F486040

General Info

Members Datasets Scaffolds Average Seq Length
931 387 930 228

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10142167|Ga0207645_101421672
Length 271
Sequence MDYRDRHVLVTGGTGALGAAVVGALIEAGAICHVPWRDEREAERFAYRDHGQVKLLGPIELTDEAALRQFYEGIPDLWASIHIAGGFAMSPVAKTDKAALMHLLDMNLVSCFLCCSAAVNAIARSGKGGRIVNVAARHALEWRGGAGLVAYTASKAAVAALTLALSEEVAKQDILVNAVAPSIMDTPTNRRDMPKADFDKWVKDSQLGKMDGARKGGAIVVYDFEGNAVKRYKITNAWPKSLEVTSLKAGDTSVLSEKLVLTYEKCEPESA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
140 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
237 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
241 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
242 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
243 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
244 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
245 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
246 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
247 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
248 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
262 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
277 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
328 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
387 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.21
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0
Rhizoplane 8.81
Rhizosphere 88.51
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214928522 2209111006 Bacteria 1347
2 ARcpr5oldR_c000029 3300000041 Bacteria 29077
3 ARcpr5yngRDRAFT_c000051 3300000043 Bacteria 18515
4 ARSoilOldRDRAFT_c000078 3300000044 Bacteria 18538
5 ARCol0yngRDRAFT_1000056 3300000652 Bacteria 20075
6 JGI24032J14994_100417 3300001430 Bacteria 2225
7 JGI24741J21665_1012565 3300001915 Bacteria 1451
8 JGI24752J21851_1004120 3300001976 Bacteria 1908
9 JGI24746J21847_1003746 3300001977 Bacteria 2402
10 JGI24746J21847_1018892 3300001977 Bacteria 973
11 JGI24739J22299_10003115 3300001989 Bacteria 6328
12 JGI24739J22299_10030177 3300001989 Bacteria 1880
13 JGI24737J22298_10000192 3300001990 Bacteria 19781
14 JGI24737J22298_10004940 3300001990 Bacteria 4619
15 JGI24735J21928_10013679 3300002067 Bacteria 2547
16 JGI24750J21931_1000008 3300002070 Bacteria 23752
17 JGI24748J21848_1003980 3300002074 Bacteria 1694
18 JGI24748J21848_1010552 3300002074 Bacteria 1087
19 JGI24738J21930_10000228 3300002075 Bacteria 15272
20 JGI24738J21930_10002997 3300002075 Bacteria 4314
21 JGI24744J21845_10013361 3300002077 Bacteria 1655
22 JGI24035J26624_1000004 3300002126 Bacteria 15166
23 JGI24742J22300_10000704 3300002244 Bacteria 5056
24 JGI24742J22300_10001815 3300002244 Bacteria 3398
25 JGI24751J29686_10002080 3300002459 Bacteria 4061
26 JGI24751J29686_10009787 3300002459 Bacteria 1975
27 JGI25405J52794_10013222 3300003911 Bacteria 1598
28 Ga0058860_12244705 3300004801 Unclassified 1129
29 Ga0065712_10072196 3300005290 Bacteria 4858
30 Ga0065715_10093738 3300005293 Bacteria 4581
31 Ga0070658_10148448 3300005327 Bacteria 1962
32 Ga0070658_10394600 3300005327 Bacteria 1188
33 Ga0070676_10000092 3300005328 Bacteria 31160
34 Ga0070676_10002129 3300005328 Bacteria 10081
35 Ga0070676_10047401 3300005328 Bacteria 2509
36 Ga0070683_100000314 3300005329 Bacteria 33370
37 Ga0070683_100891918 3300005329 Bacteria 853
38 Ga0070690_100001103 3300005330 Bacteria 13884
39 Ga0070690_100006642 3300005330 Bacteria 6570
40 Ga0070690_100019192 3300005330 Bacteria 4145
41 Ga0070690_100057438 3300005330 Bacteria 2497
42 Ga0070690_100187886 3300005330 Bacteria 1431
43 Ga0070670_100004057 3300005331 Bacteria 12232
44 Ga0070670_100006325 3300005331 Bacteria 10022
45 Ga0070670_100038299 3300005331 Bacteria 4124
46 Ga0070670_100290917 3300005331 Bacteria 1427
47 Ga0070677_10000577 3300005333 Bacteria 12405
48 Ga0068869_100006201 3300005334 Bacteria 7571
49 Ga0068869_100014379 3300005334 Bacteria 5285
50 Ga0068869_100174207 3300005334 Bacteria 1683
51 Ga0070666_10100706 3300005335 Bacteria 1991
52 Ga0070666_10241792 3300005335 Bacteria 1277
53 Ga0070680_100000515 3300005336 Bacteria 26512
54 Ga0070680_100008159 3300005336 Bacteria 8001
55 Ga0070680_100029392 3300005336 Bacteria 4415
56 Ga0070680_100160758 3300005336 Bacteria 1887
57 Ga0070680_100308185 3300005336 Bacteria 1343
58 Ga0070682_100000230 3300005337 Bacteria 40502
59 Ga0070682_100015639 3300005337 Bacteria 4399
60 Ga0070682_100441284 3300005337 Bacteria 994
61 Ga0068868_100000973 3300005338 Bacteria 19502
62 Ga0068868_100005613 3300005338 Bacteria 8827
63 Ga0068868_100036974 3300005338 Bacteria 3783
64 Ga0070660_100003630 3300005339 Bacteria 10663
65 Ga0070660_100010815 3300005339 Bacteria 6459
66 Ga0070660_100022222 3300005339 Bacteria 4688
67 Ga0070660_100477695 3300005339 Bacteria 1035
68 Ga0070689_100000145 3300005340 Bacteria 40970
69 Ga0070689_100007489 3300005340 Bacteria 7639
70 Ga0070689_100011582 3300005340 Bacteria 6321
71 Ga0070691_10000107 3300005341 Bacteria 24697
72 Ga0070691_10005289 3300005341 Bacteria 5863
73 Ga0070687_100001052 3300005343 Bacteria 9437
74 Ga0070687_100015721 3300005343 Bacteria 3429
75 Ga0070687_100026522 3300005343 Bacteria 2791
76 Ga0070661_100000808 3300005344 Bacteria 22497
77 Ga0070661_100017368 3300005344 Bacteria 5104
78 Ga0070661_100231185 3300005344 Bacteria 1421
79 Ga0070692_10000115 3300005345 Bacteria 18618
80 Ga0070692_10018977 3300005345 Bacteria 3314
81 Ga0070692_10039154 3300005345 Bacteria 2419
82 Ga0070692_10099585 3300005345 Bacteria 1591
83 Ga0070668_100001616 3300005347 Bacteria 16309
84 Ga0070668_100019523 3300005347 Bacteria 5101
85 Ga0070668_100048646 3300005347 Bacteria 3261
86 Ga0070668_100222333 3300005347 Bacteria 1558
87 Ga0070668_100252680 3300005347 Bacteria 1464
88 Ga0070669_100000343 3300005353 Bacteria 36254
89 Ga0070669_100011278 3300005353 Bacteria 6345
90 Ga0070669_100187813 3300005353 Bacteria 1620
91 Ga0070675_100000210 3300005354 Bacteria 37423
92 Ga0070675_100017011 3300005354 Bacteria 5779
93 Ga0070675_100106638 3300005354 Bacteria 2365
94 Ga0070675_100340097 3300005354 Bacteria 1329
95 Ga0070675_100502423 3300005354 Bacteria 1093
96 Ga0070671_100000396 3300005355 Bacteria 29967
97 Ga0070674_100000733 3300005356 Bacteria 16737
98 Ga0070674_100013318 3300005356 Bacteria 5081
99 Ga0070674_100649252 3300005356 Unclassified 897
100 Ga0070673_100000130 3300005364 Bacteria 35440
101 Ga0070673_100003944 3300005364 Bacteria 9322
102 Ga0070673_100018971 3300005364 Bacteria 4930
103 Ga0070673_100180050 3300005364 Unclassified 1809
104 Ga0070688_100003254 3300005365 Bacteria 8321
105 Ga0070688_100014789 3300005365 Bacteria 4427
106 Ga0070688_100046521 3300005365 Bacteria 2687
107 Ga0070659_100002709 3300005366 Bacteria 12594
108 Ga0070659_100013517 3300005366 Bacteria 6078
109 Ga0070659_100015144 3300005366 Bacteria 5768
110 Ga0070659_100696986 3300005366 Unclassified 878
111 Ga0070667_100001673 3300005367 Bacteria 19816
112 Ga0070667_100013178 3300005367 Bacteria 6834
113 Ga0070667_100043593 3300005367 Bacteria 3766
114 Ga0070703_10001152 3300005406 Bacteria 8142
115 Ga0070709_10006605 3300005434 Bacteria 6328
116 Ga0070714_100027773 3300005435 Bacteria 4688
117 Ga0070714_100191018 3300005435 Bacteria 1869
118 Ga0070714_100992837 3300005435 Bacteria 817
119 Ga0070713_100037677 3300005436 Bacteria 3910
120 Ga0070713_100311927 3300005436 Bacteria 1451
121 Ga0070713_100421322 3300005436 Bacteria 1250
122 Ga0070710_10003341 3300005437 Bacteria 7603
123 Ga0070710_10122089 3300005437 Bacteria 1578
124 Ga0070701_10000012 3300005438 Bacteria 46531
125 Ga0070701_10006970 3300005438 Bacteria 4794
126 Ga0070701_10009117 3300005438 Bacteria 4334
127 Ga0070711_100013443 3300005439 Bacteria 5142
128 Ga0070711_100298801 3300005439 Bacteria 1280
129 Ga0070705_100000341 3300005440 Bacteria 27488
130 Ga0070705_100003401 3300005440 Bacteria 7799
131 Ga0070705_100095309 3300005440 Unclassified 1866
132 Ga0070700_100001057 3300005441 Bacteria 13636
133 Ga0070700_100019859 3300005441 Bacteria 3882
134 Ga0070700_100571608 3300005441 Bacteria 881
135 Ga0070694_100001081 3300005444 Bacteria 15608
136 Ga0070694_100006936 3300005444 Bacteria 6885
137 Ga0070694_100126740 3300005444 Bacteria 1839
138 Ga0070708_100559591 3300005445 Bacteria 1078
139 Ga0070663_100000097 3300005455 Bacteria 39662
140 Ga0070663_100408926 3300005455 Bacteria 1111
141 Ga0070678_100000452 3300005456 Bacteria 19516
142 Ga0070678_100002678 3300005456 Bacteria 9819
143 Ga0070678_100005200 3300005456 Bacteria 7485
144 Ga0070662_100000336 3300005457 Bacteria 28144
145 Ga0070662_100006628 3300005457 Bacteria 7476
146 Ga0070662_100025255 3300005457 Bacteria 4100
147 Ga0070662_100452576 3300005457 Bacteria 1066
148 Ga0070681_10005380 3300005458 Bacteria 12363
149 Ga0070681_10055049 3300005458 Bacteria 3963
150 Ga0070681_10066676 3300005458 Bacteria 3568
151 Ga0070681_10102495 3300005458 Bacteria 2807
152 Ga0070681_10104785 3300005458 Bacteria 2770
153 Ga0070681_10314513 3300005458 Unclassified 1475
154 Ga0070681_10624016 3300005458 Unclassified 993
155 Ga0068867_100000731 3300005459 Bacteria 22005
156 Ga0068867_100016596 3300005459 Bacteria 5230
157 Ga0068867_100046106 3300005459 Bacteria 3200
158 Ga0068867_100272732 3300005459 Bacteria 1384
159 Ga0070685_10001019 3300005466 Bacteria 15068
160 Ga0070685_10043366 3300005466 Bacteria 2571
161 Ga0070685_10075324 3300005466 Bacteria 2010
162 Ga0070685_10138448 3300005466 Bacteria 1529
163 Ga0070706_100165424 3300005467 Bacteria 2065
164 Ga0070707_100026730 3300005468 Bacteria 5482
165 Ga0070698_100167580 3300005471 Bacteria 2138
166 Ga0070699_100003057 3300005518 Bacteria 14839
167 Ga0070699_100034397 3300005518 Bacteria 4379
168 Ga0070699_100228510 3300005518 Bacteria 1659
169 Ga0070699_100514407 3300005518 Bacteria 1088
170 Ga0070679_100017090 3300005530 Bacteria 7013
171 Ga0070679_100045759 3300005530 Bacteria 4360
172 Ga0070679_100058680 3300005530 Bacteria 3835
173 Ga0070684_100000157 3300005535 Bacteria 46152
174 Ga0070684_100006691 3300005535 Bacteria 8934
175 Ga0070684_100143283 3300005535 Bacteria 2162
176 Ga0070684_100316858 3300005535 Bacteria 1432
177 Ga0070697_100041373 3300005536 Bacteria 3730
178 Ga0070697_100067714 3300005536 Bacteria 2921
179 Ga0070697_100078970 3300005536 Bacteria 2709
180 Ga0070697_100106470 3300005536 Bacteria 2333
181 Ga0070697_100286719 3300005536 Bacteria 1413
182 Ga0068853_100000376 3300005539 Bacteria 30625
183 Ga0068853_100001479 3300005539 Bacteria 17079
184 Ga0068853_100584428 3300005539 Bacteria 1060
185 Ga0070672_100001119 3300005543 Bacteria 16354
186 Ga0070672_100009766 3300005543 Bacteria 6627
187 Ga0070672_100092673 3300005543 Bacteria 2439
188 Ga0070686_100000127 3300005544 Bacteria 53295
189 Ga0070686_100010021 3300005544 Bacteria 5335
190 Ga0070686_100062851 3300005544 Bacteria 2403
191 Ga0070686_100135679 3300005544 Unclassified 1707
192 Ga0070695_100007768 3300005545 Bacteria 6354
193 Ga0070695_100019183 3300005545 Bacteria 4161
194 Ga0070695_100020454 3300005545 Bacteria 4042
195 Ga0070696_100000219 3300005546 Bacteria 34543
196 Ga0070696_100022964 3300005546 Bacteria 4242
197 Ga0070696_100053993 3300005546 Bacteria 2799
198 Ga0070696_100067110 3300005546 Bacteria 2517
199 Ga0070693_100000414 3300005547 Bacteria 19333
200 Ga0070693_100003980 3300005547 Bacteria 6937
201 Ga0070693_100295496 3300005547 Unclassified 1090
202 Ga0070665_100042930 3300005548 Bacteria 4545
203 Ga0070665_100139524 3300005548 Bacteria 2428
204 Ga0070665_100164532 3300005548 Bacteria 2221
205 Ga0070704_100001431 3300005549 Bacteria 12748
206 Ga0070704_100081023 3300005549 Bacteria 2389
207 Ga0068855_100004578 3300005563 Bacteria 16892
208 Ga0068855_100067656 3300005563 Bacteria 4160
209 Ga0070664_100000326 3300005564 Bacteria 34609
210 Ga0070664_100047854 3300005564 Bacteria 3614
211 Ga0070664_100103611 3300005564 Unclassified 2477
212 Ga0070664_100104155 3300005564 Bacteria 2470
213 Ga0068857_100000063 3300005577 Bacteria 60089
214 Ga0068857_100023355 3300005577 Bacteria 5443
215 Ga0068857_100518800 3300005577 Bacteria 1120
216 Ga0068854_100000220 3300005578 Bacteria 38637
217 Ga0068854_100003463 3300005578 Bacteria 9852
218 Ga0068854_100064955 3300005578 Bacteria 2652
219 Ga0068856_100000815 3300005614 Bacteria 33600
220 Ga0068856_100042339 3300005614 Bacteria 4479
221 Ga0068856_100272674 3300005614 Bacteria 1708
222 Ga0070702_100002268 3300005615 Bacteria 8227
223 Ga0070702_100003706 3300005615 Bacteria 6887
224 Ga0070702_100023799 3300005615 Bacteria 3259
225 Ga0068852_100001063 3300005616 Bacteria 18125
226 Ga0068852_100029426 3300005616 Bacteria 4512
227 Ga0068852_100033664 3300005616 Bacteria 4257
228 Ga0068852_100273955 3300005616 Bacteria 1625
229 Ga0068859_100010551 3300005617 Bacteria 9301
230 Ga0068859_100079841 3300005617 Bacteria 3312
231 Ga0068859_100114714 3300005617 Bacteria 2758
232 Ga0068859_100392377 3300005617 Bacteria 1484
233 Ga0068859_100720392 3300005617 Bacteria 1088
234 Ga0068859_100734612 3300005617 Unclassified 1077
235 Ga0068864_100000380 3300005618 Bacteria 38785
236 Ga0068864_100069586 3300005618 Bacteria 3060
237 Ga0068864_100082154 3300005618 Bacteria 2826
238 Ga0068866_10000193 3300005718 Bacteria 28522
239 Ga0068866_10078729 3300005718 Bacteria 1764
240 Ga0068866_10101864 3300005718 Bacteria 1586
241 Ga0068866_10186731 3300005718 Bacteria 1228
242 Ga0068861_100000101 3300005719 Bacteria 42384
243 Ga0068861_100006236 3300005719 Bacteria 8111
244 Ga0068861_100153893 3300005719 Bacteria 1889
245 Ga0068861_100466570 3300005719 Bacteria 1134
246 Ga0068870_10000028 3300005840 Bacteria 45368
247 Ga0068870_10006425 3300005840 Bacteria 5181
248 Ga0068863_100000386 3300005841 Bacteria 44817
249 Ga0068863_100018294 3300005841 Bacteria 6709
250 Ga0068863_100513545 3300005841 Bacteria 1181
251 Ga0068858_100034821 3300005842 Bacteria 4670
252 Ga0068858_100035282 3300005842 Bacteria 4639
253 Ga0068858_100098222 3300005842 Bacteria 2730
254 Ga0068858_100208792 3300005842 Bacteria 1848
255 Ga0068860_100001254 3300005843 Bacteria 27668
256 Ga0068860_100016023 3300005843 Bacteria 7312
257 Ga0068860_100063689 3300005843 Bacteria 3501
258 Ga0068860_100747111 3300005843 Unclassified 990
259 Ga0068862_100002105 3300005844 Bacteria 17935
260 Ga0068862_100004930 3300005844 Bacteria 11235
261 Ga0068862_100031507 3300005844 Bacteria 4477
262 Ga0068862_100343665 3300005844 Bacteria 1383
263 Ga0081455_10003621 3300005937 Bacteria 17706
264 Ga0081455_10013398 3300005937 Bacteria 8109
265 Ga0081455_10025326 3300005937 Bacteria 5479
266 Ga0081455_10095805 3300005937 Bacteria 2395
267 Ga0081538_10055925 3300005981 Bacteria 2317
268 Ga0081540_1037632 3300005983 Bacteria 2561
269 Ga0081540_1116838 3300005983 Bacteria 1115
270 Ga0070717_10195444 3300006028 Bacteria 1769
271 Ga0070717_10235082 3300006028 Bacteria 1614
272 Ga0075365_10042900 3300006038 Bacteria 2959
273 Ga0075365_10436465 3300006038 Unclassified 925
274 Ga0075364_10286056 3300006051 Bacteria 1122
275 Ga0070715_10001242 3300006163 Bacteria 7308
276 Ga0070715_10403016 3300006163 Bacteria 761
277 Ga0070716_100015185 3300006173 Bacteria 3952
278 Ga0070712_100063748 3300006175 Bacteria 2611
279 Ga0070712_100114813 3300006175 Bacteria 2017
280 Ga0075367_10012294 3300006178 Bacteria 4559
281 Ga0075367_10070817 3300006178 Bacteria 2097
282 Ga0097621_100000577 3300006237 Bacteria 25806
283 Ga0097621_100008916 3300006237 Bacteria 7250
284 Ga0097621_100108772 3300006237 Bacteria 2341
285 Ga0068871_100000298 3300006358 Bacteria 34572
286 Ga0068871_100222881 3300006358 Bacteria 1634
287 Ga0075428_100054716 3300006844 Bacteria 4373
288 Ga0075428_100061750 3300006844 Bacteria 4104
289 Ga0075428_100079781 3300006844 Bacteria 3572
290 Ga0075428_100476022 3300006844 Bacteria 1337
291 Ga0075428_100502510 3300006844 Bacteria 1297
292 Ga0075430_100253888 3300006846 Bacteria 1457
293 Ga0075430_100466794 3300006846 Bacteria 1042
294 Ga0075430_100755967 3300006846 Bacteria 801
295 Ga0075431_100149005 3300006847 Bacteria 2410
296 Ga0075431_100181948 3300006847 Bacteria 2157
297 Ga0075431_100239256 3300006847 Bacteria 1847
298 Ga0075431_100239673 3300006847 Bacteria 1845
299 Ga0075431_100316153 3300006847 Bacteria 1575
300 Ga0075433_10008685 3300006852 Bacteria 8105
301 Ga0075433_10141955 3300006852 Bacteria 2134
302 Ga0075433_10220248 3300006852 Bacteria 1686
303 Ga0075434_100018218 3300006871 Bacteria 6781
304 Ga0075434_100021970 3300006871 Bacteria 6210
305 Ga0075434_100073924 3300006871 Bacteria 3402
306 Ga0075434_100355260 3300006871 Unclassified 1486
307 Ga0075434_100428612 3300006871 Unclassified 1344
308 Ga0075434_100968539 3300006871 Unclassified 865
309 Ga0075429_100108978 3300006880 Bacteria 2421
310 Ga0075429_100610307 3300006880 Bacteria 956
311 Ga0068865_100000125 3300006881 Bacteria 39482
312 Ga0068865_100006959 3300006881 Bacteria 6937
313 Ga0075436_100153735 3300006914 Bacteria 1620
314 Ga0075436_100190218 3300006914 Bacteria 1452
315 Ga0075436_100334652 3300006914 Bacteria 1089
316 Ga0097620_100010551 3300006931 Bacteria 9301
317 Ga0097620_100079842 3300006931 Bacteria 3312
318 Ga0097620_100114715 3300006931 Bacteria 2758
319 Ga0097620_100392386 3300006931 Bacteria 1484
320 Ga0097620_100720265 3300006931 Bacteria 1088
321 Ga0097620_100734654 3300006931 Unclassified 1077
322 Ga0075435_100167850 3300007076 Bacteria 1851
323 Ga0075435_100179244 3300007076 Bacteria 1790
324 Ga0075435_100213279 3300007076 Bacteria 1638
325 Ga0075435_100291542 3300007076 Unclassified 1394
326 Ga0105251_10021088 3300009011 Bacteria 3409
327 Ga0105251_10135476 3300009011 Bacteria 1115
328 Ga0105244_10246773 3300009036 Bacteria 833
329 Ga0105250_10038616 3300009092 Bacteria 1914
330 Ga0105250_10106985 3300009092 Bacteria 1144
331 Ga0105240_10014048 3300009093 Bacteria 10952
332 Ga0111539_10000548 3300009094 Bacteria 47926
333 Ga0111539_10007739 3300009094 Bacteria 13721
334 Ga0111539_10088301 3300009094 Bacteria 3643
335 Ga0111539_10166482 3300009094 Bacteria 2577
336 Ga0111539_10190904 3300009094 Bacteria 2390
337 Ga0111539_10549428 3300009094 Bacteria 1345
338 Ga0111539_11012060 3300009094 Bacteria 966
339 Ga0105245_10000173 3300009098 Bacteria 61528
340 Ga0105245_10375635 3300009098 Bacteria 1414
341 Ga0105245_10713630 3300009098 Bacteria 1037
342 Ga0105247_10002800 3300009101 Bacteria 11662
343 Ga0105247_10007920 3300009101 Bacteria 6496
344 Ga0105247_10029012 3300009101 Bacteria 3350
345 Ga0105247_10050052 3300009101 Unclassified 2570
346 Ga0114129_10003643 3300009147 Bacteria 21672
347 Ga0114129_11362965 3300009147 Bacteria 877
348 Ga0105243_10000377 3300009148 Bacteria 47825
349 Ga0105243_10017817 3300009148 Bacteria 5374
350 Ga0105243_10120108 3300009148 Bacteria 2214
351 Ga0105243_10254143 3300009148 Bacteria 1570
352 Ga0105241_10001249 3300009174 Bacteria 19401
353 Ga0105241_10010359 3300009174 Bacteria 6843
354 Ga0105242_10000419 3300009176 Bacteria 33812
355 Ga0105242_10599018 3300009176 Bacteria 1064
356 Ga0105248_10000643 3300009177 Bacteria 39655
357 Ga0105248_10008602 3300009177 Bacteria 11211
358 Ga0105248_10080754 3300009177 Bacteria 3655
359 Ga0105248_10094904 3300009177 Bacteria 3358
360 Ga0105237_10007697 3300009545 Bacteria 11768
361 Ga0105237_10021014 3300009545 Bacteria 6718
362 Ga0105237_10031168 3300009545 Bacteria 5409
363 Ga0105237_10291831 3300009545 Bacteria 1634
364 Ga0105237_10401229 3300009545 Bacteria 1376
365 Ga0105238_10046148 3300009551 Bacteria 4398
366 Ga0105238_10065646 3300009551 Bacteria 3631
367 Ga0105249_10006636 3300009553 Bacteria 10070
368 Ga0105249_10016803 3300009553 Bacteria 6493
369 Ga0105249_10017441 3300009553 Bacteria 6373
370 Ga0105249_10361965 3300009553 Bacteria 1472
371 Ga0099796_10055339 3300010159 Bacteria 1389
372 Ga0105239_10009309 3300010375 Bacteria 11101
373 Ga0105239_10018417 3300010375 Bacteria 7715
374 Ga0105239_10058349 3300010375 Bacteria 4235
375 Ga0105239_10852918 3300010375 Bacteria 1045
376 Ga0105246_10000819 3300011119 Bacteria 17695
377 Ga0105246_10020654 3300011119 Bacteria 4227
378 Ga0105246_10285247 3300011119 Bacteria 1326
379 Ga0105246_10289894 3300011119 Unclassified 1316
380 Ga0157326_1021439 3300012513 Bacteria 801
381 Ga0157338_1000385 3300012515 Bacteria 2512
382 Ga0157373_10003113 3300013100 Bacteria 12536
383 Ga0157373_10025646 3300013100 Bacteria 4262
384 Ga0157373_10163244 3300013100 Bacteria 1567
385 Ga0157371_10007096 3300013102 Bacteria 9107
386 Ga0157371_10072538 3300013102 Bacteria 2438
387 Ga0157370_10139565 3300013104 Bacteria 2258
388 Ga0157369_10002471 3300013105 Bacteria 22151
389 Ga0157369_10357613 3300013105 Bacteria 1516
390 Ga0157374_10004172 3300013296 Bacteria 12134
391 Ga0157374_10041948 3300013296 Bacteria 4219
392 Ga0157378_10000993 3300013297 Bacteria 25998
393 Ga0157378_10018527 3300013297 Bacteria 6119
394 Ga0157378_10127919 3300013297 Bacteria 2348
395 Ga0157378_10134727 3300013297 Bacteria 2289
396 Ga0157378_10256495 3300013297 Bacteria 1676
397 Ga0163162_10001508 3300013306 Bacteria 21697
398 Ga0163162_10021249 3300013306 Bacteria 6388
399 Ga0163162_10026452 3300013306 Bacteria 5733
400 Ga0157372_10008930 3300013307 Bacteria 10651
401 Ga0157372_10024481 3300013307 Bacteria 6559
402 Ga0157372_10380283 3300013307 Bacteria 1645
403 Ga0157375_10000283 3300013308 Bacteria 46225
404 Ga0157375_10017827 3300013308 Bacteria 6422
405 Ga0157375_10076749 3300013308 Bacteria 3369
406 Ga0157375_10305601 3300013308 Bacteria 1755
407 Ga0157375_11505486 3300013308 Unclassified 794
408 Ga0163163_10000757 3300014325 Bacteria 27476
409 Ga0163163_10018211 3300014325 Bacteria 6569
410 Ga0163163_10094798 3300014325 Bacteria 3003
411 Ga0163163_10099847 3300014325 Bacteria 2924
412 Ga0157380_10000095 3300014326 Bacteria 48588
413 Ga0157380_10009789 3300014326 Bacteria 6883
414 Ga0182008_10043993 3300014497 Bacteria 2222
415 Ga0157377_10001144 3300014745 Bacteria 11253
416 Ga0157377_10006484 3300014745 Bacteria 5587
417 Ga0157379_10009736 3300014968 Bacteria 8373
418 Ga0157379_10016635 3300014968 Bacteria 6467
419 Ga0157379_10079062 3300014968 Bacteria 2946
420 Ga0157376_10000634 3300014969 Bacteria 22779
421 Ga0157376_10010367 3300014969 Bacteria 6812
422 Ga0163161_10001324 3300017792 Bacteria 18424
423 Ga0163161_10013788 3300017792 Bacteria 5628
424 Ga0163161_10237339 3300017792 Bacteria 1417
425 Ga0206353_10213769 3300020082 Bacteria 1117
426 Ga0213872_10042183 3300021361 Bacteria 2081
427 Ga0213876_10056585 3300021384 Bacteria 2070
428 Ga0207666_1000045 3300025271 Bacteria 24475
429 Ga0207673_1000048 3300025290 Bacteria 9798
430 Ga0207697_10000551 3300025315 Bacteria 21235
431 Ga0207697_10154966 3300025315 Bacteria 998
432 Ga0207656_10130556 3300025321 Unclassified 1177
433 Ga0207696_1016412 3300025711 Bacteria 2477
434 Ga0207653_10003534 3300025885 Bacteria 4924
435 Ga0207653_10038925 3300025885 Bacteria 1555
436 Ga0207682_10000065 3300025893 Bacteria 46642
437 Ga0207642_10227563 3300025899 Bacteria 1046
438 Ga0207710_10002620 3300025900 Bacteria 8298
439 Ga0207710_10003935 3300025900 Bacteria 6553
440 Ga0207688_10000039 3300025901 Bacteria 44849
441 Ga0207688_10007776 3300025901 Bacteria 5833
442 Ga0207688_10008435 3300025901 Bacteria 5604
443 Ga0207688_10052345 3300025901 Bacteria 2287
444 Ga0207680_10010818 3300025903 Bacteria 4581
445 Ga0207680_10042017 3300025903 Bacteria 2672
446 Ga0207680_10139870 3300025903 Unclassified 1604
447 Ga0207647_10001204 3300025904 Bacteria 19906
448 Ga0207647_10014680 3300025904 Bacteria 5395
449 Ga0207647_10024058 3300025904 Bacteria 4018
450 Ga0207647_10029533 3300025904 Bacteria 3547
451 Ga0207685_10003251 3300025905 Bacteria 3919
452 Ga0207645_10000080 3300025907 Bacteria 68968
453 Ga0207645_10007301 3300025907 Bacteria 7815
454 Ga0207645_10044077 3300025907 Bacteria 2855
455 Ga0207645_10056961 3300025907 Bacteria 2495
456 Ga0207645_10142167 3300025907 Bacteria 1564
457 Ga0207643_10000135 3300025908 Bacteria 49853
458 Ga0207643_10001337 3300025908 Bacteria 14257
459 Ga0207705_10051854 3300025909 Bacteria 2953
460 Ga0207684_10021159 3300025910 Bacteria 5553
461 Ga0207684_10169158 3300025910 Bacteria 1884
462 Ga0207684_10170271 3300025910 Bacteria 1877
463 Ga0207684_10553354 3300025910 Unclassified 984
464 Ga0207654_10005870 3300025911 Bacteria 6187
465 Ga0207654_10007959 3300025911 Bacteria 5344
466 Ga0207707_10002157 3300025912 Bacteria 17788
467 Ga0207707_10042863 3300025912 Bacteria 3949
468 Ga0207707_10195623 3300025912 Bacteria 1764
469 Ga0207707_10205781 3300025912 Bacteria 1715
470 Ga0207707_10278001 3300025912 Bacteria 1450
471 Ga0207707_10404492 3300025912 Unclassified 1172
472 Ga0207695_10185434 3300025913 Bacteria 2000
473 Ga0207671_10003900 3300025914 Bacteria 14541
474 Ga0207671_10031657 3300025914 Bacteria 3942
475 Ga0207671_10091047 3300025914 Bacteria 2298
476 Ga0207693_10010373 3300025915 Bacteria 7562
477 Ga0207693_10028298 3300025915 Bacteria 4428
478 Ga0207693_10060332 3300025915 Bacteria 2971
479 Ga0207693_10175100 3300025915 Bacteria 1689
480 Ga0207663_10005810 3300025916 Bacteria 6252
481 Ga0207660_10002445 3300025917 Bacteria 12199
482 Ga0207660_10011111 3300025917 Bacteria 5853
483 Ga0207660_10095630 3300025917 Bacteria 2210
484 Ga0207660_10256790 3300025917 Bacteria 1381
485 Ga0207660_10343904 3300025917 Bacteria 1194
486 Ga0207662_10000336 3300025918 Bacteria 21233
487 Ga0207662_10008664 3300025918 Bacteria 5579
488 Ga0207662_10035336 3300025918 Bacteria 2919
489 Ga0207657_10000186 3300025919 Bacteria 64342
490 Ga0207657_10002336 3300025919 Bacteria 20569
491 Ga0207657_10017486 3300025919 Bacteria 6872
492 Ga0207657_10075800 3300025919 Bacteria 2838
493 Ga0207649_10000571 3300025920 Bacteria 25261
494 Ga0207649_10011692 3300025920 Bacteria 4849
495 Ga0207652_10001096 3300025921 Bacteria 24512
496 Ga0207652_10039714 3300025921 Bacteria 3994
497 Ga0207652_10097434 3300025921 Bacteria 2592
498 Ga0207646_10065570 3300025922 Bacteria 3243
499 Ga0207646_10098788 3300025922 Bacteria 2616
500 Ga0207681_10011812 3300025923 Bacteria 5373
501 Ga0207681_10032843 3300025923 Bacteria 3400
502 Ga0207694_10288847 3300025924 Bacteria 1348
503 Ga0207694_10418040 3300025924 Bacteria 1117
504 Ga0207650_10028311 3300025925 Bacteria 4016
505 Ga0207650_10044073 3300025925 Bacteria 3277
506 Ga0207650_10100950 3300025925 Bacteria 2221
507 Ga0207650_10117429 3300025925 Bacteria 2067
508 Ga0207650_10180325 3300025925 Bacteria 1683
509 Ga0207650_10447848 3300025925 Bacteria 1074
510 Ga0207659_10000127 3300025926 Bacteria 44761
511 Ga0207659_10042756 3300025926 Bacteria 3178
512 Ga0207687_10000334 3300025927 Bacteria 31485
513 Ga0207687_10333703 3300025927 Bacteria 1231
514 Ga0207700_10410430 3300025928 Bacteria 1188
515 Ga0207644_10002918 3300025931 Bacteria 11013
516 Ga0207644_10010543 3300025931 Bacteria 6092
517 Ga0207644_10075355 3300025931 Bacteria 2479
518 Ga0207690_10003358 3300025932 Bacteria 9570
519 Ga0207690_10018543 3300025932 Bacteria 4268
520 Ga0207690_10071987 3300025932 Bacteria 2386
521 Ga0207690_10322211 3300025932 Bacteria 1215
522 Ga0207690_10617743 3300025932 Unclassified 886
523 Ga0207706_10001765 3300025933 Bacteria 21233
524 Ga0207706_10014913 3300025933 Bacteria 7038
525 Ga0207706_10017451 3300025933 Bacteria 6467
526 Ga0207706_10018586 3300025933 Bacteria 6254
527 Ga0207686_10000297 3300025934 Bacteria 36292
528 Ga0207686_10034591 3300025934 Bacteria 3025
529 Ga0207686_10178954 3300025934 Bacteria 1502
530 Ga0207709_10000257 3300025935 Bacteria 63623
531 Ga0207709_10004698 3300025935 Bacteria 7855
532 Ga0207709_10075527 3300025935 Bacteria 2154
533 Ga0207709_10349118 3300025935 Bacteria 1116
534 Ga0207670_10000371 3300025936 Bacteria 25929
535 Ga0207670_10020974 3300025936 Bacteria 4023
536 Ga0207670_10028654 3300025936 Bacteria 3539
537 Ga0207669_10000089 3300025937 Bacteria 46184
538 Ga0207669_10112928 3300025937 Bacteria 1825
539 Ga0207704_10000355 3300025938 Bacteria 21359
540 Ga0207704_10261411 3300025938 Bacteria 1305
541 Ga0207665_10000186 3300025939 Bacteria 41649
542 Ga0207665_10049910 3300025939 Bacteria 2813
543 Ga0207691_10001737 3300025940 Bacteria 21481
544 Ga0207691_10028104 3300025940 Bacteria 5268
545 Ga0207691_10057591 3300025940 Bacteria 3536
546 Ga0207711_10118481 3300025941 Bacteria 2362
547 Ga0207711_10141145 3300025941 Bacteria 2167
548 Ga0207689_10000095 3300025942 Bacteria 71568
549 Ga0207689_10014632 3300025942 Bacteria 6666
550 Ga0207661_10000366 3300025944 Bacteria 29023
551 Ga0207679_10000073 3300025945 Bacteria 89687
552 Ga0207679_10009670 3300025945 Bacteria 6181
553 Ga0207679_10059275 3300025945 Bacteria 2839
554 Ga0207679_10267382 3300025945 Bacteria 1461
555 Ga0207679_10806791 3300025945 Bacteria 856
556 Ga0207667_10010897 3300025949 Bacteria 10598
557 Ga0207667_10046869 3300025949 Bacteria 4577
558 Ga0207667_10547570 3300025949 Bacteria 1170
559 Ga0207651_10001109 3300025960 Bacteria 11982
560 Ga0207651_10016924 3300025960 Bacteria 4290
561 Ga0207712_10000457 3300025961 Bacteria 34730
562 Ga0207712_10012149 3300025961 Bacteria 5503
563 Ga0207668_10000971 3300025972 Bacteria 17231
564 Ga0207668_10035080 3300025972 Bacteria 3336
565 Ga0207640_10001226 3300025981 Bacteria 13970
566 Ga0207640_10025655 3300025981 Bacteria 3570
567 Ga0207658_10003961 3300025986 Bacteria 10399
568 Ga0207658_10016145 3300025986 Bacteria 5131
569 Ga0207658_10043934 3300025986 Bacteria 3251
570 Ga0207658_10748777 3300025986 Bacteria 885
571 Ga0207677_10009833 3300026023 Bacteria 5390
572 Ga0207677_10063120 3300026023 Bacteria 2573
573 Ga0207703_10005066 3300026035 Bacteria 10666
574 Ga0207703_10054180 3300026035 Bacteria 3261
575 Ga0207703_10983607 3300026035 Bacteria 809
576 Ga0207639_10018364 3300026041 Bacteria 4969
577 Ga0207639_10134191 3300026041 Bacteria 2053
578 Ga0207678_10000426 3300026067 Bacteria 38181
579 Ga0207678_10012836 3300026067 Bacteria 7355
580 Ga0207678_10020810 3300026067 Bacteria 5750
581 Ga0207708_10000624 3300026075 Bacteria 27228
582 Ga0207708_10000991 3300026075 Bacteria 21233
583 Ga0207708_10033947 3300026075 Bacteria 3880
584 Ga0207708_10034414 3300026075 Bacteria 3854
585 Ga0207708_10275336 3300026075 Bacteria 1362
586 Ga0207708_10559252 3300026075 Bacteria 965
587 Ga0207702_10008786 3300026078 Bacteria 8514
588 Ga0207702_10095493 3300026078 Bacteria 2612
589 Ga0207641_10001067 3300026088 Bacteria 27627
590 Ga0207641_10024810 3300026088 Bacteria 4942
591 Ga0207641_10033009 3300026088 Bacteria 4300
592 Ga0207648_10000207 3300026089 Bacteria 62972
593 Ga0207648_10001430 3300026089 Bacteria 26279
594 Ga0207648_10051427 3300026089 Bacteria 3601
595 Ga0207676_10000875 3300026095 Bacteria 23361
596 Ga0207676_10007995 3300026095 Bacteria 7518
597 Ga0207676_10067109 3300026095 Bacteria 2864
598 Ga0207676_10152114 3300026095 Bacteria 1994
599 Ga0207674_10001021 3300026116 Bacteria 36545
600 Ga0207674_10032377 3300026116 Bacteria 5485
601 Ga0207674_10519549 3300026116 Bacteria 1150
602 Ga0207675_100000447 3300026118 Bacteria 40184
603 Ga0207675_100001849 3300026118 Bacteria 21247
604 Ga0207675_100008098 3300026118 Bacteria 9902
605 Ga0207675_100150332 3300026118 Bacteria 2216
606 Ga0207675_100494770 3300026118 Bacteria 1216
607 Ga0207683_10000096 3300026121 Bacteria 71829
608 Ga0207683_10013771 3300026121 Bacteria 6896
609 Ga0207683_10046039 3300026121 Bacteria 3816
610 Ga0207683_10284271 3300026121 Bacteria 1512
611 Ga0207698_10002278 3300026142 Bacteria 11362
612 Ga0207698_10452124 3300026142 Bacteria 1240
613 Ga0209179_1007258 3300027512 Bacteria 1824
614 Ga0209966_1002326 3300027695 Bacteria 3173
615 Ga0209998_10001024 3300027717 Bacteria 7042
616 Ga0209998_10001533 3300027717 Bacteria 5552
617 Ga0209974_10001855 3300027876 Bacteria 7711
618 Ga0207428_10000160 3300027907 Bacteria 92379
619 Ga0207428_10014000 3300027907 Bacteria 6986
620 Ga0207428_10061624 3300027907 Bacteria 2969
621 Ga0268266_10082872 3300028379 Bacteria 2798
622 Ga0268266_10181263 3300028379 Bacteria 1918
623 Ga0268265_10003071 3300028380 Bacteria 12178
624 Ga0268265_10061051 3300028380 Bacteria 2891
625 Ga0268264_10002954 3300028381 Bacteria 14771
626 Ga0268264_10032764 3300028381 Bacteria 4264
627 Ga0268264_10089680 3300028381 Bacteria 2648
628 Ga0268264_10119697 3300028381 Bacteria 2319
629 Ga0268264_10556571 3300028381 Bacteria 1125
630 Ga0265318_10075108 3300028577 Bacteria 1251
631 Ga0265325_10003848 3300031241 Bacteria 9645
632 Ga0265316_10296434 3300031344 Bacteria 1179
633 Ga0307513_10103448 3300031456 Bacteria 2864
634 Ga0265313_10000524 3300031595 Bacteria 40120
635 Ga0265313_10076822 3300031595 Bacteria 1525
636 Ga0265314_10001524 3300031711 Bacteria 25572
637 Ga0373930_0000578 3300034816 Bacteria 5067
638 Ga0373948_0009148 3300034817 Bacteria 1703
639 Ga0373958_0001030 3300034819 Bacteria 3637
640 Ga0373959_0004468 3300034820 Bacteria 2256
641 Ga0373959_0009786 3300034820 Bacteria 1662
642 Ga0373938_0000028 3300034957 Bacteria 18996
643 Ga0373938_0000033 3300034957 Bacteria 17806
644 Ga0373928_0019501 3300035084 Bacteria 1415
645 Ga0373928_0030401 3300035084 Bacteria 1193
646 Ga0373929_0025611 3300035085 Bacteria 1226
647 Ga0373940_0010637 3300035088 Bacteria 2169
648 Ga0373940_0020740 3300035088 Bacteria 1672
649 Ga0373949_0003081 3300035090 Bacteria 4072
650 Ga0373951_0000666 3300035091 Bacteria 9448
651 Ga0373951_0004442 3300035091 Bacteria 3332
652 Ga0373952_0006012 3300035092 Bacteria 2236
653 Ga0373932_0000749 3300035112 Bacteria 9676
654 Ga0373932_0000983 3300035112 Bacteria 8260
655 Ga0373936_0107817 3300035113 Bacteria 1180
656 Ga0373939_0000342 3300035114 Bacteria 11883
657 Ga0373953_0002640 3300035117 Bacteria 5428
658 Ga0373954_0003770 3300035118 Bacteria 6465
659 Ga0373960_0000100 3300035121 Bacteria 13629
660 Ga0373946_0005589 3300035171 Bacteria 4538
661 Ga0373946_0053840 3300035171 Bacteria 1691
662 Ga0373946_0311760 3300035171 Unclassified 780
663 Ga0373955_0002025 3300035172 Bacteria 8719
664 Ga0373942_0002640 3300035207 Bacteria 4310
665 Ga0373942_0023984 3300035207 Bacteria 1561
666 Ga0373961_0042708 3300035241 Bacteria 1315
667 Ga0373962_0000272 3300035242 Bacteria 11145
668 Ga0373962_0000881 3300035242 Bacteria 6853
669 Ga0373962_0077043 3300035242 Bacteria 1006
670 Ga0373962_0101582 3300035242 Bacteria 898
671 Ga0373931_0001372 3300035691 Bacteria 10411
672 Ga0373931_0106010 3300035691 Bacteria 1588
673 Ga0373931_0178320 3300035691 Bacteria 1257
674 Ga0373935_0000179 3300035692 Bacteria 29705
675 Ga0373927_0118199 3300035695 Bacteria 1729
676 Ga0373927_0147978 3300035695 Bacteria 1538
677 Ga0373933_0002450 3300035724 Bacteria 10444
678 Ga0373947_0382683 3300035725 Bacteria 947
679 Ga0373937_0000864 3300036401 Bacteria 26035
680 Ga0373937_0172623 3300036401 Bacteria 2029
681 Ga0373925_0000639 3300037068 Bacteria 32946
682 Ga0373925_0004022 3300037068 Bacteria 11180
683 Ga0373925_0197594 3300037068 Bacteria 1598
684 Ga0395899_0368606 3300037312 Bacteria 957
685 Ga0395900_0017207 3300037418 Bacteria 7378
686 Ga0395898_0011333 3300037466 Bacteria 9268
687 Ga0395898_0660310 3300037466 Bacteria 988
688 Ga0395905_0002399 3300037471 Bacteria 20844
689 Ga0395905_0112548 3300037471 Bacteria 2557
690 Ga0436365_1134850 3300039437 Bacteria 1317
691 Ga0436365_1428872 3300039437 Bacteria 13961
692 Ga0436361_0166397 3300039447 Bacteria 45243
693 Ga0439455_0022300 3300042012 Bacteria 1517
694 Ga0451577_0363956 3300042876 Bacteria 1312
695 Ga0453684_0097934 3300044712 Bacteria 3598
696 Ga0451576_0088025 3300045051 Bacteria 3230
697 Ga0495627_079143 3300046453 Bacteria 954
698 Ga0495592_0000348 3300046454 Bacteria 37669
699 Ga0495603_0031637 3300046455 Bacteria 3185
700 Ga0495629_0027169 3300046459 Bacteria 4065
701 Ga0495641_0011562 3300046461 Bacteria 5016
702 Ga0495651_0000781 3300046462 Bacteria 24676
703 Ga0495653_0000030 3300046463 Bacteria 142668
704 Ga0495582_0007216 3300046473 Bacteria 6165
705 Ga0495605_0156414 3300046474 Bacteria 1014
706 Ga0495662_0000776 3300046476 Bacteria 15446
707 Ga0495664_0000003 3300046477 Bacteria 551602
708 Ga0495584_0012992 3300046491 Bacteria 4250
709 Ga0495584_0036607 3300046491 Bacteria 2479
710 Ga0495584_0235420 3300046491 Bacteria 931
711 Ga0495594_0005256 3300046499 Bacteria 6657
712 Ga0495607_0154444 3300046501 Unclassified 1172
713 Ga0495607_0207849 3300046501 Bacteria 965
714 Ga0495608_0000011 3300046511 Bacteria 248514
715 Ga0495608_0067898 3300046511 Bacteria 2332
716 Ga0495608_0310287 3300046511 Bacteria 976
717 Ga0495618_0000025 3300046514 Bacteria 116027
718 Ga0495618_0109332 3300046514 Bacteria 1770
719 Ga0495620_0192190 3300046515 Bacteria 787
720 Ga0495628_0000001 3300046516 Bacteria 917742
721 Ga0495632_0056731 3300046519 Bacteria 1914
722 Ga0495652_0000002 3300046529 Bacteria 946606
723 Ga0495665_0247543 3300046531 Bacteria 918
724 Ga0495640_0000002 3300046533 Bacteria 646434
725 Ga0495587_0000001 3300046536 Bacteria 724132
726 Ga0495598_0030664 3300046537 Bacteria 1508
727 Ga0495598_0034323 3300046537 Bacteria 1446
728 Ga0495645_0000276 3300046543 Bacteria 37763
729 Ga0495667_0000004 3300046559 Bacteria 295297
730 Ga0495667_0218223 3300046559 Bacteria 1218
731 Ga0495656_0083987 3300046615 Bacteria 1443
732 Ga0495656_0189389 3300046615 Bacteria 1015
733 Ga0495668_0041609 3300046616 Bacteria 2559
734 Ga0495634_0001327 3300046642 Bacteria 22545
735 Ga0495611_0218112 3300046648 Bacteria 888
736 Ga0495635_0000001 3300046663 Bacteria 704901
737 Ga0495657_0000190 3300046675 Bacteria 55153
738 Ga0495599_0000212 3300046678 Bacteria 37642
739 Ga0495623_0000043 3300046679 Bacteria 77839
740 Ga0495646_0000009 3300046680 Bacteria 200698
741 Ga0495647_0083832 3300046681 Bacteria 1296
742 Ga0495669_0087917 3300046684 Bacteria 1432
743 Ga0495669_0101789 3300046684 Bacteria 1335
744 Ga0495613_0004409 3300046689 Bacteria 10541
745 Ga0495624_0047828 3300046690 Bacteria 2717
746 Ga0495670_0030357 3300046691 Bacteria 2685
747 Ga0495649_0211030 3300046694 Bacteria 1006
748 Ga0495600_0000017 3300046809 Bacteria 107635
749 Ga0495604_0000008 3300047317 Bacteria 341160
750 Ga0495674_0000016 3300047319 Bacteria 216763
751 Ga0495674_0373878 3300047319 Bacteria 1154
752 Ga0495672_0153062 3300047320 Bacteria 1194
753 Ga0495680_0001034 3300047322 Bacteria 30822
754 Ga0495675_0170972 3300047444 Bacteria 1334
755 Ga0495677_0049527 3300047445 Bacteria 1544
756 Ga0495684_0000002 3300047471 Bacteria 341216
757 Ga0495593_0000458 3300047673 Bacteria 22861
758 Ga0495593_0121463 3300047673 Bacteria 1329
759 Ga0495602_0000024 3300048088 Bacteria 151162
760 Ga0496100_0001377 3300048903 Bacteria 11912
761 Ga0496100_0122050 3300048903 Bacteria 1824
762 Ga0496100_0189248 3300048903 Unclassified 1493
763 Ga0496100_0205235 3300048903 Bacteria 1438
764 Ga0496100_0223587 3300048903 Bacteria 1382
765 Ga0496101_0009219 3300048904 Bacteria 6479
766 Ga0496101_0013564 3300048904 Bacteria 5463
767 Ga0496101_0031294 3300048904 Bacteria 3739
768 Ga0496102_0006717 3300048905 Bacteria 9828
769 Ga0496102_0006945 3300048905 Bacteria 9657
770 Ga0496102_0041360 3300048905 Bacteria 4172
771 Ga0496102_0089329 3300048905 Bacteria 2850
772 Ga0496102_0137624 3300048905 Bacteria 2288
773 Ga0496102_0217998 3300048905 Bacteria 1798
774 Ga0496102_0463771 3300048905 Bacteria 1188
775 Ga0496103_0001472 3300048906 Bacteria 15759
776 Ga0496103_0008971 3300048906 Bacteria 5928
777 Ga0496103_0014262 3300048906 Bacteria 4719
778 Ga0496103_0026372 3300048906 Bacteria 3518
779 Ga0496103_0058259 3300048906 Bacteria 2399
780 Ga0496103_0081282 3300048906 Bacteria 2038
781 Ga0496104_0004766 3300048907 Bacteria 11811
782 Ga0496104_0005758 3300048907 Bacteria 10847
783 Ga0496104_0091102 3300048907 Bacteria 2914
784 Ga0496104_0103147 3300048907 Bacteria 2732
785 Ga0496105_0009176 3300048908 Bacteria 7720
786 Ga0496105_0119096 3300048908 Bacteria 2178
787 Ga0496105_0134402 3300048908 Bacteria 2038
788 Ga0496105_0141999 3300048908 Bacteria 1976
789 Ga0496106_0002903 3300048909 Bacteria 12747
790 Ga0496106_0011116 3300048909 Bacteria 6657
791 Ga0496106_0035803 3300048909 Bacteria 3712
792 Ga0496106_0057065 3300048909 Bacteria 2952
793 Ga0496106_0074645 3300048909 Bacteria 2596
794 Ga0496106_0080753 3300048909 Bacteria 2497
795 Ga0496106_0108814 3300048909 Bacteria 2156
796 Ga0496107_0002783 3300048910 Bacteria 11534
797 Ga0496107_0024972 3300048910 Bacteria 4229
798 Ga0496107_0027697 3300048910 Bacteria 4025
799 Ga0496107_0093441 3300048910 Bacteria 2199
800 Ga0496107_0462188 3300048910 Unclassified 942
801 Ga0496108_0000746 3300048911 Bacteria 25332
802 Ga0496108_0001712 3300048911 Bacteria 17379
803 Ga0496108_0022767 3300048911 Bacteria 5154
804 Ga0496108_0082105 3300048911 Bacteria 2732
805 Ga0496108_0130145 3300048911 Bacteria 2163
806 Ga0496109_0001064 3300048912 Bacteria 22726
807 Ga0496109_0003828 3300048912 Bacteria 12569
808 Ga0496109_0005286 3300048912 Bacteria 10788
809 Ga0496109_0018504 3300048912 Bacteria 6118
810 Ga0496109_0183921 3300048912 Bacteria 1963
811 Ga0496110_0004442 3300048913 Bacteria 10873
812 Ga0496110_0013739 3300048913 Bacteria 6709
813 Ga0496110_0070526 3300048913 Bacteria 3096
814 Ga0496110_0192406 3300048913 Bacteria 1852
815 Ga0496110_0773038 3300048913 Bacteria 864
816 Ga0496111_0001412 3300048914 Bacteria 13658
817 Ga0496111_0016642 3300048914 Bacteria 5070
818 Ga0496111_0019059 3300048914 Bacteria 4760
819 Ga0496111_0024187 3300048914 Bacteria 4274
820 Ga0496111_0037068 3300048914 Bacteria 3489
821 Ga0496111_0095394 3300048914 Bacteria 2183
822 Ga0496111_0175258 3300048914 Bacteria 1594
823 Ga0496111_0230850 3300048914 Bacteria 1374
824 Ga0496111_0351558 3300048914 Bacteria 1091
825 Ga0496112_0010687 3300048915 Bacteria 8341
826 Ga0496112_0013459 3300048915 Bacteria 7551
827 Ga0496112_0047166 3300048915 Plasmid 4226
828 Ga0496112_0072786 3300048915 Bacteria 3397
829 Ga0496112_0419340 3300048915 Bacteria 1277
830 Ga0496113_0000750 3300048916 Bacteria 16701
831 Ga0496113_0001219 3300048916 Bacteria 14112
832 Ga0496113_0019688 3300048916 Bacteria 4727
833 Ga0496113_0035388 3300048916 Bacteria 3651
834 Ga0496113_0105411 3300048916 Bacteria 2189
835 Ga0496113_0466292 3300048916 Unclassified 1015
836 Ga0496114_0002625 3300048917 Bacteria 13717
837 Ga0496114_0081557 3300048917 Bacteria 2732
838 Ga0496114_0118107 3300048917 Bacteria 2278
839 Ga0496114_0124173 3300048917 Bacteria 2223
840 Ga0496115_0000935 3300048918 Bacteria 21173
841 Ga0496115_0064082 3300048918 Bacteria 2966
842 Ga0501033_0339588 3300049570 Unclassified 1053
843 Ga0501036_0041568 3300049572 Bacteria 3889
844 Ga0501038_0160711 3300049574 Unclassified 1826
845 Ga0501041_0038076 3300049577 Bacteria 2915
846 Ga0501043_0377710 3300049579 Unclassified 1073
847 Ga0501046_0108202 3300049580 Bacteria 2126
848 Ga0501048_0115606 3300049582 Bacteria 1895
849 Ga0501048_0151980 3300049582 Bacteria 1638
850 Ga0501048_0290549 3300049582 Bacteria 1163
851 Ga0501070_0425838 3300049586 Unclassified 1072
852 Ga0501075_0249919 3300049591 Unclassified 1351
853 Ga0501076_0057848 3300049592 Bacteria 3080
854 Ga0501076_0424896 3300049592 Bacteria 1093
855 Ga0501076_0584039 3300049592 Unclassified 921
856 Ga0501077_0020914 3300049593 Bacteria 4142
857 Ga0501077_0023130 3300049593 Bacteria 3940
858 Ga0501079_0029477 3300049741 Bacteria 4213
859 Ga0501079_0120499 3300049741 Bacteria 2040
860 Ga0501079_0204922 3300049741 Bacteria 1540
861 Ga0501080_0148157 3300049742 Bacteria 2170
862 Ga0501081_0102485 3300049743 Bacteria 2024
863 Ga0501081_0373654 3300049743 Bacteria 1053
864 Ga0501081_0374868 3300049743 Bacteria 1051
865 Ga0501035_0105490 3300049822 Bacteria 2471
866 Ga0501035_0392348 3300049822 Bacteria 1156
867 Ga0501044_0316888 3300049823 Unclassified 1485
868 nmdc:mga03683_6762_c1 3300050489 Bacteria 3946
869 nmdc:mga00v17_178357_c1 3300050491 Bacteria 1370
870 nmdc:mga0yw44_2273_c1 3300050492 Bacteria 8102
871 nmdc:mga0yw44_249330_c1 3300050492 Bacteria 1181
872 nmdc:mga0yw44_4473_c1 3300050492 Bacteria 6418
873 nmdc:mga0yw44_46704_c1 3300050492 Bacteria 2602
874 nmdc:mga0yw44_467730_c1 3300050492 Unclassified 855
875 nmdc:mga0yw44_64314_c1 3300050492 Bacteria 2257
876 nmdc:mga06z11_12010_c1 3300050494 Bacteria 3754
877 nmdc:mga06z11_42843_c1 3300050494 Bacteria 2273
878 nmdc:mga05p37_151819_c1 3300050507 Bacteria 2833
879 nmdc:mga05p37_370351_c1 3300050507 Bacteria 1681
880 nmdc:mga05p37_54022_c1 3300050507 Bacteria 4942
881 nmdc:mga05p37_57252_c1 3300050507 Bacteria 4801
882 nmdc:mga05p37_714477_c1 3300050507 Bacteria 1111
883 nmdc:mga09592_591314_c1 3300050508 Bacteria 951
884 nmdc:mga0qj67_274916_c1 3300050509 Bacteria 1365
885 nmdc:mga0qj67_447259_c1 3300050509 Bacteria 1041
886 nmdc:mga0qj67_663375_c1 3300050509 Bacteria 832
887 nmdc:mga0qj67_680863_c1 3300050509 Bacteria 819
888 nmdc:mga0qj67_688695_c1 3300050509 Bacteria 814
889 nmdc:mga06r32_199556_c1 3300050510 Bacteria 1988
890 nmdc:mga06r32_21674_c2 3300050510 Bacteria 4339
891 nmdc:mga06r32_813117_c1 3300050510 Unclassified 895
892 nmdc:mga06r32_97375_c1 3300050510 Bacteria 2882
893 nmdc:mga08y16_312407_c1 3300050511 Bacteria 1619
894 nmdc:mga08y16_31900_c1 3300050511 Bacteria 5539
895 nmdc:mga08y16_34440_c1 3300050511 Bacteria 5320
896 nmdc:mga08y16_95196_c1 3300050511 Bacteria 3102
897 nmdc:mga0n895_25477_c1 3300050512 Bacteria 5589
898 nmdc:mga0n895_3347_c1 3300050512 Bacteria 12892
899 nmdc:mga0n895_37489_c1 3300050512 Bacteria 4690
900 nmdc:mga0n895_400372_c1 3300050512 Bacteria 1388
901 nmdc:mga0n895_531545_c1 3300050512 Unclassified 1183
902 nmdc:mga0rr50_10581_c1 3300050513 Bacteria 5862
903 nmdc:mga0rr50_40522_c1 3300050513 Plasmid 3387
904 nmdc:mga0rr50_831772_c1 3300050513 Unclassified 788
905 nmdc:mga08x19_105984_c1 3300050514 Unclassified 1870
906 nmdc:mga08x19_163965_c1 3300050514 Unclassified 1510
907 nmdc:mga0a205_159421_c1 3300050515 Bacteria 2154
908 nmdc:mga0a205_169290_c1 3300050515 Bacteria 2080
909 nmdc:mga0a205_91515_c1 3300050515 Bacteria 2939
910 Ga0495601_0000001 3300053077 Bacteria 549454
911 Ga0495601_0036304 3300053077 Bacteria 3077
912 Ga0495612_0000097 3300053078 Bacteria 37614
913 Ga0495612_0041925 3300053078 Bacteria 1867
914 Ga0495612_0099117 3300053078 Bacteria 1240
915 Ga0495655_0134057 3300053083 Unclassified 765
916 Ga0495595_0000502 3300053084 Bacteria 14977
917 Ga0495619_0000004 3300053085 Bacteria 500068
918 Ga0495619_0015074 3300053085 Bacteria 4884
919 Ga0500658_0058298 3300053134 Bacteria 1599
920 Ga0500568_0003570 3300053139 Bacteria 8596
921 Ga0500616_0019413 3300053153 Bacteria 3831
922 Ga0500616_0060193 3300053153 Bacteria 1969
923 Ga0501084_0031416 3300054114 Bacteria 4440
924 Ga0501084_0050136 3300054114 Bacteria 3494
925 Ga0501084_0066670 3300054114 Bacteria 3012
926 Ga0501082_0051209 3300060353 Bacteria 3559
927 Ga0501082_0105110 3300060353 Bacteria 2443
928 Ga0501082_0319068 3300060353 Unclassified 1353
929 Ga0530510_0041940 3300061734 Bacteria 3305
930 Ga0530510_0099132 3300061734 Bacteria 2130

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100106470 Ga0070697_1001064702 205
2 3300028577 Ga0265318_10075108 Ga0265318_100751082 205
3 3300005290 Ga0065712_10072196 Ga0065712_100721964 207
4 3300005330 Ga0070690_100019192 Ga0070690_1000191922 207
5 3300005354 Ga0070675_100340097 Ga0070675_1003400972 207
6 3300005455 Ga0070663_100408926 Ga0070663_1004089261 207
7 3300005458 Ga0070681_10055049 Ga0070681_100550493 207
8 3300005530 Ga0070679_100045759 Ga0070679_1000457593 207
9 3300005547 Ga0070693_100295496 Ga0070693_1002954962 207
10 3300009177 Ga0105248_10008602 Ga0105248_1000860211 207
11 3300014325 Ga0163163_10000757 Ga0163163_1000075713 207
12 3300025903 Ga0207680_10139870 Ga0207680_101398701 207
13 3300025941 Ga0207711_10118481 Ga0207711_101184812 207
14 3300025986 Ga0207658_10016145 Ga0207658_100161452 207
15 3300048907 Ga0496104_0091102 Ga0496104_0091102_515_1213 207
16 3300048908 Ga0496105_0134402 Ga0496105_0134402_1192_1890 207
17 3300048911 Ga0496108_0130145 Ga0496108_0130145_903_1601 207
18 3300048912 Ga0496109_0001064 Ga0496109_0001064_8956_9654 207
19 3300048914 Ga0496111_0019059 Ga0496111_0019059_2321_3019 207
20 3300048916 Ga0496113_0001219 Ga0496113_0001219_11116_11814 207
21 3300050512 nmdc:mga0n895_400372_c1 nmdc:mga0n895_400372_c1_130_828 207
22 3300025885 Ga0207653_10038925 Ga0207653_100389252 208
23 3300001430 JGI24032J14994_100417 JGI24032J14994_1004173 210
24 3300001915 JGI24741J21665_1012565 JGI24741J21665_10125652 210
25 3300001976 JGI24752J21851_1004120 JGI24752J21851_10041202 210
26 3300001977 JGI24746J21847_1018892 JGI24746J21847_10188922 210
27 3300001989 JGI24739J22299_10003115 JGI24739J22299_100031155 210
28 3300001990 JGI24737J22298_10000192 JGI24737J22298_1000019213 210
29 3300002070 JGI24750J21931_1000008 JGI24750J21931_100000810 210
30 3300002074 JGI24748J21848_1003980 JGI24748J21848_10039802 210
31 3300002075 JGI24738J21930_10000228 JGI24738J21930_1000022814 210
32 3300002077 JGI24744J21845_10013361 JGI24744J21845_100133612 210
33 3300002126 JGI24035J26624_1000004 JGI24035J26624_100000413 210
34 3300002244 JGI24742J22300_10001815 JGI24742J22300_100018153 210
35 3300002459 JGI24751J29686_10009787 JGI24751J29686_100097872 210
36 3300005293 Ga0065715_10093738 Ga0065715_100937383 210
37 3300005328 Ga0070676_10000092 Ga0070676_1000009214 210
38 3300005329 Ga0070683_100000314 Ga0070683_10000031420 210
39 3300005330 Ga0070690_100001103 Ga0070690_1000011039 210
40 3300005331 Ga0070670_100006325 Ga0070670_1000063253 210
41 3300005333 Ga0070677_10000577 Ga0070677_100005774 210
42 3300005334 Ga0068869_100006201 Ga0068869_1000062012 210
43 3300005335 Ga0070666_10100706 Ga0070666_101007062 210
44 3300005336 Ga0070680_100000515 Ga0070680_10000051510 210
45 3300005337 Ga0070682_100000230 Ga0070682_10000023015 210
46 3300005338 Ga0068868_100000973 Ga0068868_1000009732 210
47 3300005339 Ga0070660_100003630 Ga0070660_1000036303 210
48 3300005340 Ga0070689_100000145 Ga0070689_10000014510 210
49 3300005341 Ga0070691_10000107 Ga0070691_100001072 210
50 3300005343 Ga0070687_100001052 Ga0070687_1000010523 210
51 3300005344 Ga0070661_100000808 Ga0070661_10000080815 210
52 3300005345 Ga0070692_10000115 Ga0070692_1000011514 210
53 3300005347 Ga0070668_100001616 Ga0070668_10000161613 210
54 3300005353 Ga0070669_100000343 Ga0070669_10000034315 210
55 3300005354 Ga0070675_100000210 Ga0070675_10000021015 210
56 3300005355 Ga0070671_100000396 Ga0070671_10000039624 210
57 3300005356 Ga0070674_100000733 Ga0070674_10000073315 210
58 3300005364 Ga0070673_100000130 Ga0070673_10000013016 210
59 3300005365 Ga0070688_100003254 Ga0070688_1000032548 210
60 3300005366 Ga0070659_100002709 Ga0070659_1000027094 210
61 3300005367 Ga0070667_100001673 Ga0070667_1000016735 210
62 3300005406 Ga0070703_10001152 Ga0070703_100011528 210
63 3300005438 Ga0070701_10000012 Ga0070701_1000001215 210
64 3300005440 Ga0070705_100000341 Ga0070705_10000034114 210
65 3300005441 Ga0070700_100001057 Ga0070700_10000105710 210
66 3300005444 Ga0070694_100001081 Ga0070694_1000010814 210
67 3300005455 Ga0070663_100000097 Ga0070663_10000009715 210
68 3300005456 Ga0070678_100000452 Ga0070678_1000004523 210
69 3300005457 Ga0070662_100000336 Ga0070662_1000003365 210
70 3300005458 Ga0070681_10005380 Ga0070681_100053802 210
71 3300005459 Ga0068867_100000731 Ga0068867_1000007318 210
72 3300005466 Ga0070685_10001019 Ga0070685_1000101911 210
73 3300005530 Ga0070679_100017090 Ga0070679_1000170902 210
74 3300005535 Ga0070684_100000157 Ga0070684_10000015724 210
75 3300005539 Ga0068853_100001479 Ga0068853_10000147914 210
76 3300005543 Ga0070672_100001119 Ga0070672_1000011193 210
77 3300005544 Ga0070686_100000127 Ga0070686_10000012732 210
78 3300005545 Ga0070695_100020454 Ga0070695_1000204544 210
79 3300005546 Ga0070696_100000219 Ga0070696_10000021914 210
80 3300005547 Ga0070693_100000414 Ga0070693_1000004148 210
81 3300005548 Ga0070665_100139524 Ga0070665_1001395242 210
82 3300005549 Ga0070704_100001431 Ga0070704_1000014318 210
83 3300005563 Ga0068855_100004578 Ga0068855_1000045782 210
84 3300005564 Ga0070664_100000326 Ga0070664_10000032626 210
85 3300005577 Ga0068857_100000063 Ga0068857_10000006314 210
86 3300005578 Ga0068854_100000220 Ga0068854_10000022015 210
87 3300005614 Ga0068856_100000815 Ga0068856_10000081510 210
88 3300005615 Ga0070702_100002268 Ga0070702_1000022684 210
89 3300005616 Ga0068852_100001063 Ga0068852_1000010634 210
90 3300005617 Ga0068859_100010551 Ga0068859_1000105518 210
91 3300005618 Ga0068864_100000380 Ga0068864_1000003808 210
92 3300005718 Ga0068866_10000193 Ga0068866_1000019325 210
93 3300005719 Ga0068861_100000101 Ga0068861_10000010117 210
94 3300005840 Ga0068870_10000028 Ga0068870_1000002833 210
95 3300005841 Ga0068863_100000386 Ga0068863_10000038632 210
96 3300005842 Ga0068858_100034821 Ga0068858_1000348212 210
97 3300005843 Ga0068860_100001254 Ga0068860_1000012547 210
98 3300005844 Ga0068862_100002105 Ga0068862_1000021054 210
99 3300006178 Ga0075367_10012294 Ga0075367_100122942 210
100 3300006237 Ga0097621_100000577 Ga0097621_10000057724 210
101 3300006358 Ga0068871_100000298 Ga0068871_10000029813 210
102 3300006852 Ga0075433_10008685 Ga0075433_100086853 210
103 3300006871 Ga0075434_100021970 Ga0075434_1000219705 210
104 3300006881 Ga0068865_100000125 Ga0068865_10000012527 210
105 3300006914 Ga0075436_100190218 Ga0075436_1001902182 210
106 3300006931 Ga0097620_100010551 Ga0097620_1000105518 210
107 3300007076 Ga0075435_100167850 Ga0075435_1001678502 210
108 3300009011 Ga0105251_10135476 Ga0105251_101354762 210
109 3300009093 Ga0105240_10014048 Ga0105240_100140486 210
110 3300009094 Ga0111539_10000548 Ga0111539_1000054824 210
111 3300009098 Ga0105245_10000173 Ga0105245_1000017321 210
112 3300009101 Ga0105247_10002800 Ga0105247_100028004 210
113 3300009148 Ga0105243_10000377 Ga0105243_1000037729 210
114 3300009174 Ga0105241_10001249 Ga0105241_1000124916 210
115 3300009176 Ga0105242_10000419 Ga0105242_1000041918 210
116 3300009177 Ga0105248_10000643 Ga0105248_1000064332 210
117 3300009545 Ga0105237_10007697 Ga0105237_100076975 210
118 3300009553 Ga0105249_10017441 Ga0105249_100174416 210
119 3300010375 Ga0105239_10009309 Ga0105239_100093094 210
120 3300011119 Ga0105246_10000819 Ga0105246_1000081914 210
121 3300013100 Ga0157373_10003113 Ga0157373_100031134 210
122 3300013102 Ga0157371_10072538 Ga0157371_100725382 210
123 3300013105 Ga0157369_10357613 Ga0157369_103576132 210
124 3300013296 Ga0157374_10004172 Ga0157374_1000417211 210
125 3300013297 Ga0157378_10000993 Ga0157378_1000099316 210
126 3300013306 Ga0163162_10001508 Ga0163162_1000150816 210
127 3300013307 Ga0157372_10008930 Ga0157372_100089305 210
128 3300013308 Ga0157375_10000283 Ga0157375_1000028325 210
129 3300014325 Ga0163163_10094798 Ga0163163_100947983 210
130 3300014326 Ga0157380_10000095 Ga0157380_1000009524 210
131 3300014745 Ga0157377_10001144 Ga0157377_1000114410 210
132 3300014968 Ga0157379_10009736 Ga0157379_100097362 210
133 3300014969 Ga0157376_10000634 Ga0157376_1000063418 210
134 3300017792 Ga0163161_10001324 Ga0163161_100013243 210
135 3300025271 Ga0207666_1000045 Ga0207666_100004511 210
136 3300025290 Ga0207673_1000048 Ga0207673_10000485 210
137 3300025315 Ga0207697_10000551 Ga0207697_1000055114 210
138 3300025885 Ga0207653_10003534 Ga0207653_100035342 210
139 3300025893 Ga0207682_10000065 Ga0207682_100000654 210
140 3300025900 Ga0207710_10002620 Ga0207710_100026206 210
141 3300025901 Ga0207688_10000039 Ga0207688_1000003914 210
142 3300025903 Ga0207680_10042017 Ga0207680_100420173 210
143 3300025904 Ga0207647_10014680 Ga0207647_100146802 210
144 3300025907 Ga0207645_10000080 Ga0207645_1000008046 210
145 3300025908 Ga0207643_10000135 Ga0207643_1000013519 210
146 3300025911 Ga0207654_10005870 Ga0207654_100058705 210
147 3300025912 Ga0207707_10002157 Ga0207707_100021573 210
148 3300025913 Ga0207695_10185434 Ga0207695_101854342 210
149 3300025914 Ga0207671_10003900 Ga0207671_100039005 210
150 3300025917 Ga0207660_10002445 Ga0207660_1000244510 210
151 3300025918 Ga0207662_10000336 Ga0207662_100003368 210
152 3300025919 Ga0207657_10002336 Ga0207657_1000233613 210
153 3300025920 Ga0207649_10000571 Ga0207649_100005719 210
154 3300025921 Ga0207652_10001096 Ga0207652_100010962 210
155 3300025923 Ga0207681_10032843 Ga0207681_100328433 210
156 3300025925 Ga0207650_10028311 Ga0207650_100283112 210
157 3300025926 Ga0207659_10000127 Ga0207659_1000012714 210
158 3300025927 Ga0207687_10000334 Ga0207687_100003342 210
159 3300025931 Ga0207644_10002918 Ga0207644_100029182 210
160 3300025932 Ga0207690_10003358 Ga0207690_100033588 210
161 3300025933 Ga0207706_10001765 Ga0207706_1000176514 210
162 3300025934 Ga0207686_10000297 Ga0207686_1000029714 210
163 3300025935 Ga0207709_10000257 Ga0207709_1000025736 210
164 3300025936 Ga0207670_10000371 Ga0207670_1000037111 210
165 3300025937 Ga0207669_10000089 Ga0207669_1000008916 210
166 3300025938 Ga0207704_10000355 Ga0207704_100003556 210
167 3300025940 Ga0207691_10001737 Ga0207691_100017378 210
168 3300025941 Ga0207711_10141145 Ga0207711_101411452 210
169 3300025942 Ga0207689_10000095 Ga0207689_1000009529 210
170 3300025944 Ga0207661_10000366 Ga0207661_1000036624 210
171 3300025945 Ga0207679_10000073 Ga0207679_1000007364 210
172 3300025949 Ga0207667_10010897 Ga0207667_100108973 210
173 3300025960 Ga0207651_10001109 Ga0207651_100011097 210
174 3300025961 Ga0207712_10000457 Ga0207712_1000045723 210
175 3300025972 Ga0207668_10000971 Ga0207668_1000097115 210
176 3300025981 Ga0207640_10001226 Ga0207640_100012267 210
177 3300025986 Ga0207658_10003961 Ga0207658_100039619 210
178 3300026023 Ga0207677_10009833 Ga0207677_100098335 210
179 3300026035 Ga0207703_10005066 Ga0207703_100050662 210
180 3300026041 Ga0207639_10018364 Ga0207639_100183642 210
181 3300026067 Ga0207678_10000426 Ga0207678_1000042623 210
182 3300026075 Ga0207708_10000991 Ga0207708_1000099114 210
183 3300026078 Ga0207702_10008786 Ga0207702_100087867 210
184 3300026088 Ga0207641_10001067 Ga0207641_100010672 210
185 3300026089 Ga0207648_10000207 Ga0207648_1000020728 210
186 3300026095 Ga0207676_10000875 Ga0207676_100008758 210
187 3300026116 Ga0207674_10001021 Ga0207674_100010218 210
188 3300026118 Ga0207675_100001849 Ga0207675_1000018498 210
189 3300026121 Ga0207683_10000096 Ga0207683_1000009639 210
190 3300026142 Ga0207698_10002278 Ga0207698_100022788 210
191 3300027717 Ga0209998_10001024 Ga0209998_100010246 210
192 3300027876 Ga0209974_10001855 Ga0209974_100018552 210
193 3300027907 Ga0207428_10000160 Ga0207428_1000016035 210
194 3300028379 Ga0268266_10082872 Ga0268266_100828722 210
195 3300028380 Ga0268265_10003071 Ga0268265_1000307111 210
196 3300028381 Ga0268264_10002954 Ga0268264_100029548 210
197 3300034817 Ga0373948_0009148 Ga0373948_0009148_328_1026 210
198 3300034819 Ga0373958_0001030 Ga0373958_0001030_1533_2231 210
199 3300034820 Ga0373959_0009786 Ga0373959_0009786_817_1515 210
200 3300034957 Ga0373938_0000033 Ga0373938_0000033_9158_9856 210
201 3300035084 Ga0373928_0019501 Ga0373928_0019501_468_1166 210
202 3300035088 Ga0373940_0020740 Ga0373940_0020740_42_740 210
203 3300035090 Ga0373949_0003081 Ga0373949_0003081_3317_4015 210
204 3300035091 Ga0373951_0004442 Ga0373951_0004442_1229_1927 210
205 3300035112 Ga0373932_0000983 Ga0373932_0000983_7517_8215 210
206 3300035114 Ga0373939_0000342 Ga0373939_0000342_7496_8194 210
207 3300035121 Ga0373960_0000100 Ga0373960_0000100_7778_8476 210
208 3300035207 Ga0373942_0002640 Ga0373942_0002640_945_1643 210
209 3300035242 Ga0373962_0000272 Ga0373962_0000272_3718_4416 210
210 3300035691 Ga0373931_0001372 Ga0373931_0001372_7516_8214 210
211 3300046684 Ga0495669_0087917 Ga0495669_0087917_180_878 210
212 3300047445 Ga0495677_0049527 Ga0495677_0049527_523_1221 210
213 3300048903 Ga0496100_0001377 Ga0496100_0001377_3842_4540 210
214 3300048904 Ga0496101_0013564 Ga0496101_0013564_1648_2346 210
215 3300048905 Ga0496102_0041360 Ga0496102_0041360_2378_3076 210
216 3300048906 Ga0496103_0008971 Ga0496103_0008971_204_902 210
217 3300048908 Ga0496105_0119096 Ga0496105_0119096_493_1191 210
218 3300048909 Ga0496106_0080753 Ga0496106_0080753_1747_2445 210
219 3300048910 Ga0496107_0024972 Ga0496107_0024972_3200_3898 210
220 3300048911 Ga0496108_0001712 Ga0496108_0001712_3636_4334 210
221 3300048913 Ga0496110_0192406 Ga0496110_0192406_616_1314 210
222 3300048914 Ga0496111_0024187 Ga0496111_0024187_52_750 210
223 3300048915 Ga0496112_0419340 Ga0496112_0419340_245_943 210
224 3300048918 Ga0496115_0000935 Ga0496115_0000935_10548_11246 210
225 3300050511 nmdc:mga08y16_34440_c1 nmdc:mga08y16_34440_c1_3190_3888 210
226 3300050512 nmdc:mga0n895_3347_c1 nmdc:mga0n895_3347_c1_1619_2317 210
227 3300050513 nmdc:mga0rr50_10581_c1 nmdc:mga0rr50_10581_c1_4921_5619 210
228 3300049741 Ga0501079_0204922 Ga0501079_0204922_720_1418 211
229 3300050508 nmdc:mga09592_591314_c1 nmdc:mga09592_591314_c1_40_714 211
230 3300046648 Ga0495611_0218112 Ga0495611_0218112_18_695 212
231 3300050509 nmdc:mga0qj67_274916_c1 nmdc:mga0qj67_274916_c1_421_1098 212
232 3300050515 nmdc:mga0a205_91515_c1 nmdc:mga0a205_91515_c1_12_689 213
233 3300009092 Ga0105250_10106985 Ga0105250_101069852 215
234 3300049592 Ga0501076_0057848 Ga0501076_0057848_1029_1727 215
235 3300049743 Ga0501081_0373654 Ga0501081_0373654_337_1035 215
236 3300053139 Ga0500568_0003570 Ga0500568_0003570_2123_2812 215
237 3300006871 Ga0075434_100968539 Ga0075434_1009685392 216
238 3300009094 Ga0111539_10088301 Ga0111539_100883012 216
239 3300025907 Ga0207645_10142167 Ga0207645_101421672 216
240 3300042012 Ga0439455_0022300 Ga0439455_0022300_346_1044 216
241 iso_pu_bacteria 2821443989 2821446308 216
242 3300005458 Ga0070681_10104785 Ga0070681_101047852 217
243 3300025912 Ga0207707_10042863 Ga0207707_100428633 217
244 3300031241 Ga0265325_10003848 Ga0265325_100038489 217
245 3300031595 Ga0265313_10000524 Ga0265313_1000052419 217
246 3300031595 Ga0265313_10076822 Ga0265313_100768222 217
247 3300031711 Ga0265314_10001524 Ga0265314_1000152421 217
248 3300005327 Ga0070658_10148448 Ga0070658_101484483 218
249 3300005336 Ga0070680_100008159 Ga0070680_1000081594 218
250 3300005458 Ga0070681_10624016 Ga0070681_106240162 218
251 3300025912 Ga0207707_10195623 Ga0207707_101956232 218
252 3300025917 Ga0207660_10011111 Ga0207660_100111116 218
253 3300025919 Ga0207657_10075800 Ga0207657_100758003 218
254 3300025921 Ga0207652_10039714 Ga0207652_100397143 218
255 3300005354 Ga0070675_100502423 Ga0070675_1005024232 219
256 3300005441 Ga0070700_100571608 Ga0070700_1005716081 219
257 3300005457 Ga0070662_100025255 Ga0070662_1000252554 219
258 3300025933 Ga0207706_10018586 Ga0207706_100185866 219
259 3300025945 Ga0207679_10806791 Ga0207679_108067912 219
260 3300026075 Ga0207708_10559252 Ga0207708_105592522 219
261 3300035242 Ga0373962_0077043 Ga0373962_0077043_300_995 219
262 3300035691 Ga0373931_0106010 Ga0373931_0106010_691_1389 219
263 3300053153 Ga0500616_0019413 Ga0500616_0019413_678_1391 219
264 3300053153 Ga0500616_0060193 Ga0500616_0060193_983_1696 219
265 2209111006 2214928522 2213990018 220
266 3300000041 ARcpr5oldR_c000029 ARcpr5oldR_0000292 220
267 3300000043 ARcpr5yngRDRAFT_c000051 ARcpr5yngRDRAFT_0000512 220
268 3300000044 ARSoilOldRDRAFT_c000078 ARSoilOldRDRAFT_00007818 220
269 3300000652 ARCol0yngRDRAFT_1000056 ARCol0yngRDRAFT_10000563 220
270 3300001977 JGI24746J21847_1003746 JGI24746J21847_10037463 220
271 3300001989 JGI24739J22299_10030177 JGI24739J22299_100301772 220
272 3300001990 JGI24737J22298_10004940 JGI24737J22298_100049403 220
273 3300002067 JGI24735J21928_10013679 JGI24735J21928_100136793 220
274 3300002074 JGI24748J21848_1010552 JGI24748J21848_10105522 220
275 3300002075 JGI24738J21930_10002997 JGI24738J21930_100029974 220
276 3300002244 JGI24742J22300_10000704 JGI24742J22300_100007044 220
277 3300002459 JGI24751J29686_10002080 JGI24751J29686_100020803 220
278 3300003911 JGI25405J52794_10013222 JGI25405J52794_100132222 220
279 3300004801 Ga0058860_12244705 Ga0058860_122447052 220
280 3300005327 Ga0070658_10394600 Ga0070658_103946002 220
281 3300005328 Ga0070676_10002129 Ga0070676_100021298 220
282 3300005328 Ga0070676_10047401 Ga0070676_100474012 220
283 3300005329 Ga0070683_100891918 Ga0070683_1008919181 220
284 3300005330 Ga0070690_100006642 Ga0070690_1000066425 220
285 3300005330 Ga0070690_100057438 Ga0070690_1000574383 220
286 3300005330 Ga0070690_100187886 Ga0070690_1001878861 220
287 3300005331 Ga0070670_100004057 Ga0070670_10000405718 220
288 3300005331 Ga0070670_100038299 Ga0070670_1000382991 220
289 3300005331 Ga0070670_100290917 Ga0070670_1002909172 220
290 3300005334 Ga0068869_100014379 Ga0068869_1000143793 220
291 3300005334 Ga0068869_100174207 Ga0068869_1001742072 220
292 3300005335 Ga0070666_10241792 Ga0070666_102417921 220
293 3300005336 Ga0070680_100029392 Ga0070680_1000293924 220
294 3300005336 Ga0070680_100160758 Ga0070680_1001607582 220
295 3300005336 Ga0070680_100308185 Ga0070680_1003081851 220
296 3300005337 Ga0070682_100015639 Ga0070682_1000156398 220
297 3300005337 Ga0070682_100441284 Ga0070682_1004412841 220
298 3300005338 Ga0068868_100005613 Ga0068868_1000056134 220
299 3300005338 Ga0068868_100036974 Ga0068868_1000369741 220
300 3300005339 Ga0070660_100010815 Ga0070660_1000108155 220
301 3300005339 Ga0070660_100022222 Ga0070660_1000222224 220
302 3300005339 Ga0070660_100477695 Ga0070660_1004776951 220
303 3300005340 Ga0070689_100007489 Ga0070689_1000074897 220
304 3300005340 Ga0070689_100011582 Ga0070689_1000115823 220
305 3300005341 Ga0070691_10005289 Ga0070691_100052894 220
306 3300005343 Ga0070687_100015721 Ga0070687_1000157213 220
307 3300005343 Ga0070687_100026522 Ga0070687_1000265222 220
308 3300005344 Ga0070661_100017368 Ga0070661_1000173687 220
309 3300005344 Ga0070661_100231185 Ga0070661_1002311852 220
310 3300005345 Ga0070692_10018977 Ga0070692_100189772 220
311 3300005345 Ga0070692_10039154 Ga0070692_100391542 220
312 3300005345 Ga0070692_10099585 Ga0070692_100995851 220
313 3300005347 Ga0070668_100019523 Ga0070668_1000195233 220
314 3300005347 Ga0070668_100048646 Ga0070668_1000486463 220
315 3300005347 Ga0070668_100222333 Ga0070668_1002223331 220
316 3300005347 Ga0070668_100252680 Ga0070668_1002526802 220
317 3300005353 Ga0070669_100011278 Ga0070669_1000112788 220
318 3300005353 Ga0070669_100187813 Ga0070669_1001878132 220
319 3300005354 Ga0070675_100017011 Ga0070675_1000170116 220
320 3300005354 Ga0070675_100106638 Ga0070675_1001066382 220
321 3300005356 Ga0070674_100013318 Ga0070674_1000133184 220
322 3300005356 Ga0070674_100649252 Ga0070674_1006492522 220
323 3300005364 Ga0070673_100003944 Ga0070673_1000039447 220
324 3300005364 Ga0070673_100018971 Ga0070673_1000189712 220
325 3300005364 Ga0070673_100180050 Ga0070673_1001800503 220
326 3300005365 Ga0070688_100014789 Ga0070688_1000147894 220
327 3300005365 Ga0070688_100046521 Ga0070688_1000465213 220
328 3300005366 Ga0070659_100013517 Ga0070659_1000135173 220
329 3300005366 Ga0070659_100015144 Ga0070659_1000151444 220
330 3300005366 Ga0070659_100696986 Ga0070659_1006969862 220
331 3300005367 Ga0070667_100013178 Ga0070667_1000131784 220
332 3300005367 Ga0070667_100043593 Ga0070667_1000435933 220
333 3300005434 Ga0070709_10006605 Ga0070709_100066053 220
334 3300005435 Ga0070714_100027773 Ga0070714_1000277734 220
335 3300005435 Ga0070714_100191018 Ga0070714_1001910182 220
336 3300005435 Ga0070714_100992837 Ga0070714_1009928371 220
337 3300005436 Ga0070713_100037677 Ga0070713_1000376773 220
338 3300005436 Ga0070713_100311927 Ga0070713_1003119271 220
339 3300005436 Ga0070713_100421322 Ga0070713_1004213222 220
340 3300005437 Ga0070710_10003341 Ga0070710_100033414 220
341 3300005437 Ga0070710_10122089 Ga0070710_101220892 220
342 3300005438 Ga0070701_10006970 Ga0070701_100069704 220
343 3300005438 Ga0070701_10009117 Ga0070701_100091172 220
344 3300005439 Ga0070711_100013443 Ga0070711_1000134433 220
345 3300005439 Ga0070711_100298801 Ga0070711_1002988011 220
346 3300005440 Ga0070705_100003401 Ga0070705_1000034015 220
347 3300005440 Ga0070705_100095309 Ga0070705_1000953093 220
348 3300005441 Ga0070700_100019859 Ga0070700_1000198594 220
349 3300005444 Ga0070694_100006936 Ga0070694_1000069368 220
350 3300005444 Ga0070694_100126740 Ga0070694_1001267403 220
351 3300005445 Ga0070708_100559591 Ga0070708_1005595911 220
352 3300005456 Ga0070678_100002678 Ga0070678_1000026784 220
353 3300005456 Ga0070678_100005200 Ga0070678_1000052005 220
354 3300005457 Ga0070662_100006628 Ga0070662_1000066285 220
355 3300005457 Ga0070662_100452576 Ga0070662_1004525762 220
356 3300005458 Ga0070681_10066676 Ga0070681_100666762 220
357 3300005458 Ga0070681_10102495 Ga0070681_101024952 220
358 3300005458 Ga0070681_10314513 Ga0070681_103145132 220
359 3300005459 Ga0068867_100016596 Ga0068867_1000165963 220
360 3300005459 Ga0068867_100046106 Ga0068867_1000461062 220
361 3300005459 Ga0068867_100272732 Ga0068867_1002727322 220
362 3300005466 Ga0070685_10043366 Ga0070685_100433662 220
363 3300005466 Ga0070685_10075324 Ga0070685_100753243 220
364 3300005466 Ga0070685_10138448 Ga0070685_101384481 220
365 3300005467 Ga0070706_100165424 Ga0070706_1001654242 220
366 3300005468 Ga0070707_100026730 Ga0070707_1000267305 220
367 3300005471 Ga0070698_100167580 Ga0070698_1001675802 220
368 3300005518 Ga0070699_100003057 Ga0070699_1000030577 220
369 3300005518 Ga0070699_100034397 Ga0070699_1000343971 220
370 3300005518 Ga0070699_100228510 Ga0070699_1002285102 220
371 3300005518 Ga0070699_100514407 Ga0070699_1005144071 220
372 3300005530 Ga0070679_100058680 Ga0070679_1000586803 220
373 3300005535 Ga0070684_100006691 Ga0070684_1000066918 220
374 3300005535 Ga0070684_100143283 Ga0070684_1001432832 220
375 3300005535 Ga0070684_100316858 Ga0070684_1003168582 220
376 3300005536 Ga0070697_100041373 Ga0070697_1000413733 220
377 3300005536 Ga0070697_100067714 Ga0070697_1000677143 220
378 3300005536 Ga0070697_100078970 Ga0070697_1000789702 220
379 3300005536 Ga0070697_100286719 Ga0070697_1002867192 220
380 3300005539 Ga0068853_100000376 Ga0068853_10000037635 220
381 3300005539 Ga0068853_100584428 Ga0068853_1005844282 220
382 3300005543 Ga0070672_100009766 Ga0070672_10000976610 220
383 3300005543 Ga0070672_100092673 Ga0070672_1000926733 220
384 3300005544 Ga0070686_100010021 Ga0070686_1000100213 220
385 3300005544 Ga0070686_100062851 Ga0070686_1000628512 220
386 3300005544 Ga0070686_100135679 Ga0070686_1001356791 220
387 3300005545 Ga0070695_100007768 Ga0070695_1000077684 220
388 3300005545 Ga0070695_100019183 Ga0070695_1000191836 220
389 3300005546 Ga0070696_100022964 Ga0070696_1000229646 220
390 3300005546 Ga0070696_100053993 Ga0070696_1000539933 220
391 3300005546 Ga0070696_100067110 Ga0070696_1000671102 220
392 3300005547 Ga0070693_100003980 Ga0070693_1000039804 220
393 3300005548 Ga0070665_100042930 Ga0070665_1000429305 220
394 3300005548 Ga0070665_100164532 Ga0070665_1001645323 220
395 3300005549 Ga0070704_100081023 Ga0070704_1000810232 220
396 3300005563 Ga0068855_100067656 Ga0068855_1000676564 220
397 3300005564 Ga0070664_100047854 Ga0070664_1000478543 220
398 3300005564 Ga0070664_100103611 Ga0070664_1001036113 220
399 3300005564 Ga0070664_100104155 Ga0070664_1001041551 220
400 3300005577 Ga0068857_100023355 Ga0068857_1000233553 220
401 3300005577 Ga0068857_100518800 Ga0068857_1005188001 220
402 3300005578 Ga0068854_100003463 Ga0068854_10000346315 220
403 3300005578 Ga0068854_100064955 Ga0068854_1000649552 220
404 3300005614 Ga0068856_100042339 Ga0068856_1000423392 220
405 3300005614 Ga0068856_100272674 Ga0068856_1002726741 220
406 3300005615 Ga0070702_100003706 Ga0070702_1000037067 220
407 3300005615 Ga0070702_100023799 Ga0070702_1000237993 220
408 3300005616 Ga0068852_100029426 Ga0068852_1000294262 220
409 3300005616 Ga0068852_100033664 Ga0068852_1000336644 220
410 3300005616 Ga0068852_100273955 Ga0068852_1002739552 220
411 3300005617 Ga0068859_100079841 Ga0068859_1000798412 220
412 3300005617 Ga0068859_100114714 Ga0068859_1001147143 220
413 3300005617 Ga0068859_100392377 Ga0068859_1003923772 220
414 3300005617 Ga0068859_100720392 Ga0068859_1007203921 220
415 3300005617 Ga0068859_100734612 Ga0068859_1007346121 220
416 3300005618 Ga0068864_100069586 Ga0068864_1000695863 220
417 3300005618 Ga0068864_100082154 Ga0068864_1000821543 220
418 3300005718 Ga0068866_10078729 Ga0068866_100787291 220
419 3300005718 Ga0068866_10101864 Ga0068866_101018642 220
420 3300005718 Ga0068866_10186731 Ga0068866_101867312 220
421 3300005719 Ga0068861_100006236 Ga0068861_1000062367 220
422 3300005719 Ga0068861_100153893 Ga0068861_1001538932 220
423 3300005719 Ga0068861_100466570 Ga0068861_1004665702 220
424 3300005840 Ga0068870_10006425 Ga0068870_100064256 220
425 3300005841 Ga0068863_100018294 Ga0068863_1000182944 220
426 3300005841 Ga0068863_100513545 Ga0068863_1005135452 220
427 3300005842 Ga0068858_100035282 Ga0068858_1000352822 220
428 3300005842 Ga0068858_100098222 Ga0068858_1000982223 220
429 3300005842 Ga0068858_100208792 Ga0068858_1002087922 220
430 3300005843 Ga0068860_100016023 Ga0068860_1000160235 220
431 3300005843 Ga0068860_100063689 Ga0068860_1000636893 220
432 3300005843 Ga0068860_100747111 Ga0068860_1007471111 220
433 3300005844 Ga0068862_100004930 Ga0068862_1000049302 220
434 3300005844 Ga0068862_100031507 Ga0068862_1000315072 220
435 3300005844 Ga0068862_100343665 Ga0068862_1003436651 220
436 3300005937 Ga0081455_10003621 Ga0081455_100036213 220
437 3300005937 Ga0081455_10013398 Ga0081455_100133982 220
438 3300005937 Ga0081455_10025326 Ga0081455_100253266 220
439 3300005937 Ga0081455_10095805 Ga0081455_100958052 220
440 3300005981 Ga0081538_10055925 Ga0081538_100559252 220
441 3300005983 Ga0081540_1037632 Ga0081540_10376323 220
442 3300005983 Ga0081540_1116838 Ga0081540_11168381 220
443 3300006028 Ga0070717_10195444 Ga0070717_101954442 220
444 3300006028 Ga0070717_10235082 Ga0070717_102350822 220
445 3300006038 Ga0075365_10042900 Ga0075365_100429002 220
446 3300006038 Ga0075365_10436465 Ga0075365_104364651 220
447 3300006051 Ga0075364_10286056 Ga0075364_102860561 220
448 3300006163 Ga0070715_10001242 Ga0070715_100012425 220
449 3300006163 Ga0070715_10403016 Ga0070715_104030161 220
450 3300006173 Ga0070716_100015185 Ga0070716_1000151853 220
451 3300006175 Ga0070712_100063748 Ga0070712_1000637483 220
452 3300006175 Ga0070712_100114813 Ga0070712_1001148131 220
453 3300006178 Ga0075367_10070817 Ga0075367_100708172 220
454 3300006237 Ga0097621_100008916 Ga0097621_1000089164 220
455 3300006237 Ga0097621_100108772 Ga0097621_1001087722 220
456 3300006358 Ga0068871_100222881 Ga0068871_1002228812 220
457 3300006844 Ga0075428_100054716 Ga0075428_1000547163 220
458 3300006844 Ga0075428_100061750 Ga0075428_1000617503 220
459 3300006844 Ga0075428_100079781 Ga0075428_1000797812 220
460 3300006844 Ga0075428_100476022 Ga0075428_1004760222 220
461 3300006844 Ga0075428_100502510 Ga0075428_1005025102 220
462 3300006846 Ga0075430_100253888 Ga0075430_1002538881 220
463 3300006846 Ga0075430_100466794 Ga0075430_1004667942 220
464 3300006846 Ga0075430_100755967 Ga0075430_1007559671 220
465 3300006847 Ga0075431_100149005 Ga0075431_1001490053 220
466 3300006847 Ga0075431_100181948 Ga0075431_1001819483 220
467 3300006847 Ga0075431_100239256 Ga0075431_1002392562 220
468 3300006847 Ga0075431_100239673 Ga0075431_1002396732 220
469 3300006847 Ga0075431_100316153 Ga0075431_1003161532 220
470 3300006852 Ga0075433_10141955 Ga0075433_101419552 220
471 3300006852 Ga0075433_10220248 Ga0075433_102202483 220
472 3300006871 Ga0075434_100018218 Ga0075434_1000182186 220
473 3300006871 Ga0075434_100073924 Ga0075434_1000739243 220
474 3300006871 Ga0075434_100355260 Ga0075434_1003552602 220
475 3300006871 Ga0075434_100428612 Ga0075434_1004286122 220
476 3300006880 Ga0075429_100108978 Ga0075429_1001089781 220
477 3300006880 Ga0075429_100610307 Ga0075429_1006103071 220
478 3300006881 Ga0068865_100006959 Ga0068865_10000695910 220
479 3300006914 Ga0075436_100153735 Ga0075436_1001537352 220
480 3300006914 Ga0075436_100334652 Ga0075436_1003346522 220
481 3300006931 Ga0097620_100079842 Ga0097620_1000798422 220
482 3300006931 Ga0097620_100114715 Ga0097620_1001147153 220
483 3300006931 Ga0097620_100392386 Ga0097620_1003923861 220
484 3300006931 Ga0097620_100720265 Ga0097620_1007202652 220
485 3300006931 Ga0097620_100734654 Ga0097620_1007346541 220
486 3300007076 Ga0075435_100179244 Ga0075435_1001792442 220
487 3300007076 Ga0075435_100213279 Ga0075435_1002132792 220
488 3300007076 Ga0075435_100291542 Ga0075435_1002915423 220
489 3300009011 Ga0105251_10021088 Ga0105251_100210882 220
490 3300009036 Ga0105244_10246773 Ga0105244_102467731 220
491 3300009092 Ga0105250_10038616 Ga0105250_100386161 220
492 3300009094 Ga0111539_10007739 Ga0111539_100077393 220
493 3300009094 Ga0111539_10166482 Ga0111539_101664824 220
494 3300009094 Ga0111539_10190904 Ga0111539_101909042 220
495 3300009094 Ga0111539_10549428 Ga0111539_105494281 220
496 3300009094 Ga0111539_11012060 Ga0111539_110120601 220
497 3300009098 Ga0105245_10375635 Ga0105245_103756351 220
498 3300009098 Ga0105245_10713630 Ga0105245_107136302 220
499 3300009101 Ga0105247_10007920 Ga0105247_100079207 220
500 3300009101 Ga0105247_10029012 Ga0105247_100290122 220
501 3300009101 Ga0105247_10050052 Ga0105247_100500521 220
502 3300009147 Ga0114129_10003643 Ga0114129_100036437 220
503 3300009147 Ga0114129_11362965 Ga0114129_113629651 220
504 3300009148 Ga0105243_10017817 Ga0105243_100178177 220
505 3300009148 Ga0105243_10120108 Ga0105243_101201082 220
506 3300009148 Ga0105243_10254143 Ga0105243_102541431 220
507 3300009174 Ga0105241_10010359 Ga0105241_100103597 220
508 3300009176 Ga0105242_10599018 Ga0105242_105990181 220
509 3300009177 Ga0105248_10080754 Ga0105248_100807545 220
510 3300009177 Ga0105248_10094904 Ga0105248_100949041 220
511 3300009545 Ga0105237_10021014 Ga0105237_100210144 220
512 3300009545 Ga0105237_10031168 Ga0105237_100311683 220
513 3300009545 Ga0105237_10291831 Ga0105237_102918312 220
514 3300009545 Ga0105237_10401229 Ga0105237_104012292 220
515 3300009551 Ga0105238_10046148 Ga0105238_100461482 220
516 3300009551 Ga0105238_10065646 Ga0105238_100656462 220
517 3300009553 Ga0105249_10006636 Ga0105249_100066369 220
518 3300009553 Ga0105249_10016803 Ga0105249_100168037 220
519 3300009553 Ga0105249_10361965 Ga0105249_103619651 220
520 3300010159 Ga0099796_10055339 Ga0099796_100553392 220
521 3300010375 Ga0105239_10018417 Ga0105239_100184175 220
522 3300010375 Ga0105239_10058349 Ga0105239_100583491 220
523 3300010375 Ga0105239_10852918 Ga0105239_108529182 220
524 3300011119 Ga0105246_10020654 Ga0105246_100206544 220
525 3300011119 Ga0105246_10285247 Ga0105246_102852472 220
526 3300011119 Ga0105246_10289894 Ga0105246_102898941 220
527 3300012513 Ga0157326_1021439 Ga0157326_10214392 220
528 3300012515 Ga0157338_1000385 Ga0157338_10003852 220
529 3300013100 Ga0157373_10025646 Ga0157373_100256463 220
530 3300013100 Ga0157373_10163244 Ga0157373_101632442 220
531 3300013102 Ga0157371_10007096 Ga0157371_100070968 220
532 3300013104 Ga0157370_10139565 Ga0157370_101395652 220
533 3300013105 Ga0157369_10002471 Ga0157369_1000247128 220
534 3300013296 Ga0157374_10041948 Ga0157374_100419482 220
535 3300013297 Ga0157378_10018527 Ga0157378_100185275 220
536 3300013297 Ga0157378_10127919 Ga0157378_101279194 220
537 3300013297 Ga0157378_10134727 Ga0157378_101347274 220
538 3300013297 Ga0157378_10256495 Ga0157378_102564952 220
539 3300013306 Ga0163162_10021249 Ga0163162_100212495 220
540 3300013306 Ga0163162_10026452 Ga0163162_100264523 220
541 3300013307 Ga0157372_10024481 Ga0157372_100244815 220
542 3300013307 Ga0157372_10380283 Ga0157372_103802832 220
543 3300013308 Ga0157375_10017827 Ga0157375_100178276 220
544 3300013308 Ga0157375_10076749 Ga0157375_100767491 220
545 3300013308 Ga0157375_10305601 Ga0157375_103056012 220
546 3300013308 Ga0157375_11505486 Ga0157375_115054861 220
547 3300014325 Ga0163163_10018211 Ga0163163_100182113 220
548 3300014325 Ga0163163_10099847 Ga0163163_100998473 220
549 3300014326 Ga0157380_10009789 Ga0157380_100097897 220
550 3300014497 Ga0182008_10043993 Ga0182008_100439932 220
551 3300014745 Ga0157377_10006484 Ga0157377_100064847 220
552 3300014968 Ga0157379_10016635 Ga0157379_100166356 220
553 3300014968 Ga0157379_10079062 Ga0157379_100790621 220
554 3300014969 Ga0157376_10010367 Ga0157376_100103677 220
555 3300017792 Ga0163161_10013788 Ga0163161_100137886 220
556 3300017792 Ga0163161_10237339 Ga0163161_102373392 220
557 3300020082 Ga0206353_10213769 Ga0206353_102137691 220
558 3300021361 Ga0213872_10042183 Ga0213872_100421832 220
559 3300021384 Ga0213876_10056585 Ga0213876_100565852 220
560 3300025315 Ga0207697_10154966 Ga0207697_101549661 220
561 3300025321 Ga0207656_10130556 Ga0207656_101305561 220
562 3300025711 Ga0207696_1016412 Ga0207696_10164122 220
563 3300025899 Ga0207642_10227563 Ga0207642_102275632 220
564 3300025900 Ga0207710_10003935 Ga0207710_100039355 220
565 3300025901 Ga0207688_10007776 Ga0207688_100077765 220
566 3300025901 Ga0207688_10008435 Ga0207688_100084353 220
567 3300025901 Ga0207688_10052345 Ga0207688_100523453 220
568 3300025903 Ga0207680_10010818 Ga0207680_100108187 220
569 3300025904 Ga0207647_10001204 Ga0207647_100012047 220
570 3300025904 Ga0207647_10024058 Ga0207647_100240582 220
571 3300025904 Ga0207647_10029533 Ga0207647_100295335 220
572 3300025905 Ga0207685_10003251 Ga0207685_100032513 220
573 3300025907 Ga0207645_10007301 Ga0207645_100073015 220
574 3300025907 Ga0207645_10044077 Ga0207645_100440772 220
575 3300025907 Ga0207645_10056961 Ga0207645_100569612 220
576 3300025908 Ga0207643_10001337 Ga0207643_100013374 220
577 3300025909 Ga0207705_10051854 Ga0207705_100518543 220
578 3300025910 Ga0207684_10021159 Ga0207684_100211593 220
579 3300025910 Ga0207684_10169158 Ga0207684_101691582 220
580 3300025910 Ga0207684_10170271 Ga0207684_101702711 220
581 3300025910 Ga0207684_10553354 Ga0207684_105533542 220
582 3300025911 Ga0207654_10007959 Ga0207654_100079596 220
583 3300025912 Ga0207707_10205781 Ga0207707_102057812 220
584 3300025912 Ga0207707_10278001 Ga0207707_102780012 220
585 3300025912 Ga0207707_10404492 Ga0207707_104044921 220
586 3300025914 Ga0207671_10031657 Ga0207671_100316574 220
587 3300025914 Ga0207671_10091047 Ga0207671_100910472 220
588 3300025915 Ga0207693_10010373 Ga0207693_100103735 220
589 3300025915 Ga0207693_10028298 Ga0207693_100282981 220
590 3300025915 Ga0207693_10060332 Ga0207693_100603322 220
591 3300025915 Ga0207693_10175100 Ga0207693_101751002 220
592 3300025916 Ga0207663_10005810 Ga0207663_100058105 220
593 3300025917 Ga0207660_10095630 Ga0207660_100956302 220
594 3300025917 Ga0207660_10256790 Ga0207660_102567902 220
595 3300025917 Ga0207660_10343904 Ga0207660_103439042 220
596 3300025918 Ga0207662_10008664 Ga0207662_100086642 220
597 3300025918 Ga0207662_10035336 Ga0207662_100353363 220
598 3300025919 Ga0207657_10000186 Ga0207657_100001867 220
599 3300025919 Ga0207657_10017486 Ga0207657_100174865 220
600 3300025920 Ga0207649_10011692 Ga0207649_100116925 220
601 3300025921 Ga0207652_10097434 Ga0207652_100974343 220
602 3300025922 Ga0207646_10065570 Ga0207646_100655702 220
603 3300025922 Ga0207646_10098788 Ga0207646_100987882 220
604 3300025923 Ga0207681_10011812 Ga0207681_100118124 220
605 3300025924 Ga0207694_10288847 Ga0207694_102888472 220
606 3300025924 Ga0207694_10418040 Ga0207694_104180402 220
607 3300025925 Ga0207650_10044073 Ga0207650_100440731 220
608 3300025925 Ga0207650_10100950 Ga0207650_101009503 220
609 3300025925 Ga0207650_10117429 Ga0207650_101174291 220
610 3300025925 Ga0207650_10180325 Ga0207650_101803252 220
611 3300025925 Ga0207650_10447848 Ga0207650_104478482 220
612 3300025926 Ga0207659_10042756 Ga0207659_100427563 220
613 3300025927 Ga0207687_10333703 Ga0207687_103337032 220
614 3300025928 Ga0207700_10410430 Ga0207700_104104301 220
615 3300025931 Ga0207644_10010543 Ga0207644_100105434 220
616 3300025931 Ga0207644_10075355 Ga0207644_100753552 220
617 3300025932 Ga0207690_10018543 Ga0207690_100185434 220
618 3300025932 Ga0207690_10071987 Ga0207690_100719873 220
619 3300025932 Ga0207690_10322211 Ga0207690_103222112 220
620 3300025932 Ga0207690_10617743 Ga0207690_106177431 220
621 3300025933 Ga0207706_10014913 Ga0207706_100149138 220
622 3300025933 Ga0207706_10017451 Ga0207706_100174513 220
623 3300025934 Ga0207686_10034591 Ga0207686_100345913 220
624 3300025934 Ga0207686_10178954 Ga0207686_101789541 220
625 3300025935 Ga0207709_10004698 Ga0207709_100046981 220
626 3300025935 Ga0207709_10075527 Ga0207709_100755272 220
627 3300025935 Ga0207709_10349118 Ga0207709_103491182 220
628 3300025936 Ga0207670_10020974 Ga0207670_100209741 220
629 3300025936 Ga0207670_10028654 Ga0207670_100286543 220
630 3300025937 Ga0207669_10112928 Ga0207669_101129282 220
631 3300025938 Ga0207704_10261411 Ga0207704_102614111 220
632 3300025939 Ga0207665_10000186 Ga0207665_1000018643 220
633 3300025939 Ga0207665_10049910 Ga0207665_100499102 220
634 3300025940 Ga0207691_10028104 Ga0207691_100281042 220
635 3300025940 Ga0207691_10057591 Ga0207691_100575913 220
636 3300025942 Ga0207689_10014632 Ga0207689_100146327 220
637 3300025945 Ga0207679_10009670 Ga0207679_100096704 220
638 3300025945 Ga0207679_10059275 Ga0207679_100592753 220
639 3300025945 Ga0207679_10267382 Ga0207679_102673822 220
640 3300025949 Ga0207667_10046869 Ga0207667_100468694 220
641 3300025949 Ga0207667_10547570 Ga0207667_105475702 220
642 3300025960 Ga0207651_10016924 Ga0207651_100169244 220
643 3300025961 Ga0207712_10012149 Ga0207712_100121496 220
644 3300025972 Ga0207668_10035080 Ga0207668_100350803 220
645 3300025981 Ga0207640_10025655 Ga0207640_100256554 220
646 3300025986 Ga0207658_10043934 Ga0207658_100439343 220
647 3300025986 Ga0207658_10748777 Ga0207658_107487771 220
648 3300026023 Ga0207677_10063120 Ga0207677_100631203 220
649 3300026035 Ga0207703_10054180 Ga0207703_100541801 220
650 3300026035 Ga0207703_10983607 Ga0207703_109836072 220
651 3300026041 Ga0207639_10134191 Ga0207639_101341912 220
652 3300026067 Ga0207678_10012836 Ga0207678_100128365 220
653 3300026067 Ga0207678_10020810 Ga0207678_100208102 220
654 3300026075 Ga0207708_10000624 Ga0207708_1000062410 220
655 3300026075 Ga0207708_10033947 Ga0207708_100339471 220
656 3300026075 Ga0207708_10034414 Ga0207708_100344142 220
657 3300026075 Ga0207708_10275336 Ga0207708_102753362 220
658 3300026078 Ga0207702_10095493 Ga0207702_100954932 220
659 3300026088 Ga0207641_10024810 Ga0207641_100248105 220
660 3300026088 Ga0207641_10033009 Ga0207641_100330094 220
661 3300026089 Ga0207648_10001430 Ga0207648_100014306 220
662 3300026089 Ga0207648_10051427 Ga0207648_100514273 220
663 3300026095 Ga0207676_10007995 Ga0207676_100079952 220
664 3300026095 Ga0207676_10067109 Ga0207676_100671092 220
665 3300026095 Ga0207676_10152114 Ga0207676_101521142 220
666 3300026116 Ga0207674_10032377 Ga0207674_100323777 220
667 3300026116 Ga0207674_10519549 Ga0207674_105195492 220
668 3300026118 Ga0207675_100000447 Ga0207675_10000044743 220
669 3300026118 Ga0207675_100008098 Ga0207675_1000080983 220
670 3300026118 Ga0207675_100150332 Ga0207675_1001503322 220
671 3300026118 Ga0207675_100494770 Ga0207675_1004947701 220
672 3300026121 Ga0207683_10013771 Ga0207683_100137714 220
673 3300026121 Ga0207683_10046039 Ga0207683_100460392 220
674 3300026121 Ga0207683_10284271 Ga0207683_102842712 220
675 3300026142 Ga0207698_10452124 Ga0207698_104521241 220
676 3300027512 Ga0209179_1007258 Ga0209179_10072582 220
677 3300027695 Ga0209966_1002326 Ga0209966_10023262 220
678 3300027717 Ga0209998_10001533 Ga0209998_100015332 220
679 3300027907 Ga0207428_10014000 Ga0207428_100140007 220
680 3300027907 Ga0207428_10061624 Ga0207428_100616241 220
681 3300028379 Ga0268266_10181263 Ga0268266_101812633 220
682 3300028380 Ga0268265_10061051 Ga0268265_100610515 220
683 3300028381 Ga0268264_10032764 Ga0268264_100327642 220
684 3300028381 Ga0268264_10089680 Ga0268264_100896803 220
685 3300028381 Ga0268264_10119697 Ga0268264_101196972 220
686 3300028381 Ga0268264_10556571 Ga0268264_105565712 220
687 3300031344 Ga0265316_10296434 Ga0265316_102964341 220
688 3300031456 Ga0307513_10103448 Ga0307513_101034483 220
689 3300034816 Ga0373930_0000578 Ga0373930_0000578_1466_2164 220
690 3300034820 Ga0373959_0004468 Ga0373959_0004468_928_1626 220
691 3300034957 Ga0373938_0000028 Ga0373938_0000028_17048_17746 220
692 3300035084 Ga0373928_0030401 Ga0373928_0030401_392_1090 220
693 3300035085 Ga0373929_0025611 Ga0373929_0025611_305_1003 220
694 3300035088 Ga0373940_0010637 Ga0373940_0010637_327_1028 220
695 3300035091 Ga0373951_0000666 Ga0373951_0000666_198_896 220
696 3300035092 Ga0373952_0006012 Ga0373952_0006012_289_987 220
697 3300035112 Ga0373932_0000749 Ga0373932_0000749_1611_2309 220
698 3300035113 Ga0373936_0107817 Ga0373936_0107817_181_882 220
699 3300035117 Ga0373953_0002640 Ga0373953_0002640_2695_3402 220
700 3300035118 Ga0373954_0003770 Ga0373954_0003770_292_999 220
701 3300035171 Ga0373946_0005589 Ga0373946_0005589_3613_4320 220
702 3300035171 Ga0373946_0053840 Ga0373946_0053840_491_1228 220
703 3300035171 Ga0373946_0311760 Ga0373946_0311760_37_738 220
704 3300035172 Ga0373955_0002025 Ga0373955_0002025_2016_2723 220
705 3300035207 Ga0373942_0023984 Ga0373942_0023984_639_1337 220
706 3300035241 Ga0373961_0042708 Ga0373961_0042708_397_1095 220
707 3300035242 Ga0373962_0000881 Ga0373962_0000881_453_1151 220
708 3300035242 Ga0373962_0101582 Ga0373962_0101582_149_850 220
709 3300035691 Ga0373931_0178320 Ga0373931_0178320_106_807 220
710 3300035692 Ga0373935_0000179 Ga0373935_0000179_6200_6907 220
711 3300035695 Ga0373927_0118199 Ga0373927_0118199_434_1141 220
712 3300035695 Ga0373927_0147978 Ga0373927_0147978_72_773 220
713 3300035724 Ga0373933_0002450 Ga0373933_0002450_9463_10170 220
714 3300035725 Ga0373947_0382683 Ga0373947_0382683_126_827 220
715 3300036401 Ga0373937_0000864 Ga0373937_0000864_19755_20462 220
716 3300036401 Ga0373937_0172623 Ga0373937_0172623_468_1271 220
717 3300037068 Ga0373925_0000639 Ga0373925_0000639_19742_20449 220
718 3300037068 Ga0373925_0004022 Ga0373925_0004022_10176_10913 220
719 3300037068 Ga0373925_0197594 Ga0373925_0197594_131_835 220
720 3300037312 Ga0395899_0368606 Ga0395899_0368606_148_849 220
721 3300037418 Ga0395900_0017207 Ga0395900_0017207_1315_2016 220
722 3300037466 Ga0395898_0011333 Ga0395898_0011333_2789_3490 220
723 3300037466 Ga0395898_0660310 Ga0395898_0660310_157_858 220
724 3300037471 Ga0395905_0002399 Ga0395905_0002399_5164_5865 220
725 3300037471 Ga0395905_0112548 Ga0395905_0112548_1796_2497 220
726 3300039437 Ga0436365_1134850 Ga0436365_1134850_27_728 220
727 3300039437 Ga0436365_1428872 Ga0436365_1428872_7676_8377 220
728 3300039447 Ga0436361_0166397 Ga0436361_0166397_11139_11840 220
729 3300042876 Ga0451577_0363956 Ga0451577_0363956_51_749 220
730 3300044712 Ga0453684_0097934 Ga0453684_0097934_2137_2835 220
731 3300045051 Ga0451576_0088025 Ga0451576_0088025_1800_2498 220
732 3300046453 Ga0495627_079143 Ga0495627_079143_38_739 220
733 3300046454 Ga0495592_0000348 Ga0495592_0000348_26002_26709 220
734 3300046455 Ga0495603_0031637 Ga0495603_0031637_2221_2922 220
735 3300046459 Ga0495629_0027169 Ga0495629_0027169_719_1426 220
736 3300046461 Ga0495641_0011562 Ga0495641_0011562_1117_1818 220
737 3300046462 Ga0495651_0000781 Ga0495651_0000781_19779_20486 220
738 3300046463 Ga0495653_0000030 Ga0495653_0000030_52519_53226 220
739 3300046473 Ga0495582_0007216 Ga0495582_0007216_1504_2238 220
740 3300046474 Ga0495605_0156414 Ga0495605_0156414_220_921 220
741 3300046476 Ga0495662_0000776 Ga0495662_0000776_6685_7392 220
742 3300046477 Ga0495664_0000003 Ga0495664_0000003_173137_173844 220
743 3300046491 Ga0495584_0012992 Ga0495584_0012992_2877_3578 220
744 3300046491 Ga0495584_0036607 Ga0495584_0036607_101_802 220
745 3300046491 Ga0495584_0235420 Ga0495584_0235420_131_832 220
746 3300046499 Ga0495594_0005256 Ga0495594_0005256_3873_4574 220
747 3300046501 Ga0495607_0154444 Ga0495607_0154444_245_946 220
748 3300046501 Ga0495607_0207849 Ga0495607_0207849_45_746 220
749 3300046511 Ga0495608_0000011 Ga0495608_0000011_119141_119848 220
750 3300046511 Ga0495608_0067898 Ga0495608_0067898_1558_2259 220
751 3300046511 Ga0495608_0310287 Ga0495608_0310287_172_873 220
752 3300046514 Ga0495618_0000025 Ga0495618_0000025_89435_90142 220
753 3300046514 Ga0495618_0109332 Ga0495618_0109332_931_1632 220
754 3300046515 Ga0495620_0192190 Ga0495620_0192190_37_738 220
755 3300046516 Ga0495628_0000001 Ga0495628_0000001_662538_663245 220
756 3300046519 Ga0495632_0056731 Ga0495632_0056731_107_808 220
757 3300046529 Ga0495652_0000002 Ga0495652_0000002_877072_877779 220
758 3300046531 Ga0495665_0247543 Ga0495665_0247543_178_879 220
759 3300046533 Ga0495640_0000002 Ga0495640_0000002_117401_118108 220
760 3300046536 Ga0495587_0000001 Ga0495587_0000001_189807_190514 220
761 3300046537 Ga0495598_0030664 Ga0495598_0030664_387_1088 220
762 3300046537 Ga0495598_0034323 Ga0495598_0034323_219_920 220
763 3300046543 Ga0495645_0000276 Ga0495645_0000276_11006_11713 220
764 3300046559 Ga0495667_0000004 Ga0495667_0000004_89454_90161 220
765 3300046559 Ga0495667_0218223 Ga0495667_0218223_296_1099 220
766 3300046615 Ga0495656_0083987 Ga0495656_0083987_19_720 220
767 3300046615 Ga0495656_0189389 Ga0495656_0189389_219_920 220
768 3300046616 Ga0495668_0041609 Ga0495668_0041609_1447_2148 220
769 3300046642 Ga0495634_0001327 Ga0495634_0001327_10861_11568 220
770 3300046663 Ga0495635_0000001 Ga0495635_0000001_175618_176325 220
771 3300046675 Ga0495657_0000190 Ga0495657_0000190_10907_11614 220
772 3300046678 Ga0495599_0000212 Ga0495599_0000212_26015_26722 220
773 3300046679 Ga0495623_0000043 Ga0495623_0000043_8289_8996 220
774 3300046680 Ga0495646_0000009 Ga0495646_0000009_190718_191425 220
775 3300046681 Ga0495647_0083832 Ga0495647_0083832_224_961 220
776 3300046684 Ga0495669_0101789 Ga0495669_0101789_618_1319 220
777 3300046689 Ga0495613_0004409 Ga0495613_0004409_727_1434 220
778 3300046690 Ga0495624_0047828 Ga0495624_0047828_1295_2002 220
779 3300046691 Ga0495670_0030357 Ga0495670_0030357_47_748 220
780 3300046694 Ga0495649_0211030 Ga0495649_0211030_231_932 220
781 3300046809 Ga0495600_0000017 Ga0495600_0000017_106233_106940 220
782 3300047317 Ga0495604_0000008 Ga0495604_0000008_329520_330227 220
783 3300047319 Ga0495674_0000016 Ga0495674_0000016_11048_11755 220
784 3300047319 Ga0495674_0373878 Ga0495674_0373878_98_901 220
785 3300047320 Ga0495672_0153062 Ga0495672_0153062_113_814 220
786 3300047322 Ga0495680_0001034 Ga0495680_0001034_25994_26701 220
787 3300047444 Ga0495675_0170972 Ga0495675_0170972_67_774 220
788 3300047471 Ga0495684_0000002 Ga0495684_0000002_329578_330285 220
789 3300047673 Ga0495593_0000458 Ga0495593_0000458_12221_12928 220
790 3300047673 Ga0495593_0121463 Ga0495593_0121463_136_837 220
791 3300048088 Ga0495602_0000024 Ga0495602_0000024_25994_26701 220
792 3300048903 Ga0496100_0122050 Ga0496100_0122050_626_1330 220
793 3300048903 Ga0496100_0189248 Ga0496100_0189248_640_1341 220
794 3300048903 Ga0496100_0205235 Ga0496100_0205235_617_1318 220
795 3300048903 Ga0496100_0223587 Ga0496100_0223587_438_1139 220
796 3300048904 Ga0496101_0009219 Ga0496101_0009219_3763_4464 220
797 3300048904 Ga0496101_0031294 Ga0496101_0031294_1542_2243 220
798 3300048905 Ga0496102_0006717 Ga0496102_0006717_6664_7365 220
799 3300048905 Ga0496102_0006945 Ga0496102_0006945_2865_3566 220
800 3300048905 Ga0496102_0089329 Ga0496102_0089329_733_1431 220
801 3300048905 Ga0496102_0137624 Ga0496102_0137624_1231_1932 220
802 3300048905 Ga0496102_0217998 Ga0496102_0217998_1059_1760 220
803 3300048905 Ga0496102_0463771 Ga0496102_0463771_108_809 220
804 3300048906 Ga0496103_0001472 Ga0496103_0001472_5282_5983 220
805 3300048906 Ga0496103_0014262 Ga0496103_0014262_2626_3324 220
806 3300048906 Ga0496103_0026372 Ga0496103_0026372_40_741 220
807 3300048906 Ga0496103_0058259 Ga0496103_0058259_438_1139 220
808 3300048906 Ga0496103_0081282 Ga0496103_0081282_959_1660 220
809 3300048907 Ga0496104_0004766 Ga0496104_0004766_889_1590 220
810 3300048907 Ga0496104_0005758 Ga0496104_0005758_9790_10491 220
811 3300048907 Ga0496104_0103147 Ga0496104_0103147_1855_2556 220
812 3300048908 Ga0496105_0009176 Ga0496105_0009176_3960_4661 220
813 3300048908 Ga0496105_0141999 Ga0496105_0141999_173_874 220
814 3300048909 Ga0496106_0002903 Ga0496106_0002903_5712_6413 220
815 3300048909 Ga0496106_0011116 Ga0496106_0011116_1020_1721 220
816 3300048909 Ga0496106_0035803 Ga0496106_0035803_1753_2454 220
817 3300048909 Ga0496106_0057065 Ga0496106_0057065_438_1139 220
818 3300048909 Ga0496106_0074645 Ga0496106_0074645_87_785 220
819 3300048909 Ga0496106_0108814 Ga0496106_0108814_664_1401 220
820 3300048910 Ga0496107_0002783 Ga0496107_0002783_10752_11453 220
821 3300048910 Ga0496107_0027697 Ga0496107_0027697_2762_3463 220
822 3300048910 Ga0496107_0093441 Ga0496107_0093441_270_968 220
823 3300048910 Ga0496107_0462188 Ga0496107_0462188_166_867 220
824 3300048911 Ga0496108_0000746 Ga0496108_0000746_13592_14293 220
825 3300048911 Ga0496108_0022767 Ga0496108_0022767_338_1039 220
826 3300048911 Ga0496108_0082105 Ga0496108_0082105_1855_2556 220
827 3300048912 Ga0496109_0003828 Ga0496109_0003828_849_1550 220
828 3300048912 Ga0496109_0005286 Ga0496109_0005286_2360_3061 220
829 3300048912 Ga0496109_0018504 Ga0496109_0018504_2356_3057 220
830 3300048912 Ga0496109_0183921 Ga0496109_0183921_1224_1925 220
831 3300048913 Ga0496110_0004442 Ga0496110_0004442_2084_2785 220
832 3300048913 Ga0496110_0013739 Ga0496110_0013739_5882_6583 220
833 3300048913 Ga0496110_0070526 Ga0496110_0070526_1983_2684 220
834 3300048913 Ga0496110_0773038 Ga0496110_0773038_49_750 220
835 3300048914 Ga0496111_0001412 Ga0496111_0001412_2363_3064 220
836 3300048914 Ga0496111_0016642 Ga0496111_0016642_305_1006 220
837 3300048914 Ga0496111_0037068 Ga0496111_0037068_861_1562 220
838 3300048914 Ga0496111_0095394 Ga0496111_0095394_772_1473 220
839 3300048914 Ga0496111_0175258 Ga0496111_0175258_622_1320 220
840 3300048914 Ga0496111_0230850 Ga0496111_0230850_416_1117 220
841 3300048914 Ga0496111_0351558 Ga0496111_0351558_341_1042 220
842 3300048915 Ga0496112_0010687 Ga0496112_0010687_3957_4658 220
843 3300048915 Ga0496112_0013459 Ga0496112_0013459_4007_4708 220
844 3300048915 Ga0496112_0047166 Ga0496112_0047166_1870_2571 220
845 3300048915 Ga0496112_0072786 Ga0496112_0072786_1151_1852 220
846 3300048916 Ga0496113_0000750 Ga0496113_0000750_3684_4385 220
847 3300048916 Ga0496113_0019688 Ga0496113_0019688_2481_3182 220
848 3300048916 Ga0496113_0035388 Ga0496113_0035388_2044_2745 220
849 3300048916 Ga0496113_0105411 Ga0496113_0105411_1476_2177 220
850 3300048916 Ga0496113_0466292 Ga0496113_0466292_185_886 220
851 3300048917 Ga0496114_0002625 Ga0496114_0002625_2652_3353 220
852 3300048917 Ga0496114_0081557 Ga0496114_0081557_177_878 220
853 3300048917 Ga0496114_0118107 Ga0496114_0118107_587_1288 220
854 3300048917 Ga0496114_0124173 Ga0496114_0124173_1433_2134 220
855 3300048918 Ga0496115_0064082 Ga0496115_0064082_568_1269 220
856 3300049570 Ga0501033_0339588 Ga0501033_0339588_255_956 220
857 3300049572 Ga0501036_0041568 Ga0501036_0041568_1079_1780 220
858 3300049574 Ga0501038_0160711 Ga0501038_0160711_594_1295 220
859 3300049577 Ga0501041_0038076 Ga0501041_0038076_1924_2625 220
860 3300049579 Ga0501043_0377710 Ga0501043_0377710_137_838 220
861 3300049580 Ga0501046_0108202 Ga0501046_0108202_796_1497 220
862 3300049582 Ga0501048_0115606 Ga0501048_0115606_128_829 220
863 3300049582 Ga0501048_0151980 Ga0501048_0151980_453_1154 220
864 3300049582 Ga0501048_0290549 Ga0501048_0290549_121_822 220
865 3300049586 Ga0501070_0425838 Ga0501070_0425838_218_919 220
866 3300049591 Ga0501075_0249919 Ga0501075_0249919_473_1174 220
867 3300049592 Ga0501076_0424896 Ga0501076_0424896_199_900 220
868 3300049592 Ga0501076_0584039 Ga0501076_0584039_101_802 220
869 3300049593 Ga0501077_0020914 Ga0501077_0020914_2735_3436 220
870 3300049593 Ga0501077_0023130 Ga0501077_0023130_813_1514 220
871 3300049741 Ga0501079_0029477 Ga0501079_0029477_3151_3852 220
872 3300049741 Ga0501079_0120499 Ga0501079_0120499_676_1377 220
873 3300049742 Ga0501080_0148157 Ga0501080_0148157_63_764 220
874 3300049743 Ga0501081_0102485 Ga0501081_0102485_943_1644 220
875 3300049743 Ga0501081_0374868 Ga0501081_0374868_107_808 220
876 3300049822 Ga0501035_0105490 Ga0501035_0105490_1094_1795 220
877 3300049822 Ga0501035_0392348 Ga0501035_0392348_431_1132 220
878 3300049823 Ga0501044_0316888 Ga0501044_0316888_436_1137 220
879 3300050489 nmdc:mga03683_6762_c1 nmdc:mga03683_6762_c1_1048_1749 220
880 3300050491 nmdc:mga00v17_178357_c1 nmdc:mga00v17_178357_c1_482_1183 220
881 3300050492 nmdc:mga0yw44_2273_c1 nmdc:mga0yw44_2273_c1_3351_4052 220
882 3300050492 nmdc:mga0yw44_249330_c1 nmdc:mga0yw44_249330_c1_180_881 220
883 3300050492 nmdc:mga0yw44_4473_c1 nmdc:mga0yw44_4473_c1_909_1610 220
884 3300050492 nmdc:mga0yw44_46704_c1 nmdc:mga0yw44_46704_c1_691_1392 220
885 3300050492 nmdc:mga0yw44_467730_c1 nmdc:mga0yw44_467730_c1_107_808 220
886 3300050492 nmdc:mga0yw44_64314_c1 nmdc:mga0yw44_64314_c1_389_1090 220
887 3300050494 nmdc:mga06z11_12010_c1 nmdc:mga06z11_12010_c1_281_982 220
888 3300050494 nmdc:mga06z11_42843_c1 nmdc:mga06z11_42843_c1_266_967 220
889 3300050507 nmdc:mga05p37_151819_c1 nmdc:mga05p37_151819_c1_653_1354 220
890 3300050507 nmdc:mga05p37_370351_c1 nmdc:mga05p37_370351_c1_103_804 220
891 3300050507 nmdc:mga05p37_54022_c1 nmdc:mga05p37_54022_c1_2972_3673 220
892 3300050507 nmdc:mga05p37_57252_c1 nmdc:mga05p37_57252_c1_1220_1921 220
893 3300050507 nmdc:mga05p37_714477_c1 nmdc:mga05p37_714477_c1_41_742 220
894 3300050509 nmdc:mga0qj67_447259_c1 nmdc:mga0qj67_447259_c1_280_981 220
895 3300050509 nmdc:mga0qj67_663375_c1 nmdc:mga0qj67_663375_c1_97_798 220
896 3300050509 nmdc:mga0qj67_680863_c1 nmdc:mga0qj67_680863_c1_57_758 220
897 3300050509 nmdc:mga0qj67_688695_c1 nmdc:mga0qj67_688695_c1_20_721 220
898 3300050510 nmdc:mga06r32_199556_c1 nmdc:mga06r32_199556_c1_943_1644 220
899 3300050510 nmdc:mga06r32_21674_c2 nmdc:mga06r32_21674_c2_1987_2688 220
900 3300050510 nmdc:mga06r32_813117_c1 nmdc:mga06r32_813117_c1_163_864 220
901 3300050510 nmdc:mga06r32_97375_c1 nmdc:mga06r32_97375_c1_491_1192 220
902 3300050511 nmdc:mga08y16_312407_c1 nmdc:mga08y16_312407_c1_904_1605 220
903 3300050511 nmdc:mga08y16_31900_c1 nmdc:mga08y16_31900_c1_3021_3722 220
904 3300050511 nmdc:mga08y16_95196_c1 nmdc:mga08y16_95196_c1_1951_2649 220
905 3300050512 nmdc:mga0n895_25477_c1 nmdc:mga0n895_25477_c1_4185_4886 220
906 3300050512 nmdc:mga0n895_37489_c1 nmdc:mga0n895_37489_c1_1572_2273 220
907 3300050512 nmdc:mga0n895_531545_c1 nmdc:mga0n895_531545_c1_285_986 220
908 3300050513 nmdc:mga0rr50_40522_c1 nmdc:mga0rr50_40522_c1_2248_2949 220
909 3300050513 nmdc:mga0rr50_831772_c1 nmdc:mga0rr50_831772_c1_40_741 220
910 3300050514 nmdc:mga08x19_105984_c1 nmdc:mga08x19_105984_c1_57_758 220
911 3300050514 nmdc:mga08x19_163965_c1 nmdc:mga08x19_163965_c1_89_790 220
912 3300050515 nmdc:mga0a205_159421_c1 nmdc:mga0a205_159421_c1_452_1153 220
913 3300050515 nmdc:mga0a205_169290_c1 nmdc:mga0a205_169290_c1_1341_2042 220
914 3300053077 Ga0495601_0000001 Ga0495601_0000001_369078_369785 220
915 3300053077 Ga0495601_0036304 Ga0495601_0036304_841_1542 220
916 3300053078 Ga0495612_0000097 Ga0495612_0000097_10924_11631 220
917 3300053078 Ga0495612_0041925 Ga0495612_0041925_57_758 220
918 3300053078 Ga0495612_0099117 Ga0495612_0099117_438_1139 220
919 3300053083 Ga0495655_0134057 Ga0495655_0134057_26_727 220
920 3300053084 Ga0495595_0000502 Ga0495595_0000502_10933_11640 220
921 3300053085 Ga0495619_0000004 Ga0495619_0000004_369109_369816 220
922 3300053085 Ga0495619_0015074 Ga0495619_0015074_3189_3890 220
923 3300053134 Ga0500658_0058298 Ga0500658_0058298_319_1020 220
924 3300054114 Ga0501084_0031416 Ga0501084_0031416_681_1382 220
925 3300054114 Ga0501084_0050136 Ga0501084_0050136_178_879 220
926 3300054114 Ga0501084_0066670 Ga0501084_0066670_1517_2218 220
927 3300060353 Ga0501082_0051209 Ga0501082_0051209_131_832 220
928 3300060353 Ga0501082_0105110 Ga0501082_0105110_507_1208 220
929 3300060353 Ga0501082_0319068 Ga0501082_0319068_347_1048 220
930 3300061734 Ga0530510_0041940 Ga0530510_0041940_642_1391 220
931 3300061734 Ga0530510_0099132 Ga0530510_0099132_362_1063 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

190

267

0.95

PF00106

adh_short

short chain dehydrogenase

6

197

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

222

0.82

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

8

176

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o6q-assembly1.cif.gz_C structure of the borneol dehydrogenase 1 of salvia rosmarinus 0.8607 1 205
7o6q-assembly1.cif.gz_D structure of the borneol dehydrogenase 1 of salvia rosmarinus 0.8603 1 205
3lqf-assembly1.cif.gz_B crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with nad and erythritol 0.8603 2 205
3d3w-assembly1.cif.gz_A structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. 0.8551 3 211
4dqx-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.8518 1 207
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.872 2 58 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8555 2 132 3.40.50.720
af_Q0ISZ5_12_118_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8553 4 84 3.40.50.720
1wntC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8474 3 216 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8462 1 205 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537PMZ4-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9439 1 85
AF-A0A529ZGL1-F1-model_v4 deleted 0.9136 1 130
AF-A0A5S4T8V0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.8955 1 105
AF-A0A382PAL4-F1-model_v4 Oxidoreductase 0.8846 1 130 GO:0016020
GO:0016491
AF-A0A3D5TS92-F1-model_v4 deleted 0.8689 1 130

Feature Viewer

pLDDT pTM Quality
79.87 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map