria | 10873 |
| 812 | Ga0496110_0013739 | 3300048913 | Bacteria | 6709 |
| 813 | Ga0496110_0070526 | 3300048913 | Bacteria | 3096 |
| 814 | Ga0496110_0192406 | 3300048913 | Bacteria | 1852 |
| 815 | Ga0496110_0773038 | 3300048913 | Bacteria | 864 |
| 816 | Ga0496111_0001412 | 3300048914 | Bacteria | 13658 |
| 817 | Ga0496111_0016642 | 3300048914 | Bacteria | 5070 |
| 818 | Ga0496111_0019059 | 3300048914 | Bacteria | 4760 |
| 819 | Ga0496111_0024187 | 3300048914 | Bacteria | 4274 |
| 820 | Ga0496111_0037068 | 3300048914 | Bacteria | 3489 |
| 821 | Ga0496111_0095394 | 3300048914 | Bacteria | 2183 |
| 822 | Ga0496111_0175258 | 3300048914 | Bacteria | 1594 |
| 823 | Ga0496111_0230850 | 3300048914 | Bacteria | 1374 |
| 824 | Ga0496111_0351558 | 3300048914 | Bacteria | 1091 |
| 825 | Ga0496112_0010687 | 3300048915 | Bacteria | 8341 |
| 826 | Ga0496112_0013459 | 3300048915 | Bacteria | 7551 |
| 827 | Ga0496112_0047166 | 3300048915 | Plasmid | 4226 |
| 828 | Ga0496112_0072786 | 3300048915 | Bacteria | 3397 |
| 829 | Ga0496112_0419340 | 3300048915 | Bacteria | 1277 |
| 830 | Ga0496113_0000750 | 3300048916 | Bacteria | 16701 |
| 831 | Ga0496113_0001219 | 3300048916 | Bacteria | 14112 |
| 832 | Ga0496113_0019688 | 3300048916 | Bacteria | 4727 |
| 833 | Ga0496113_0035388 | 3300048916 | Bacteria | 3651 |
| 834 | Ga0496113_0105411 | 3300048916 | Bacteria | 2189 |
| 835 | Ga0496113_0466292 | 3300048916 | Unclassified | 1015 |
| 836 | Ga0496114_0002625 | 3300048917 | Bacteria | 13717 |
| 837 | Ga0496114_0081557 | 3300048917 | Bacteria | 2732 |
| 838 | Ga0496114_0118107 | 3300048917 | Bacteria | 2278 |
| 839 | Ga0496114_0124173 | 3300048917 | Bacteria | 2223 |
| 840 | Ga0496115_0000935 | 3300048918 | Bacteria | 21173 |
| 841 | Ga0496115_0064082 | 3300048918 | Bacteria | 2966 |
| 842 | Ga0501033_0339588 | 3300049570 | Unclassified | 1053 |
| 843 | Ga0501036_0041568 | 3300049572 | Bacteria | 3889 |
| 844 | Ga0501038_0160711 | 3300049574 | Unclassified | 1826 |
| 845 | Ga0501041_0038076 | 3300049577 | Bacteria | 2915 |
| 846 | Ga0501043_0377710 | 3300049579 | Unclassified | 1073 |
| 847 | Ga0501046_0108202 | 3300049580 | Bacteria | 2126 |
| 848 | Ga0501048_0115606 | 3300049582 | Bacteria | 1895 |
| 849 | Ga0501048_0151980 | 3300049582 | Bacteria | 1638 |
| 850 | Ga0501048_0290549 | 3300049582 | Bacteria | 1163 |
| 851 | Ga0501070_0425838 | 3300049586 | Unclassified | 1072 |
| 852 | Ga0501075_0249919 | 3300049591 | Unclassified | 1351 |
| 853 | Ga0501076_0057848 | 3300049592 | Bacteria | 3080 |
| 854 | Ga0501076_0424896 | 3300049592 | Bacteria | 1093 |
| 855 | Ga0501076_0584039 | 3300049592 | Unclassified | 921 |
| 856 | Ga0501077_0020914 | 3300049593 | Bacteria | 4142 |
| 857 | Ga0501077_0023130 | 3300049593 | Bacteria | 3940 |
| 858 | Ga0501079_0029477 | 3300049741 | Bacteria | 4213 |
| 859 | Ga0501079_0120499 | 3300049741 | Bacteria | 2040 |
| 860 | Ga0501079_0204922 | 3300049741 | Bacteria | 1540 |
| 861 | Ga0501080_0148157 | 3300049742 | Bacteria | 2170 |
| 862 | Ga0501081_0102485 | 3300049743 | Bacteria | 2024 |
| 863 | Ga0501081_0373654 | 3300049743 | Bacteria | 1053 |
| 864 | Ga0501081_0374868 | 3300049743 | Bacteria | 1051 |
| 865 | Ga0501035_0105490 | 3300049822 | Bacteria | 2471 |
| 866 | Ga0501035_0392348 | 3300049822 | Bacteria | 1156 |
| 867 | Ga0501044_0316888 | 3300049823 | Unclassified | 1485 |
| 868 | nmdc:mga03683_6762_c1 | 3300050489 | Bacteria | 3946 |
| 869 | nmdc:mga00v17_178357_c1 | 3300050491 | Bacteria | 1370 |
| 870 | nmdc:mga0yw44_2273_c1 | 3300050492 | Bacteria | 8102 |
| 871 | nmdc:mga0yw44_249330_c1 | 3300050492 | Bacteria | 1181 |
| 872 | nmdc:mga0yw44_4473_c1 | 3300050492 | Bacteria | 6418 |
| 873 | nmdc:mga0yw44_46704_c1 | 3300050492 | Bacteria | 2602 |
| 874 | nmdc:mga0yw44_467730_c1 | 3300050492 | Unclassified | 855 |
| 875 | nmdc:mga0yw44_64314_c1 | 3300050492 | Bacteria | 2257 |
| 876 | nmdc:mga06z11_12010_c1 | 3300050494 | Bacteria | 3754 |
| 877 | nmdc:mga06z11_42843_c1 | 3300050494 | Bacteria | 2273 |
| 878 | nmdc:mga05p37_151819_c1 | 3300050507 | Bacteria | 2833 |
| 879 | nmdc:mga05p37_370351_c1 | 3300050507 | Bacteria | 1681 |
| 880 | nmdc:mga05p37_54022_c1 | 3300050507 | Bacteria | 4942 |
| 881 | nmdc:mga05p37_57252_c1 | 3300050507 | Bacteria | 4801 |
| 882 | nmdc:mga05p37_714477_c1 | 3300050507 | Bacteria | 1111 |
| 883 | nmdc:mga09592_591314_c1 | 3300050508 | Bacteria | 951 |
| 884 | nmdc:mga0qj67_274916_c1 | 3300050509 | Bacteria | 1365 |
| 885 | nmdc:mga0qj67_447259_c1 | 3300050509 | Bacteria | 1041 |
| 886 | nmdc:mga0qj67_663375_c1 | 3300050509 | Bacteria | 832 |
| 887 | nmdc:mga0qj67_680863_c1 | 3300050509 | Bacteria | 819 |
| 888 | nmdc:mga0qj67_688695_c1 | 3300050509 | Bacteria | 814 |
| 889 | nmdc:mga06r32_199556_c1 | 3300050510 | Bacteria | 1988 |
| 890 | nmdc:mga06r32_21674_c2 | 3300050510 | Bacteria | 4339 |
| 891 | nmdc:mga06r32_813117_c1 | 3300050510 | Unclassified | 895 |
| 892 | nmdc:mga06r32_97375_c1 | 3300050510 | Bacteria | 2882 |
| 893 | nmdc:mga08y16_312407_c1 | 3300050511 | Bacteria | 1619 |
| 894 | nmdc:mga08y16_31900_c1 | 3300050511 | Bacteria | 5539 |
| 895 | nmdc:mga08y16_34440_c1 | 3300050511 | Bacteria | 5320 |
| 896 | nmdc:mga08y16_95196_c1 | 3300050511 | Bacteria | 3102 |
| 897 | nmdc:mga0n895_25477_c1 | 3300050512 | Bacteria | 5589 |
| 898 | nmdc:mga0n895_3347_c1 | 3300050512 | Bacteria | 12892 |
| 899 | nmdc:mga0n895_37489_c1 | 3300050512 | Bacteria | 4690 |
| 900 | nmdc:mga0n895_400372_c1 | 3300050512 | Bacteria | 1388 |
| 901 | nmdc:mga0n895_531545_c1 | 3300050512 | Unclassified | 1183 |
| 902 | nmdc:mga0rr50_10581_c1 | 3300050513 | Bacteria | 5862 |
| 903 | nmdc:mga0rr50_40522_c1 | 3300050513 | Plasmid | 3387 |
| 904 | nmdc:mga0rr50_831772_c1 | 3300050513 | Unclassified | 788 |
| 905 | nmdc:mga08x19_105984_c1 | 3300050514 | Unclassified | 1870 |
| 906 | nmdc:mga08x19_163965_c1 | 3300050514 | Unclassified | 1510 |
| 907 | nmdc:mga0a205_159421_c1 | 3300050515 | Bacteria | 2154 |
| 908 | nmdc:mga0a205_169290_c1 | 3300050515 | Bacteria | 2080 |
| 909 | nmdc:mga0a205_91515_c1 | 3300050515 | Bacteria | 2939 |
| 910 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 911 | Ga0495601_0036304 | 3300053077 | Bacteria | 3077 |
| 912 | Ga0495612_0000097 | 3300053078 | Bacteria | 37614 |
| 913 | Ga0495612_0041925 | 3300053078 | Bacteria | 1867 |
| 914 | Ga0495612_0099117 | 3300053078 | Bacteria | 1240 |
| 915 | Ga0495655_0134057 | 3300053083 | Unclassified | 765 |
| 916 | Ga0495595_0000502 | 3300053084 | Bacteria | 14977 |
| 917 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 918 | Ga0495619_0015074 | 3300053085 | Bacteria | 4884 |
| 919 | Ga0500658_0058298 | 3300053134 | Bacteria | 1599 |
| 920 | Ga0500568_0003570 | 3300053139 | Bacteria | 8596 |
| 921 | Ga0500616_0019413 | 3300053153 | Bacteria | 3831 |
| 922 | Ga0500616_0060193 | 3300053153 | Bacteria | 1969 |
| 923 | Ga0501084_0031416 | 3300054114 | Bacteria | 4440 |
| 924 | Ga0501084_0050136 | 3300054114 | Bacteria | 3494 |
| 925 | Ga0501084_0066670 | 3300054114 | Bacteria | 3012 |
| 926 | Ga0501082_0051209 | 3300060353 | Bacteria | 3559 |
| 927 | Ga0501082_0105110 | 3300060353 | Bacteria | 2443 |
| 928 | Ga0501082_0319068 | 3300060353 | Unclassified | 1353 |
| 929 | Ga0530510_0041940 | 3300061734 | Bacteria | 3305 |
| 930 | Ga0530510_0099132 | 3300061734 | Bacteria | 2130 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005536 | Ga0070697_100106470 | Ga0070697_1001064702 | 205 |
| 2 | 3300028577 | Ga0265318_10075108 | Ga0265318_100751082 | 205 |
| 3 | 3300005290 | Ga0065712_10072196 | Ga0065712_100721964 | 207 |
| 4 | 3300005330 | Ga0070690_100019192 | Ga0070690_1000191922 | 207 |
| 5 | 3300005354 | Ga0070675_100340097 | Ga0070675_1003400972 | 207 |
| 6 | 3300005455 | Ga0070663_100408926 | Ga0070663_1004089261 | 207 |
| 7 | 3300005458 | Ga0070681_10055049 | Ga0070681_100550493 | 207 |
| 8 | 3300005530 | Ga0070679_100045759 | Ga0070679_1000457593 | 207 |
| 9 | 3300005547 | Ga0070693_100295496 | Ga0070693_1002954962 | 207 |
| 10 | 3300009177 | Ga0105248_10008602 | Ga0105248_1000860211 | 207 |
| 11 | 3300014325 | Ga0163163_10000757 | Ga0163163_1000075713 | 207 |
| 12 | 3300025903 | Ga0207680_10139870 | Ga0207680_101398701 | 207 |
| 13 | 3300025941 | Ga0207711_10118481 | Ga0207711_101184812 | 207 |
| 14 | 3300025986 | Ga0207658_10016145 | Ga0207658_100161452 | 207 |
| 15 | 3300048907 | Ga0496104_0091102 | Ga0496104_0091102_515_1213 | 207 |
| 16 | 3300048908 | Ga0496105_0134402 | Ga0496105_0134402_1192_1890 | 207 |
| 17 | 3300048911 | Ga0496108_0130145 | Ga0496108_0130145_903_1601 | 207 |
| 18 | 3300048912 | Ga0496109_0001064 | Ga0496109_0001064_8956_9654 | 207 |
| 19 | 3300048914 | Ga0496111_0019059 | Ga0496111_0019059_2321_3019 | 207 |
| 20 | 3300048916 | Ga0496113_0001219 | Ga0496113_0001219_11116_11814 | 207 |
| 21 | 3300050512 | nmdc:mga0n895_400372_c1 | nmdc:mga0n895_400372_c1_130_828 | 207 |
| 22 | 3300025885 | Ga0207653_10038925 | Ga0207653_100389252 | 208 |
| 23 | 3300001430 | JGI24032J14994_100417 | JGI24032J14994_1004173 | 210 |
| 24 | 3300001915 | JGI24741J21665_1012565 | JGI24741J21665_10125652 | 210 |
| 25 | 3300001976 | JGI24752J21851_1004120 | JGI24752J21851_10041202 | 210 |
| 26 | 3300001977 | JGI24746J21847_1018892 | JGI24746J21847_10188922 | 210 |
| 27 | 3300001989 | JGI24739J22299_10003115 | JGI24739J22299_100031155 | 210 |
| 28 | 3300001990 | JGI24737J22298_10000192 | JGI24737J22298_1000019213 | 210 |
| 29 | 3300002070 | JGI24750J21931_1000008 | JGI24750J21931_100000810 | 210 |
| 30 | 3300002074 | JGI24748J21848_1003980 | JGI24748J21848_10039802 | 210 |
| 31 | 3300002075 | JGI24738J21930_10000228 | JGI24738J21930_1000022814 | 210 |
| 32 | 3300002077 | JGI24744J21845_10013361 | JGI24744J21845_100133612 | 210 |
| 33 | 3300002126 | JGI24035J26624_1000004 | JGI24035J26624_100000413 | 210 |
| 34 | 3300002244 | JGI24742J22300_10001815 | JGI24742J22300_100018153 | 210 |
| 35 | 3300002459 | JGI24751J29686_10009787 | JGI24751J29686_100097872 | 210 |
| 36 | 3300005293 | Ga0065715_10093738 | Ga0065715_100937383 | 210 |
| 37 | 3300005328 | Ga0070676_10000092 | Ga0070676_1000009214 | 210 |
| 38 | 3300005329 | Ga0070683_100000314 | Ga0070683_10000031420 | 210 |
| 39 | 3300005330 | Ga0070690_100001103 | Ga0070690_1000011039 | 210 |
| 40 | 3300005331 | Ga0070670_100006325 | Ga0070670_1000063253 | 210 |
| 41 | 3300005333 | Ga0070677_10000577 | Ga0070677_100005774 | 210 |
| 42 | 3300005334 | Ga0068869_100006201 | Ga0068869_1000062012 | 210 |
| 43 | 3300005335 | Ga0070666_10100706 | Ga0070666_101007062 | 210 |
| 44 | 3300005336 | Ga0070680_100000515 | Ga0070680_10000051510 | 210 |
| 45 | 3300005337 | Ga0070682_100000230 | Ga0070682_10000023015 | 210 |
| 46 | 3300005338 | Ga0068868_100000973 | Ga0068868_1000009732 | 210 |
| 47 | 3300005339 | Ga0070660_100003630 | Ga0070660_1000036303 | 210 |
| 48 | 3300005340 | Ga0070689_100000145 | Ga0070689_10000014510 | 210 |
| 49 | 3300005341 | Ga0070691_10000107 | Ga0070691_100001072 | 210 |
| 50 | 3300005343 | Ga0070687_100001052 | Ga0070687_1000010523 | 210 |
| 51 | 3300005344 | Ga0070661_100000808 | Ga0070661_10000080815 | 210 |
| 52 | 3300005345 | Ga0070692_10000115 | Ga0070692_1000011514 | 210 |
| 53 | 3300005347 | Ga0070668_100001616 | Ga0070668_10000161613 | 210 |
| 54 | 3300005353 | Ga0070669_100000343 | Ga0070669_10000034315 | 210 |
| 55 | 3300005354 | Ga0070675_100000210 | Ga0070675_10000021015 | 210 |
| 56 | 3300005355 | Ga0070671_100000396 | Ga0070671_10000039624 | 210 |
| 57 | 3300005356 | Ga0070674_100000733 | Ga0070674_10000073315 | 210 |
| 58 | 3300005364 | Ga0070673_100000130 | Ga0070673_10000013016 | 210 |
| 59 | 3300005365 | Ga0070688_100003254 | Ga0070688_1000032548 | 210 |
| 60 | 3300005366 | Ga0070659_100002709 | Ga0070659_1000027094 | 210 |
| 61 | 3300005367 | Ga0070667_100001673 | Ga0070667_1000016735 | 210 |
| 62 | 3300005406 | Ga0070703_10001152 | Ga0070703_100011528 | 210 |
| 63 | 3300005438 | Ga0070701_10000012 | Ga0070701_1000001215 | 210 |
| 64 | 3300005440 | Ga0070705_100000341 | Ga0070705_10000034114 | 210 |
| 65 | 3300005441 | Ga0070700_100001057 | Ga0070700_10000105710 | 210 |
| 66 | 3300005444 | Ga0070694_100001081 | Ga0070694_1000010814 | 210 |
| 67 | 3300005455 | Ga0070663_100000097 | Ga0070663_10000009715 | 210 |
| 68 | 3300005456 | Ga0070678_100000452 | Ga0070678_1000004523 | 210 |
| 69 | 3300005457 | Ga0070662_100000336 | Ga0070662_1000003365 | 210 |
| 70 | 3300005458 | Ga0070681_10005380 | Ga0070681_100053802 | 210 |
| 71 | 3300005459 | Ga0068867_100000731 | Ga0068867_1000007318 | 210 |
| 72 | 3300005466 | Ga0070685_10001019 | Ga0070685_1000101911 | 210 |
| 73 | 3300005530 | Ga0070679_100017090 | Ga0070679_1000170902 | 210 |
| 74 | 3300005535 | Ga0070684_100000157 | Ga0070684_10000015724 | 210 |
| 75 | 3300005539 | Ga0068853_100001479 | Ga0068853_10000147914 | 210 |
| 76 | 3300005543 | Ga0070672_100001119 | Ga0070672_1000011193 | 210 |
| 77 | 3300005544 | Ga0070686_100000127 | Ga0070686_10000012732 | 210 |
| 78 | 3300005545 | Ga0070695_100020454 | Ga0070695_1000204544 | 210 |
| 79 | 3300005546 | Ga0070696_100000219 | Ga0070696_10000021914 | 210 |
| 80 | 3300005547 | Ga0070693_100000414 | Ga0070693_1000004148 | 210 |
| 81 | 3300005548 | Ga0070665_100139524 | Ga0070665_1001395242 | 210 |
| 82 | 3300005549 | Ga0070704_100001431 | Ga0070704_1000014318 | 210 |
| 83 | 3300005563 | Ga0068855_100004578 | Ga0068855_1000045782 | 210 |
| 84 | 3300005564 | Ga0070664_100000326 | Ga0070664_10000032626 | 210 |
| 85 | 3300005577 | Ga0068857_100000063 | Ga0068857_10000006314 | 210 |
| 86 | 3300005578 | Ga0068854_100000220 | Ga0068854_10000022015 | 210 |
| 87 | 3300005614 | Ga0068856_100000815 | Ga0068856_10000081510 | 210 |
| 88 | 3300005615 | Ga0070702_100002268 | Ga0070702_1000022684 | 210 |
| 89 | 3300005616 | Ga0068852_100001063 | Ga0068852_1000010634 | 210 |
| 90 | 3300005617 | Ga0068859_100010551 | Ga0068859_1000105518 | 210 |
| 91 | 3300005618 | Ga0068864_100000380 | Ga0068864_1000003808 | 210 |
| 92 | 3300005718 | Ga0068866_10000193 | Ga0068866_1000019325 | 210 |
| 93 | 3300005719 | Ga0068861_100000101 | Ga0068861_10000010117 | 210 |
| 94 | 3300005840 | Ga0068870_10000028 | Ga0068870_1000002833 | 210 |
| 95 | 3300005841 | Ga0068863_100000386 | Ga0068863_10000038632 | 210 |
| 96 | 3300005842 | Ga0068858_100034821 | Ga0068858_1000348212 | 210 |
| 97 | 3300005843 | Ga0068860_100001254 | Ga0068860_1000012547 | 210 |
| 98 | 3300005844 | Ga0068862_100002105 | Ga0068862_1000021054 | 210 |
| 99 | 3300006178 | Ga0075367_10012294 | Ga0075367_100122942 | 210 |
| 100 | 3300006237 | Ga0097621_100000577 | Ga0097621_10000057724 | 210 |
| 101 | 3300006358 | Ga0068871_100000298 | Ga0068871_10000029813 | 210 |
| 102 | 3300006852 | Ga0075433_10008685 | Ga0075433_100086853 | 210 |
| 103 | 3300006871 | Ga0075434_100021970 | Ga0075434_1000219705 | 210 |
| 104 | 3300006881 | Ga0068865_100000125 | Ga0068865_10000012527 | 210 |
| 105 | 3300006914 | Ga0075436_100190218 | Ga0075436_1001902182 | 210 |
| 106 | 3300006931 | Ga0097620_100010551 | Ga0097620_1000105518 | 210 |
| 107 | 3300007076 | Ga0075435_100167850 | Ga0075435_1001678502 | 210 |
| 108 | 3300009011 | Ga0105251_10135476 | Ga0105251_101354762 | 210 |
| 109 | 3300009093 | Ga0105240_10014048 | Ga0105240_100140486 | 210 |
| 110 | 3300009094 | Ga0111539_10000548 | Ga0111539_1000054824 | 210 |
| 111 | 3300009098 | Ga0105245_10000173 | Ga0105245_1000017321 | 210 |
| 112 | 3300009101 | Ga0105247_10002800 | Ga0105247_100028004 | 210 |
| 113 | 3300009148 | Ga0105243_10000377 | Ga0105243_1000037729 | 210 |
| 114 | 3300009174 | Ga0105241_10001249 | Ga0105241_1000124916 | 210 |
| 115 | 3300009176 | Ga0105242_10000419 | Ga0105242_1000041918 | 210 |
| 116 | 3300009177 | Ga0105248_10000643 | Ga0105248_1000064332 | 210 |
| 117 | 3300009545 | Ga0105237_10007697 | Ga0105237_100076975 | 210 |
| 118 | 3300009553 | Ga0105249_10017441 | Ga0105249_100174416 | 210 |
| 119 | 3300010375 | Ga0105239_10009309 | Ga0105239_100093094 | 210 |
| 120 | 3300011119 | Ga0105246_10000819 | Ga0105246_1000081914 | 210 |
| 121 | 3300013100 | Ga0157373_10003113 | Ga0157373_100031134 | 210 |
| 122 | 3300013102 | Ga0157371_10072538 | Ga0157371_100725382 | 210 |
| 123 | 3300013105 | Ga0157369_10357613 | Ga0157369_103576132 | 210 |
| 124 | 3300013296 | Ga0157374_10004172 | Ga0157374_1000417211 | 210 |
| 125 | 3300013297 | Ga0157378_10000993 | Ga0157378_1000099316 | 210 |
| 126 | 3300013306 | Ga0163162_10001508 | Ga0163162_1000150816 | 210 |
| 127 | 3300013307 | Ga0157372_10008930 | Ga0157372_100089305 | 210 |
| 128 | 3300013308 | Ga0157375_10000283 | Ga0157375_1000028325 | 210 |
| 129 | 3300014325 | Ga0163163_10094798 | Ga0163163_100947983 | 210 |
| 130 | 3300014326 | Ga0157380_10000095 | Ga0157380_1000009524 | 210 |
| 131 | 3300014745 | Ga0157377_10001144 | Ga0157377_1000114410 | 210 |
| 132 | 3300014968 | Ga0157379_10009736 | Ga0157379_100097362 | 210 |
| 133 | 3300014969 | Ga0157376_10000634 | Ga0157376_1000063418 | 210 |
| 134 | 3300017792 | Ga0163161_10001324 | Ga0163161_100013243 | 210 |
| 135 | 3300025271 | Ga0207666_1000045 | Ga0207666_100004511 | 210 |
| 136 | 3300025290 | Ga0207673_1000048 | Ga0207673_10000485 | 210 |
| 137 | 3300025315 | Ga0207697_10000551 | Ga0207697_1000055114 | 210 |
| 138 | 3300025885 | Ga0207653_10003534 | Ga0207653_100035342 | 210 |
| 139 | 3300025893 | Ga0207682_10000065 | Ga0207682_100000654 | 210 |
| 140 | 3300025900 | Ga0207710_10002620 | Ga0207710_100026206 | 210 |
| 141 | 3300025901 | Ga0207688_10000039 | Ga0207688_1000003914 | 210 |
| 142 | 3300025903 | Ga0207680_10042017 | Ga0207680_100420173 | 210 |
| 143 | 3300025904 | Ga0207647_10014680 | Ga0207647_100146802 | 210 |
| 144 | 3300025907 | Ga0207645_10000080 | Ga0207645_1000008046 | 210 |
| 145 | 3300025908 | Ga0207643_10000135 | Ga0207643_1000013519 | 210 |
| 146 | 3300025911 | Ga0207654_10005870 | Ga0207654_100058705 | 210 |
| 147 | 3300025912 | Ga0207707_10002157 | Ga0207707_100021573 | 210 |
| 148 | 3300025913 | Ga0207695_10185434 | Ga0207695_101854342 | 210 |
| 149 | 3300025914 | Ga0207671_10003900 | Ga0207671_100039005 | 210 |
| 150 | 3300025917 | Ga0207660_10002445 | Ga0207660_1000244510 | 210 |
| 151 | 3300025918 | Ga0207662_10000336 | Ga0207662_100003368 | 210 |
| 152 | 3300025919 | Ga0207657_10002336 | Ga0207657_1000233613 | 210 |
| 153 | 3300025920 | Ga0207649_10000571 | Ga0207649_100005719 | 210 |
| 154 | 3300025921 | Ga0207652_10001096 | Ga0207652_100010962 | 210 |
| 155 | 3300025923 | Ga0207681_10032843 | Ga0207681_100328433 | 210 |
| 156 | 3300025925 | Ga0207650_10028311 | Ga0207650_100283112 | 210 |
| 157 | 3300025926 | Ga0207659_10000127 | Ga0207659_1000012714 | 210 |
| 158 | 3300025927 | Ga0207687_10000334 | Ga0207687_100003342 | 210 |
| 159 | 3300025931 | Ga0207644_10002918 | Ga0207644_100029182 | 210 |
| 160 | 3300025932 | Ga0207690_10003358 | Ga0207690_100033588 | 210 |
| 161 | 3300025933 | Ga0207706_10001765 | Ga0207706_1000176514 | 210 |
| 162 | 3300025934 | Ga0207686_10000297 | Ga0207686_1000029714 | 210 |
| 163 | 3300025935 | Ga0207709_10000257 | Ga0207709_1000025736 | 210 |
| 164 | 3300025936 | Ga0207670_10000371 | Ga0207670_1000037111 | 210 |
| 165 | 3300025937 | Ga0207669_10000089 | Ga0207669_1000008916 | 210 |
| 166 | 3300025938 | Ga0207704_10000355 | Ga0207704_100003556 | 210 |
| 167 | 3300025940 | Ga0207691_10001737 | Ga0207691_100017378 | 210 |
| 168 | 3300025941 | Ga0207711_10141145 | Ga0207711_101411452 | 210 |
| 169 | 3300025942 | Ga0207689_10000095 | Ga0207689_1000009529 | 210 |
| 170 | 3300025944 | Ga0207661_10000366 | Ga0207661_1000036624 | 210 |
| 171 | 3300025945 | Ga0207679_10000073 | Ga0207679_1000007364 | 210 |
| 172 | 3300025949 | Ga0207667_10010897 | Ga0207667_100108973 | 210 |
| 173 | 3300025960 | Ga0207651_10001109 | Ga0207651_100011097 | 210 |
| 174 | 3300025961 | Ga0207712_10000457 | Ga0207712_1000045723 | 210 |
| 175 | 3300025972 | Ga0207668_10000971 | Ga0207668_1000097115 | 210 |
| 176 | 3300025981 | Ga0207640_10001226 | Ga0207640_100012267 | 210 |
| 177 | 3300025986 | Ga0207658_10003961 | Ga0207658_100039619 | 210 |
| 178 | 3300026023 | Ga0207677_10009833 | Ga0207677_100098335 | 210 |
| 179 | 3300026035 | Ga0207703_10005066 | Ga0207703_100050662 | 210 |
| 180 | 3300026041 | Ga0207639_10018364 | Ga0207639_100183642 | 210 |
| 181 | 3300026067 | Ga0207678_10000426 | Ga0207678_1000042623 | 210 |
| 182 | 3300026075 | Ga0207708_10000991 | Ga0207708_1000099114 | 210 |
| 183 | 3300026078 | Ga0207702_10008786 | Ga0207702_100087867 | 210 |
| 184 | 3300026088 | Ga0207641_10001067 | Ga0207641_100010672 | 210 |
| 185 | 3300026089 | Ga0207648_10000207 | Ga0207648_1000020728 | 210 |
| 186 | 3300026095 | Ga0207676_10000875 | Ga0207676_100008758 | 210 |
| 187 | 3300026116 | Ga0207674_10001021 | Ga0207674_100010218 | 210 |
| 188 | 3300026118 | Ga0207675_100001849 | Ga0207675_1000018498 | 210 |
| 189 | 3300026121 | Ga0207683_10000096 | Ga0207683_1000009639 | 210 |
| 190 | 3300026142 | Ga0207698_10002278 | Ga0207698_100022788 | 210 |
| 191 | 3300027717 | Ga0209998_10001024 | Ga0209998_100010246 | 210 |
| 192 | 3300027876 | Ga0209974_10001855 | Ga0209974_100018552 | 210 |
| 193 | 3300027907 | Ga0207428_10000160 | Ga0207428_1000016035 | 210 |
| 194 | 3300028379 | Ga0268266_10082872 | Ga0268266_100828722 | 210 |
| 195 | 3300028380 | Ga0268265_10003071 | Ga0268265_1000307111 | 210 |
| 196 | 3300028381 | Ga0268264_10002954 | Ga0268264_100029548 | 210 |
| 197 | 3300034817 | Ga0373948_0009148 | Ga0373948_0009148_328_1026 | 210 |
| 198 | 3300034819 | Ga0373958_0001030 | Ga0373958_0001030_1533_2231 | 210 |
| 199 | 3300034820 | Ga0373959_0009786 | Ga0373959_0009786_817_1515 | 210 |
| 200 | 3300034957 | Ga0373938_0000033 | Ga0373938_0000033_9158_9856 | 210 |
| 201 | 3300035084 | Ga0373928_0019501 | Ga0373928_0019501_468_1166 | 210 |
| 202 | 3300035088 | Ga0373940_0020740 | Ga0373940_0020740_42_740 | 210 |
| 203 | 3300035090 | Ga0373949_0003081 | Ga0373949_0003081_3317_4015 | 210 |
| 204 | 3300035091 | Ga0373951_0004442 | Ga0373951_0004442_1229_1927 | 210 |
| 205 | 3300035112 | Ga0373932_0000983 | Ga0373932_0000983_7517_8215 | 210 |
| 206 | 3300035114 | Ga0373939_0000342 | Ga0373939_0000342_7496_8194 | 210 |
| 207 | 3300035121 | Ga0373960_0000100 | Ga0373960_0000100_7778_8476 | 210 |
| 208 | 3300035207 | Ga0373942_0002640 | Ga0373942_0002640_945_1643 | 210 |
| 209 | 3300035242 | Ga0373962_0000272 | Ga0373962_0000272_3718_4416 | 210 |
| 210 | 3300035691 | Ga0373931_0001372 | Ga0373931_0001372_7516_8214 | 210 |
| 211 | 3300046684 | Ga0495669_0087917 | Ga0495669_0087917_180_878 | 210 |
| 212 | 3300047445 | Ga0495677_0049527 | Ga0495677_0049527_523_1221 | 210 |
| 213 | 3300048903 | Ga0496100_0001377 | Ga0496100_0001377_3842_4540 | 210 |
| 214 | 3300048904 | Ga0496101_0013564 | Ga0496101_0013564_1648_2346 | 210 |
| 215 | 3300048905 | Ga0496102_0041360 | Ga0496102_0041360_2378_3076 | 210 |
| 216 | 3300048906 | Ga0496103_0008971 | Ga0496103_0008971_204_902 | 210 |
| 217 | 3300048908 | Ga0496105_0119096 | Ga0496105_0119096_493_1191 | 210 |
| 218 | 3300048909 | Ga0496106_0080753 | Ga0496106_0080753_1747_2445 | 210 |
| 219 | 3300048910 | Ga0496107_0024972 | Ga0496107_0024972_3200_3898 | 210 |
| 220 | 3300048911 | Ga0496108_0001712 | Ga0496108_0001712_3636_4334 | 210 |
| 221 | 3300048913 | Ga0496110_0192406 | Ga0496110_0192406_616_1314 | 210 |
| 222 | 3300048914 | Ga0496111_0024187 | Ga0496111_0024187_52_750 | 210 |
| 223 | 3300048915 | Ga0496112_0419340 | Ga0496112_0419340_245_943 | 210 |
| 224 | 3300048918 | Ga0496115_0000935 | Ga0496115_0000935_10548_11246 | 210 |
| 225 | 3300050511 | nmdc:mga08y16_34440_c1 | nmdc:mga08y16_34440_c1_3190_3888 | 210 |
| 226 | 3300050512 | nmdc:mga0n895_3347_c1 | nmdc:mga0n895_3347_c1_1619_2317 | 210 |
| 227 | 3300050513 | nmdc:mga0rr50_10581_c1 | nmdc:mga0rr50_10581_c1_4921_5619 | 210 |
| 228 | 3300049741 | Ga0501079_0204922 | Ga0501079_0204922_720_1418 | 211 |
| 229 | 3300050508 | nmdc:mga09592_591314_c1 | nmdc:mga09592_591314_c1_40_714 | 211 |
| 230 | 3300046648 | Ga0495611_0218112 | Ga0495611_0218112_18_695 | 212 |
| 231 | 3300050509 | nmdc:mga0qj67_274916_c1 | nmdc:mga0qj67_274916_c1_421_1098 | 212 |
| 232 | 3300050515 | nmdc:mga0a205_91515_c1 | nmdc:mga0a205_91515_c1_12_689 | 213 |
| 233 | 3300009092 | Ga0105250_10106985 | Ga0105250_101069852 | 215 |
| 234 | 3300049592 | Ga0501076_0057848 | Ga0501076_0057848_1029_1727 | 215 |
| 235 | 3300049743 | Ga0501081_0373654 | Ga0501081_0373654_337_1035 | 215 |
| 236 | 3300053139 | Ga0500568_0003570 | Ga0500568_0003570_2123_2812 | 215 |
| 237 | 3300006871 | Ga0075434_100968539 | Ga0075434_1009685392 | 216 |
| 238 | 3300009094 | Ga0111539_10088301 | Ga0111539_100883012 | 216 |
| 239 | 3300025907 | Ga0207645_10142167 | Ga0207645_101421672 | 216 |
| 240 | 3300042012 | Ga0439455_0022300 | Ga0439455_0022300_346_1044 | 216 |
| 241 | iso_pu_bacteria | 2821443989 | 2821446308 | 216 |
| 242 | 3300005458 | Ga0070681_10104785 | Ga0070681_101047852 | 217 |
| 243 | 3300025912 | Ga0207707_10042863 | Ga0207707_100428633 | 217 |
| 244 | 3300031241 | Ga0265325_10003848 | Ga0265325_100038489 | 217 |
| 245 | 3300031595 | Ga0265313_10000524 | Ga0265313_1000052419 | 217 |
| 246 | 3300031595 | Ga0265313_10076822 | Ga0265313_100768222 | 217 |
| 247 | 3300031711 | Ga0265314_10001524 | Ga0265314_1000152421 | 217 |
| 248 | 3300005327 | Ga0070658_10148448 | Ga0070658_101484483 | 218 |
| 249 | 3300005336 | Ga0070680_100008159 | Ga0070680_1000081594 | 218 |
| 250 | 3300005458 | Ga0070681_10624016 | Ga0070681_106240162 | 218 |
| 251 | 3300025912 | Ga0207707_10195623 | Ga0207707_101956232 | 218 |
| 252 | 3300025917 | Ga0207660_10011111 | Ga0207660_100111116 | 218 |
| 253 | 3300025919 | Ga0207657_10075800 | Ga0207657_100758003 | 218 |
| 254 | 3300025921 | Ga0207652_10039714 | Ga0207652_100397143 | 218 |
| 255 | 3300005354 | Ga0070675_100502423 | Ga0070675_1005024232 | 219 |
| 256 | 3300005441 | Ga0070700_100571608 | Ga0070700_1005716081 | 219 |
| 257 | 3300005457 | Ga0070662_100025255 | Ga0070662_1000252554 | 219 |
| 258 | 3300025933 | Ga0207706_10018586 | Ga0207706_100185866 | 219 |
| 259 | 3300025945 | Ga0207679_10806791 | Ga0207679_108067912 | 219 |
| 260 | 3300026075 | Ga0207708_10559252 | Ga0207708_105592522 | 219 |
| 261 | 3300035242 | Ga0373962_0077043 | Ga0373962_0077043_300_995 | 219 |
| 262 | 3300035691 | Ga0373931_0106010 | Ga0373931_0106010_691_1389 | 219 |
| 263 | 3300053153 | Ga0500616_0019413 | Ga0500616_0019413_678_1391 | 219 |
| 264 | 3300053153 | Ga0500616_0060193 | Ga0500616_0060193_983_1696 | 219 |
| 265 | 2209111006 | 2214928522 | 2213990018 | 220 |
| 266 | 3300000041 | ARcpr5oldR_c000029 | ARcpr5oldR_0000292 | 220 |
| 267 | 3300000043 | ARcpr5yngRDRAFT_c000051 | ARcpr5yngRDRAFT_0000512 | 220 |
| 268 | 3300000044 | ARSoilOldRDRAFT_c000078 | ARSoilOldRDRAFT_00007818 | 220 |
| 269 | 3300000652 | ARCol0yngRDRAFT_1000056 | ARCol0yngRDRAFT_10000563 | 220 |
| 270 | 3300001977 | JGI24746J21847_1003746 | JGI24746J21847_10037463 | 220 |
| 271 | 3300001989 | JGI24739J22299_10030177 | JGI24739J22299_100301772 | 220 |
| 272 | 3300001990 | JGI24737J22298_10004940 | JGI24737J22298_100049403 | 220 |
| 273 | 3300002067 | JGI24735J21928_10013679 | JGI24735J21928_100136793 | 220 |
| 274 | 3300002074 | JGI24748J21848_1010552 | JGI24748J21848_10105522 | 220 |
| 275 | 3300002075 | JGI24738J21930_10002997 | JGI24738J21930_100029974 | 220 |
| 276 | 3300002244 | JGI24742J22300_10000704 | JGI24742J22300_100007044 | 220 |
| 277 | 3300002459 | JGI24751J29686_10002080 | JGI24751J29686_100020803 | 220 |
| 278 | 3300003911 | JGI25405J52794_10013222 | JGI25405J52794_100132222 | 220 |
| 279 | 3300004801 | Ga0058860_12244705 | Ga0058860_122447052 | 220 |
| 280 | 3300005327 | Ga0070658_10394600 | Ga0070658_103946002 | 220 |
| 281 | 3300005328 | Ga0070676_10002129 | Ga0070676_100021298 | 220 |
| 282 | 3300005328 | Ga0070676_10047401 | Ga0070676_100474012 | 220 |
| 283 | 3300005329 | Ga0070683_100891918 | Ga0070683_1008919181 | 220 |
| 284 | 3300005330 | Ga0070690_100006642 | Ga0070690_1000066425 | 220 |
| 285 | 3300005330 | Ga0070690_100057438 | Ga0070690_1000574383 | 220 |
| 286 | 3300005330 | Ga0070690_100187886 | Ga0070690_1001878861 | 220 |
| 287 | 3300005331 | Ga0070670_100004057 | Ga0070670_10000405718 | 220 |
| 288 | 3300005331 | Ga0070670_100038299 | Ga0070670_1000382991 | 220 |
| 289 | 3300005331 | Ga0070670_100290917 | Ga0070670_1002909172 | 220 |
| 290 | 3300005334 | Ga0068869_100014379 | Ga0068869_1000143793 | 220 |
| 291 | 3300005334 | Ga0068869_100174207 | Ga0068869_1001742072 | 220 |
| 292 | 3300005335 | Ga0070666_10241792 | Ga0070666_102417921 | 220 |
| 293 | 3300005336 | Ga0070680_100029392 | Ga0070680_1000293924 | 220 |
| 294 | 3300005336 | Ga0070680_100160758 | Ga0070680_1001607582 | 220 |
| 295 | 3300005336 | Ga0070680_100308185 | Ga0070680_1003081851 | 220 |
| 296 | 3300005337 | Ga0070682_100015639 | Ga0070682_1000156398 | 220 |
| 297 | 3300005337 | Ga0070682_100441284 | Ga0070682_1004412841 | 220 |
| 298 | 3300005338 | Ga0068868_100005613 | Ga0068868_1000056134 | 220 |
| 299 | 3300005338 | Ga0068868_100036974 | Ga0068868_1000369741 | 220 |
| 300 | 3300005339 | Ga0070660_100010815 | Ga0070660_1000108155 | 220 |
| 301 | 3300005339 | Ga0070660_100022222 | Ga0070660_1000222224 | 220 |
| 302 | 3300005339 | Ga0070660_100477695 | Ga0070660_1004776951 | 220 |
| 303 | 3300005340 | Ga0070689_100007489 | Ga0070689_1000074897 | 220 |
| 304 | 3300005340 | Ga0070689_100011582 | Ga0070689_1000115823 | 220 |
| 305 | 3300005341 | Ga0070691_10005289 | Ga0070691_100052894 | 220 |
| 306 | 3300005343 | Ga0070687_100015721 | Ga0070687_1000157213 | 220 |
| 307 | 3300005343 | Ga0070687_100026522 | Ga0070687_1000265222 | 220 |
| 308 | 3300005344 | Ga0070661_100017368 | Ga0070661_1000173687 | 220 |
| 309 | 3300005344 | Ga0070661_100231185 | Ga0070661_1002311852 | 220 |
| 310 | 3300005345 | Ga0070692_10018977 | Ga0070692_100189772 | 220 |
| 311 | 3300005345 | Ga0070692_10039154 | Ga0070692_100391542 | 220 |
| 312 | 3300005345 | Ga0070692_10099585 | Ga0070692_100995851 | 220 |
| 313 | 3300005347 | Ga0070668_100019523 | Ga0070668_1000195233 | 220 |
| 314 | 3300005347 | Ga0070668_100048646 | Ga0070668_1000486463 | 220 |
| 315 | 3300005347 | Ga0070668_100222333 | Ga0070668_1002223331 | 220 |
| 316 | 3300005347 | Ga0070668_100252680 | Ga0070668_1002526802 | 220 |
| 317 | 3300005353 | Ga0070669_100011278 | Ga0070669_1000112788 | 220 |
| 318 | 3300005353 | Ga0070669_100187813 | Ga0070669_1001878132 | 220 |
| 319 | 3300005354 | Ga0070675_100017011 | Ga0070675_1000170116 | 220 |
| 320 | 3300005354 | Ga0070675_100106638 | Ga0070675_1001066382 | 220 |
| 321 | 3300005356 | Ga0070674_100013318 | Ga0070674_1000133184 | 220 |
| 322 | 3300005356 | Ga0070674_100649252 | Ga0070674_1006492522 | 220 |
| 323 | 3300005364 | Ga0070673_100003944 | Ga0070673_1000039447 | 220 |
| 324 | 3300005364 | Ga0070673_100018971 | Ga0070673_1000189712 | 220 |
| 325 | 3300005364 | Ga0070673_100180050 | Ga0070673_1001800503 | 220 |
| 326 | 3300005365 | Ga0070688_100014789 | Ga0070688_1000147894 | 220 |
| 327 | 3300005365 | Ga0070688_100046521 | Ga0070688_1000465213 | 220 |
| 328 | 3300005366 | Ga0070659_100013517 | Ga0070659_1000135173 | 220 |
| 329 | 3300005366 | Ga0070659_100015144 | Ga0070659_1000151444 | 220 |
| 330 | 3300005366 | Ga0070659_100696986 | Ga0070659_1006969862 | 220 |
| 331 | 3300005367 | Ga0070667_100013178 | Ga0070667_1000131784 | 220 |
| 332 | 3300005367 | Ga0070667_100043593 | Ga0070667_1000435933 | 220 |
| 333 | 3300005434 | Ga0070709_10006605 | Ga0070709_100066053 | 220 |
| 334 | 3300005435 | Ga0070714_100027773 | Ga0070714_1000277734 | 220 |
| 335 | 3300005435 | Ga0070714_100191018 | Ga0070714_1001910182 | 220 |
| 336 | 3300005435 | Ga0070714_100992837 | Ga0070714_1009928371 | 220 |
| 337 | 3300005436 | Ga0070713_100037677 | Ga0070713_1000376773 | 220 |
| 338 | 3300005436 | Ga0070713_100311927 | Ga0070713_1003119271 | 220 |
| 339 | 3300005436 | Ga0070713_100421322 | Ga0070713_1004213222 | 220 |
| 340 | 3300005437 | Ga0070710_10003341 | Ga0070710_100033414 | 220 |
| 341 | 3300005437 | Ga0070710_10122089 | Ga0070710_101220892 | 220 |
| 342 | 3300005438 | Ga0070701_10006970 | Ga0070701_100069704 | 220 |
| 343 | 3300005438 | Ga0070701_10009117 | Ga0070701_100091172 | 220 |
| 344 | 3300005439 | Ga0070711_100013443 | Ga0070711_1000134433 | 220 |
| 345 | 3300005439 | Ga0070711_100298801 | Ga0070711_1002988011 | 220 |
| 346 | 3300005440 | Ga0070705_100003401 | Ga0070705_1000034015 | 220 |
| 347 | 3300005440 | Ga0070705_100095309 | Ga0070705_1000953093 | 220 |
| 348 | 3300005441 | Ga0070700_100019859 | Ga0070700_1000198594 | 220 |
| 349 | 3300005444 | Ga0070694_100006936 | Ga0070694_1000069368 | 220 |
| 350 | 3300005444 | Ga0070694_100126740 | Ga0070694_1001267403 | 220 |
| 351 | 3300005445 | Ga0070708_100559591 | Ga0070708_1005595911 | 220 |
| 352 | 3300005456 | Ga0070678_100002678 | Ga0070678_1000026784 | 220 |
| 353 | 3300005456 | Ga0070678_100005200 | Ga0070678_1000052005 | 220 |
| 354 | 3300005457 | Ga0070662_100006628 | Ga0070662_1000066285 | 220 |
| 355 | 3300005457 | Ga0070662_100452576 | Ga0070662_1004525762 | 220 |
| 356 | 3300005458 | Ga0070681_10066676 | Ga0070681_100666762 | 220 |
| 357 | 3300005458 | Ga0070681_10102495 | Ga0070681_101024952 | 220 |
| 358 | 3300005458 | Ga0070681_10314513 | Ga0070681_103145132 | 220 |
| 359 | 3300005459 | Ga0068867_100016596 | Ga0068867_1000165963 | 220 |
| 360 | 3300005459 | Ga0068867_100046106 | Ga0068867_1000461062 | 220 |
| 361 | 3300005459 | Ga0068867_100272732 | Ga0068867_1002727322 | 220 |
| 362 | 3300005466 | Ga0070685_10043366 | Ga0070685_100433662 | 220 |
| 363 | 3300005466 | Ga0070685_10075324 | Ga0070685_100753243 | 220 |
| 364 | 3300005466 | Ga0070685_10138448 | Ga0070685_101384481 | 220 |
| 365 | 3300005467 | Ga0070706_100165424 | Ga0070706_1001654242 | 220 |
| 366 | 3300005468 | Ga0070707_100026730 | Ga0070707_1000267305 | 220 |
| 367 | 3300005471 | Ga0070698_100167580 | Ga0070698_1001675802 | 220 |
| 368 | 3300005518 | Ga0070699_100003057 | Ga0070699_1000030577 | 220 |
| 369 | 3300005518 | Ga0070699_100034397 | Ga0070699_1000343971 | 220 |
| 370 | 3300005518 | Ga0070699_100228510 | Ga0070699_1002285102 | 220 |
| 371 | 3300005518 | Ga0070699_100514407 | Ga0070699_1005144071 | 220 |
| 372 | 3300005530 | Ga0070679_100058680 | Ga0070679_1000586803 | 220 |
| 373 | 3300005535 | Ga0070684_100006691 | Ga0070684_1000066918 | 220 |
| 374 | 3300005535 | Ga0070684_100143283 | Ga0070684_1001432832 | 220 |
| 375 | 3300005535 | Ga0070684_100316858 | Ga0070684_1003168582 | 220 |
| 376 | 3300005536 | Ga0070697_100041373 | Ga0070697_1000413733 | 220 |
| 377 | 3300005536 | Ga0070697_100067714 | Ga0070697_1000677143 | 220 |
| 378 | 3300005536 | Ga0070697_100078970 | Ga0070697_1000789702 | 220 |
| 379 | 3300005536 | Ga0070697_100286719 | Ga0070697_1002867192 | 220 |
| 380 | 3300005539 | Ga0068853_100000376 | Ga0068853_10000037635 | 220 |
| 381 | 3300005539 | Ga0068853_100584428 | Ga0068853_1005844282 | 220 |
| 382 | 3300005543 | Ga0070672_100009766 | Ga0070672_10000976610 | 220 |
| 383 | 3300005543 | Ga0070672_100092673 | Ga0070672_1000926733 | 220 |
| 384 | 3300005544 | Ga0070686_100010021 | Ga0070686_1000100213 | 220 |
| 385 | 3300005544 | Ga0070686_100062851 | Ga0070686_1000628512 | 220 |
| 386 | 3300005544 | Ga0070686_100135679 | Ga0070686_1001356791 | 220 |
| 387 | 3300005545 | Ga0070695_100007768 | Ga0070695_1000077684 | 220 |
| 388 | 3300005545 | Ga0070695_100019183 | Ga0070695_1000191836 | 220 |
| 389 | 3300005546 | Ga0070696_100022964 | Ga0070696_1000229646 | 220 |
| 390 | 3300005546 | Ga0070696_100053993 | Ga0070696_1000539933 | 220 |
| 391 | 3300005546 | Ga0070696_100067110 | Ga0070696_1000671102 | 220 |
| 392 | 3300005547 | Ga0070693_100003980 | Ga0070693_1000039804 | 220 |
| 393 | 3300005548 | Ga0070665_100042930 | Ga0070665_1000429305 | 220 |
| 394 | 3300005548 | Ga0070665_100164532 | Ga0070665_1001645323 | 220 |
| 395 | 3300005549 | Ga0070704_100081023 | Ga0070704_1000810232 | 220 |
| 396 | 3300005563 | Ga0068855_100067656 | Ga0068855_1000676564 | 220 |
| 397 | 3300005564 | Ga0070664_100047854 | Ga0070664_1000478543 | 220 |
| 398 | 3300005564 | Ga0070664_100103611 | Ga0070664_1001036113 | 220 |
| 399 | 3300005564 | Ga0070664_100104155 | Ga0070664_1001041551 | 220 |
| 400 | 3300005577 | Ga0068857_100023355 | Ga0068857_1000233553 | 220 |
| 401 | 3300005577 | Ga0068857_100518800 | Ga0068857_1005188001 | 220 |
| 402 | 3300005578 | Ga0068854_100003463 | Ga0068854_10000346315 | 220 |
| 403 | 3300005578 | Ga0068854_100064955 | Ga0068854_1000649552 | 220 |
| 404 | 3300005614 | Ga0068856_100042339 | Ga0068856_1000423392 | 220 |
| 405 | 3300005614 | Ga0068856_100272674 | Ga0068856_1002726741 | 220 |
| 406 | 3300005615 | Ga0070702_100003706 | Ga0070702_1000037067 | 220 |
| 407 | 3300005615 | Ga0070702_100023799 | Ga0070702_1000237993 | 220 |
| 408 | 3300005616 | Ga0068852_100029426 | Ga0068852_1000294262 | 220 |
| 409 | 3300005616 | Ga0068852_100033664 | Ga0068852_1000336644 | 220 |
| 410 | 3300005616 | Ga0068852_100273955 | Ga0068852_1002739552 | 220 |
| 411 | 3300005617 | Ga0068859_100079841 | Ga0068859_1000798412 | 220 |
| 412 | 3300005617 | Ga0068859_100114714 | Ga0068859_1001147143 | 220 |
| 413 | 3300005617 | Ga0068859_100392377 | Ga0068859_1003923772 | 220 |
| 414 | 3300005617 | Ga0068859_100720392 | Ga0068859_1007203921 | 220 |
| 415 | 3300005617 | Ga0068859_100734612 | Ga0068859_1007346121 | 220 |
| 416 | 3300005618 | Ga0068864_100069586 | Ga0068864_1000695863 | 220 |
| 417 | 3300005618 | Ga0068864_100082154 | Ga0068864_1000821543 | 220 |
| 418 | 3300005718 | Ga0068866_10078729 | Ga0068866_100787291 | 220 |
| 419 | 3300005718 | Ga0068866_10101864 | Ga0068866_101018642 | 220 |
| 420 | 3300005718 | Ga0068866_10186731 | Ga0068866_101867312 | 220 |
| 421 | 3300005719 | Ga0068861_100006236 | Ga0068861_1000062367 | 220 |
| 422 | 3300005719 | Ga0068861_100153893 | Ga0068861_1001538932 | 220 |
| 423 | 3300005719 | Ga0068861_100466570 | Ga0068861_1004665702 | 220 |
| 424 | 3300005840 | Ga0068870_10006425 | Ga0068870_100064256 | 220 |
| 425 | 3300005841 | Ga0068863_100018294 | Ga0068863_1000182944 | 220 |
| 426 | 3300005841 | Ga0068863_100513545 | Ga0068863_1005135452 | 220 |
| 427 | 3300005842 | Ga0068858_100035282 | Ga0068858_1000352822 | 220 |
| 428 | 3300005842 | Ga0068858_100098222 | Ga0068858_1000982223 | 220 |
| 429 | 3300005842 | Ga0068858_100208792 | Ga0068858_1002087922 | 220 |
| 430 | 3300005843 | Ga0068860_100016023 | Ga0068860_1000160235 | 220 |
| 431 | 3300005843 | Ga0068860_100063689 | Ga0068860_1000636893 | 220 |
| 432 | 3300005843 | Ga0068860_100747111 | Ga0068860_1007471111 | 220 |
| 433 | 3300005844 | Ga0068862_100004930 | Ga0068862_1000049302 | 220 |
| 434 | 3300005844 | Ga0068862_100031507 | Ga0068862_1000315072 | 220 |
| 435 | 3300005844 | Ga0068862_100343665 | Ga0068862_1003436651 | 220 |
| 436 | 3300005937 | Ga0081455_10003621 | Ga0081455_100036213 | 220 |
| 437 | 3300005937 | Ga0081455_10013398 | Ga0081455_100133982 | 220 |
| 438 | 3300005937 | Ga0081455_10025326 | Ga0081455_100253266 | 220 |
| 439 | 3300005937 | Ga0081455_10095805 | Ga0081455_100958052 | 220 |
| 440 | 3300005981 | Ga0081538_10055925 | Ga0081538_100559252 | 220 |
| 441 | 3300005983 | Ga0081540_1037632 | Ga0081540_10376323 | 220 |
| 442 | 3300005983 | Ga0081540_1116838 | Ga0081540_11168381 | 220 |
| 443 | 3300006028 | Ga0070717_10195444 | Ga0070717_101954442 | 220 |
| 444 | 3300006028 | Ga0070717_10235082 | Ga0070717_102350822 | 220 |
| 445 | 3300006038 | Ga0075365_10042900 | Ga0075365_100429002 | 220 |
| 446 | 3300006038 | Ga0075365_10436465 | Ga0075365_104364651 | 220 |
| 447 | 3300006051 | Ga0075364_10286056 | Ga0075364_102860561 | 220 |
| 448 | 3300006163 | Ga0070715_10001242 | Ga0070715_100012425 | 220 |
| 449 | 3300006163 | Ga0070715_10403016 | Ga0070715_104030161 | 220 |
| 450 | 3300006173 | Ga0070716_100015185 | Ga0070716_1000151853 | 220 |
| 451 | 3300006175 | Ga0070712_100063748 | Ga0070712_1000637483 | 220 |
| 452 | 3300006175 | Ga0070712_100114813 | Ga0070712_1001148131 | 220 |
| 453 | 3300006178 | Ga0075367_10070817 | Ga0075367_100708172 | 220 |
| 454 | 3300006237 | Ga0097621_100008916 | Ga0097621_1000089164 | 220 |
| 455 | 3300006237 | Ga0097621_100108772 | Ga0097621_1001087722 | 220 |
| 456 | 3300006358 | Ga0068871_100222881 | Ga0068871_1002228812 | 220 |
| 457 | 3300006844 | Ga0075428_100054716 | Ga0075428_1000547163 | 220 |
| 458 | 3300006844 | Ga0075428_100061750 | Ga0075428_1000617503 | 220 |
| 459 | 3300006844 | Ga0075428_100079781 | Ga0075428_1000797812 | 220 |
| 460 | 3300006844 | Ga0075428_100476022 | Ga0075428_1004760222 | 220 |
| 461 | 3300006844 | Ga0075428_100502510 | Ga0075428_1005025102 | 220 |
| 462 | 3300006846 | Ga0075430_100253888 | Ga0075430_1002538881 | 220 |
| 463 | 3300006846 | Ga0075430_100466794 | Ga0075430_1004667942 | 220 |
| 464 | 3300006846 | Ga0075430_100755967 | Ga0075430_1007559671 | 220 |
| 465 | 3300006847 | Ga0075431_100149005 | Ga0075431_1001490053 | 220 |
| 466 | 3300006847 | Ga0075431_100181948 | Ga0075431_1001819483 | 220 |
| 467 | 3300006847 | Ga0075431_100239256 | Ga0075431_1002392562 | 220 |
| 468 | 3300006847 | Ga0075431_100239673 | Ga0075431_1002396732 | 220 |
| 469 | 3300006847 | Ga0075431_100316153 | Ga0075431_1003161532 | 220 |
| 470 | 3300006852 | Ga0075433_10141955 | Ga0075433_101419552 | 220 |
| 471 | 3300006852 | Ga0075433_10220248 | Ga0075433_102202483 | 220 |
| 472 | 3300006871 | Ga0075434_100018218 | Ga0075434_1000182186 | 220 |
| 473 | 3300006871 | Ga0075434_100073924 | Ga0075434_1000739243 | 220 |
| 474 | 3300006871 | Ga0075434_100355260 | Ga0075434_1003552602 | 220 |
| 475 | 3300006871 | Ga0075434_100428612 | Ga0075434_1004286122 | 220 |
| 476 | 3300006880 | Ga0075429_100108978 | Ga0075429_1001089781 | 220 |
| 477 | 3300006880 | Ga0075429_100610307 | Ga0075429_1006103071 | 220 |
| 478 | 3300006881 | Ga0068865_100006959 | Ga0068865_10000695910 | 220 |
| 479 | 3300006914 | Ga0075436_100153735 | Ga0075436_1001537352 | 220 |
| 480 | 3300006914 | Ga0075436_100334652 | Ga0075436_1003346522 | 220 |
| 481 | 3300006931 | Ga0097620_100079842 | Ga0097620_1000798422 | 220 |
| 482 | 3300006931 | Ga0097620_100114715 | Ga0097620_1001147153 | 220 |
| 483 | 3300006931 | Ga0097620_100392386 | Ga0097620_1003923861 | 220 |
| 484 | 3300006931 | Ga0097620_100720265 | Ga0097620_1007202652 | 220 |
| 485 | 3300006931 | Ga0097620_100734654 | Ga0097620_1007346541 | 220 |
| 486 | 3300007076 | Ga0075435_100179244 | Ga0075435_1001792442 | 220 |
| 487 | 3300007076 | Ga0075435_100213279 | Ga0075435_1002132792 | 220 |
| 488 | 3300007076 | Ga0075435_100291542 | Ga0075435_1002915423 | 220 |
| 489 | 3300009011 | Ga0105251_10021088 | Ga0105251_100210882 | 220 |
| 490 | 3300009036 | Ga0105244_10246773 | Ga0105244_102467731 | 220 |
| 491 | 3300009092 | Ga0105250_10038616 | Ga0105250_100386161 | 220 |
| 492 | 3300009094 | Ga0111539_10007739 | Ga0111539_100077393 | 220 |
| 493 | 3300009094 | Ga0111539_10166482 | Ga0111539_101664824 | 220 |
| 494 | 3300009094 | Ga0111539_10190904 | Ga0111539_101909042 | 220 |
| 495 | 3300009094 | Ga0111539_10549428 | Ga0111539_105494281 | 220 |
| 496 | 3300009094 | Ga0111539_11012060 | Ga0111539_110120601 | 220 |
| 497 | 3300009098 | Ga0105245_10375635 | Ga0105245_103756351 | 220 |
| 498 | 3300009098 | Ga0105245_10713630 | Ga0105245_107136302 | 220 |
| 499 | 3300009101 | Ga0105247_10007920 | Ga0105247_100079207 | 220 |
| 500 | 3300009101 | Ga0105247_10029012 | Ga0105247_100290122 | 220 |
| 501 | 3300009101 | Ga0105247_10050052 | Ga0105247_100500521 | 220 |
| 502 | 3300009147 | Ga0114129_10003643 | Ga0114129_100036437 | 220 |
| 503 | 3300009147 | Ga0114129_11362965 | Ga0114129_113629651 | 220 |
| 504 | 3300009148 | Ga0105243_10017817 | Ga0105243_100178177 | 220 |
| 505 | 3300009148 | Ga0105243_10120108 | Ga0105243_101201082 | 220 |
| 506 | 3300009148 | Ga0105243_10254143 | Ga0105243_102541431 | 220 |
| 507 | 3300009174 | Ga0105241_10010359 | Ga0105241_100103597 | 220 |
| 508 | 3300009176 | Ga0105242_10599018 | Ga0105242_105990181 | 220 |
| 509 | 3300009177 | Ga0105248_10080754 | Ga0105248_100807545 | 220 |
| 510 | 3300009177 | Ga0105248_10094904 | Ga0105248_100949041 | 220 |
| 511 | 3300009545 | Ga0105237_10021014 | Ga0105237_100210144 | 220 |
| 512 | 3300009545 | Ga0105237_10031168 | Ga0105237_100311683 | 220 |
| 513 | 3300009545 | Ga0105237_10291831 | Ga0105237_102918312 | 220 |
| 514 | 3300009545 | Ga0105237_10401229 | Ga0105237_104012292 | 220 |
| 515 | 3300009551 | Ga0105238_10046148 | Ga0105238_100461482 | 220 |
| 516 | 3300009551 | Ga0105238_10065646 | Ga0105238_100656462 | 220 |
| 517 | 3300009553 | Ga0105249_10006636 | Ga0105249_100066369 | 220 |
| 518 | 3300009553 | Ga0105249_10016803 | Ga0105249_100168037 | 220 |
| 519 | 3300009553 | Ga0105249_10361965 | Ga0105249_103619651 | 220 |
| 520 | 3300010159 | Ga0099796_10055339 | Ga0099796_100553392 | 220 |
| 521 | 3300010375 | Ga0105239_10018417 | Ga0105239_100184175 | 220 |
| 522 | 3300010375 | Ga0105239_10058349 | Ga0105239_100583491 | 220 |
| 523 | 3300010375 | Ga0105239_10852918 | Ga0105239_108529182 | 220 |
| 524 | 3300011119 | Ga0105246_10020654 | Ga0105246_100206544 | 220 |
| 525 | 3300011119 | Ga0105246_10285247 | Ga0105246_102852472 | 220 |
| 526 | 3300011119 | Ga0105246_10289894 | Ga0105246_102898941 | 220 |
| 527 | 3300012513 | Ga0157326_1021439 | Ga0157326_10214392 | 220 |
| 528 | 3300012515 | Ga0157338_1000385 | Ga0157338_10003852 | 220 |
| 529 | 3300013100 | Ga0157373_10025646 | Ga0157373_100256463 | 220 |
| 530 | 3300013100 | Ga0157373_10163244 | Ga0157373_101632442 | 220 |
| 531 | 3300013102 | Ga0157371_10007096 | Ga0157371_100070968 | 220 |
| 532 | 3300013104 | Ga0157370_10139565 | Ga0157370_101395652 | 220 |
| 533 | 3300013105 | Ga0157369_10002471 | Ga0157369_1000247128 | 220 |
| 534 | 3300013296 | Ga0157374_10041948 | Ga0157374_100419482 | 220 |
| 535 | 3300013297 | Ga0157378_10018527 | Ga0157378_100185275 | 220 |
| 536 | 3300013297 | Ga0157378_10127919 | Ga0157378_101279194 | 220 |
| 537 | 3300013297 | Ga0157378_10134727 | Ga0157378_101347274 | 220 |
| 538 | 3300013297 | Ga0157378_10256495 | Ga0157378_102564952 | 220 |
| 539 | 3300013306 | Ga0163162_10021249 | Ga0163162_100212495 | 220 |
| 540 | 3300013306 | Ga0163162_10026452 | Ga0163162_100264523 | 220 |
| 541 | 3300013307 | Ga0157372_10024481 | Ga0157372_100244815 | 220 |
| 542 | 3300013307 | Ga0157372_10380283 | Ga0157372_103802832 | 220 |
| 543 | 3300013308 | Ga0157375_10017827 | Ga0157375_100178276 | 220 |
| 544 | 3300013308 | Ga0157375_10076749 | Ga0157375_100767491 | 220 |
| 545 | 3300013308 | Ga0157375_10305601 | Ga0157375_103056012 | 220 |
| 546 | 3300013308 | Ga0157375_11505486 | Ga0157375_115054861 | 220 |
| 547 | 3300014325 | Ga0163163_10018211 | Ga0163163_100182113 | 220 |
| 548 | 3300014325 | Ga0163163_10099847 | Ga0163163_100998473 | 220 |
| 549 | 3300014326 | Ga0157380_10009789 | Ga0157380_100097897 | 220 |
| 550 | 3300014497 | Ga0182008_10043993 | Ga0182008_100439932 | 220 |
| 551 | 3300014745 | Ga0157377_10006484 | Ga0157377_100064847 | 220 |
| 552 | 3300014968 | Ga0157379_10016635 | Ga0157379_100166356 | 220 |
| 553 | 3300014968 | Ga0157379_10079062 | Ga0157379_100790621 | 220 |
| 554 | 3300014969 | Ga0157376_10010367 | Ga0157376_100103677 | 220 |
| 555 | 3300017792 | Ga0163161_10013788 | Ga0163161_100137886 | 220 |
| 556 | 3300017792 | Ga0163161_10237339 | Ga0163161_102373392 | 220 |
| 557 | 3300020082 | Ga0206353_10213769 | Ga0206353_102137691 | 220 |
| 558 | 3300021361 | Ga0213872_10042183 | Ga0213872_100421832 | 220 |
| 559 | 3300021384 | Ga0213876_10056585 | Ga0213876_100565852 | 220 |
| 560 | 3300025315 | Ga0207697_10154966 | Ga0207697_101549661 | 220 |
| 561 | 3300025321 | Ga0207656_10130556 | Ga0207656_101305561 | 220 |
| 562 | 3300025711 | Ga0207696_1016412 | Ga0207696_10164122 | 220 |
| 563 | 3300025899 | Ga0207642_10227563 | Ga0207642_102275632 | 220 |
| 564 | 3300025900 | Ga0207710_10003935 | Ga0207710_100039355 | 220 |
| 565 | 3300025901 | Ga0207688_10007776 | Ga0207688_100077765 | 220 |
| 566 | 3300025901 | Ga0207688_10008435 | Ga0207688_100084353 | 220 |
| 567 | 3300025901 | Ga0207688_10052345 | Ga0207688_100523453 | 220 |
| 568 | 3300025903 | Ga0207680_10010818 | Ga0207680_100108187 | 220 |
| 569 | 3300025904 | Ga0207647_10001204 | Ga0207647_100012047 | 220 |
| 570 | 3300025904 | Ga0207647_10024058 | Ga0207647_100240582 | 220 |
| 571 | 3300025904 | Ga0207647_10029533 | Ga0207647_100295335 | 220 |
| 572 | 3300025905 | Ga0207685_10003251 | Ga0207685_100032513 | 220 |
| 573 | 3300025907 | Ga0207645_10007301 | Ga0207645_100073015 | 220 |
| 574 | 3300025907 | Ga0207645_10044077 | Ga0207645_100440772 | 220 |
| 575 | 3300025907 | Ga0207645_10056961 | Ga0207645_100569612 | 220 |
| 576 | 3300025908 | Ga0207643_10001337 | Ga0207643_100013374 | 220 |
| 577 | 3300025909 | Ga0207705_10051854 | Ga0207705_100518543 | 220 |
| 578 | 3300025910 | Ga0207684_10021159 | Ga0207684_100211593 | 220 |
| 579 | 3300025910 | Ga0207684_10169158 | Ga0207684_101691582 | 220 |
| 580 | 3300025910 | Ga0207684_10170271 | Ga0207684_101702711 | 220 |
| 581 | 3300025910 | Ga0207684_10553354 | Ga0207684_105533542 | 220 |
| 582 | 3300025911 | Ga0207654_10007959 | Ga0207654_100079596 | 220 |
| 583 | 3300025912 | Ga0207707_10205781 | Ga0207707_102057812 | 220 |
| 584 | 3300025912 | Ga0207707_10278001 | Ga0207707_102780012 | 220 |
| 585 | 3300025912 | Ga0207707_10404492 | Ga0207707_104044921 | 220 |
| 586 | 3300025914 | Ga0207671_10031657 | Ga0207671_100316574 | 220 |
| 587 | 3300025914 | Ga0207671_10091047 | Ga0207671_100910472 | 220 |
| 588 | 3300025915 | Ga0207693_10010373 | Ga0207693_100103735 | 220 |
| 589 | 3300025915 | Ga0207693_10028298 | Ga0207693_100282981 | 220 |
| 590 | 3300025915 | Ga0207693_10060332 | Ga0207693_100603322 | 220 |
| 591 | 3300025915 | Ga0207693_10175100 | Ga0207693_101751002 | 220 |
| 592 | 3300025916 | Ga0207663_10005810 | Ga0207663_100058105 | 220 |
| 593 | 3300025917 | Ga0207660_10095630 | Ga0207660_100956302 | 220 |
| 594 | 3300025917 | Ga0207660_10256790 | Ga0207660_102567902 | 220 |
| 595 | 3300025917 | Ga0207660_10343904 | Ga0207660_103439042 | 220 |
| 596 | 3300025918 | Ga0207662_10008664 | Ga0207662_100086642 | 220 |
| 597 | 3300025918 | Ga0207662_10035336 | Ga0207662_100353363 | 220 |
| 598 | 3300025919 | Ga0207657_10000186 | Ga0207657_100001867 | 220 |
| 599 | 3300025919 | Ga0207657_10017486 | Ga0207657_100174865 | 220 |
| 600 | 3300025920 | Ga0207649_10011692 | Ga0207649_100116925 | 220 |
| 601 | 3300025921 | Ga0207652_10097434 | Ga0207652_100974343 | 220 |
| 602 | 3300025922 | Ga0207646_10065570 | Ga0207646_100655702 | 220 |
| 603 | 3300025922 | Ga0207646_10098788 | Ga0207646_100987882 | 220 |
| 604 | 3300025923 | Ga0207681_10011812 | Ga0207681_100118124 | 220 |
| 605 | 3300025924 | Ga0207694_10288847 | Ga0207694_102888472 | 220 |
| 606 | 3300025924 | Ga0207694_10418040 | Ga0207694_104180402 | 220 |
| 607 | 3300025925 | Ga0207650_10044073 | Ga0207650_100440731 | 220 |
| 608 | 3300025925 | Ga0207650_10100950 | Ga0207650_101009503 | 220 |
| 609 | 3300025925 | Ga0207650_10117429 | Ga0207650_101174291 | 220 |
| 610 | 3300025925 | Ga0207650_10180325 | Ga0207650_101803252 | 220 |
| 611 | 3300025925 | Ga0207650_10447848 | Ga0207650_104478482 | 220 |
| 612 | 3300025926 | Ga0207659_10042756 | Ga0207659_100427563 | 220 |
| 613 | 3300025927 | Ga0207687_10333703 | Ga0207687_103337032 | 220 |
| 614 | 3300025928 | Ga0207700_10410430 | Ga0207700_104104301 | 220 |
| 615 | 3300025931 | Ga0207644_10010543 | Ga0207644_100105434 | 220 |
| 616 | 3300025931 | Ga0207644_10075355 | Ga0207644_100753552 | 220 |
| 617 | 3300025932 | Ga0207690_10018543 | Ga0207690_100185434 | 220 |
| 618 | 3300025932 | Ga0207690_10071987 | Ga0207690_100719873 | 220 |
| 619 | 3300025932 | Ga0207690_10322211 | Ga0207690_103222112 | 220 |
| 620 | 3300025932 | Ga0207690_10617743 | Ga0207690_106177431 | 220 |
| 621 | 3300025933 | Ga0207706_10014913 | Ga0207706_100149138 | 220 |
| 622 | 3300025933 | Ga0207706_10017451 | Ga0207706_100174513 | 220 |
| 623 | 3300025934 | Ga0207686_10034591 | Ga0207686_100345913 | 220 |
| 624 | 3300025934 | Ga0207686_10178954 | Ga0207686_101789541 | 220 |
| 625 | 3300025935 | Ga0207709_10004698 | Ga0207709_100046981 | 220 |
| 626 | 3300025935 | Ga0207709_10075527 | Ga0207709_100755272 | 220 |
| 627 | 3300025935 | Ga0207709_10349118 | Ga0207709_103491182 | 220 |
| 628 | 3300025936 | Ga0207670_10020974 | Ga0207670_100209741 | 220 |
| 629 | 3300025936 | Ga0207670_10028654 | Ga0207670_100286543 | 220 |
| 630 | 3300025937 | Ga0207669_10112928 | Ga0207669_101129282 | 220 |
| 631 | 3300025938 | Ga0207704_10261411 | Ga0207704_102614111 | 220 |
| 632 | 3300025939 | Ga0207665_10000186 | Ga0207665_1000018643 | 220 |
| 633 | 3300025939 | Ga0207665_10049910 | Ga0207665_100499102 | 220 |
| 634 | 3300025940 | Ga0207691_10028104 | Ga0207691_100281042 | 220 |
| 635 | 3300025940 | Ga0207691_10057591 | Ga0207691_100575913 | 220 |
| 636 | 3300025942 | Ga0207689_10014632 | Ga0207689_100146327 | 220 |
| 637 | 3300025945 | Ga0207679_10009670 | Ga0207679_100096704 | 220 |
| 638 | 3300025945 | Ga0207679_10059275 | Ga0207679_100592753 | 220 |
| 639 | 3300025945 | Ga0207679_10267382 | Ga0207679_102673822 | 220 |
| 640 | 3300025949 | Ga0207667_10046869 | Ga0207667_100468694 | 220 |
| 641 | 3300025949 | Ga0207667_10547570 | Ga0207667_105475702 | 220 |
| 642 | 3300025960 | Ga0207651_10016924 | Ga0207651_100169244 | 220 |
| 643 | 3300025961 | Ga0207712_10012149 | Ga0207712_100121496 | 220 |
| 644 | 3300025972 | Ga0207668_10035080 | Ga0207668_100350803 | 220 |
| 645 | 3300025981 | Ga0207640_10025655 | Ga0207640_100256554 | 220 |
| 646 | 3300025986 | Ga0207658_10043934 | Ga0207658_100439343 | 220 |
| 647 | 3300025986 | Ga0207658_10748777 | Ga0207658_107487771 | 220 |
| 648 | 3300026023 | Ga0207677_10063120 | Ga0207677_100631203 | 220 |
| 649 | 3300026035 | Ga0207703_10054180 | Ga0207703_100541801 | 220 |
| 650 | 3300026035 | Ga0207703_10983607 | Ga0207703_109836072 | 220 |
| 651 | 3300026041 | Ga0207639_10134191 | Ga0207639_101341912 | 220 |
| 652 | 3300026067 | Ga0207678_10012836 | Ga0207678_100128365 | 220 |
| 653 | 3300026067 | Ga0207678_10020810 | Ga0207678_100208102 | 220 |
| 654 | 3300026075 | Ga0207708_10000624 | Ga0207708_1000062410 | 220 |
| 655 | 3300026075 | Ga0207708_10033947 | Ga0207708_100339471 | 220 |
| 656 | 3300026075 | Ga0207708_10034414 | Ga0207708_100344142 | 220 |
| 657 | 3300026075 | Ga0207708_10275336 | Ga0207708_102753362 | 220 |
| 658 | 3300026078 | Ga0207702_10095493 | Ga0207702_100954932 | 220 |
| 659 | 3300026088 | Ga0207641_10024810 | Ga0207641_100248105 | 220 |
| 660 | 3300026088 | Ga0207641_10033009 | Ga0207641_100330094 | 220 |
| 661 | 3300026089 | Ga0207648_10001430 | Ga0207648_100014306 | 220 |
| 662 | 3300026089 | Ga0207648_10051427 | Ga0207648_100514273 | 220 |
| 663 | 3300026095 | Ga0207676_10007995 | Ga0207676_100079952 | 220 |
| 664 | 3300026095 | Ga0207676_10067109 | Ga0207676_100671092 | 220 |
| 665 | 3300026095 | Ga0207676_10152114 | Ga0207676_101521142 | 220 |
| 666 | 3300026116 | Ga0207674_10032377 | Ga0207674_100323777 | 220 |
| 667 | 3300026116 | Ga0207674_10519549 | Ga0207674_105195492 | 220 |
| 668 | 3300026118 | Ga0207675_100000447 | Ga0207675_10000044743 | 220 |
| 669 | 3300026118 | Ga0207675_100008098 | Ga0207675_1000080983 | 220 |
| 670 | 3300026118 | Ga0207675_100150332 | Ga0207675_1001503322 | 220 |
| 671 | 3300026118 | Ga0207675_100494770 | Ga0207675_1004947701 | 220 |
| 672 | 3300026121 | Ga0207683_10013771 | Ga0207683_100137714 | 220 |
| 673 | 3300026121 | Ga0207683_10046039 | Ga0207683_100460392 | 220 |
| 674 | 3300026121 | Ga0207683_10284271 | Ga0207683_102842712 | 220 |
| 675 | 3300026142 | Ga0207698_10452124 | Ga0207698_104521241 | 220 |
| 676 | 3300027512 | Ga0209179_1007258 | Ga0209179_10072582 | 220 |
| 677 | 3300027695 | Ga0209966_1002326 | Ga0209966_10023262 | 220 |
| 678 | 3300027717 | Ga0209998_10001533 | Ga0209998_100015332 | 220 |
| 679 | 3300027907 | Ga0207428_10014000 | Ga0207428_100140007 | 220 |
| 680 | 3300027907 | Ga0207428_10061624 | Ga0207428_100616241 | 220 |
| 681 | 3300028379 | Ga0268266_10181263 | Ga0268266_101812633 | 220 |
| 682 | 3300028380 | Ga0268265_10061051 | Ga0268265_100610515 | 220 |
| 683 | 3300028381 | Ga0268264_10032764 | Ga0268264_100327642 | 220 |
| 684 | 3300028381 | Ga0268264_10089680 | Ga0268264_100896803 | 220 |
| 685 | 3300028381 | Ga0268264_10119697 | Ga0268264_101196972 | 220 |
| 686 | 3300028381 | Ga0268264_10556571 | Ga0268264_105565712 | 220 |
| 687 | 3300031344 | Ga0265316_10296434 | Ga0265316_102964341 | 220 |
| 688 | 3300031456 | Ga0307513_10103448 | Ga0307513_101034483 | 220 |
| 689 | 3300034816 | Ga0373930_0000578 | Ga0373930_0000578_1466_2164 | 220 |
| 690 | 3300034820 | Ga0373959_0004468 | Ga0373959_0004468_928_1626 | 220 |
| 691 | 3300034957 | Ga0373938_0000028 | Ga0373938_0000028_17048_17746 | 220 |
| 692 | 3300035084 | Ga0373928_0030401 | Ga0373928_0030401_392_1090 | 220 |
| 693 | 3300035085 | Ga0373929_0025611 | Ga0373929_0025611_305_1003 | 220 |
| 694 | 3300035088 | Ga0373940_0010637 | Ga0373940_0010637_327_1028 | 220 |
| 695 | 3300035091 | Ga0373951_0000666 | Ga0373951_0000666_198_896 | 220 |
| 696 | 3300035092 | Ga0373952_0006012 | Ga0373952_0006012_289_987 | 220 |
| 697 | 3300035112 | Ga0373932_0000749 | Ga0373932_0000749_1611_2309 | 220 |
| 698 | 3300035113 | Ga0373936_0107817 | Ga0373936_0107817_181_882 | 220 |
| 699 | 3300035117 | Ga0373953_0002640 | Ga0373953_0002640_2695_3402 | 220 |
| 700 | 3300035118 | Ga0373954_0003770 | Ga0373954_0003770_292_999 | 220 |
| 701 | 3300035171 | Ga0373946_0005589 | Ga0373946_0005589_3613_4320 | 220 |
| 702 | 3300035171 | Ga0373946_0053840 | Ga0373946_0053840_491_1228 | 220 |
| 703 | 3300035171 | Ga0373946_0311760 | Ga0373946_0311760_37_738 | 220 |
| 704 | 3300035172 | Ga0373955_0002025 | Ga0373955_0002025_2016_2723 | 220 |
| 705 | 3300035207 | Ga0373942_0023984 | Ga0373942_0023984_639_1337 | 220 |
| 706 | 3300035241 | Ga0373961_0042708 | Ga0373961_0042708_397_1095 | 220 |
| 707 | 3300035242 | Ga0373962_0000881 | Ga0373962_0000881_453_1151 | 220 |
| 708 | 3300035242 | Ga0373962_0101582 | Ga0373962_0101582_149_850 | 220 |
| 709 | 3300035691 | Ga0373931_0178320 | Ga0373931_0178320_106_807 | 220 |
| 710 | 3300035692 | Ga0373935_0000179 | Ga0373935_0000179_6200_6907 | 220 |
| 711 | 3300035695 | Ga0373927_0118199 | Ga0373927_0118199_434_1141 | 220 |
| 712 | 3300035695 | Ga0373927_0147978 | Ga0373927_0147978_72_773 | 220 |
| 713 | 3300035724 | Ga0373933_0002450 | Ga0373933_0002450_9463_10170 | 220 |
| 714 | 3300035725 | Ga0373947_0382683 | Ga0373947_0382683_126_827 | 220 |
| 715 | 3300036401 | Ga0373937_0000864 | Ga0373937_0000864_19755_20462 | 220 |
| 716 | 3300036401 | Ga0373937_0172623 | Ga0373937_0172623_468_1271 | 220 |
| 717 | 3300037068 | Ga0373925_0000639 | Ga0373925_0000639_19742_20449 | 220 |
| 718 | 3300037068 | Ga0373925_0004022 | Ga0373925_0004022_10176_10913 | 220 |
| 719 | 3300037068 | Ga0373925_0197594 | Ga0373925_0197594_131_835 | 220 |
| 720 | 3300037312 | Ga0395899_0368606 | Ga0395899_0368606_148_849 | 220 |
| 721 | 3300037418 | Ga0395900_0017207 | Ga0395900_0017207_1315_2016 | 220 |
| 722 | 3300037466 | Ga0395898_0011333 | Ga0395898_0011333_2789_3490 | 220 |
| 723 | 3300037466 | Ga0395898_0660310 | Ga0395898_0660310_157_858 | 220 |
| 724 | 3300037471 | Ga0395905_0002399 | Ga0395905_0002399_5164_5865 | 220 |
| 725 | 3300037471 | Ga0395905_0112548 | Ga0395905_0112548_1796_2497 | 220 |
| 726 | 3300039437 | Ga0436365_1134850 | Ga0436365_1134850_27_728 | 220 |
| 727 | 3300039437 | Ga0436365_1428872 | Ga0436365_1428872_7676_8377 | 220 |
| 728 | 3300039447 | Ga0436361_0166397 | Ga0436361_0166397_11139_11840 | 220 |
| 729 | 3300042876 | Ga0451577_0363956 | Ga0451577_0363956_51_749 | 220 |
| 730 | 3300044712 | Ga0453684_0097934 | Ga0453684_0097934_2137_2835 | 220 |
| 731 | 3300045051 | Ga0451576_0088025 | Ga0451576_0088025_1800_2498 | 220 |
| 732 | 3300046453 | Ga0495627_079143 | Ga0495627_079143_38_739 | 220 |
| 733 | 3300046454 | Ga0495592_0000348 | Ga0495592_0000348_26002_26709 | 220 |
| 734 | 3300046455 | Ga0495603_0031637 | Ga0495603_0031637_2221_2922 | 220 |
| 735 | 3300046459 | Ga0495629_0027169 | Ga0495629_0027169_719_1426 | 220 |
| 736 | 3300046461 | Ga0495641_0011562 | Ga0495641_0011562_1117_1818 | 220 |
| 737 | 3300046462 | Ga0495651_0000781 | Ga0495651_0000781_19779_20486 | 220 |
| 738 | 3300046463 | Ga0495653_0000030 | Ga0495653_0000030_52519_53226 | 220 |
| 739 | 3300046473 | Ga0495582_0007216 | Ga0495582_0007216_1504_2238 | 220 |
| 740 | 3300046474 | Ga0495605_0156414 | Ga0495605_0156414_220_921 | 220 |
| 741 | 3300046476 | Ga0495662_0000776 | Ga0495662_0000776_6685_7392 | 220 |
| 742 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_173137_173844 | 220 |
| 743 | 3300046491 | Ga0495584_0012992 | Ga0495584_0012992_2877_3578 | 220 |
| 744 | 3300046491 | Ga0495584_0036607 | Ga0495584_0036607_101_802 | 220 |
| 745 | 3300046491 | Ga0495584_0235420 | Ga0495584_0235420_131_832 | 220 |
| 746 | 3300046499 | Ga0495594_0005256 | Ga0495594_0005256_3873_4574 | 220 |
| 747 | 3300046501 | Ga0495607_0154444 | Ga0495607_0154444_245_946 | 220 |
| 748 | 3300046501 | Ga0495607_0207849 | Ga0495607_0207849_45_746 | 220 |
| 749 | 3300046511 | Ga0495608_0000011 | Ga0495608_0000011_119141_119848 | 220 |
| 750 | 3300046511 | Ga0495608_0067898 | Ga0495608_0067898_1558_2259 | 220 |
| 751 | 3300046511 | Ga0495608_0310287 | Ga0495608_0310287_172_873 | 220 |
| 752 | 3300046514 | Ga0495618_0000025 | Ga0495618_0000025_89435_90142 | 220 |
| 753 | 3300046514 | Ga0495618_0109332 | Ga0495618_0109332_931_1632 | 220 |
| 754 | 3300046515 | Ga0495620_0192190 | Ga0495620_0192190_37_738 | 220 |
| 755 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_662538_663245 | 220 |
| 756 | 3300046519 | Ga0495632_0056731 | Ga0495632_0056731_107_808 | 220 |
| 757 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_877072_877779 | 220 |
| 758 | 3300046531 | Ga0495665_0247543 | Ga0495665_0247543_178_879 | 220 |
| 759 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_117401_118108 | 220 |
| 760 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_189807_190514 | 220 |
| 761 | 3300046537 | Ga0495598_0030664 | Ga0495598_0030664_387_1088 | 220 |
| 762 | 3300046537 | Ga0495598_0034323 | Ga0495598_0034323_219_920 | 220 |
| 763 | 3300046543 | Ga0495645_0000276 | Ga0495645_0000276_11006_11713 | 220 |
| 764 | 3300046559 | Ga0495667_0000004 | Ga0495667_0000004_89454_90161 | 220 |
| 765 | 3300046559 | Ga0495667_0218223 | Ga0495667_0218223_296_1099 | 220 |
| 766 | 3300046615 | Ga0495656_0083987 | Ga0495656_0083987_19_720 | 220 |
| 767 | 3300046615 | Ga0495656_0189389 | Ga0495656_0189389_219_920 | 220 |
| 768 | 3300046616 | Ga0495668_0041609 | Ga0495668_0041609_1447_2148 | 220 |
| 769 | 3300046642 | Ga0495634_0001327 | Ga0495634_0001327_10861_11568 | 220 |
| 770 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_175618_176325 | 220 |
| 771 | 3300046675 | Ga0495657_0000190 | Ga0495657_0000190_10907_11614 | 220 |
| 772 | 3300046678 | Ga0495599_0000212 | Ga0495599_0000212_26015_26722 | 220 |
| 773 | 3300046679 | Ga0495623_0000043 | Ga0495623_0000043_8289_8996 | 220 |
| 774 | 3300046680 | Ga0495646_0000009 | Ga0495646_0000009_190718_191425 | 220 |
| 775 | 3300046681 | Ga0495647_0083832 | Ga0495647_0083832_224_961 | 220 |
| 776 | 3300046684 | Ga0495669_0101789 | Ga0495669_0101789_618_1319 | 220 |
| 777 | 3300046689 | Ga0495613_0004409 | Ga0495613_0004409_727_1434 | 220 |
| 778 | 3300046690 | Ga0495624_0047828 | Ga0495624_0047828_1295_2002 | 220 |
| 779 | 3300046691 | Ga0495670_0030357 | Ga0495670_0030357_47_748 | 220 |
| 780 | 3300046694 | Ga0495649_0211030 | Ga0495649_0211030_231_932 | 220 |
| 781 | 3300046809 | Ga0495600_0000017 | Ga0495600_0000017_106233_106940 | 220 |
| 782 | 3300047317 | Ga0495604_0000008 | Ga0495604_0000008_329520_330227 | 220 |
| 783 | 3300047319 | Ga0495674_0000016 | Ga0495674_0000016_11048_11755 | 220 |
| 784 | 3300047319 | Ga0495674_0373878 | Ga0495674_0373878_98_901 | 220 |
| 785 | 3300047320 | Ga0495672_0153062 | Ga0495672_0153062_113_814 | 220 |
| 786 | 3300047322 | Ga0495680_0001034 | Ga0495680_0001034_25994_26701 | 220 |
| 787 | 3300047444 | Ga0495675_0170972 | Ga0495675_0170972_67_774 | 220 |
| 788 | 3300047471 | Ga0495684_0000002 | Ga0495684_0000002_329578_330285 | 220 |
| 789 | 3300047673 | Ga0495593_0000458 | Ga0495593_0000458_12221_12928 | 220 |
| 790 | 3300047673 | Ga0495593_0121463 | Ga0495593_0121463_136_837 | 220 |
| 791 | 3300048088 | Ga0495602_0000024 | Ga0495602_0000024_25994_26701 | 220 |
| 792 | 3300048903 | Ga0496100_0122050 | Ga0496100_0122050_626_1330 | 220 |
| 793 | 3300048903 | Ga0496100_0189248 | Ga0496100_0189248_640_1341 | 220 |
| 794 | 3300048903 | Ga0496100_0205235 | Ga0496100_0205235_617_1318 | 220 |
| 795 | 3300048903 | Ga0496100_0223587 | Ga0496100_0223587_438_1139 | 220 |
| 796 | 3300048904 | Ga0496101_0009219 | Ga0496101_0009219_3763_4464 | 220 |
| 797 | 3300048904 | Ga0496101_0031294 | Ga0496101_0031294_1542_2243 | 220 |
| 798 | 3300048905 | Ga0496102_0006717 | Ga0496102_0006717_6664_7365 | 220 |
| 799 | 3300048905 | Ga0496102_0006945 | Ga0496102_0006945_2865_3566 | 220 |
| 800 | 3300048905 | Ga0496102_0089329 | Ga0496102_0089329_733_1431 | 220 |
| 801 | 3300048905 | Ga0496102_0137624 | Ga0496102_0137624_1231_1932 | 220 |
| 802 | 3300048905 | Ga0496102_0217998 | Ga0496102_0217998_1059_1760 | 220 |
| 803 | 3300048905 | Ga0496102_0463771 | Ga0496102_0463771_108_809 | 220 |
| 804 | 3300048906 | Ga0496103_0001472 | Ga0496103_0001472_5282_5983 | 220 |
| 805 | 3300048906 | Ga0496103_0014262 | Ga0496103_0014262_2626_3324 | 220 |
| 806 | 3300048906 | Ga0496103_0026372 | Ga0496103_0026372_40_741 | 220 |
| 807 | 3300048906 | Ga0496103_0058259 | Ga0496103_0058259_438_1139 | 220 |
| 808 | 3300048906 | Ga0496103_0081282 | Ga0496103_0081282_959_1660 | 220 |
| 809 | 3300048907 | Ga0496104_0004766 | Ga0496104_0004766_889_1590 | 220 |
| 810 | 3300048907 | Ga0496104_0005758 | Ga0496104_0005758_9790_10491 | 220 |
| 811 | 3300048907 | Ga0496104_0103147 | Ga0496104_0103147_1855_2556 | 220 |
| 812 | 3300048908 | Ga0496105_0009176 | Ga0496105_0009176_3960_4661 | 220 |
| 813 | 3300048908 | Ga0496105_0141999 | Ga0496105_0141999_173_874 | 220 |
| 814 | 3300048909 | Ga0496106_0002903 | Ga0496106_0002903_5712_6413 | 220 |
| 815 | 3300048909 | Ga0496106_0011116 | Ga0496106_0011116_1020_1721 | 220 |
| 816 | 3300048909 | Ga0496106_0035803 | Ga0496106_0035803_1753_2454 | 220 |
| 817 | 3300048909 | Ga0496106_0057065 | Ga0496106_0057065_438_1139 | 220 |
| 818 | 3300048909 | Ga0496106_0074645 | Ga0496106_0074645_87_785 | 220 |
| 819 | 3300048909 | Ga0496106_0108814 | Ga0496106_0108814_664_1401 | 220 |
| 820 | 3300048910 | Ga0496107_0002783 | Ga0496107_0002783_10752_11453 | 220 |
| 821 | 3300048910 | Ga0496107_0027697 | Ga0496107_0027697_2762_3463 | 220 |
| 822 | 3300048910 | Ga0496107_0093441 | Ga0496107_0093441_270_968 | 220 |
| 823 | 3300048910 | Ga0496107_0462188 | Ga0496107_0462188_166_867 | 220 |
| 824 | 3300048911 | Ga0496108_0000746 | Ga0496108_0000746_13592_14293 | 220 |
| 825 | 3300048911 | Ga0496108_0022767 | Ga0496108_0022767_338_1039 | 220 |
| 826 | 3300048911 | Ga0496108_0082105 | Ga0496108_0082105_1855_2556 | 220 |
| 827 | 3300048912 | Ga0496109_0003828 | Ga0496109_0003828_849_1550 | 220 |
| 828 | 3300048912 | Ga0496109_0005286 | Ga0496109_0005286_2360_3061 | 220 |
| 829 | 3300048912 | Ga0496109_0018504 | Ga0496109_0018504_2356_3057 | 220 |
| 830 | 3300048912 | Ga0496109_0183921 | Ga0496109_0183921_1224_1925 | 220 |
| 831 | 3300048913 | Ga0496110_0004442 | Ga0496110_0004442_2084_2785 | 220 |
| 832 | 3300048913 | Ga0496110_0013739 | Ga0496110_0013739_5882_6583 | 220 |
| 833 | 3300048913 | Ga0496110_0070526 | Ga0496110_0070526_1983_2684 | 220 |
| 834 | 3300048913 | Ga0496110_0773038 | Ga0496110_0773038_49_750 | 220 |
| 835 | 3300048914 | Ga0496111_0001412 | Ga0496111_0001412_2363_3064 | 220 |
| 836 | 3300048914 | Ga0496111_0016642 | Ga0496111_0016642_305_1006 | 220 |
| 837 | 3300048914 | Ga0496111_0037068 | Ga0496111_0037068_861_1562 | 220 |
| 838 | 3300048914 | Ga0496111_0095394 | Ga0496111_0095394_772_1473 | 220 |
| 839 | 3300048914 | Ga0496111_0175258 | Ga0496111_0175258_622_1320 | 220 |
| 840 | 3300048914 | Ga0496111_0230850 | Ga0496111_0230850_416_1117 | 220 |
| 841 | 3300048914 | Ga0496111_0351558 | Ga0496111_0351558_341_1042 | 220 |
| 842 | 3300048915 | Ga0496112_0010687 | Ga0496112_0010687_3957_4658 | 220 |
| 843 | 3300048915 | Ga0496112_0013459 | Ga0496112_0013459_4007_4708 | 220 |
| 844 | 3300048915 | Ga0496112_0047166 | Ga0496112_0047166_1870_2571 | 220 |
| 845 | 3300048915 | Ga0496112_0072786 | Ga0496112_0072786_1151_1852 | 220 |
| 846 | 3300048916 | Ga0496113_0000750 | Ga0496113_0000750_3684_4385 | 220 |
| 847 | 3300048916 | Ga0496113_0019688 | Ga0496113_0019688_2481_3182 | 220 |
| 848 | 3300048916 | Ga0496113_0035388 | Ga0496113_0035388_2044_2745 | 220 |
| 849 | 3300048916 | Ga0496113_0105411 | Ga0496113_0105411_1476_2177 | 220 |
| 850 | 3300048916 | Ga0496113_0466292 | Ga0496113_0466292_185_886 | 220 |
| 851 | 3300048917 | Ga0496114_0002625 | Ga0496114_0002625_2652_3353 | 220 |
| 852 | 3300048917 | Ga0496114_0081557 | Ga0496114_0081557_177_878 | 220 |
| 853 | 3300048917 | Ga0496114_0118107 | Ga0496114_0118107_587_1288 | 220 |
| 854 | 3300048917 | Ga0496114_0124173 | Ga0496114_0124173_1433_2134 | 220 |
| 855 | 3300048918 | Ga0496115_0064082 | Ga0496115_0064082_568_1269 | 220 |
| 856 | 3300049570 | Ga0501033_0339588 | Ga0501033_0339588_255_956 | 220 |
| 857 | 3300049572 | Ga0501036_0041568 | Ga0501036_0041568_1079_1780 | 220 |
| 858 | 3300049574 | Ga0501038_0160711 | Ga0501038_0160711_594_1295 | 220 |
| 859 | 3300049577 | Ga0501041_0038076 | Ga0501041_0038076_1924_2625 | 220 |
| 860 | 3300049579 | Ga0501043_0377710 | Ga0501043_0377710_137_838 | 220 |
| 861 | 3300049580 | Ga0501046_0108202 | Ga0501046_0108202_796_1497 | 220 |
| 862 | 3300049582 | Ga0501048_0115606 | Ga0501048_0115606_128_829 | 220 |
| 863 | 3300049582 | Ga0501048_0151980 | Ga0501048_0151980_453_1154 | 220 |
| 864 | 3300049582 | Ga0501048_0290549 | Ga0501048_0290549_121_822 | 220 |
| 865 | 3300049586 | Ga0501070_0425838 | Ga0501070_0425838_218_919 | 220 |
| 866 | 3300049591 | Ga0501075_0249919 | Ga0501075_0249919_473_1174 | 220 |
| 867 | 3300049592 | Ga0501076_0424896 | Ga0501076_0424896_199_900 | 220 |
| 868 | 3300049592 | Ga0501076_0584039 | Ga0501076_0584039_101_802 | 220 |
| 869 | 3300049593 | Ga0501077_0020914 | Ga0501077_0020914_2735_3436 | 220 |
| 870 | 3300049593 | Ga0501077_0023130 | Ga0501077_0023130_813_1514 | 220 |
| 871 | 3300049741 | Ga0501079_0029477 | Ga0501079_0029477_3151_3852 | 220 |
| 872 | 3300049741 | Ga0501079_0120499 | Ga0501079_0120499_676_1377 | 220 |
| 873 | 3300049742 | Ga0501080_0148157 | Ga0501080_0148157_63_764 | 220 |
| 874 | 3300049743 | Ga0501081_0102485 | Ga0501081_0102485_943_1644 | 220 |
| 875 | 3300049743 | Ga0501081_0374868 | Ga0501081_0374868_107_808 | 220 |
| 876 | 3300049822 | Ga0501035_0105490 | Ga0501035_0105490_1094_1795 | 220 |
| 877 | 3300049822 | Ga0501035_0392348 | Ga0501035_0392348_431_1132 | 220 |
| 878 | 3300049823 | Ga0501044_0316888 | Ga0501044_0316888_436_1137 | 220 |
| 879 | 3300050489 | nmdc:mga03683_6762_c1 | nmdc:mga03683_6762_c1_1048_1749 | 220 |
| 880 | 3300050491 | nmdc:mga00v17_178357_c1 | nmdc:mga00v17_178357_c1_482_1183 | 220 |
| 881 | 3300050492 | nmdc:mga0yw44_2273_c1 | nmdc:mga0yw44_2273_c1_3351_4052 | 220 |
| 882 | 3300050492 | nmdc:mga0yw44_249330_c1 | nmdc:mga0yw44_249330_c1_180_881 | 220 |
| 883 | 3300050492 | nmdc:mga0yw44_4473_c1 | nmdc:mga0yw44_4473_c1_909_1610 | 220 |
| 884 | 3300050492 | nmdc:mga0yw44_46704_c1 | nmdc:mga0yw44_46704_c1_691_1392 | 220 |
| 885 | 3300050492 | nmdc:mga0yw44_467730_c1 | nmdc:mga0yw44_467730_c1_107_808 | 220 |
| 886 | 3300050492 | nmdc:mga0yw44_64314_c1 | nmdc:mga0yw44_64314_c1_389_1090 | 220 |
| 887 | 3300050494 | nmdc:mga06z11_12010_c1 | nmdc:mga06z11_12010_c1_281_982 | 220 |
| 888 | 3300050494 | nmdc:mga06z11_42843_c1 | nmdc:mga06z11_42843_c1_266_967 | 220 |
| 889 | 3300050507 | nmdc:mga05p37_151819_c1 | nmdc:mga05p37_151819_c1_653_1354 | 220 |
| 890 | 3300050507 | nmdc:mga05p37_370351_c1 | nmdc:mga05p37_370351_c1_103_804 | 220 |
| 891 | 3300050507 | nmdc:mga05p37_54022_c1 | nmdc:mga05p37_54022_c1_2972_3673 | 220 |
| 892 | 3300050507 | nmdc:mga05p37_57252_c1 | nmdc:mga05p37_57252_c1_1220_1921 | 220 |
| 893 | 3300050507 | nmdc:mga05p37_714477_c1 | nmdc:mga05p37_714477_c1_41_742 | 220 |
| 894 | 3300050509 | nmdc:mga0qj67_447259_c1 | nmdc:mga0qj67_447259_c1_280_981 | 220 |
| 895 | 3300050509 | nmdc:mga0qj67_663375_c1 | nmdc:mga0qj67_663375_c1_97_798 | 220 |
| 896 | 3300050509 | nmdc:mga0qj67_680863_c1 | nmdc:mga0qj67_680863_c1_57_758 | 220 |
| 897 | 3300050509 | nmdc:mga0qj67_688695_c1 | nmdc:mga0qj67_688695_c1_20_721 | 220 |
| 898 | 3300050510 | nmdc:mga06r32_199556_c1 | nmdc:mga06r32_199556_c1_943_1644 | 220 |
| 899 | 3300050510 | nmdc:mga06r32_21674_c2 | nmdc:mga06r32_21674_c2_1987_2688 | 220 |
| 900 | 3300050510 | nmdc:mga06r32_813117_c1 | nmdc:mga06r32_813117_c1_163_864 | 220 |
| 901 | 3300050510 | nmdc:mga06r32_97375_c1 | nmdc:mga06r32_97375_c1_491_1192 | 220 |
| 902 | 3300050511 | nmdc:mga08y16_312407_c1 | nmdc:mga08y16_312407_c1_904_1605 | 220 |
| 903 | 3300050511 | nmdc:mga08y16_31900_c1 | nmdc:mga08y16_31900_c1_3021_3722 | 220 |
| 904 | 3300050511 | nmdc:mga08y16_95196_c1 | nmdc:mga08y16_95196_c1_1951_2649 | 220 |
| 905 | 3300050512 | nmdc:mga0n895_25477_c1 | nmdc:mga0n895_25477_c1_4185_4886 | 220 |
| 906 | 3300050512 | nmdc:mga0n895_37489_c1 | nmdc:mga0n895_37489_c1_1572_2273 | 220 |
| 907 | 3300050512 | nmdc:mga0n895_531545_c1 | nmdc:mga0n895_531545_c1_285_986 | 220 |
| 908 | 3300050513 | nmdc:mga0rr50_40522_c1 | nmdc:mga0rr50_40522_c1_2248_2949 | 220 |
| 909 | 3300050513 | nmdc:mga0rr50_831772_c1 | nmdc:mga0rr50_831772_c1_40_741 | 220 |
| 910 | 3300050514 | nmdc:mga08x19_105984_c1 | nmdc:mga08x19_105984_c1_57_758 | 220 |
| 911 | 3300050514 | nmdc:mga08x19_163965_c1 | nmdc:mga08x19_163965_c1_89_790 | 220 |
| 912 | 3300050515 | nmdc:mga0a205_159421_c1 | nmdc:mga0a205_159421_c1_452_1153 | 220 |
| 913 | 3300050515 | nmdc:mga0a205_169290_c1 | nmdc:mga0a205_169290_c1_1341_2042 | 220 |
| 914 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_369078_369785 | 220 |
| 915 | 3300053077 | Ga0495601_0036304 | Ga0495601_0036304_841_1542 | 220 |
| 916 | 3300053078 | Ga0495612_0000097 | Ga0495612_0000097_10924_11631 | 220 |
| 917 | 3300053078 | Ga0495612_0041925 | Ga0495612_0041925_57_758 | 220 |
| 918 | 3300053078 | Ga0495612_0099117 | Ga0495612_0099117_438_1139 | 220 |
| 919 | 3300053083 | Ga0495655_0134057 | Ga0495655_0134057_26_727 | 220 |
| 920 | 3300053084 | Ga0495595_0000502 | Ga0495595_0000502_10933_11640 | 220 |
| 921 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_369109_369816 | 220 |
| 922 | 3300053085 | Ga0495619_0015074 | Ga0495619_0015074_3189_3890 | 220 |
| 923 | 3300053134 | Ga0500658_0058298 | Ga0500658_0058298_319_1020 | 220 |
| 924 | 3300054114 | Ga0501084_0031416 | Ga0501084_0031416_681_1382 | 220 |
| 925 | 3300054114 | Ga0501084_0050136 | Ga0501084_0050136_178_879 | 220 |
| 926 | 3300054114 | Ga0501084_0066670 | Ga0501084_0066670_1517_2218 | 220 |
| 927 | 3300060353 | Ga0501082_0051209 | Ga0501082_0051209_131_832 | 220 |
| 928 | 3300060353 | Ga0501082_0105110 | Ga0501082_0105110_507_1208 | 220 |
| 929 | 3300060353 | Ga0501082_0319068 | Ga0501082_0319068_347_1048 | 220 |
| 930 | 3300061734 | Ga0530510_0041940 | Ga0530510_0041940_642_1391 | 220 |
| 931 | 3300061734 | Ga0530510_0099132 | Ga0530510_0099132_362_1063 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o6q-assembly1.cif.gz_C | structure of the borneol dehydrogenase 1 of salvia rosmarinus | 0.8607 | 1 | 205 |
| 7o6q-assembly1.cif.gz_D | structure of the borneol dehydrogenase 1 of salvia rosmarinus | 0.8603 | 1 | 205 |
| 3lqf-assembly1.cif.gz_B | crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with nad and erythritol | 0.8603 | 2 | 205 |
| 3d3w-assembly1.cif.gz_A | structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. | 0.8551 | 3 | 211 |
| 4dqx-assembly1.cif.gz_D | crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 | 0.8518 | 1 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JEC9_1_74_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.872 | 2 | 58 | 3.40.50.720 |
| af_A0A0N7KIR0_69_250_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8555 | 2 | 132 | 3.40.50.720 |
| af_Q0ISZ5_12_118_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8553 | 4 | 84 | 3.40.50.720 |
| 1wntC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8474 | 3 | 216 | 3.40.50.720 |
| 5t2uB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8462 | 1 | 205 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537PMZ4-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9439 | 1 | 85 |
|
| AF-A0A529ZGL1-F1-model_v4 | deleted | 0.9136 | 1 | 130 |
|
| AF-A0A5S4T8V0-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.8955 | 1 | 105 |
|
| AF-A0A382PAL4-F1-model_v4 | Oxidoreductase | 0.8846 | 1 | 130 |
GO:0016020
GO:0016491 |
| AF-A0A3D5TS92-F1-model_v4 | deleted | 0.8689 | 1 | 130 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar