F486038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 931 | 342 | 906 | 413 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10017466|Ga0157370_100174666 |
| Length | 450 |
| Sequence | LQITDDREIEINEMKKEKIDAGLDTQLRDVQSFSNSHVELIIGLFGFGVVGEGLYKVLKQTPSLKASIKKVCIKNYDKRRDAPASLFTTDKNELLDDRDINVIVEVINDCEAAFEIVSIALKNGKHVVSASKRMIAEHLPDLLLLQQETGRSFLYESAACASIPVIRNLEEYYDNDLLHSIRAIVNGSTNFILTRIFEDGLNFREALLLAQQAGFAETDPRLDVEGYDAVSKWSFLLTHAYGILARPGDILFNGIQHIKKEDAVLAASREQEIRLVACAQKLKDGKVAAFVLPQFVRKDDHLAFVKNEYNGVVIESSFADKQFFYGKGAGSFPTASAVLSDIAALRYNYKYEXKKLYHHQPHEITDDLYLRVFVSFDDLSRVPRDNFEWIEEWHADLDRKWLIGVIHFSELKKYSWWKQENTSLILAADPIVEDIETRKLKRKSLELAGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 7 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 8 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 9 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 10 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 11 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 12 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 13 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 14 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 15 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 16 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 17 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 18 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 19 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 20 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 21 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 22 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 23 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 24 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 25 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 26 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 27 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 28 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 29 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 30 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 33 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 34 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 35 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 36 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 45 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 211 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 216 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 229 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 240 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 241 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 242 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 243 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 246 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 288 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 289 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 307 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 325 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 327 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 330 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 331 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 332 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 333 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 336 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 338 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 342 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.31 |
| Metatranscriptomes | 0 |
| Isolates | 2.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.44 |
| Nodule | 0 |
| Rhizoplane | 0.32 |
| Rhizosphere | 88.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1239318 | 2162886007 | Bacteria | 1524 |
| 2 | SwRhRL2b_contig_1759593 | 2162886007 | Bacteria | 266684 |
| 3 | JGI24740J21852_10000358 | 3300001979 | Bacteria | 19557 |
| 4 | JGI24740J21852_10037900 | 3300001979 | Bacteria | 1484 |
| 5 | JGI24739J22299_10000433 | 3300001989 | Bacteria | 14530 |
| 6 | JGI24751J29686_10002215 | 3300002459 | Bacteria | 3937 |
| 7 | JGI25154J39366_1000007 | 3300002738 | Bacteria | 335932 |
| 8 | JGI25406J46586_10004160 | 3300003203 | Bacteria | 6754 |
| 9 | JGI25153J46596_10001828 | 3300003215 | Bacteria | 12620 |
| 10 | JGI25153J46596_10018062 | 3300003215 | Bacteria | 2753 |
| 11 | rootH2_10020884 | 3300003320 | Bacteria | 5195 |
| 12 | rootH2_10056261 | 3300003320 | Bacteria | 14958 |
| 13 | rootH2_10100645 | 3300003320 | Bacteria | 10994 |
| 14 | rootL2_10022865 | 3300003322 | Bacteria | 7745 |
| 15 | rootL2_10140272 | 3300003322 | Bacteria | 3928 |
| 16 | rootL2_10163823 | 3300003322 | Bacteria | 2021 |
| 17 | rootH1_10005865 | 3300003323 | Bacteria | 31302 |
| 18 | rootH1_10046794 | 3300003323 | Bacteria | 11572 |
| 19 | rootH1_10135802 | 3300003323 | Bacteria | 4034 |
| 20 | JGI25160J50197_1001383 | 3300003354 | Bacteria | 12214 |
| 21 | JGI25160J50197_1003564 | 3300003354 | Bacteria | 6924 |
| 22 | JGI25160J50197_1011746 | 3300003354 | Bacteria | 3080 |
| 23 | JGI25160J50197_1015956 | 3300003354 | Bacteria | 2443 |
| 24 | Ga0055535_1003112 | 3300003761 | Bacteria | 4990 |
| 25 | Ga0055526_1011071 | 3300003771 | Bacteria | 4115 |
| 26 | Ga0055528_1015931 | 3300003790 | Bacteria | 2686 |
| 27 | Ga0055530_10001252 | 3300003791 | Bacteria | 19331 |
| 28 | Ga0055531_10000020 | 3300003794 | Bacteria | 170186 |
| 29 | Ga0055531_10031189 | 3300003794 | Bacteria | 1771 |
| 30 | Ga0065165_1000010 | 3300005262 | Bacteria | 323737 |
| 31 | Ga0065165_1009228 | 3300005262 | Bacteria | 4460 |
| 32 | Ga0065714_10017635 | 3300005288 | Bacteria | 1889 |
| 33 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 34 | Ga0065704_10073952 | 3300005289 | Bacteria | 6644 |
| 35 | Ga0065704_10075046 | 3300005289 | Bacteria | 5824 |
| 36 | Ga0065712_10007993 | 3300005290 | Bacteria | 3304 |
| 37 | Ga0065715_10093864 | 3300005293 | Bacteria | 4520 |
| 38 | Ga0065715_10098173 | 3300005293 | Bacteria | 3586 |
| 39 | Ga0070658_10058958 | 3300005327 | Bacteria | 3126 |
| 40 | Ga0070658_10075475 | 3300005327 | Bacteria | 2765 |
| 41 | Ga0070658_10179516 | 3300005327 | Bacteria | 1781 |
| 42 | Ga0070658_10214036 | 3300005327 | Bacteria | 1628 |
| 43 | Ga0070676_10004661 | 3300005328 | Bacteria | 7243 |
| 44 | Ga0070683_100001844 | 3300005329 | Bacteria | 16533 |
| 45 | Ga0070683_100003744 | 3300005329 | Bacteria | 12409 |
| 46 | Ga0070683_100018837 | 3300005329 | Bacteria | 6123 |
| 47 | Ga0070683_100020019 | 3300005329 | Bacteria | 5950 |
| 48 | Ga0070690_100016948 | 3300005330 | Bacteria | 4373 |
| 49 | Ga0070690_100032271 | 3300005330 | Bacteria | 3270 |
| 50 | Ga0070690_100112891 | 3300005330 | Bacteria | 1816 |
| 51 | Ga0070670_100026565 | 3300005331 | Bacteria | 4980 |
| 52 | Ga0070670_100027222 | 3300005331 | Bacteria | 4918 |
| 53 | Ga0070670_100038903 | 3300005331 | Bacteria | 4090 |
| 54 | Ga0070670_100059185 | 3300005331 | Bacteria | 3288 |
| 55 | Ga0070670_100080565 | 3300005331 | Bacteria | 2798 |
| 56 | Ga0070670_100297706 | 3300005331 | Bacteria | 1411 |
| 57 | Ga0068869_100002681 | 3300005334 | Bacteria | 10764 |
| 58 | Ga0068869_100009889 | 3300005334 | Bacteria | 6196 |
| 59 | Ga0068869_100016541 | 3300005334 | Bacteria | 4973 |
| 60 | Ga0068869_100034075 | 3300005334 | Bacteria | 3600 |
| 61 | Ga0068869_100084756 | 3300005334 | Unclassified | 2372 |
| 62 | Ga0068869_100186944 | 3300005334 | Unclassified | 1627 |
| 63 | Ga0070666_10026338 | 3300005335 | Bacteria | 3798 |
| 64 | Ga0070666_10030778 | 3300005335 | Bacteria | 3538 |
| 65 | Ga0070666_10095753 | 3300005335 | Bacteria | 2043 |
| 66 | Ga0070680_100011958 | 3300005336 | Bacteria | 6734 |
| 67 | Ga0070680_100130702 | 3300005336 | Bacteria | 2101 |
| 68 | Ga0070680_100163013 | 3300005336 | Bacteria | 1874 |
| 69 | Ga0070680_100217863 | 3300005336 | Unclassified | 1611 |
| 70 | Ga0070682_100000018 | 3300005337 | Bacteria | 229427 |
| 71 | Ga0070682_100013032 | 3300005337 | Bacteria | 4774 |
| 72 | Ga0070682_100072253 | 3300005337 | Bacteria | 2211 |
| 73 | Ga0068868_100008559 | 3300005338 | Bacteria | 7326 |
| 74 | Ga0068868_100063499 | 3300005338 | Bacteria | 2929 |
| 75 | Ga0068868_100107795 | 3300005338 | Bacteria | 2261 |
| 76 | Ga0070660_100001278 | 3300005339 | Bacteria | 17159 |
| 77 | Ga0070660_100005738 | 3300005339 | Bacteria | 8598 |
| 78 | Ga0070660_100041472 | 3300005339 | Bacteria | 3509 |
| 79 | Ga0070660_100067403 | 3300005339 | Bacteria | 2788 |
| 80 | Ga0070660_100072985 | 3300005339 | Bacteria | 2682 |
| 81 | Ga0070660_100092127 | 3300005339 | Bacteria | 2392 |
| 82 | Ga0070689_100035493 | 3300005340 | Bacteria | 3810 |
| 83 | Ga0070689_100039392 | 3300005340 | Bacteria | 3618 |
| 84 | Ga0070689_100088598 | 3300005340 | Bacteria | 2436 |
| 85 | Ga0070691_10001047 | 3300005341 | Bacteria | 11397 |
| 86 | Ga0070661_100018952 | 3300005344 | Bacteria | 4900 |
| 87 | Ga0070668_100008170 | 3300005347 | Bacteria | 7771 |
| 88 | Ga0070669_100017590 | 3300005353 | Bacteria | 5099 |
| 89 | Ga0070669_100021311 | 3300005353 | Bacteria | 4632 |
| 90 | Ga0070669_100074842 | 3300005353 | Bacteria | 2510 |
| 91 | Ga0070669_100166113 | 3300005353 | Bacteria | 1718 |
| 92 | Ga0070675_100007148 | 3300005354 | Bacteria | 8599 |
| 93 | Ga0070675_100016579 | 3300005354 | Bacteria | 5849 |
| 94 | Ga0070675_100323480 | 3300005354 | Bacteria | 1363 |
| 95 | Ga0070671_100017404 | 3300005355 | Bacteria | 5821 |
| 96 | Ga0070671_100100027 | 3300005355 | Bacteria | 2433 |
| 97 | Ga0070674_100053564 | 3300005356 | Bacteria | 2787 |
| 98 | Ga0070674_100145194 | 3300005356 | Bacteria | 1785 |
| 99 | Ga0070673_100013654 | 3300005364 | Bacteria | 5629 |
| 100 | Ga0070673_100034796 | 3300005364 | Bacteria | 3816 |
| 101 | Ga0070673_100049925 | 3300005364 | Bacteria | 3269 |
| 102 | Ga0070673_100062303 | 3300005364 | Bacteria | 2963 |
| 103 | Ga0070673_100089685 | 3300005364 | Bacteria | 2510 |
| 104 | Ga0070673_100177729 | 3300005364 | Bacteria | 1820 |
| 105 | Ga0070688_100005858 | 3300005365 | Bacteria | 6504 |
| 106 | Ga0070688_100007595 | 3300005365 | Bacteria | 5852 |
| 107 | Ga0070688_100132491 | 3300005365 | Bacteria | 1684 |
| 108 | Ga0070659_100002027 | 3300005366 | Bacteria | 14487 |
| 109 | Ga0070659_100005677 | 3300005366 | Bacteria | 8974 |
| 110 | Ga0070659_100010931 | 3300005366 | Bacteria | 6699 |
| 111 | Ga0070659_100081983 | 3300005366 | Bacteria | 2577 |
| 112 | Ga0070659_100167753 | 3300005366 | Bacteria | 1797 |
| 113 | Ga0070667_100012198 | 3300005367 | Bacteria | 7110 |
| 114 | Ga0070667_100012604 | 3300005367 | Bacteria | 6992 |
| 115 | Ga0070667_100053963 | 3300005367 | Bacteria | 3393 |
| 116 | Ga0070667_100103445 | 3300005367 | Unclassified | 2462 |
| 117 | Ga0070667_100108956 | 3300005367 | Bacteria | 2400 |
| 118 | Ga0070667_100112696 | 3300005367 | Bacteria | 2360 |
| 119 | Ga0070667_100136993 | 3300005367 | Bacteria | 2141 |
| 120 | Ga0070667_100156773 | 3300005367 | Bacteria | 2003 |
| 121 | Ga0070701_10006632 | 3300005438 | Bacteria | 4884 |
| 122 | Ga0070663_100089989 | 3300005455 | Bacteria | 2272 |
| 123 | Ga0070678_100021106 | 3300005456 | Bacteria | 4288 |
| 124 | Ga0070678_100061577 | 3300005456 | Bacteria | 2767 |
| 125 | Ga0070678_100088451 | 3300005456 | Bacteria | 2368 |
| 126 | Ga0070678_100208121 | 3300005456 | Bacteria | 1619 |
| 127 | Ga0070662_100002931 | 3300005457 | Bacteria | 10611 |
| 128 | Ga0070662_100004967 | 3300005457 | Bacteria | 8451 |
| 129 | Ga0070662_100007145 | 3300005457 | Bacteria | 7230 |
| 130 | Ga0070662_100009392 | 3300005457 | Bacteria | 6392 |
| 131 | Ga0070662_100016106 | 3300005457 | Bacteria | 5015 |
| 132 | Ga0070662_100111416 | 3300005457 | Bacteria | 2085 |
| 133 | Ga0070681_10032814 | 3300005458 | Bacteria | 5213 |
| 134 | Ga0070681_10065886 | 3300005458 | Unclassified | 3591 |
| 135 | Ga0070681_10074057 | 3300005458 | Bacteria | 3367 |
| 136 | Ga0068867_100059343 | 3300005459 | Bacteria | 2836 |
| 137 | Ga0068867_100074463 | 3300005459 | Bacteria | 2545 |
| 138 | Ga0070685_10024229 | 3300005466 | Bacteria | 3331 |
| 139 | Ga0070685_10069976 | 3300005466 | Bacteria | 2077 |
| 140 | Ga0070698_100003400 | 3300005471 | Bacteria | 17500 |
| 141 | Ga0070679_100001044 | 3300005530 | Bacteria | 24138 |
| 142 | Ga0070679_100004008 | 3300005530 | Bacteria | 13562 |
| 143 | Ga0070679_100073106 | 3300005530 | Bacteria | 3421 |
| 144 | Ga0070679_100157594 | 3300005530 | Bacteria | 2245 |
| 145 | Ga0070684_100001070 | 3300005535 | Bacteria | 19608 |
| 146 | Ga0070684_100012432 | 3300005535 | Bacteria | 6823 |
| 147 | Ga0070684_100014413 | 3300005535 | Bacteria | 6405 |
| 148 | Ga0070684_100055619 | 3300005535 | Bacteria | 3450 |
| 149 | Ga0070684_100061868 | 3300005535 | Bacteria | 3278 |
| 150 | Ga0070684_100120096 | 3300005535 | Unclassified | 2364 |
| 151 | Ga0068853_100001291 | 3300005539 | Bacteria | 17981 |
| 152 | Ga0068853_100006484 | 3300005539 | Bacteria | 9307 |
| 153 | Ga0068853_100022502 | 3300005539 | Bacteria | 5265 |
| 154 | Ga0068853_100044640 | 3300005539 | Bacteria | 3794 |
| 155 | Ga0070672_100001603 | 3300005543 | Bacteria | 14052 |
| 156 | Ga0070672_100214597 | 3300005543 | Bacteria | 1613 |
| 157 | Ga0070693_100050821 | 3300005547 | Bacteria | 2371 |
| 158 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 159 | Ga0070665_100003504 | 3300005548 | Bacteria | 16699 |
| 160 | Ga0070665_100109195 | 3300005548 | Bacteria | 2769 |
| 161 | Ga0070665_100114404 | 3300005548 | Bacteria | 2701 |
| 162 | Ga0070704_100025018 | 3300005549 | Bacteria | 3926 |
| 163 | Ga0068855_100000329 | 3300005563 | Bacteria | 58994 |
| 164 | Ga0068855_100000406 | 3300005563 | Bacteria | 53320 |
| 165 | Ga0068855_100013158 | 3300005563 | Bacteria | 9980 |
| 166 | Ga0068855_100013953 | 3300005563 | Bacteria | 9688 |
| 167 | Ga0068855_100017499 | 3300005563 | Bacteria | 8619 |
| 168 | Ga0068855_100056531 | 3300005563 | Bacteria | 4604 |
| 169 | Ga0068855_100064457 | 3300005563 | Bacteria | 4273 |
| 170 | Ga0068855_100108409 | 3300005563 | Bacteria | 3190 |
| 171 | Ga0068855_100111470 | 3300005563 | Bacteria | 3141 |
| 172 | Ga0068855_100143074 | 3300005563 | Bacteria | 2724 |
| 173 | Ga0068855_100183932 | 3300005563 | Bacteria | 2362 |
| 174 | Ga0070664_100008883 | 3300005564 | Bacteria | 8141 |
| 175 | Ga0070664_100026666 | 3300005564 | Bacteria | 4796 |
| 176 | Ga0070664_100031978 | 3300005564 | Bacteria | 4401 |
| 177 | Ga0070664_100061377 | 3300005564 | Unclassified | 3204 |
| 178 | Ga0070664_100067420 | 3300005564 | Bacteria | 3058 |
| 179 | Ga0070664_100346098 | 3300005564 | Bacteria | 1351 |
| 180 | Ga0068857_100004345 | 3300005577 | Bacteria | 11963 |
| 181 | Ga0068857_100004830 | 3300005577 | Bacteria | 11421 |
| 182 | Ga0068857_100015114 | 3300005577 | Bacteria | 6737 |
| 183 | Ga0068857_100022205 | 3300005577 | Bacteria | 5582 |
| 184 | Ga0068857_100080583 | 3300005577 | Bacteria | 2907 |
| 185 | Ga0068857_100130731 | 3300005577 | Bacteria | 2264 |
| 186 | Ga0068857_100132320 | 3300005577 | Bacteria | 2250 |
| 187 | Ga0068854_100006808 | 3300005578 | Bacteria | 7287 |
| 188 | Ga0068854_100022079 | 3300005578 | Bacteria | 4328 |
| 189 | Ga0068854_100031903 | 3300005578 | Bacteria | 3663 |
| 190 | Ga0068854_100073428 | 3300005578 | Bacteria | 2507 |
| 191 | Ga0068854_100144895 | 3300005578 | Bacteria | 1826 |
| 192 | Ga0068854_100208667 | 3300005578 | Bacteria | 1540 |
| 193 | Ga0068856_100034788 | 3300005614 | Bacteria | 4935 |
| 194 | Ga0068856_100035282 | 3300005614 | Bacteria | 4900 |
| 195 | Ga0068856_100131052 | 3300005614 | Bacteria | 2512 |
| 196 | Ga0070702_100046856 | 3300005615 | Bacteria | 2452 |
| 197 | Ga0068852_100006208 | 3300005616 | Bacteria | 8614 |
| 198 | Ga0068852_100008807 | 3300005616 | Bacteria | 7466 |
| 199 | Ga0068852_100015602 | 3300005616 | Bacteria | 5900 |
| 200 | Ga0068852_100020725 | 3300005616 | Bacteria | 5231 |
| 201 | Ga0068852_100138617 | 3300005616 | Bacteria | 2249 |
| 202 | Ga0068852_100175196 | 3300005616 | Bacteria | 2013 |
| 203 | Ga0068852_100184164 | 3300005616 | Bacteria | 1966 |
| 204 | Ga0068859_100000023 | 3300005617 | Bacteria | 221914 |
| 205 | Ga0068859_100000859 | 3300005617 | Bacteria | 30939 |
| 206 | Ga0068859_100020142 | 3300005617 | Bacteria | 6697 |
| 207 | Ga0068859_100058275 | 3300005617 | Bacteria | 3890 |
| 208 | Ga0068859_100134287 | 3300005617 | Bacteria | 2546 |
| 209 | Ga0068859_100176293 | 3300005617 | Unclassified | 2219 |
| 210 | Ga0068859_100187243 | 3300005617 | Bacteria | 2154 |
| 211 | Ga0068864_100009349 | 3300005618 | Bacteria | 8085 |
| 212 | Ga0068864_100056257 | 3300005618 | Bacteria | 3399 |
| 213 | Ga0068864_100153429 | 3300005618 | Unclassified | 2088 |
| 214 | Ga0068866_10017119 | 3300005718 | Bacteria | 3254 |
| 215 | Ga0068866_10040962 | 3300005718 | Bacteria | 2296 |
| 216 | Ga0068861_100047027 | 3300005719 | Bacteria | 3256 |
| 217 | Ga0068861_100059398 | 3300005719 | Bacteria | 2928 |
| 218 | Ga0068861_100256002 | 3300005719 | Unclassified | 1496 |
| 219 | Ga0068851_10002822 | 3300005834 | Bacteria | 7654 |
| 220 | Ga0068851_10053510 | 3300005834 | Bacteria | 2055 |
| 221 | Ga0068870_10030301 | 3300005840 | Bacteria | 2733 |
| 222 | Ga0068870_10041365 | 3300005840 | Bacteria | 2394 |
| 223 | Ga0068863_100000424 | 3300005841 | Bacteria | 42794 |
| 224 | Ga0068863_100065852 | 3300005841 | Bacteria | 3428 |
| 225 | Ga0068863_100193970 | 3300005841 | Bacteria | 1952 |
| 226 | Ga0068863_100306769 | 3300005841 | Bacteria | 1540 |
| 227 | Ga0068860_100000059 | 3300005843 | Bacteria | 196400 |
| 228 | Ga0068860_100001384 | 3300005843 | Bacteria | 26311 |
| 229 | Ga0068860_100009247 | 3300005843 | Bacteria | 9797 |
| 230 | Ga0068860_100011810 | 3300005843 | Bacteria | 8607 |
| 231 | Ga0068860_100013541 | 3300005843 | Bacteria | 7996 |
| 232 | Ga0068860_100015628 | 3300005843 | Bacteria | 7411 |
| 233 | Ga0068860_100024851 | 3300005843 | Bacteria | 5783 |
| 234 | Ga0068860_100029257 | 3300005843 | Bacteria | 5298 |
| 235 | Ga0068860_100034335 | 3300005843 | Unclassified | 4864 |
| 236 | Ga0068860_100063750 | 3300005843 | Bacteria | 3500 |
| 237 | Ga0068860_100153902 | 3300005843 | Bacteria | 2215 |
| 238 | Ga0068862_100004782 | 3300005844 | Bacteria | 11396 |
| 239 | Ga0068862_100061946 | 3300005844 | Bacteria | 3216 |
| 240 | Ga0081539_10001000 | 3300005985 | Bacteria | 52492 |
| 241 | Ga0081539_10012887 | 3300005985 | Bacteria | 6367 |
| 242 | Ga0070716_100103258 | 3300006173 | Bacteria | 1752 |
| 243 | Ga0075366_10017853 | 3300006195 | Bacteria | 4091 |
| 244 | Ga0075366_10091015 | 3300006195 | Bacteria | 1827 |
| 245 | Ga0097621_100000487 | 3300006237 | Bacteria | 27766 |
| 246 | Ga0097621_100028199 | 3300006237 | Bacteria | 4424 |
| 247 | Ga0097621_100071294 | 3300006237 | Bacteria | 2871 |
| 248 | Ga0097621_100078691 | 3300006237 | Bacteria | 2739 |
| 249 | Ga0097621_100089616 | 3300006237 | Bacteria | 2572 |
| 250 | Ga0097621_100114598 | 3300006237 | Bacteria | 2281 |
| 251 | Ga0097621_100119702 | 3300006237 | Bacteria | 2232 |
| 252 | Ga0097621_100259683 | 3300006237 | Bacteria | 1523 |
| 253 | Ga0068871_100024719 | 3300006358 | Unclassified | 4662 |
| 254 | Ga0068871_100097088 | 3300006358 | Bacteria | 2462 |
| 255 | Ga0068871_100189196 | 3300006358 | Bacteria | 1772 |
| 256 | Ga0075428_100006657 | 3300006844 | Bacteria | 12851 |
| 257 | Ga0075428_100079725 | 3300006844 | Bacteria | 3573 |
| 258 | Ga0075428_100102763 | 3300006844 | Bacteria | 3117 |
| 259 | Ga0075430_100029748 | 3300006846 | Bacteria | 4636 |
| 260 | Ga0075431_100032992 | 3300006847 | Bacteria | 5336 |
| 261 | Ga0075431_100165692 | 3300006847 | Bacteria | 2272 |
| 262 | Ga0075429_100006669 | 3300006880 | Bacteria | 10009 |
| 263 | Ga0075429_100027628 | 3300006880 | Bacteria | 4926 |
| 264 | Ga0068865_100008569 | 3300006881 | Bacteria | 6321 |
| 265 | Ga0068865_100098462 | 3300006881 | Bacteria | 2137 |
| 266 | Ga0068865_100211413 | 3300006881 | Bacteria | 1512 |
| 267 | Ga0097620_100000023 | 3300006931 | Bacteria | 221914 |
| 268 | Ga0097620_100000859 | 3300006931 | Bacteria | 30939 |
| 269 | Ga0097620_100020142 | 3300006931 | Bacteria | 6697 |
| 270 | Ga0097620_100058269 | 3300006931 | Bacteria | 3890 |
| 271 | Ga0097620_100134284 | 3300006931 | Bacteria | 2546 |
| 272 | Ga0097620_100176303 | 3300006931 | Unclassified | 2219 |
| 273 | Ga0097620_100187246 | 3300006931 | Bacteria | 2154 |
| 274 | Ga0105240_10000011 | 3300009093 | Bacteria | 523646 |
| 275 | Ga0105240_10000767 | 3300009093 | Bacteria | 58332 |
| 276 | Ga0105240_10002681 | 3300009093 | Bacteria | 28340 |
| 277 | Ga0105240_10008492 | 3300009093 | Bacteria | 14688 |
| 278 | Ga0105240_10009313 | 3300009093 | Bacteria | 13924 |
| 279 | Ga0105240_10009560 | 3300009093 | Bacteria | 13726 |
| 280 | Ga0105240_10016269 | 3300009093 | Bacteria | 10076 |
| 281 | Ga0105240_10064033 | 3300009093 | Bacteria | 4570 |
| 282 | Ga0105240_10182785 | 3300009093 | Bacteria | 2473 |
| 283 | Ga0111539_10006433 | 3300009094 | Bacteria | 15147 |
| 284 | Ga0111539_10022168 | 3300009094 | Bacteria | 7807 |
| 285 | Ga0105245_10317179 | 3300009098 | Bacteria | 1534 |
| 286 | Ga0105247_10024168 | 3300009101 | Bacteria | 3661 |
| 287 | Ga0114129_10003306 | 3300009147 | Bacteria | 22637 |
| 288 | Ga0114129_10182219 | 3300009147 | Bacteria | 2857 |
| 289 | Ga0114129_10206848 | 3300009147 | Bacteria | 2655 |
| 290 | Ga0105241_10000861 | 3300009174 | Bacteria | 23026 |
| 291 | Ga0105241_10010072 | 3300009174 | Bacteria | 6941 |
| 292 | Ga0105241_10018003 | 3300009174 | Bacteria | 5193 |
| 293 | Ga0105241_10024675 | 3300009174 | Bacteria | 4466 |
| 294 | Ga0105241_10133889 | 3300009174 | Bacteria | 2010 |
| 295 | Ga0105242_10005203 | 3300009176 | Bacteria | 10041 |
| 296 | Ga0105242_10027845 | 3300009176 | Bacteria | 4493 |
| 297 | Ga0105242_10035959 | 3300009176 | Bacteria | 3971 |
| 298 | Ga0105242_10066012 | 3300009176 | Bacteria | 2987 |
| 299 | Ga0105242_10094343 | 3300009176 | Bacteria | 2524 |
| 300 | Ga0105242_10257862 | 3300009176 | Bacteria | 1574 |
| 301 | Ga0105248_10040274 | 3300009177 | Bacteria | 5237 |
| 302 | Ga0105237_10000128 | 3300009545 | Bacteria | 106338 |
| 303 | Ga0105237_10001750 | 3300009545 | Bacteria | 28065 |
| 304 | Ga0105237_10006346 | 3300009545 | Bacteria | 13145 |
| 305 | Ga0105237_10007600 | 3300009545 | Bacteria | 11844 |
| 306 | Ga0105237_10007857 | 3300009545 | Bacteria | 11628 |
| 307 | Ga0105237_10040418 | 3300009545 | Bacteria | 4703 |
| 308 | Ga0105237_10112647 | 3300009545 | Bacteria | 2713 |
| 309 | Ga0105237_10139842 | 3300009545 | Unclassified | 2415 |
| 310 | Ga0105237_10143287 | 3300009545 | Bacteria | 2384 |
| 311 | Ga0105238_10013311 | 3300009551 | Bacteria | 8299 |
| 312 | Ga0105238_10023664 | 3300009551 | Bacteria | 6259 |
| 313 | Ga0105238_10082937 | 3300009551 | Unclassified | 3195 |
| 314 | Ga0105249_10002037 | 3300009553 | Bacteria | 17526 |
| 315 | Ga0105249_10002885 | 3300009553 | Bacteria | 14839 |
| 316 | Ga0105249_10008554 | 3300009553 | Bacteria | 8924 |
| 317 | Ga0105249_10010023 | 3300009553 | Bacteria | 8315 |
| 318 | Ga0105249_10019818 | 3300009553 | Bacteria | 6005 |
| 319 | Ga0105249_10025260 | 3300009553 | Bacteria | 5346 |
| 320 | Ga0105249_10119485 | 3300009553 | Bacteria | 2503 |
| 321 | Ga0105239_10000052 | 3300010375 | Bacteria | 164624 |
| 322 | Ga0105239_10000263 | 3300010375 | Bacteria | 78014 |
| 323 | Ga0105239_10000748 | 3300010375 | Bacteria | 46087 |
| 324 | Ga0105239_10002485 | 3300010375 | Bacteria | 23480 |
| 325 | Ga0105239_10003037 | 3300010375 | Bacteria | 20874 |
| 326 | Ga0105239_10016636 | 3300010375 | Bacteria | 8130 |
| 327 | Ga0105239_10025164 | 3300010375 | Bacteria | 6556 |
| 328 | Ga0105239_10103105 | 3300010375 | Bacteria | 3157 |
| 329 | Ga0105239_10121663 | 3300010375 | Bacteria | 2899 |
| 330 | Ga0105239_10129240 | 3300010375 | Bacteria | 2808 |
| 331 | Ga0105239_10180254 | 3300010375 | Bacteria | 2363 |
| 332 | Ga0105246_10000127 | 3300011119 | Bacteria | 35078 |
| 333 | Ga0105246_10007561 | 3300011119 | Bacteria | 6667 |
| 334 | Ga0105246_10099983 | 3300011119 | Bacteria | 2109 |
| 335 | Ga0157373_10001583 | 3300013100 | Bacteria | 17384 |
| 336 | Ga0157373_10004754 | 3300013100 | Bacteria | 10220 |
| 337 | Ga0157373_10089780 | 3300013100 | Unclassified | 2164 |
| 338 | Ga0157373_10135784 | 3300013100 | Bacteria | 1729 |
| 339 | Ga0157373_10161231 | 3300013100 | Bacteria | 1578 |
| 340 | Ga0157371_10000651 | 3300013102 | Bacteria | 41136 |
| 341 | Ga0157371_10000874 | 3300013102 | Bacteria | 34176 |
| 342 | Ga0157371_10002691 | 3300013102 | Bacteria | 16786 |
| 343 | Ga0157371_10003885 | 3300013102 | Bacteria | 13319 |
| 344 | Ga0157371_10012057 | 3300013102 | Bacteria | 6625 |
| 345 | Ga0157371_10014455 | 3300013102 | Bacteria | 5956 |
| 346 | Ga0157371_10015537 | 3300013102 | Bacteria | 5710 |
| 347 | Ga0157371_10026427 | 3300013102 | Bacteria | 4220 |
| 348 | Ga0157371_10031082 | 3300013102 | Bacteria | 3847 |
| 349 | Ga0157371_10044799 | 3300013102 | Bacteria | 3149 |
| 350 | Ga0157371_10053023 | 3300013102 | Unclassified | 2880 |
| 351 | Ga0157371_10116551 | 3300013102 | Bacteria | 1898 |
| 352 | Ga0157371_10153838 | 3300013102 | Bacteria | 1641 |
| 353 | Ga0157370_10010139 | 3300013104 | Bacteria | 9950 |
| 354 | Ga0157370_10017466 | 3300013104 | Bacteria | 7238 |
| 355 | Ga0157370_10019741 | 3300013104 | Bacteria | 6747 |
| 356 | Ga0157370_10027186 | 3300013104 | Bacteria | 5641 |
| 357 | Ga0157370_10032940 | 3300013104 | Bacteria | 5055 |
| 358 | Ga0157370_10060071 | 3300013104 | Bacteria | 3610 |
| 359 | Ga0157370_10067521 | 3300013104 | Bacteria | 3380 |
| 360 | Ga0157370_10101118 | 3300013104 | Bacteria | 2700 |
| 361 | Ga0157370_10103180 | 3300013104 | Bacteria | 2670 |
| 362 | Ga0157370_10175087 | 3300013104 | Bacteria | 1994 |
| 363 | Ga0157369_10016571 | 3300013105 | Bacteria | 8283 |
| 364 | Ga0157369_10066270 | 3300013105 | Bacteria | 3885 |
| 365 | Ga0157369_10124521 | 3300013105 | Bacteria | 2733 |
| 366 | Ga0157369_10288447 | 3300013105 | Bacteria | 1709 |
| 367 | Ga0157374_10000009 | 3300013296 | Bacteria | 564330 |
| 368 | Ga0157374_10002136 | 3300013296 | Bacteria | 16661 |
| 369 | Ga0157374_10017972 | 3300013296 | Bacteria | 6234 |
| 370 | Ga0157374_10050185 | 3300013296 | Bacteria | 3878 |
| 371 | Ga0157374_10050987 | 3300013296 | Bacteria | 3850 |
| 372 | Ga0157374_10071492 | 3300013296 | Unclassified | 3271 |
| 373 | Ga0157374_10152858 | 3300013296 | Bacteria | 2245 |
| 374 | Ga0157374_10311262 | 3300013296 | Bacteria | 1559 |
| 375 | Ga0157378_10003896 | 3300013297 | Bacteria | 13218 |
| 376 | Ga0157378_10004726 | 3300013297 | Bacteria | 11942 |
| 377 | Ga0157378_10005272 | 3300013297 | Bacteria | 11353 |
| 378 | Ga0157378_10025100 | 3300013297 | Bacteria | 5251 |
| 379 | Ga0157378_10025456 | 3300013297 | Bacteria | 5210 |
| 380 | Ga0157378_10044912 | 3300013297 | Bacteria | 3924 |
| 381 | Ga0157378_10175156 | 3300013297 | Bacteria | 2014 |
| 382 | Ga0157378_10284351 | 3300013297 | Bacteria | 1595 |
| 383 | Ga0163162_10000164 | 3300013306 | Bacteria | 60866 |
| 384 | Ga0163162_10000373 | 3300013306 | Bacteria | 40682 |
| 385 | Ga0163162_10000413 | 3300013306 | Bacteria | 39230 |
| 386 | Ga0163162_10000697 | 3300013306 | Bacteria | 31013 |
| 387 | Ga0163162_10000856 | 3300013306 | Bacteria | 28341 |
| 388 | Ga0163162_10002755 | 3300013306 | Bacteria | 16693 |
| 389 | Ga0163162_10007340 | 3300013306 | Bacteria | 10714 |
| 390 | Ga0163162_10060105 | 3300013306 | Bacteria | 3834 |
| 391 | Ga0163162_10141353 | 3300013306 | Bacteria | 2521 |
| 392 | Ga0163162_10151709 | 3300013306 | Bacteria | 2436 |
| 393 | Ga0163162_10222422 | 3300013306 | Bacteria | 2018 |
| 394 | Ga0163162_10237579 | 3300013306 | Bacteria | 1953 |
| 395 | Ga0163162_10253355 | 3300013306 | Bacteria | 1892 |
| 396 | Ga0163162_10287102 | 3300013306 | Bacteria | 1777 |
| 397 | Ga0157372_10000361 | 3300013307 | Bacteria | 50140 |
| 398 | Ga0157372_10000676 | 3300013307 | Bacteria | 37536 |
| 399 | Ga0157372_10004620 | 3300013307 | Bacteria | 14640 |
| 400 | Ga0157372_10007453 | 3300013307 | Bacteria | 11638 |
| 401 | Ga0157372_10016144 | 3300013307 | Bacteria | 8012 |
| 402 | Ga0157372_10032100 | 3300013307 | Bacteria | 5755 |
| 403 | Ga0157372_10041530 | 3300013307 | Bacteria | 5086 |
| 404 | Ga0157372_10046886 | 3300013307 | Bacteria | 4799 |
| 405 | Ga0157372_10050674 | 3300013307 | Bacteria | 4617 |
| 406 | Ga0157372_10061020 | 3300013307 | Bacteria | 4220 |
| 407 | Ga0157372_10143700 | 3300013307 | Unclassified | 2751 |
| 408 | Ga0157372_10147340 | 3300013307 | Bacteria | 2715 |
| 409 | Ga0157372_10155238 | 3300013307 | Bacteria | 2643 |
| 410 | Ga0157372_10172947 | 3300013307 | Bacteria | 2499 |
| 411 | Ga0157372_10256260 | 3300013307 | Bacteria | 2031 |
| 412 | Ga0157372_10434942 | 3300013307 | Bacteria | 1529 |
| 413 | Ga0157372_10465252 | 3300013307 | Bacteria | 1474 |
| 414 | Ga0157375_10019779 | 3300013308 | Bacteria | 6135 |
| 415 | Ga0157375_10129843 | 3300013308 | Bacteria | 2638 |
| 416 | Ga0157375_10155632 | 3300013308 | Bacteria | 2424 |
| 417 | Ga0157375_10169648 | 3300013308 | Bacteria | 2329 |
| 418 | Ga0157375_10281391 | 3300013308 | Bacteria | 1826 |
| 419 | Ga0163163_10000560 | 3300014325 | Bacteria | 32679 |
| 420 | Ga0163163_10002603 | 3300014325 | Bacteria | 15288 |
| 421 | Ga0163163_10012527 | 3300014325 | Bacteria | 7732 |
| 422 | Ga0157380_10020668 | 3300014326 | Bacteria | 4923 |
| 423 | Ga0157380_10035702 | 3300014326 | Bacteria | 3841 |
| 424 | Ga0157380_10068775 | 3300014326 | Bacteria | 2855 |
| 425 | Ga0157380_10098766 | 3300014326 | Bacteria | 2426 |
| 426 | Ga0157380_10126642 | 3300014326 | Bacteria | 2172 |
| 427 | Ga0157380_10190663 | 3300014326 | Bacteria | 1809 |
| 428 | Ga0157377_10004008 | 3300014745 | Bacteria | 6716 |
| 429 | Ga0157377_10030917 | 3300014745 | Bacteria | 2905 |
| 430 | Ga0157377_10034815 | 3300014745 | Bacteria | 2757 |
| 431 | Ga0157377_10035061 | 3300014745 | Bacteria | 2750 |
| 432 | Ga0157377_10073216 | 3300014745 | Bacteria | 1985 |
| 433 | Ga0157377_10147612 | 3300014745 | Bacteria | 1451 |
| 434 | Ga0157379_10016875 | 3300014968 | Bacteria | 6426 |
| 435 | Ga0157379_10034273 | 3300014968 | Bacteria | 4525 |
| 436 | Ga0157379_10048438 | 3300014968 | Bacteria | 3793 |
| 437 | Ga0157379_10149386 | 3300014968 | Bacteria | 2107 |
| 438 | Ga0157376_10002437 | 3300014969 | Bacteria | 12579 |
| 439 | Ga0157376_10003607 | 3300014969 | Bacteria | 10680 |
| 440 | Ga0157376_10007147 | 3300014969 | Bacteria | 7933 |
| 441 | Ga0157376_10065638 | 3300014969 | Bacteria | 3066 |
| 442 | Ga0157376_10113436 | 3300014969 | Bacteria | 2390 |
| 443 | Ga0157376_10179106 | 3300014969 | Bacteria | 1936 |
| 444 | Ga0182005_1000215 | 3300015265 | Bacteria | 38214 |
| 445 | Ga0163161_10001190 | 3300017792 | Bacteria | 19553 |
| 446 | Ga0163161_10006822 | 3300017792 | Bacteria | 7896 |
| 447 | Ga0163161_10030521 | 3300017792 | Bacteria | 3837 |
| 448 | Ga0163161_10042807 | 3300017792 | Bacteria | 3258 |
| 449 | Ga0163161_10108419 | 3300017792 | Unclassified | 2074 |
| 450 | Ga0209436_110381 | 3300025208 | Bacteria | 1707 |
| 451 | Ga0209258_102250 | 3300025242 | Bacteria | 5201 |
| 452 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 453 | Ga0209646_1002397 | 3300025246 | Bacteria | 4188 |
| 454 | Ga0209026_1000545 | 3300025250 | Bacteria | 25918 |
| 455 | Ga0209148_1000283 | 3300025254 | Bacteria | 77780 |
| 456 | Ga0209673_1000082 | 3300025273 | Bacteria | 219716 |
| 457 | Ga0209130_1004066 | 3300025284 | Bacteria | 5780 |
| 458 | Ga0209564_1002231 | 3300025295 | Bacteria | 15987 |
| 459 | Ga0209758_1015206 | 3300025297 | Bacteria | 4010 |
| 460 | Ga0209758_1039797 | 3300025297 | Bacteria | 1782 |
| 461 | Ga0209050_1000389 | 3300025298 | Bacteria | 82517 |
| 462 | Ga0207426_1000040 | 3300025302 | Bacteria | 433920 |
| 463 | Ga0207426_1000341 | 3300025302 | Bacteria | 87735 |
| 464 | Ga0207426_1000951 | 3300025302 | Bacteria | 28622 |
| 465 | Ga0207426_1002430 | 3300025302 | Bacteria | 11906 |
| 466 | Ga0207426_1040618 | 3300025302 | Bacteria | 1448 |
| 467 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 468 | Ga0209257_1003759 | 3300025304 | Bacteria | 12538 |
| 469 | Ga0207697_10081107 | 3300025315 | Unclassified | 1367 |
| 470 | Ga0207656_10039892 | 3300025321 | Bacteria | 1989 |
| 471 | Ga0207682_10013516 | 3300025893 | Bacteria | 3181 |
| 472 | Ga0207642_10012939 | 3300025899 | Bacteria | 3028 |
| 473 | Ga0207710_10002430 | 3300025900 | Bacteria | 8659 |
| 474 | Ga0207710_10034808 | 3300025900 | Bacteria | 2214 |
| 475 | Ga0207680_10107618 | 3300025903 | Bacteria | 1802 |
| 476 | Ga0207647_10000139 | 3300025904 | Bacteria | 57477 |
| 477 | Ga0207647_10000485 | 3300025904 | Bacteria | 31915 |
| 478 | Ga0207647_10016694 | 3300025904 | Bacteria | 5004 |
| 479 | Ga0207647_10038075 | 3300025904 | Bacteria | 3043 |
| 480 | Ga0207647_10077222 | 3300025904 | Bacteria | 2002 |
| 481 | Ga0207647_10083236 | 3300025904 | Unclassified | 1916 |
| 482 | Ga0207645_10000093 | 3300025907 | Bacteria | 64854 |
| 483 | Ga0207645_10008549 | 3300025907 | Bacteria | 7135 |
| 484 | Ga0207645_10045019 | 3300025907 | Bacteria | 2821 |
| 485 | Ga0207643_10003399 | 3300025908 | Bacteria | 8581 |
| 486 | Ga0207705_10007859 | 3300025909 | Bacteria | 7832 |
| 487 | Ga0207705_10014478 | 3300025909 | Bacteria | 5676 |
| 488 | Ga0207705_10097990 | 3300025909 | Bacteria | 2154 |
| 489 | Ga0207705_10100159 | 3300025909 | Bacteria | 2131 |
| 490 | Ga0207654_10009898 | 3300025911 | Bacteria | 4848 |
| 491 | Ga0207654_10014620 | 3300025911 | Bacteria | 4057 |
| 492 | Ga0207654_10020576 | 3300025911 | Bacteria | 3500 |
| 493 | Ga0207707_10003165 | 3300025912 | Bacteria | 14612 |
| 494 | Ga0207707_10084908 | 3300025912 | Unclassified | 2766 |
| 495 | Ga0207707_10173295 | 3300025912 | Bacteria | 1885 |
| 496 | Ga0207707_10219642 | 3300025912 | Bacteria | 1654 |
| 497 | Ga0207695_10000010 | 3300025913 | Bacteria | 981919 |
| 498 | Ga0207695_10000051 | 3300025913 | Bacteria | 399641 |
| 499 | Ga0207695_10000056 | 3300025913 | Bacteria | 382433 |
| 500 | Ga0207695_10000081 | 3300025913 | Bacteria | 284797 |
| 501 | Ga0207695_10000425 | 3300025913 | Bacteria | 93523 |
| 502 | Ga0207695_10000446 | 3300025913 | Bacteria | 90493 |
| 503 | Ga0207695_10000873 | 3300025913 | Bacteria | 54922 |
| 504 | Ga0207695_10011272 | 3300025913 | Bacteria | 10839 |
| 505 | Ga0207695_10013688 | 3300025913 | Bacteria | 9656 |
| 506 | Ga0207695_10025625 | 3300025913 | Bacteria | 6597 |
| 507 | Ga0207695_10147130 | 3300025913 | Bacteria | 2299 |
| 508 | Ga0207671_10000150 | 3300025914 | Bacteria | 107685 |
| 509 | Ga0207671_10001329 | 3300025914 | Bacteria | 28904 |
| 510 | Ga0207671_10001864 | 3300025914 | Bacteria | 23482 |
| 511 | Ga0207671_10007560 | 3300025914 | Bacteria | 9410 |
| 512 | Ga0207671_10007853 | 3300025914 | Bacteria | 9167 |
| 513 | Ga0207671_10033040 | 3300025914 | Bacteria | 3851 |
| 514 | Ga0207671_10068398 | 3300025914 | Unclassified | 2646 |
| 515 | Ga0207671_10085591 | 3300025914 | Bacteria | 2369 |
| 516 | Ga0207660_10023446 | 3300025917 | Bacteria | 4168 |
| 517 | Ga0207660_10034825 | 3300025917 | Bacteria | 3492 |
| 518 | Ga0207660_10097456 | 3300025917 | Unclassified | 2191 |
| 519 | Ga0207660_10141570 | 3300025917 | Bacteria | 1839 |
| 520 | Ga0207662_10004373 | 3300025918 | Bacteria | 7423 |
| 521 | Ga0207657_10002529 | 3300025919 | Bacteria | 19785 |
| 522 | Ga0207657_10008447 | 3300025919 | Bacteria | 10445 |
| 523 | Ga0207657_10021296 | 3300025919 | Bacteria | 6105 |
| 524 | Ga0207657_10025251 | 3300025919 | Bacteria | 5482 |
| 525 | Ga0207657_10106366 | 3300025919 | Bacteria | 2321 |
| 526 | Ga0207657_10125502 | 3300025919 | Bacteria | 2108 |
| 527 | Ga0207657_10233751 | 3300025919 | Bacteria | 1469 |
| 528 | Ga0207649_10037474 | 3300025920 | Bacteria | 2929 |
| 529 | Ga0207649_10090252 | 3300025920 | Bacteria | 2005 |
| 530 | Ga0207652_10000051 | 3300025921 | Bacteria | 120327 |
| 531 | Ga0207652_10000770 | 3300025921 | Bacteria | 30686 |
| 532 | Ga0207652_10014831 | 3300025921 | Bacteria | 6319 |
| 533 | Ga0207652_10031057 | 3300025921 | Bacteria | 4482 |
| 534 | Ga0207652_10170711 | 3300025921 | Unclassified | 1951 |
| 535 | Ga0207652_10253698 | 3300025921 | Bacteria | 1586 |
| 536 | Ga0207681_10046890 | 3300025923 | Bacteria | 2908 |
| 537 | Ga0207681_10150737 | 3300025923 | Bacteria | 1742 |
| 538 | Ga0207681_10204681 | 3300025923 | Bacteria | 1517 |
| 539 | Ga0207650_10011838 | 3300025925 | Bacteria | 6011 |
| 540 | Ga0207650_10132943 | 3300025925 | Bacteria | 1949 |
| 541 | Ga0207650_10150314 | 3300025925 | Bacteria | 1837 |
| 542 | Ga0207650_10168551 | 3300025925 | Bacteria | 1739 |
| 543 | Ga0207659_10027614 | 3300025926 | Bacteria | 3846 |
| 544 | Ga0207659_10033230 | 3300025926 | Bacteria | 3548 |
| 545 | Ga0207659_10035683 | 3300025926 | Unclassified | 3439 |
| 546 | Ga0207659_10058149 | 3300025926 | Bacteria | 2775 |
| 547 | Ga0207644_10039114 | 3300025931 | Bacteria | 3346 |
| 548 | Ga0207690_10043628 | 3300025932 | Bacteria | 2952 |
| 549 | Ga0207706_10002738 | 3300025933 | Bacteria | 17152 |
| 550 | Ga0207706_10006740 | 3300025933 | Bacteria | 10620 |
| 551 | Ga0207706_10131229 | 3300025933 | Unclassified | 2204 |
| 552 | Ga0207686_10002397 | 3300025934 | Bacteria | 10219 |
| 553 | Ga0207686_10077169 | 3300025934 | Bacteria | 2162 |
| 554 | Ga0207686_10106606 | 3300025934 | Bacteria | 1881 |
| 555 | Ga0207670_10061498 | 3300025936 | Bacteria | 2563 |
| 556 | Ga0207670_10099288 | 3300025936 | Bacteria | 2076 |
| 557 | Ga0207670_10170353 | 3300025936 | Bacteria | 1632 |
| 558 | Ga0207669_10029661 | 3300025937 | Bacteria | 3029 |
| 559 | Ga0207691_10000426 | 3300025940 | Bacteria | 41840 |
| 560 | Ga0207691_10003790 | 3300025940 | Bacteria | 14676 |
| 561 | Ga0207691_10007792 | 3300025940 | Bacteria | 10312 |
| 562 | Ga0207691_10024512 | 3300025940 | Bacteria | 5673 |
| 563 | Ga0207691_10060213 | 3300025940 | Bacteria | 3451 |
| 564 | Ga0207689_10005494 | 3300025942 | Bacteria | 11337 |
| 565 | Ga0207689_10006819 | 3300025942 | Bacteria | 10044 |
| 566 | Ga0207689_10008379 | 3300025942 | Bacteria | 9004 |
| 567 | Ga0207689_10009613 | 3300025942 | Bacteria | 8338 |
| 568 | Ga0207689_10012042 | 3300025942 | Bacteria | 7413 |
| 569 | Ga0207689_10012253 | 3300025942 | Bacteria | 7334 |
| 570 | Ga0207689_10031011 | 3300025942 | Bacteria | 4454 |
| 571 | Ga0207689_10033385 | 3300025942 | Bacteria | 4276 |
| 572 | Ga0207689_10132984 | 3300025942 | Unclassified | 2048 |
| 573 | Ga0207661_10000433 | 3300025944 | Bacteria | 26991 |
| 574 | Ga0207661_10002197 | 3300025944 | Bacteria | 13471 |
| 575 | Ga0207661_10009778 | 3300025944 | Bacteria | 6888 |
| 576 | Ga0207661_10020079 | 3300025944 | Bacteria | 4990 |
| 577 | Ga0207661_10023880 | 3300025944 | Unclassified | 4625 |
| 578 | Ga0207661_10055866 | 3300025944 | Bacteria | 3168 |
| 579 | Ga0207679_10013842 | 3300025945 | Bacteria | 5291 |
| 580 | Ga0207679_10077602 | 3300025945 | Bacteria | 2528 |
| 581 | Ga0207667_10000324 | 3300025949 | Bacteria | 66282 |
| 582 | Ga0207667_10001491 | 3300025949 | Bacteria | 29391 |
| 583 | Ga0207667_10004916 | 3300025949 | Bacteria | 16320 |
| 584 | Ga0207667_10020765 | 3300025949 | Bacteria | 7296 |
| 585 | Ga0207667_10026416 | 3300025949 | Bacteria | 6344 |
| 586 | Ga0207667_10040176 | 3300025949 | Bacteria | 4982 |
| 587 | Ga0207667_10064453 | 3300025949 | Unclassified | 3826 |
| 588 | Ga0207667_10117410 | 3300025949 | Bacteria | 2742 |
| 589 | Ga0207667_10142548 | 3300025949 | Bacteria | 2467 |
| 590 | Ga0207667_10177385 | 3300025949 | Bacteria | 2189 |
| 591 | Ga0207651_10019691 | 3300025960 | Bacteria | 4052 |
| 592 | Ga0207651_10160551 | 3300025960 | Bacteria | 1762 |
| 593 | Ga0207651_10223247 | 3300025960 | Bacteria | 1524 |
| 594 | Ga0207712_10001684 | 3300025961 | Bacteria | 14843 |
| 595 | Ga0207712_10016183 | 3300025961 | Bacteria | 4823 |
| 596 | Ga0207712_10026360 | 3300025961 | Unclassified | 3871 |
| 597 | Ga0207712_10115538 | 3300025961 | Bacteria | 2020 |
| 598 | Ga0207668_10001372 | 3300025972 | Bacteria | 14346 |
| 599 | Ga0207668_10090396 | 3300025972 | Bacteria | 2247 |
| 600 | Ga0207640_10069448 | 3300025981 | Bacteria | 2366 |
| 601 | Ga0207640_10146916 | 3300025981 | Bacteria | 1726 |
| 602 | Ga0207658_10080361 | 3300025986 | Bacteria | 2497 |
| 603 | Ga0207658_10082255 | 3300025986 | Unclassified | 2472 |
| 604 | Ga0207677_10017319 | 3300026023 | Bacteria | 4292 |
| 605 | Ga0207677_10143755 | 3300026023 | Bacteria | 1830 |
| 606 | Ga0207677_10197704 | 3300026023 | Bacteria | 1595 |
| 607 | Ga0207677_10256903 | 3300026023 | Bacteria | 1422 |
| 608 | Ga0207703_10008491 | 3300026035 | Bacteria | 8116 |
| 609 | Ga0207639_10009587 | 3300026041 | Bacteria | 6685 |
| 610 | Ga0207639_10015801 | 3300026041 | Bacteria | 5329 |
| 611 | Ga0207639_10021022 | 3300026041 | Bacteria | 4681 |
| 612 | Ga0207639_10041256 | 3300026041 | Bacteria | 3451 |
| 613 | Ga0207639_10049836 | 3300026041 | Bacteria | 3178 |
| 614 | Ga0207639_10068456 | 3300026041 | Bacteria | 2766 |
| 615 | Ga0207639_10075282 | 3300026041 | Bacteria | 2654 |
| 616 | Ga0207639_10129745 | 3300026041 | Bacteria | 2085 |
| 617 | Ga0207639_10214078 | 3300026041 | Bacteria | 1660 |
| 618 | Ga0207639_10236119 | 3300026041 | Bacteria | 1587 |
| 619 | Ga0207678_10040611 | 3300026067 | Bacteria | 4034 |
| 620 | Ga0207702_10038469 | 3300026078 | Bacteria | 4006 |
| 621 | Ga0207702_10043851 | 3300026078 | Bacteria | 3757 |
| 622 | Ga0207702_10086312 | 3300026078 | Unclassified | 2736 |
| 623 | Ga0207641_10000250 | 3300026088 | Bacteria | 68774 |
| 624 | Ga0207641_10003419 | 3300026088 | Bacteria | 14064 |
| 625 | Ga0207641_10003961 | 3300026088 | Bacteria | 12936 |
| 626 | Ga0207641_10111397 | 3300026088 | Bacteria | 2427 |
| 627 | Ga0207648_10004739 | 3300026089 | Bacteria | 13898 |
| 628 | Ga0207648_10010083 | 3300026089 | Bacteria | 8982 |
| 629 | Ga0207648_10022313 | 3300026089 | Bacteria | 5687 |
| 630 | Ga0207648_10025344 | 3300026089 | Bacteria | 5285 |
| 631 | Ga0207648_10037061 | 3300026089 | Bacteria | 4295 |
| 632 | Ga0207648_10044331 | 3300026089 | Bacteria | 3902 |
| 633 | Ga0207648_10066688 | 3300026089 | Bacteria | 3139 |
| 634 | Ga0207648_10107713 | 3300026089 | Bacteria | 2446 |
| 635 | Ga0207676_10013866 | 3300026095 | Bacteria | 5787 |
| 636 | Ga0207676_10024842 | 3300026095 | Bacteria | 4439 |
| 637 | Ga0207676_10028937 | 3300026095 | Bacteria | 4144 |
| 638 | Ga0207676_10030918 | 3300026095 | Bacteria | 4023 |
| 639 | Ga0207676_10050380 | 3300026095 | Bacteria | 3246 |
| 640 | Ga0207676_10099684 | 3300026095 | Unclassified | 2405 |
| 641 | Ga0207674_10004594 | 3300026116 | Bacteria | 16575 |
| 642 | Ga0207674_10008341 | 3300026116 | Bacteria | 11989 |
| 643 | Ga0207674_10030768 | 3300026116 | Bacteria | 5642 |
| 644 | Ga0207674_10033858 | 3300026116 | Bacteria | 5345 |
| 645 | Ga0207674_10123089 | 3300026116 | Bacteria | 2559 |
| 646 | Ga0207674_10250770 | 3300026116 | Bacteria | 1717 |
| 647 | Ga0207675_100000599 | 3300026118 | Bacteria | 35195 |
| 648 | Ga0207675_100008087 | 3300026118 | Bacteria | 9907 |
| 649 | Ga0207675_100040059 | 3300026118 | Bacteria | 4372 |
| 650 | Ga0207675_100040594 | 3300026118 | Bacteria | 4346 |
| 651 | Ga0207675_100429898 | 3300026118 | Bacteria | 1305 |
| 652 | Ga0207683_10011150 | 3300026121 | Bacteria | 7662 |
| 653 | Ga0207683_10037056 | 3300026121 | Bacteria | 4247 |
| 654 | Ga0207683_10081531 | 3300026121 | Bacteria | 2872 |
| 655 | Ga0207683_10112392 | 3300026121 | Bacteria | 2439 |
| 656 | Ga0207683_10133738 | 3300026121 | Bacteria | 2232 |
| 657 | Ga0207683_10305745 | 3300026121 | Bacteria | 1455 |
| 658 | Ga0207683_10313671 | 3300026121 | Unclassified | 1436 |
| 659 | Ga0207698_10002595 | 3300026142 | Bacteria | 10744 |
| 660 | Ga0207698_10084196 | 3300026142 | Unclassified | 2577 |
| 661 | Ga0207698_10127667 | 3300026142 | Unclassified | 2166 |
| 662 | Ga0207698_10175597 | 3300026142 | Bacteria | 1891 |
| 663 | Ga0207428_10101572 | 3300027907 | Bacteria | 2222 |
| 664 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 665 | Ga0268266_10007816 | 3300028379 | Bacteria | 9585 |
| 666 | Ga0268266_10214932 | 3300028379 | Bacteria | 1765 |
| 667 | Ga0268265_10042632 | 3300028380 | Bacteria | 3368 |
| 668 | Ga0268265_10260802 | 3300028380 | Bacteria | 1541 |
| 669 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 670 | Ga0268264_10001580 | 3300028381 | Bacteria | 21079 |
| 671 | Ga0268264_10003253 | 3300028381 | Bacteria | 14053 |
| 672 | Ga0268264_10003762 | 3300028381 | Bacteria | 13023 |
| 673 | Ga0268264_10023117 | 3300028381 | Bacteria | 5072 |
| 674 | Ga0268264_10027215 | 3300028381 | Bacteria | 4669 |
| 675 | Ga0268264_10027753 | 3300028381 | Unclassified | 4628 |
| 676 | Ga0268264_10049065 | 3300028381 | Bacteria | 3511 |
| 677 | Ga0268264_10139530 | 3300028381 | Bacteria | 2160 |
| 678 | Ga0307517_10015597 | 3300028786 | Bacteria | 10079 |
| 679 | Ga0307515_10000010 | 3300028794 | Bacteria | 651586 |
| 680 | Ga0307515_10000057 | 3300028794 | Bacteria | 261695 |
| 681 | Ga0265338_10079195 | 3300028800 | Bacteria | 2766 |
| 682 | Ga0265324_10023935 | 3300029957 | Bacteria | 2172 |
| 683 | Ga0307511_10000024 | 3300030521 | Bacteria | 112616 |
| 684 | Ga0265330_10000013 | 3300031235 | Bacteria | 177129 |
| 685 | Ga0265332_10000019 | 3300031238 | Bacteria | 222130 |
| 686 | Ga0265328_10004579 | 3300031239 | Bacteria | 5995 |
| 687 | Ga0265320_10008899 | 3300031240 | Bacteria | 6102 |
| 688 | Ga0265325_10008789 | 3300031241 | Bacteria | 5937 |
| 689 | Ga0265329_10004580 | 3300031242 | Bacteria | 5718 |
| 690 | Ga0265339_10023126 | 3300031249 | Bacteria | 3595 |
| 691 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 692 | Ga0265327_10000046 | 3300031251 | Bacteria | 280722 |
| 693 | Ga0265327_10000239 | 3300031251 | Bacteria | 109804 |
| 694 | Ga0265327_10000618 | 3300031251 | Bacteria | 58585 |
| 695 | Ga0265327_10000726 | 3300031251 | Bacteria | 51653 |
| 696 | Ga0265327_10031497 | 3300031251 | Bacteria | 2978 |
| 697 | Ga0265316_10000111 | 3300031344 | Bacteria | 87754 |
| 698 | Ga0307509_10102308 | 3300031507 | Bacteria | 2897 |
| 699 | Ga0307509_10290150 | 3300031507 | Unclassified | 1391 |
| 700 | Ga0307508_10001247 | 3300031616 | Bacteria | 29056 |
| 701 | Ga0265314_10000004 | 3300031711 | Bacteria | 939480 |
| 702 | Ga0265342_10000017 | 3300031712 | Bacteria | 180644 |
| 703 | Ga0307516_10002738 | 3300031730 | Bacteria | 23246 |
| 704 | Ga0307516_10052934 | 3300031730 | Bacteria | 3972 |
| 705 | Ga0307516_10221684 | 3300031730 | Bacteria | 1600 |
| 706 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 707 | Ga0307406_10017842 | 3300031901 | Bacteria | 4139 |
| 708 | Ga0307414_10072314 | 3300032004 | Bacteria | 2491 |
| 709 | Ga0307510_10000042 | 3300033180 | Bacteria | 100951 |
| 710 | Ga0373923_0036518 | 3300035111 | Bacteria | 2006 |
| 711 | Ga0373935_0178506 | 3300035692 | Bacteria | 1457 |
| 712 | Ga0373927_0019498 | 3300035695 | Bacteria | 4447 |
| 713 | Ga0373937_0002128 | 3300036401 | Bacteria | 16559 |
| 714 | Ga0395899_0011662 | 3300037312 | Bacteria | 6727 |
| 715 | Ga0395899_0035366 | 3300037312 | Bacteria | 3750 |
| 716 | Ga0395899_0039531 | 3300037312 | Bacteria | 3531 |
| 717 | Ga0395899_0047757 | 3300037312 | Bacteria | 3186 |
| 718 | Ga0395899_0110395 | 3300037312 | Bacteria | 1978 |
| 719 | Ga0395900_0010950 | 3300037418 | Bacteria | 9275 |
| 720 | Ga0395900_0011050 | 3300037418 | Bacteria | 9226 |
| 721 | Ga0395900_0165276 | 3300037418 | Bacteria | 2255 |
| 722 | Ga0395900_0391710 | 3300037418 | Bacteria | 1355 |
| 723 | Ga0395898_0001697 | 3300037466 | Bacteria | 29404 |
| 724 | Ga0395898_0045358 | 3300037466 | Bacteria | 4321 |
| 725 | Ga0395898_0053988 | 3300037466 | Bacteria | 3922 |
| 726 | Ga0395898_0132518 | 3300037466 | Bacteria | 2386 |
| 727 | Ga0395905_0019301 | 3300037471 | Bacteria | 6463 |
| 728 | Ga0395905_0065228 | 3300037471 | Bacteria | 3409 |
| 729 | Ga0395905_0116178 | 3300037471 | Bacteria | 2515 |
| 730 | Ga0395905_0242968 | 3300037471 | Bacteria | 1682 |
| 731 | Ga0395905_0277475 | 3300037471 | Bacteria | 1562 |
| 732 | Ga0395901_0079052 | 3300038443 | Unclassified | 3434 |
| 733 | Ga0395901_0086677 | 3300038443 | Bacteria | 3274 |
| 734 | Ga0395901_0088589 | 3300038443 | Bacteria | 3237 |
| 735 | Ga0436365_1889064 | 3300039437 | Bacteria | 17551 |
| 736 | Ga0436365_1892627 | 3300039437 | Bacteria | 12715 |
| 737 | Ga0439436_0001903 | 3300041404 | Bacteria | 6174 |
| 738 | Ga0439439_0013021 | 3300041406 | Bacteria | 2014 |
| 739 | Ga0439441_005992 | 3300042001 | Bacteria | 1910 |
| 740 | Ga0439442_005454 | 3300042002 | Unclassified | 2544 |
| 741 | Ga0450923_009304 | 3300042125 | Bacteria | 1715 |
| 742 | Ga0451577_0015486 | 3300042876 | Bacteria | 7094 |
| 743 | Ga0451577_0273802 | 3300042876 | Bacteria | 1529 |
| 744 | Ga0466969_0000132 | 3300044656 | Bacteria | 40569 |
| 745 | Ga0466969_0035045 | 3300044656 | Bacteria | 2541 |
| 746 | Ga0466972_0000095 | 3300044658 | Bacteria | 77981 |
| 747 | Ga0466972_0000205 | 3300044658 | Bacteria | 43008 |
| 748 | Ga0466972_0000946 | 3300044658 | Bacteria | 13963 |
| 749 | Ga0466966_0000239 | 3300044684 | Bacteria | 36312 |
| 750 | Ga0466961_0016781 | 3300044693 | Bacteria | 4708 |
| 751 | Ga0466964_0019963 | 3300044706 | Bacteria | 2578 |
| 752 | Ga0453684_0021683 | 3300044712 | Bacteria | 9579 |
| 753 | Ga0453684_0023757 | 3300044712 | Bacteria | 9004 |
| 754 | Ga0453684_0024881 | 3300044712 | Bacteria | 8719 |
| 755 | Ga0453684_0027420 | 3300044712 | Bacteria | 8171 |
| 756 | Ga0453684_0030202 | 3300044712 | Bacteria | 7663 |
| 757 | Ga0453684_0041437 | 3300044712 | Bacteria | 6228 |
| 758 | Ga0453684_0136521 | 3300044712 | Bacteria | 2936 |
| 759 | Ga0466968_0009777 | 3300044735 | Bacteria | 3701 |
| 760 | Ga0466968_0035392 | 3300044735 | Bacteria | 2089 |
| 761 | Ga0466970_0000529 | 3300044765 | Bacteria | 18707 |
| 762 | Ga0466970_0108824 | 3300044765 | Bacteria | 1513 |
| 763 | Ga0466957_0007324 | 3300044842 | Bacteria | 6235 |
| 764 | Ga0466957_0010280 | 3300044842 | Bacteria | 5364 |
| 765 | Ga0466957_0043397 | 3300044842 | Bacteria | 2723 |
| 766 | Ga0466959_0000031 | 3300045049 | Bacteria | 111271 |
| 767 | Ga0466959_0000501 | 3300045049 | Bacteria | 22709 |
| 768 | Ga0466959_0057953 | 3300045049 | Bacteria | 2823 |
| 769 | Ga0451576_0082567 | 3300045051 | Bacteria | 3342 |
| 770 | Ga0495638_0044936 | 3300046460 | Bacteria | 2781 |
| 771 | Ga0495638_0071636 | 3300046460 | Unclassified | 2120 |
| 772 | Ga0495653_0064989 | 3300046463 | Bacteria | 2747 |
| 773 | Ga0495650_0022359 | 3300046471 | Bacteria | 3034 |
| 774 | Ga0495582_0126018 | 3300046473 | Bacteria | 1445 |
| 775 | Ga0495607_0143172 | 3300046501 | Bacteria | 1231 |
| 776 | Ga0495606_0040930 | 3300046507 | Bacteria | 3110 |
| 777 | Ga0495606_0069818 | 3300046507 | Bacteria | 2218 |
| 778 | Ga0495608_0085406 | 3300046511 | Bacteria | 2046 |
| 779 | Ga0495618_0094930 | 3300046514 | Bacteria | 1907 |
| 780 | Ga0495643_0000392 | 3300046522 | Bacteria | 57744 |
| 781 | Ga0495648_0002775 | 3300046524 | Bacteria | 15798 |
| 782 | Ga0495587_0082808 | 3300046536 | Bacteria | 1859 |
| 783 | Ga0495598_0035309 | 3300046537 | Bacteria | 1431 |
| 784 | Ga0495633_0000090 | 3300046558 | Bacteria | 122693 |
| 785 | Ga0495668_0000138 | 3300046616 | Bacteria | 109654 |
| 786 | Ga0495668_0000268 | 3300046616 | Bacteria | 73486 |
| 787 | Ga0495668_0002233 | 3300046616 | Bacteria | 16405 |
| 788 | Ga0495611_0000086 | 3300046648 | Bacteria | 66762 |
| 789 | Ga0495625_0044931 | 3300046660 | Bacteria | 3196 |
| 790 | Ga0495635_0071624 | 3300046663 | Bacteria | 2376 |
| 791 | Ga0495623_0076293 | 3300046679 | Unclassified | 2080 |
| 792 | Ga0495658_0048030 | 3300046683 | Unclassified | 2405 |
| 793 | Ga0495613_0099140 | 3300046689 | Bacteria | 2105 |
| 794 | Ga0495649_0063746 | 3300046694 | Bacteria | 1980 |
| 795 | Ga0495636_0000082 | 3300047318 | Bacteria | 40011 |
| 796 | Ga0495674_0014078 | 3300047319 | Bacteria | 7498 |
| 797 | Ga0495672_0022692 | 3300047320 | Bacteria | 4075 |
| 798 | Ga0495672_0035473 | 3300047320 | Bacteria | 3072 |
| 799 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 800 | Ga0495684_0104665 | 3300047471 | Bacteria | 2139 |
| 801 | Ga0495686_0000128 | 3300047472 | Bacteria | 156223 |
| 802 | Ga0495686_0002851 | 3300047472 | Bacteria | 15578 |
| 803 | Ga0495686_0051739 | 3300047472 | Bacteria | 2577 |
| 804 | Ga0495686_0143147 | 3300047472 | Bacteria | 1409 |
| 805 | Ga0495602_0240779 | 3300048088 | Bacteria | 1354 |
| 806 | Ga0496114_0002926 | 3300048917 | Bacteria | 13088 |
| 807 | Ga0496114_0045155 | 3300048917 | Bacteria | 3659 |
| 808 | Ga0496115_0037645 | 3300048918 | Bacteria | 3835 |
| 809 | Ga0496121_0000020 | 3300048924 | Bacteria | 498732 |
| 810 | Ga0496125_0000443 | 3300048928 | Bacteria | 75675 |
| 811 | Ga0496126_0024161 | 3300048929 | Bacteria | 5871 |
| 812 | Ga0496126_0031463 | 3300048929 | Bacteria | 5013 |
| 813 | Ga0501031_0039040 | 3300049568 | Bacteria | 3097 |
| 814 | Ga0501032_0000789 | 3300049569 | Bacteria | 25632 |
| 815 | Ga0501032_0070324 | 3300049569 | Bacteria | 2334 |
| 816 | Ga0501032_0091219 | 3300049569 | Unclassified | 2021 |
| 817 | Ga0501033_0127944 | 3300049570 | Unclassified | 1841 |
| 818 | Ga0501034_0003172 | 3300049571 | Bacteria | 18908 |
| 819 | Ga0501034_0006168 | 3300049571 | Bacteria | 12923 |
| 820 | Ga0501034_0008905 | 3300049571 | Bacteria | 10548 |
| 821 | Ga0501034_0050586 | 3300049571 | Bacteria | 4190 |
| 822 | Ga0501034_0243265 | 3300049571 | Bacteria | 1745 |
| 823 | Ga0501036_0001149 | 3300049572 | Bacteria | 20161 |
| 824 | Ga0501037_0004723 | 3300049573 | Bacteria | 9900 |
| 825 | Ga0501038_0011400 | 3300049574 | Bacteria | 8113 |
| 826 | Ga0501038_0044610 | 3300049574 | Bacteria | 3850 |
| 827 | Ga0501039_0005691 | 3300049575 | Bacteria | 9441 |
| 828 | Ga0501043_0011111 | 3300049579 | Bacteria | 7054 |
| 829 | Ga0501043_0013354 | 3300049579 | Bacteria | 6422 |
| 830 | Ga0501043_0026299 | 3300049579 | Bacteria | 4566 |
| 831 | Ga0501043_0026464 | 3300049579 | Bacteria | 4550 |
| 832 | Ga0501043_0087724 | 3300049579 | Bacteria | 2445 |
| 833 | Ga0501046_0012945 | 3300049580 | Bacteria | 7088 |
| 834 | Ga0501047_0003691 | 3300049581 | Bacteria | 14416 |
| 835 | Ga0501047_0007639 | 3300049581 | Bacteria | 10181 |
| 836 | Ga0501047_0010562 | 3300049581 | Bacteria | 8732 |
| 837 | Ga0501047_0064339 | 3300049581 | Bacteria | 3537 |
| 838 | Ga0501047_0088305 | 3300049581 | Bacteria | 2977 |
| 839 | Ga0501048_0003076 | 3300049582 | Bacteria | 12717 |
| 840 | Ga0501070_0090044 | 3300049586 | Bacteria | 2539 |
| 841 | Ga0501070_0097839 | 3300049586 | Bacteria | 2427 |
| 842 | Ga0501072_0153911 | 3300049588 | Bacteria | 1834 |
| 843 | Ga0501073_0002127 | 3300049589 | Bacteria | 14843 |
| 844 | Ga0501073_0010834 | 3300049589 | Bacteria | 6677 |
| 845 | Ga0501074_0000268 | 3300049590 | Bacteria | 29703 |
| 846 | Ga0501074_0054393 | 3300049590 | Bacteria | 2887 |
| 847 | Ga0501235_006460 | 3300049669 | Bacteria | 2554 |
| 848 | Ga0501257_012348 | 3300049686 | Bacteria | 1954 |
| 849 | Ga0501225_0000589 | 3300049705 | Bacteria | 11341 |
| 850 | Ga0501079_0028531 | 3300049741 | Bacteria | 4283 |
| 851 | Ga0501080_0009651 | 3300049742 | Bacteria | 8812 |
| 852 | Ga0501080_0130042 | 3300049742 | Bacteria | 2331 |
| 853 | Ga0501083_0002364 | 3300049744 | Bacteria | 12916 |
| 854 | Ga0501241_000384 | 3300049758 | Bacteria | 9683 |
| 855 | Ga0501266_003293 | 3300049763 | Bacteria | 2009 |
| 856 | Ga0501035_0006540 | 3300049822 | Bacteria | 10934 |
| 857 | Ga0501035_0037819 | 3300049822 | Bacteria | 4368 |
| 858 | Ga0501035_0095205 | 3300049822 | Bacteria | 2618 |
| 859 | Ga0501035_0121557 | 3300049822 | Unclassified | 2282 |
| 860 | Ga0501044_0006312 | 3300049823 | Bacteria | 13108 |
| 861 | Ga0501044_0008384 | 3300049823 | Bacteria | 11335 |
| 862 | Ga0501044_0009325 | 3300049823 | Bacteria | 10708 |
| 863 | Ga0501044_0020523 | 3300049823 | Bacteria | 7056 |
| 864 | Ga0501044_0037083 | 3300049823 | Bacteria | 5097 |
| 865 | Ga0501044_0171853 | 3300049823 | Bacteria | 2138 |
| 866 | Ga0501284_00008 | 3300050005 | Bacteria | 143517 |
| 867 | nmdc:mga0k408_28094_c1 | 3300050493 | Bacteria | 3197 |
| 868 | nmdc:mga0k408_67998_c1 | 3300050493 | Bacteria | 2077 |
| 869 | nmdc:mga05p37_2260_c1 | 3300050507 | Bacteria | 22440 |
| 870 | nmdc:mga05p37_239788_c1 | 3300050507 | Bacteria | 2181 |
| 871 | nmdc:mga09592_29361_c1 | 3300050508 | Bacteria | 4574 |
| 872 | nmdc:mga09592_33001_c1 | 3300050508 | Bacteria | 4319 |
| 873 | nmdc:mga0qj67_49668_c1 | 3300050509 | Bacteria | 3315 |
| 874 | nmdc:mga0qj67_8348_c1 | 3300050509 | Bacteria | 7679 |
| 875 | nmdc:mga06r32_137630_c1 | 3300050510 | Bacteria | 2417 |
| 876 | nmdc:mga06r32_25308_c1 | 3300050510 | Bacteria | 5521 |
| 877 | nmdc:mga08y16_5732_c1 | 3300050511 | Bacteria | 13017 |
| 878 | nmdc:mga08y16_66728_c1 | 3300050511 | Bacteria | 3755 |
| 879 | Ga0500578_0000119 | 3300053086 | Bacteria | 95584 |
| 880 | Ga0500644_0000279 | 3300053088 | Bacteria | 28337 |
| 881 | Ga0500583_0000010 | 3300053092 | Bacteria | 160546 |
| 882 | Ga0500583_0003806 | 3300053092 | Bacteria | 4821 |
| 883 | Ga0500641_0000073 | 3300053096 | Bacteria | 40903 |
| 884 | Ga0500641_0036900 | 3300053096 | Bacteria | 1957 |
| 885 | Ga0500569_000815 | 3300053109 | Bacteria | 5503 |
| 886 | Ga0500642_0005679 | 3300053130 | Bacteria | 4048 |
| 887 | Ga0500658_0001824 | 3300053134 | Bacteria | 8394 |
| 888 | Ga0500568_0000641 | 3300053139 | Bacteria | 25249 |
| 889 | Ga0500568_0005236 | 3300053139 | Bacteria | 6742 |
| 890 | Ga0500577_0000916 | 3300053142 | Bacteria | 7637 |
| 891 | Ga0500588_0001353 | 3300053146 | Bacteria | 4631 |
| 892 | Ga0500589_011051 | 3300053147 | Bacteria | 3890 |
| 893 | Ga0500604_0023314 | 3300053151 | Bacteria | 1765 |
| 894 | Ga0500616_0002914 | 3300053153 | Bacteria | 13661 |
| 895 | Ga0500616_0022029 | 3300053153 | Bacteria | 3563 |
| 896 | Ga0500616_0061009 | 3300053153 | Bacteria | 1954 |
| 897 | Ga0500622_0000176 | 3300053156 | Bacteria | 69125 |
| 898 | Ga0500622_0000488 | 3300053156 | Bacteria | 37136 |
| 899 | Ga0500622_0003314 | 3300053156 | Bacteria | 10885 |
| 900 | Ga0500622_0047892 | 3300053156 | Bacteria | 2206 |
| 901 | Ga0500627_0003198 | 3300053158 | Bacteria | 5026 |
| 902 | Ga0500633_0006823 | 3300053160 | Bacteria | 2830 |
| 903 | Ga0500636_0032081 | 3300053177 | Bacteria | 3109 |
| 904 | Ga0500611_000020 | 3300053727 | Bacteria | 105250 |
| 905 | Ga0501082_0040431 | 3300060353 | Bacteria | 4022 |
| 906 | Ga0466962_0055837 | 3300061719 | Bacteria | 1887 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046501 | Ga0495607_0143172 | Ga0495607_0143172_190_1221 | 331 |
| 2 | 3300047320 | Ga0495672_0035473 | Ga0495672_0035473_41_1213 | 360 |
| 3 | 3300026118 | Ga0207675_100429898 | Ga0207675_1004298981 | 362 |
| 4 | 3300044765 | Ga0466970_0108824 | Ga0466970_0108824_39_1223 | 367 |
| 5 | 3300005327 | Ga0070658_10179516 | Ga0070658_101795161 | 373 |
| 6 | 3300005339 | Ga0070660_100072985 | Ga0070660_1000729854 | 373 |
| 7 | 3300013104 | Ga0157370_10019741 | Ga0157370_100197415 | 373 |
| 8 | 3300013104 | Ga0157370_10101118 | Ga0157370_101011182 | 373 |
| 9 | 3300025961 | Ga0207712_10026360 | Ga0207712_100263603 | 374 |
| 10 | 3300053139 | Ga0500568_0000641 | Ga0500568_0000641_15907_17163 | 374 |
| 11 | 3300005334 | Ga0068869_100084756 | Ga0068869_1000847562 | 375 |
| 12 | 3300005618 | Ga0068864_100153429 | Ga0068864_1001534292 | 375 |
| 13 | 3300005843 | Ga0068860_100029257 | Ga0068860_1000292572 | 375 |
| 14 | 3300009553 | Ga0105249_10002037 | Ga0105249_100020378 | 375 |
| 15 | 3300013306 | Ga0163162_10253355 | Ga0163162_102533552 | 375 |
| 16 | 3300014968 | Ga0157379_10016875 | Ga0157379_100168752 | 375 |
| 17 | 3300025900 | Ga0207710_10002430 | Ga0207710_100024305 | 375 |
| 18 | 3300025942 | Ga0207689_10132984 | Ga0207689_101329842 | 375 |
| 19 | 3300026095 | Ga0207676_10099684 | Ga0207676_100996842 | 375 |
| 20 | 3300047472 | Ga0495686_0143147 | Ga0495686_0143147_13_1269 | 375 |
| 21 | 3300005578 | Ga0068854_100031903 | Ga0068854_1000319034 | 376 |
| 22 | 3300006195 | Ga0075366_10091015 | Ga0075366_100910152 | 376 |
| 23 | 3300049588 | Ga0501072_0153911 | Ga0501072_0153911_600_1811 | 376 |
| 24 | 3300006844 | Ga0075428_100102763 | Ga0075428_1001027632 | 378 |
| 25 | 3300006880 | Ga0075429_100027628 | Ga0075429_1000276286 | 378 |
| 26 | 3300009094 | Ga0111539_10022168 | Ga0111539_100221683 | 378 |
| 27 | 3300013102 | Ga0157371_10000651 | Ga0157371_1000065131 | 378 |
| 28 | 3300033180 | Ga0307510_10000042 | Ga0307510_1000004270 | 378 |
| 29 | 3300046507 | Ga0495606_0040930 | Ga0495606_0040930_455_1708 | 378 |
| 30 | 3300050510 | nmdc:mga06r32_25308_c1 | nmdc:mga06r32_25308_c1_1122_2387 | 378 |
| 31 | 3300050511 | nmdc:mga08y16_66728_c1 | nmdc:mga08y16_66728_c1_405_1673 | 378 |
| 32 | 3300003322 | rootL2_10163823 | rootL2_101638231 | 379 |
| 33 | 3300005719 | Ga0068861_100256002 | Ga0068861_1002560022 | 379 |
| 34 | 3300025899 | Ga0207642_10012939 | Ga0207642_100129392 | 379 |
| 35 | 3300026089 | Ga0207648_10004739 | Ga0207648_100047395 | 379 |
| 36 | 3300053139 | Ga0500568_0005236 | Ga0500568_0005236_3949_5256 | 379 |
| 37 | 3300030521 | Ga0307511_10000024 | Ga0307511_100000244 | 380 |
| 38 | 3300005331 | Ga0070670_100038903 | Ga0070670_1000389033 | 381 |
| 39 | 3300025936 | Ga0207670_10099288 | Ga0207670_100992882 | 381 |
| 40 | 3300025960 | Ga0207651_10019691 | Ga0207651_100196912 | 381 |
| 41 | 3300027907 | Ga0207428_10101572 | Ga0207428_101015722 | 381 |
| 42 | 3300005577 | Ga0068857_100004830 | Ga0068857_1000048305 | 382 |
| 43 | 3300005578 | Ga0068854_100073428 | Ga0068854_1000734283 | 382 |
| 44 | 3300005614 | Ga0068856_100035282 | Ga0068856_1000352824 | 382 |
| 45 | 3300005616 | Ga0068852_100006208 | Ga0068852_1000062082 | 382 |
| 46 | 3300009545 | Ga0105237_10007600 | Ga0105237_1000760011 | 382 |
| 47 | 3300013307 | Ga0157372_10000676 | Ga0157372_1000067637 | 382 |
| 48 | 3300025904 | Ga0207647_10016694 | Ga0207647_100166942 | 382 |
| 49 | 3300025914 | Ga0207671_10007560 | Ga0207671_100075607 | 382 |
| 50 | 3300025949 | Ga0207667_10001491 | Ga0207667_100014918 | 382 |
| 51 | 3300025981 | Ga0207640_10069448 | Ga0207640_100694481 | 382 |
| 52 | 3300026041 | Ga0207639_10075282 | Ga0207639_100752822 | 382 |
| 53 | 3300026116 | Ga0207674_10004594 | Ga0207674_100045945 | 382 |
| 54 | 3300026142 | Ga0207698_10002595 | Ga0207698_100025959 | 382 |
| 55 | 3300005331 | Ga0070670_100080565 | Ga0070670_1000805652 | 383 |
| 56 | 3300005356 | Ga0070674_100145194 | Ga0070674_1001451941 | 383 |
| 57 | 3300006237 | Ga0097621_100000487 | Ga0097621_1000004875 | 383 |
| 58 | 3300009177 | Ga0105248_10040274 | Ga0105248_100402744 | 383 |
| 59 | 3300013297 | Ga0157378_10004726 | Ga0157378_100047265 | 383 |
| 60 | 3300013306 | Ga0163162_10000856 | Ga0163162_100008565 | 383 |
| 61 | 3300014325 | Ga0163163_10000560 | Ga0163163_100005602 | 383 |
| 62 | 3300014968 | Ga0157379_10048438 | Ga0157379_100484382 | 383 |
| 63 | 3300014969 | Ga0157376_10003607 | Ga0157376_100036075 | 383 |
| 64 | 3300017792 | Ga0163161_10001190 | Ga0163161_1000119010 | 383 |
| 65 | 3300025925 | Ga0207650_10132943 | Ga0207650_101329432 | 383 |
| 66 | 3300026121 | Ga0207683_10037056 | Ga0207683_100370562 | 383 |
| 67 | 3300044712 | Ga0453684_0027420 | Ga0453684_0027420_2428_3612 | 383 |
| 68 | 3300048917 | Ga0496114_0045155 | Ga0496114_0045155_460_1719 | 383 |
| 69 | 3300003320 | rootH2_10056261 | rootH2_100562612 | 384 |
| 70 | 3300003320 | rootH2_10100645 | rootH2_101006453 | 384 |
| 71 | 3300005367 | Ga0070667_100136993 | Ga0070667_1001369932 | 384 |
| 72 | 3300005614 | Ga0068856_100131052 | Ga0068856_1001310522 | 384 |
| 73 | 3300014326 | Ga0157380_10068775 | Ga0157380_100687752 | 384 |
| 74 | 3300025923 | Ga0207681_10150737 | Ga0207681_101507371 | 384 |
| 75 | 3300025925 | Ga0207650_10150314 | Ga0207650_101503142 | 384 |
| 76 | 3300025942 | Ga0207689_10008379 | Ga0207689_100083793 | 384 |
| 77 | 3300026078 | Ga0207702_10043851 | Ga0207702_100438512 | 384 |
| 78 | 3300026116 | Ga0207674_10250770 | Ga0207674_102507702 | 384 |
| 79 | 3300047472 | Ga0495686_0000128 | Ga0495686_0000128_17199_18455 | 384 |
| 80 | 3300049571 | Ga0501034_0008905 | Ga0501034_0008905_2887_4062 | 384 |
| 81 | 3300053096 | Ga0500641_0036900 | Ga0500641_0036900_390_1646 | 384 |
| 82 | 3300042876 | Ga0451577_0273802 | Ga0451577_0273802_268_1452 | 385 |
| 83 | 3300044712 | Ga0453684_0023757 | Ga0453684_0023757_1708_2892 | 385 |
| 84 | 3300005578 | Ga0068854_100144895 | Ga0068854_1001448952 | 386 |
| 85 | 3300013104 | Ga0157370_10010139 | Ga0157370_100101394 | 386 |
| 86 | 3300049568 | Ga0501031_0039040 | Ga0501031_0039040_899_2155 | 386 |
| 87 | 3300049569 | Ga0501032_0070324 | Ga0501032_0070324_716_1972 | 386 |
| 88 | 3300049571 | Ga0501034_0050586 | Ga0501034_0050586_1872_3128 | 386 |
| 89 | 3300049574 | Ga0501038_0044610 | Ga0501038_0044610_1224_2480 | 386 |
| 90 | 3300049579 | Ga0501043_0026464 | Ga0501043_0026464_1842_3098 | 386 |
| 91 | 3300049822 | Ga0501035_0037819 | Ga0501035_0037819_44_1300 | 386 |
| 92 | 3300049823 | Ga0501044_0020523 | Ga0501044_0020523_4565_5821 | 386 |
| 93 | 3300005329 | Ga0070683_100001844 | Ga0070683_10000184413 | 387 |
| 94 | 3300005535 | Ga0070684_100014413 | Ga0070684_1000144136 | 387 |
| 95 | 3300005563 | Ga0068855_100000406 | Ga0068855_10000040622 | 387 |
| 96 | 3300005577 | Ga0068857_100132320 | Ga0068857_1001323202 | 387 |
| 97 | 3300005578 | Ga0068854_100208667 | Ga0068854_1002086671 | 387 |
| 98 | 3300005617 | Ga0068859_100187243 | Ga0068859_1001872432 | 387 |
| 99 | 3300005843 | Ga0068860_100063750 | Ga0068860_1000637502 | 387 |
| 100 | 3300006931 | Ga0097620_100187246 | Ga0097620_1001872462 | 387 |
| 101 | 3300009093 | Ga0105240_10008492 | Ga0105240_100084922 | 387 |
| 102 | 3300009545 | Ga0105237_10006346 | Ga0105237_100063465 | 387 |
| 103 | 3300013104 | Ga0157370_10067521 | Ga0157370_100675212 | 387 |
| 104 | 3300013297 | Ga0157378_10025100 | Ga0157378_100251003 | 387 |
| 105 | 3300013306 | Ga0163162_10007340 | Ga0163162_100073409 | 387 |
| 106 | 3300013306 | Ga0163162_10141353 | Ga0163162_101413532 | 387 |
| 107 | 3300013307 | Ga0157372_10041530 | Ga0157372_100415303 | 387 |
| 108 | 3300025913 | Ga0207695_10000051 | Ga0207695_10000051225 | 387 |
| 109 | 3300025913 | Ga0207695_10000056 | Ga0207695_1000005616 | 387 |
| 110 | 3300025913 | Ga0207695_10000081 | Ga0207695_10000081225 | 387 |
| 111 | 3300025914 | Ga0207671_10000150 | Ga0207671_1000015031 | 387 |
| 112 | 3300025944 | Ga0207661_10002197 | Ga0207661_1000219711 | 387 |
| 113 | 3300025949 | Ga0207667_10000324 | Ga0207667_1000032419 | 387 |
| 114 | 3300028381 | Ga0268264_10049065 | Ga0268264_100490652 | 387 |
| 115 | 3300047320 | Ga0495672_0022692 | Ga0495672_0022692_1199_2455 | 387 |
| 116 | 3300005843 | Ga0068860_100009247 | Ga0068860_1000092471 | 388 |
| 117 | 3300005985 | Ga0081539_10012887 | Ga0081539_100128876 | 388 |
| 118 | 3300009551 | Ga0105238_10082937 | Ga0105238_100829373 | 388 |
| 119 | 3300013307 | Ga0157372_10000361 | Ga0157372_1000036118 | 388 |
| 120 | 3300025904 | Ga0207647_10077222 | Ga0207647_100772222 | 388 |
| 121 | 3300044656 | Ga0466969_0035045 | Ga0466969_0035045_90_1346 | 388 |
| 122 | 3300044693 | Ga0466961_0016781 | Ga0466961_0016781_1405_2661 | 388 |
| 123 | 3300045049 | Ga0466959_0000501 | Ga0466959_0000501_1738_2994 | 388 |
| 124 | 3300005563 | Ga0068855_100143074 | Ga0068855_1001430742 | 389 |
| 125 | 3300009093 | Ga0105240_10064033 | Ga0105240_100640333 | 389 |
| 126 | 3300009545 | Ga0105237_10143287 | Ga0105237_101432871 | 389 |
| 127 | 3300010375 | Ga0105239_10000263 | Ga0105239_1000026334 | 389 |
| 128 | 3300025914 | Ga0207671_10085591 | Ga0207671_100855911 | 389 |
| 129 | 3300025949 | Ga0207667_10117410 | Ga0207667_101174102 | 389 |
| 130 | 3300031507 | Ga0307509_10102308 | Ga0307509_101023082 | 389 |
| 131 | 3300031730 | Ga0307516_10052934 | Ga0307516_100529341 | 389 |
| 132 | 3300042002 | Ga0439442_005454 | Ga0439442_005454_805_2061 | 389 |
| 133 | 3300042876 | Ga0451577_0015486 | Ga0451577_0015486_5141_6400 | 389 |
| 134 | 3300050005 | Ga0501284_00008 | Ga0501284_00008_57937_59193 | 389 |
| 135 | iso_pu_bacteria | 2818991442 | 2819573758 | 389 |
| 136 | iso_pu_bacteria | 2818991460 | 2819680515 | 389 |
| 137 | iso_pu_bacteria | 2821136567 | 2821137092 | 389 |
| 138 | iso_pu_bacteria | 2840677318 | 2840677608 | 389 |
| 139 | iso_pu_bacteria | 2884791551 | 2884798073 | 389 |
| 140 | iso_pu_bacteria | 2890804823 | 2890807106 | 389 |
| 141 | iso_pu_bacteria | 2896085136 | 2896085426 | 389 |
| 142 | iso_pu_bacteria | 2904467357 | 2904468166 | 389 |
| 143 | iso_pu_bacteria | 2929177148 | 2929182809 | 389 |
| 144 | iso_pu_bacteria | 2929921140 | 2929923394 | 389 |
| 145 | iso_pu_bacteria | 2945977869 | 2945978763 | 389 |
| 146 | iso_pu_bacteria | 2946013367 | 2946015370 | 389 |
| 147 | iso_pu_bacteria | 8003151029 | 8003152795 | 389 |
| 148 | 3300005293 | Ga0065715_10098173 | Ga0065715_100981733 | 390 |
| 149 | 3300005331 | Ga0070670_100026565 | Ga0070670_1000265653 | 390 |
| 150 | 3300005336 | Ga0070680_100011958 | Ga0070680_1000119584 | 390 |
| 151 | 3300005340 | Ga0070689_100039392 | Ga0070689_1000393922 | 390 |
| 152 | 3300005341 | Ga0070691_10001047 | Ga0070691_100010478 | 390 |
| 153 | 3300005353 | Ga0070669_100021311 | Ga0070669_1000213114 | 390 |
| 154 | 3300005354 | Ga0070675_100007148 | Ga0070675_1000071487 | 390 |
| 155 | 3300005364 | Ga0070673_100013654 | Ga0070673_1000136542 | 390 |
| 156 | 3300005365 | Ga0070688_100005858 | Ga0070688_1000058585 | 390 |
| 157 | 3300005457 | Ga0070662_100009392 | Ga0070662_1000093922 | 390 |
| 158 | 3300005535 | Ga0070684_100055619 | Ga0070684_1000556192 | 390 |
| 159 | 3300005539 | Ga0068853_100001291 | Ga0068853_10000129121 | 390 |
| 160 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008463 | 390 |
| 161 | 3300005548 | Ga0070665_100109195 | Ga0070665_1001091952 | 390 |
| 162 | 3300005577 | Ga0068857_100015114 | Ga0068857_1000151146 | 390 |
| 163 | 3300005617 | Ga0068859_100058275 | Ga0068859_1000582753 | 390 |
| 164 | 3300005617 | Ga0068859_100176293 | Ga0068859_1001762932 | 390 |
| 165 | 3300005618 | Ga0068864_100056257 | Ga0068864_1000562573 | 390 |
| 166 | 3300005843 | Ga0068860_100000059 | Ga0068860_10000005967 | 390 |
| 167 | 3300005843 | Ga0068860_100034335 | Ga0068860_1000343351 | 390 |
| 168 | 3300005844 | Ga0068862_100061946 | Ga0068862_1000619462 | 390 |
| 169 | 3300006931 | Ga0097620_100058269 | Ga0097620_1000582692 | 390 |
| 170 | 3300006931 | Ga0097620_100176303 | Ga0097620_1001763032 | 390 |
| 171 | 3300009093 | Ga0105240_10002681 | Ga0105240_100026815 | 390 |
| 172 | 3300009093 | Ga0105240_10009313 | Ga0105240_100093135 | 390 |
| 173 | 3300009093 | Ga0105240_10009560 | Ga0105240_100095603 | 390 |
| 174 | 3300009094 | Ga0111539_10006433 | Ga0111539_1000643311 | 390 |
| 175 | 3300009174 | Ga0105241_10010072 | Ga0105241_100100724 | 390 |
| 176 | 3300009545 | Ga0105237_10000128 | Ga0105237_1000012843 | 390 |
| 177 | 3300009545 | Ga0105237_10007857 | Ga0105237_100078578 | 390 |
| 178 | 3300009545 | Ga0105237_10139842 | Ga0105237_101398424 | 390 |
| 179 | 3300009551 | Ga0105238_10023664 | Ga0105238_100236645 | 390 |
| 180 | 3300010375 | Ga0105239_10000748 | Ga0105239_1000074852 | 390 |
| 181 | 3300010375 | Ga0105239_10003037 | Ga0105239_1000303723 | 390 |
| 182 | 3300010375 | Ga0105239_10025164 | Ga0105239_100251642 | 390 |
| 183 | 3300013104 | Ga0157370_10060071 | Ga0157370_100600714 | 390 |
| 184 | 3300013306 | Ga0163162_10000164 | Ga0163162_1000016428 | 390 |
| 185 | 3300013306 | Ga0163162_10060105 | Ga0163162_100601052 | 390 |
| 186 | 3300013306 | Ga0163162_10151709 | Ga0163162_101517092 | 390 |
| 187 | 3300013307 | Ga0157372_10143700 | Ga0157372_101437004 | 390 |
| 188 | 3300014326 | Ga0157380_10020668 | Ga0157380_100206683 | 390 |
| 189 | 3300014745 | Ga0157377_10004008 | Ga0157377_100040084 | 390 |
| 190 | 3300025911 | Ga0207654_10020576 | Ga0207654_100205763 | 390 |
| 191 | 3300025912 | Ga0207707_10003165 | Ga0207707_100031659 | 390 |
| 192 | 3300025913 | Ga0207695_10000446 | Ga0207695_1000044657 | 390 |
| 193 | 3300025913 | Ga0207695_10000873 | Ga0207695_1000087331 | 390 |
| 194 | 3300025913 | Ga0207695_10011272 | Ga0207695_100112723 | 390 |
| 195 | 3300025913 | Ga0207695_10025625 | Ga0207695_100256256 | 390 |
| 196 | 3300025914 | Ga0207671_10001329 | Ga0207671_1000132913 | 390 |
| 197 | 3300025914 | Ga0207671_10007853 | Ga0207671_100078539 | 390 |
| 198 | 3300025917 | Ga0207660_10097456 | Ga0207660_100974561 | 390 |
| 199 | 3300025921 | Ga0207652_10031057 | Ga0207652_100310574 | 390 |
| 200 | 3300025926 | Ga0207659_10033230 | Ga0207659_100332302 | 390 |
| 201 | 3300025926 | Ga0207659_10035683 | Ga0207659_100356833 | 390 |
| 202 | 3300025933 | Ga0207706_10002738 | Ga0207706_100027385 | 390 |
| 203 | 3300025940 | Ga0207691_10060213 | Ga0207691_100602132 | 390 |
| 204 | 3300026041 | Ga0207639_10009587 | Ga0207639_100095872 | 390 |
| 205 | 3300026041 | Ga0207639_10129745 | Ga0207639_101297452 | 390 |
| 206 | 3300026089 | Ga0207648_10044331 | Ga0207648_100443312 | 390 |
| 207 | 3300026095 | Ga0207676_10013866 | Ga0207676_100138665 | 390 |
| 208 | 3300026116 | Ga0207674_10030768 | Ga0207674_100307685 | 390 |
| 209 | 3300026118 | Ga0207675_100000599 | Ga0207675_10000059919 | 390 |
| 210 | 3300028379 | Ga0268266_10000016 | Ga0268266_10000016461 | 390 |
| 211 | 3300028380 | Ga0268265_10042632 | Ga0268265_100426322 | 390 |
| 212 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015406 | 390 |
| 213 | 3300028381 | Ga0268264_10003253 | Ga0268264_1000325312 | 390 |
| 214 | 3300028381 | Ga0268264_10023117 | Ga0268264_100231172 | 390 |
| 215 | 3300028786 | Ga0307517_10015597 | Ga0307517_100155974 | 390 |
| 216 | 3300044706 | Ga0466964_0019963 | Ga0466964_0019963_1071_2327 | 390 |
| 217 | 3300046648 | Ga0495611_0000086 | Ga0495611_0000086_20362_21618 | 390 |
| 218 | 3300047443 | Ga0495687_000004 | Ga0495687_000004_620394_621650 | 390 |
| 219 | 3300049586 | Ga0501070_0090044 | Ga0501070_0090044_734_1990 | 390 |
| 220 | 3300049589 | Ga0501073_0010834 | Ga0501073_0010834_2640_3896 | 390 |
| 221 | 3300049590 | Ga0501074_0054393 | Ga0501074_0054393_492_1748 | 390 |
| 222 | 3300050493 | nmdc:mga0k408_28094_c1 | nmdc:mga0k408_28094_c1_1903_3159 | 390 |
| 223 | 3300050511 | nmdc:mga08y16_5732_c1 | nmdc:mga08y16_5732_c1_11221_12477 | 390 |
| 224 | 3300053092 | Ga0500583_0000010 | Ga0500583_0000010_127518_128774 | 390 |
| 225 | 3300053092 | Ga0500583_0003806 | Ga0500583_0003806_1608_2864 | 390 |
| 226 | 3300053147 | Ga0500589_011051 | Ga0500589_011051_2412_3668 | 390 |
| 227 | 3300053151 | Ga0500604_0023314 | Ga0500604_0023314_415_1671 | 390 |
| 228 | 3300053156 | Ga0500622_0047892 | Ga0500622_0047892_457_1713 | 390 |
| 229 | 3300060353 | Ga0501082_0040431 | Ga0501082_0040431_82_1395 | 390 |
| 230 | iso_pu_bacteria | 2883068021 | 2883072988 | 390 |
| 231 | iso_pu_bacteria | 2896109856 | 2896113612 | 390 |
| 232 | iso_pu_bacteria | 2929239360 | 2929241373 | 390 |
| 233 | 3300005330 | Ga0070690_100016948 | Ga0070690_1000169483 | 391 |
| 234 | 3300005334 | Ga0068869_100034075 | Ga0068869_1000340752 | 391 |
| 235 | 3300005335 | Ga0070666_10026338 | Ga0070666_100263382 | 391 |
| 236 | 3300005337 | Ga0070682_100013032 | Ga0070682_1000130323 | 391 |
| 237 | 3300005338 | Ga0068868_100008559 | Ga0068868_1000085594 | 391 |
| 238 | 3300005365 | Ga0070688_100132491 | Ga0070688_1001324912 | 391 |
| 239 | 3300005367 | Ga0070667_100012198 | Ga0070667_1000121983 | 391 |
| 240 | 3300005367 | Ga0070667_100156773 | Ga0070667_1001567731 | 391 |
| 241 | 3300005456 | Ga0070678_100021106 | Ga0070678_1000211064 | 391 |
| 242 | 3300005457 | Ga0070662_100002931 | Ga0070662_1000029319 | 391 |
| 243 | 3300005457 | Ga0070662_100016106 | Ga0070662_1000161065 | 391 |
| 244 | 3300005459 | Ga0068867_100074463 | Ga0068867_1000744632 | 391 |
| 245 | 3300005535 | Ga0070684_100001070 | Ga0070684_10000107011 | 391 |
| 246 | 3300005539 | Ga0068853_100006484 | Ga0068853_1000064843 | 391 |
| 247 | 3300005563 | Ga0068855_100111470 | Ga0068855_1001114703 | 391 |
| 248 | 3300005564 | Ga0070664_100008883 | Ga0070664_1000088836 | 391 |
| 249 | 3300005564 | Ga0070664_100061377 | Ga0070664_1000613772 | 391 |
| 250 | 3300005577 | Ga0068857_100004345 | Ga0068857_1000043456 | 391 |
| 251 | 3300005578 | Ga0068854_100022079 | Ga0068854_1000220792 | 391 |
| 252 | 3300006237 | Ga0097621_100071294 | Ga0097621_1000712943 | 391 |
| 253 | 3300006237 | Ga0097621_100089616 | Ga0097621_1000896162 | 391 |
| 254 | 3300006358 | Ga0068871_100189196 | Ga0068871_1001891962 | 391 |
| 255 | 3300009174 | Ga0105241_10133889 | Ga0105241_101338892 | 391 |
| 256 | 3300009176 | Ga0105242_10027845 | Ga0105242_100278452 | 391 |
| 257 | 3300009553 | Ga0105249_10119485 | Ga0105249_101194851 | 391 |
| 258 | 3300010375 | Ga0105239_10129240 | Ga0105239_101292402 | 391 |
| 259 | 3300013296 | Ga0157374_10000009 | Ga0157374_10000009394 | 391 |
| 260 | 3300013296 | Ga0157374_10002136 | Ga0157374_100021368 | 391 |
| 261 | 3300013306 | Ga0163162_10000413 | Ga0163162_1000041315 | 391 |
| 262 | 3300013308 | Ga0157375_10019779 | Ga0157375_100197794 | 391 |
| 263 | 3300014745 | Ga0157377_10034815 | Ga0157377_100348152 | 391 |
| 264 | 3300014745 | Ga0157377_10147612 | Ga0157377_101476121 | 391 |
| 265 | 3300014969 | Ga0157376_10007147 | Ga0157376_100071476 | 391 |
| 266 | 3300014969 | Ga0157376_10065638 | Ga0157376_100656382 | 391 |
| 267 | 3300025315 | Ga0207697_10081107 | Ga0207697_100811071 | 391 |
| 268 | 3300025907 | Ga0207645_10008549 | Ga0207645_100085492 | 391 |
| 269 | 3300025913 | Ga0207695_10147130 | Ga0207695_101471303 | 391 |
| 270 | 3300025919 | Ga0207657_10233751 | Ga0207657_102337511 | 391 |
| 271 | 3300025920 | Ga0207649_10037474 | Ga0207649_100374742 | 391 |
| 272 | 3300025933 | Ga0207706_10006740 | Ga0207706_1000674010 | 391 |
| 273 | 3300025934 | Ga0207686_10077169 | Ga0207686_100771692 | 391 |
| 274 | 3300025942 | Ga0207689_10009613 | Ga0207689_100096138 | 391 |
| 275 | 3300025942 | Ga0207689_10012042 | Ga0207689_100120423 | 391 |
| 276 | 3300025944 | Ga0207661_10000433 | Ga0207661_1000043322 | 391 |
| 277 | 3300025961 | Ga0207712_10115538 | Ga0207712_101155382 | 391 |
| 278 | 3300025986 | Ga0207658_10080361 | Ga0207658_100803612 | 391 |
| 279 | 3300026023 | Ga0207677_10017319 | Ga0207677_100173191 | 391 |
| 280 | 3300026041 | Ga0207639_10049836 | Ga0207639_100498361 | 391 |
| 281 | 3300026089 | Ga0207648_10025344 | Ga0207648_100253443 | 391 |
| 282 | 3300026089 | Ga0207648_10037061 | Ga0207648_100370614 | 391 |
| 283 | 3300026116 | Ga0207674_10008341 | Ga0207674_100083416 | 391 |
| 284 | 3300026121 | Ga0207683_10081531 | Ga0207683_100815312 | 391 |
| 285 | 3300028380 | Ga0268265_10260802 | Ga0268265_102608021 | 391 |
| 286 | 3300035111 | Ga0373923_0036518 | Ga0373923_0036518_499_1755 | 391 |
| 287 | 3300035692 | Ga0373935_0178506 | Ga0373935_0178506_156_1412 | 391 |
| 288 | 3300036401 | Ga0373937_0002128 | Ga0373937_0002128_5041_6297 | 391 |
| 289 | 3300044658 | Ga0466972_0000946 | Ga0466972_0000946_3897_5153 | 391 |
| 290 | 3300044735 | Ga0466968_0035392 | Ga0466968_0035392_507_1763 | 391 |
| 291 | 3300046460 | Ga0495638_0044936 | Ga0495638_0044936_530_1786 | 391 |
| 292 | 3300046460 | Ga0495638_0071636 | Ga0495638_0071636_55_1311 | 391 |
| 293 | 3300046463 | Ga0495653_0064989 | Ga0495653_0064989_1324_2580 | 391 |
| 294 | 3300046511 | Ga0495608_0085406 | Ga0495608_0085406_560_1816 | 391 |
| 295 | 3300046514 | Ga0495618_0094930 | Ga0495618_0094930_325_1581 | 391 |
| 296 | 3300046524 | Ga0495648_0002775 | Ga0495648_0002775_9739_10995 | 391 |
| 297 | 3300046536 | Ga0495587_0082808 | Ga0495587_0082808_35_1291 | 391 |
| 298 | 3300046663 | Ga0495635_0071624 | Ga0495635_0071624_203_1459 | 391 |
| 299 | 3300046689 | Ga0495613_0099140 | Ga0495613_0099140_672_1928 | 391 |
| 300 | 3300047471 | Ga0495684_0104665 | Ga0495684_0104665_322_1578 | 391 |
| 301 | 3300049571 | Ga0501034_0243265 | Ga0501034_0243265_488_1720 | 391 |
| 302 | 3300053086 | Ga0500578_0000119 | Ga0500578_0000119_91035_92291 | 391 |
| 303 | 3300053156 | Ga0500622_0003314 | Ga0500622_0003314_9574_10830 | 391 |
| 304 | 3300003323 | rootH1_10005865 | rootH1_1000586511 | 392 |
| 305 | 3300005331 | Ga0070670_100027222 | Ga0070670_1000272223 | 392 |
| 306 | 3300005336 | Ga0070680_100130702 | Ga0070680_1001307022 | 392 |
| 307 | 3300005336 | Ga0070680_100217863 | Ga0070680_1002178632 | 392 |
| 308 | 3300005339 | Ga0070660_100092127 | Ga0070660_1000921273 | 392 |
| 309 | 3300005456 | Ga0070678_100061577 | Ga0070678_1000615772 | 392 |
| 310 | 3300005458 | Ga0070681_10065886 | Ga0070681_100658862 | 392 |
| 311 | 3300005563 | Ga0068855_100056531 | Ga0068855_1000565315 | 392 |
| 312 | 3300005563 | Ga0068855_100064457 | Ga0068855_1000644574 | 392 |
| 313 | 3300005563 | Ga0068855_100183932 | Ga0068855_1001839324 | 392 |
| 314 | 3300005577 | Ga0068857_100080583 | Ga0068857_1000805832 | 392 |
| 315 | 3300005616 | Ga0068852_100020725 | Ga0068852_1000207255 | 392 |
| 316 | 3300006195 | Ga0075366_10017853 | Ga0075366_100178532 | 392 |
| 317 | 3300009093 | Ga0105240_10000767 | Ga0105240_100007677 | 392 |
| 318 | 3300009147 | Ga0114129_10003306 | Ga0114129_1000330617 | 392 |
| 319 | 3300009174 | Ga0105241_10018003 | Ga0105241_100180035 | 392 |
| 320 | 3300009174 | Ga0105241_10024675 | Ga0105241_100246753 | 392 |
| 321 | 3300009545 | Ga0105237_10040418 | Ga0105237_100404183 | 392 |
| 322 | 3300009545 | Ga0105237_10112647 | Ga0105237_101126472 | 392 |
| 323 | 3300009551 | Ga0105238_10013311 | Ga0105238_100133117 | 392 |
| 324 | 3300010375 | Ga0105239_10002485 | Ga0105239_100024857 | 392 |
| 325 | 3300013100 | Ga0157373_10004754 | Ga0157373_100047544 | 392 |
| 326 | 3300013102 | Ga0157371_10053023 | Ga0157371_100530234 | 392 |
| 327 | 3300013104 | Ga0157370_10032940 | Ga0157370_100329404 | 392 |
| 328 | 3300013306 | Ga0163162_10000697 | Ga0163162_100006977 | 392 |
| 329 | 3300013307 | Ga0157372_10155238 | Ga0157372_101552382 | 392 |
| 330 | 3300014969 | Ga0157376_10179106 | Ga0157376_101791062 | 392 |
| 331 | 3300017792 | Ga0163161_10108419 | Ga0163161_101084192 | 392 |
| 332 | 3300025246 | Ga0209646_1002397 | Ga0209646_10023972 | 392 |
| 333 | 3300025909 | Ga0207705_10100159 | Ga0207705_101001592 | 392 |
| 334 | 3300025911 | Ga0207654_10009898 | Ga0207654_100098983 | 392 |
| 335 | 3300025911 | Ga0207654_10014620 | Ga0207654_100146203 | 392 |
| 336 | 3300025912 | Ga0207707_10084908 | Ga0207707_100849082 | 392 |
| 337 | 3300025913 | Ga0207695_10000425 | Ga0207695_1000042565 | 392 |
| 338 | 3300025919 | Ga0207657_10021296 | Ga0207657_100212961 | 392 |
| 339 | 3300025921 | Ga0207652_10014831 | Ga0207652_100148316 | 392 |
| 340 | 3300025921 | Ga0207652_10170711 | Ga0207652_101707111 | 392 |
| 341 | 3300025949 | Ga0207667_10004916 | Ga0207667_100049161 | 392 |
| 342 | 3300025949 | Ga0207667_10020765 | Ga0207667_100207654 | 392 |
| 343 | 3300025949 | Ga0207667_10064453 | Ga0207667_100644532 | 392 |
| 344 | 3300026041 | Ga0207639_10021022 | Ga0207639_100210225 | 392 |
| 345 | 3300026067 | Ga0207678_10040611 | Ga0207678_100406113 | 392 |
| 346 | 3300026078 | Ga0207702_10086312 | Ga0207702_100863124 | 392 |
| 347 | 3300026116 | Ga0207674_10123089 | Ga0207674_101230892 | 392 |
| 348 | 3300026142 | Ga0207698_10084196 | Ga0207698_100841962 | 392 |
| 349 | 3300028794 | Ga0307515_10000057 | Ga0307515_10000057109 | 392 |
| 350 | 3300031616 | Ga0307508_10001247 | Ga0307508_1000124723 | 392 |
| 351 | 3300031730 | Ga0307516_10002738 | Ga0307516_1000273811 | 392 |
| 352 | 3300035695 | Ga0373927_0019498 | Ga0373927_0019498_1244_2500 | 392 |
| 353 | 3300041404 | Ga0439436_0001903 | Ga0439436_0001903_2541_3797 | 392 |
| 354 | 3300041406 | Ga0439439_0013021 | Ga0439439_0013021_409_1665 | 392 |
| 355 | 3300044656 | Ga0466969_0000132 | Ga0466969_0000132_21898_23154 | 392 |
| 356 | 3300044658 | Ga0466972_0000095 | Ga0466972_0000095_43823_45079 | 392 |
| 357 | 3300044684 | Ga0466966_0000239 | Ga0466966_0000239_11780_13036 | 392 |
| 358 | 3300044712 | Ga0453684_0021683 | Ga0453684_0021683_3910_5106 | 392 |
| 359 | 3300044735 | Ga0466968_0009777 | Ga0466968_0009777_934_2190 | 392 |
| 360 | 3300044842 | Ga0466957_0007324 | Ga0466957_0007324_4145_5401 | 392 |
| 361 | 3300044842 | Ga0466957_0010280 | Ga0466957_0010280_859_2115 | 392 |
| 362 | 3300045049 | Ga0466959_0000031 | Ga0466959_0000031_4913_6169 | 392 |
| 363 | 3300046660 | Ga0495625_0044931 | Ga0495625_0044931_204_1466 | 392 |
| 364 | 3300046694 | Ga0495649_0063746 | Ga0495649_0063746_668_1930 | 392 |
| 365 | 3300047472 | Ga0495686_0051739 | Ga0495686_0051739_1083_2339 | 392 |
| 366 | 3300049686 | Ga0501257_012348 | Ga0501257_012348_181_1437 | 392 |
| 367 | 3300049705 | Ga0501225_0000589 | Ga0501225_0000589_6407_7663 | 392 |
| 368 | 3300050493 | nmdc:mga0k408_67998_c1 | nmdc:mga0k408_67998_c1_445_1758 | 392 |
| 369 | 3300050507 | nmdc:mga05p37_2260_c1 | nmdc:mga05p37_2260_c1_4833_6095 | 392 |
| 370 | 3300053146 | Ga0500588_0001353 | Ga0500588_0001353_743_2005 | 392 |
| 371 | 3300053727 | Ga0500611_000020 | Ga0500611_000020_7558_8814 | 392 |
| 372 | 3300061719 | Ga0466962_0055837 | Ga0466962_0055837_38_1294 | 392 |
| 373 | 3300001979 | JGI24740J21852_10000358 | JGI24740J21852_100003583 | 393 |
| 374 | 3300001989 | JGI24739J22299_10000433 | JGI24739J22299_100004332 | 393 |
| 375 | 3300002738 | JGI25154J39366_1000007 | JGI25154J39366_100000758 | 393 |
| 376 | 3300003215 | JGI25153J46596_10001828 | JGI25153J46596_100018289 | 393 |
| 377 | 3300003215 | JGI25153J46596_10018062 | JGI25153J46596_100180622 | 393 |
| 378 | 3300003320 | rootH2_10020884 | rootH2_100208842 | 393 |
| 379 | 3300003323 | rootH1_10046794 | rootH1_100467946 | 393 |
| 380 | 3300003354 | JGI25160J50197_1001383 | JGI25160J50197_100138310 | 393 |
| 381 | 3300003354 | JGI25160J50197_1011746 | JGI25160J50197_10117462 | 393 |
| 382 | 3300003354 | JGI25160J50197_1015956 | JGI25160J50197_10159562 | 393 |
| 383 | 3300003771 | Ga0055526_1011071 | Ga0055526_10110712 | 393 |
| 384 | 3300003790 | Ga0055528_1015931 | Ga0055528_10159312 | 393 |
| 385 | 3300003791 | Ga0055530_10001252 | Ga0055530_1000125218 | 393 |
| 386 | 3300003794 | Ga0055531_10031189 | Ga0055531_100311891 | 393 |
| 387 | 3300005262 | Ga0065165_1000010 | Ga0065165_1000010218 | 393 |
| 388 | 3300005262 | Ga0065165_1009228 | Ga0065165_10092284 | 393 |
| 389 | 3300013104 | Ga0157370_10027186 | Ga0157370_100271863 | 393 |
| 390 | 3300013306 | Ga0163162_10237579 | Ga0163162_102375792 | 393 |
| 391 | 3300015265 | Ga0182005_1000215 | Ga0182005_100021519 | 393 |
| 392 | 3300017792 | Ga0163161_10006822 | Ga0163161_100068223 | 393 |
| 393 | 3300025208 | Ga0209436_110381 | Ga0209436_1103812 | 393 |
| 394 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002664 | 393 |
| 395 | 3300025250 | Ga0209026_1000545 | Ga0209026_100054516 | 393 |
| 396 | 3300025273 | Ga0209673_1000082 | Ga0209673_1000082191 | 393 |
| 397 | 3300025284 | Ga0209130_1004066 | Ga0209130_10040664 | 393 |
| 398 | 3300025295 | Ga0209564_1002231 | Ga0209564_10022317 | 393 |
| 399 | 3300025297 | Ga0209758_1015206 | Ga0209758_10152062 | 393 |
| 400 | 3300025297 | Ga0209758_1039797 | Ga0209758_10397972 | 393 |
| 401 | 3300025298 | Ga0209050_1000389 | Ga0209050_100038933 | 393 |
| 402 | 3300025302 | Ga0207426_1000341 | Ga0207426_100034130 | 393 |
| 403 | 3300025302 | Ga0207426_1000951 | Ga0207426_10009517 | 393 |
| 404 | 3300025302 | Ga0207426_1002430 | Ga0207426_10024306 | 393 |
| 405 | 3300025302 | Ga0207426_1040618 | Ga0207426_10406181 | 393 |
| 406 | 3300025304 | Ga0209257_1003759 | Ga0209257_10037592 | 393 |
| 407 | 3300044842 | Ga0466957_0043397 | Ga0466957_0043397_826_2007 | 393 |
| 408 | 3300045049 | Ga0466959_0057953 | Ga0466959_0057953_658_1839 | 393 |
| 409 | 3300046507 | Ga0495606_0069818 | Ga0495606_0069818_492_1727 | 393 |
| 410 | 3300046522 | Ga0495643_0000392 | Ga0495643_0000392_30659_31903 | 393 |
| 411 | 3300046558 | Ga0495633_0000090 | Ga0495633_0000090_71989_73170 | 393 |
| 412 | 3300048924 | Ga0496121_0000020 | Ga0496121_0000020_342082_343263 | 393 |
| 413 | 3300049581 | Ga0501047_0064339 | Ga0501047_0064339_1993_3174 | 393 |
| 414 | iso_pu_bacteria | 2881955468 | 2881957182 | 393 |
| 415 | iso_pu_bacteria | 2965320100 | 2965323596 | 393 |
| 416 | 3300003761 | Ga0055535_1003112 | Ga0055535_10031125 | 394 |
| 417 | 3300005289 | Ga0065704_10073952 | Ga0065704_100739527 | 394 |
| 418 | 3300025242 | Ga0209258_102250 | Ga0209258_1022505 | 394 |
| 419 | 3300025254 | Ga0209148_1000283 | Ga0209148_100028370 | 394 |
| 420 | 3300048918 | Ga0496115_0037645 | Ga0496115_0037645_1213_2481 | 394 |
| 421 | 3300053088 | Ga0500644_0000279 | Ga0500644_0000279_11616_12800 | 394 |
| 422 | 3300053109 | Ga0500569_000815 | Ga0500569_000815_2096_3280 | 394 |
| 423 | 3300053134 | Ga0500658_0001824 | Ga0500658_0001824_6768_7952 | 394 |
| 424 | 3300053142 | Ga0500577_0000916 | Ga0500577_0000916_459_1643 | 394 |
| 425 | 3300053153 | Ga0500616_0061009 | Ga0500616_0061009_60_1244 | 394 |
| 426 | 3300053160 | Ga0500633_0006823 | Ga0500633_0006823_1408_2592 | 394 |
| 427 | 3300053177 | Ga0500636_0032081 | Ga0500636_0032081_976_2160 | 394 |
| 428 | iso_pu_bacteria | 2738541278 | 2738729013 | 394 |
| 429 | iso_pu_bacteria | 2818991444 | 2819587877 | 394 |
| 430 | iso_pu_bacteria | 2881247448 | 2881249428 | 394 |
| 431 | iso_pu_bacteria | 2914759650 | 2914762852 | 394 |
| 432 | iso_pu_bacteria | 2919509842 | 2919511006 | 394 |
| 433 | iso_pu_bacteria | 2929154850 | 2929158096 | 394 |
| 434 | iso_pu_bacteria | 2958512119 | 2958512782 | 394 |
| 435 | 3300013100 | Ga0157373_10001583 | Ga0157373_100015839 | 395 |
| 436 | 3300013102 | Ga0157371_10002691 | Ga0157371_100026912 | 395 |
| 437 | 3300013105 | Ga0157369_10124521 | Ga0157369_101245212 | 395 |
| 438 | 3300013307 | Ga0157372_10256260 | Ga0157372_102562602 | 395 |
| 439 | 3300037418 | Ga0395900_0011050 | Ga0395900_0011050_1467_2735 | 395 |
| 440 | 3300037466 | Ga0395898_0132518 | Ga0395898_0132518_941_2209 | 395 |
| 441 | 3300037471 | Ga0395905_0242968 | Ga0395905_0242968_210_1478 | 395 |
| 442 | 3300038443 | Ga0395901_0088589 | Ga0395901_0088589_774_2042 | 395 |
| 443 | 3300044712 | Ga0453684_0024881 | Ga0453684_0024881_6326_7513 | 395 |
| 444 | 2162886007 | SwRhRL2b_contig_1759593 | SwRhRL2b_0521.00009920 | 396 |
| 445 | 3300003322 | rootL2_10022865 | rootL2_100228654 | 396 |
| 446 | 3300003322 | rootL2_10140272 | rootL2_101402725 | 396 |
| 447 | 3300003794 | Ga0055531_10000020 | Ga0055531_1000002078 | 396 |
| 448 | 3300005289 | Ga0065704_10070133 | Ga0065704_10070133209 | 396 |
| 449 | 3300005329 | Ga0070683_100003744 | Ga0070683_1000037447 | 396 |
| 450 | 3300005366 | Ga0070659_100010931 | Ga0070659_1000109315 | 396 |
| 451 | 3300005367 | Ga0070667_100108956 | Ga0070667_1001089562 | 396 |
| 452 | 3300005616 | Ga0068852_100175196 | Ga0068852_1001751962 | 396 |
| 453 | 3300005843 | Ga0068860_100011810 | Ga0068860_1000118107 | 396 |
| 454 | 3300006358 | Ga0068871_100024719 | Ga0068871_1000247192 | 396 |
| 455 | 3300010375 | Ga0105239_10016636 | Ga0105239_100166367 | 396 |
| 456 | 3300013100 | Ga0157373_10089780 | Ga0157373_100897802 | 396 |
| 457 | 3300013102 | Ga0157371_10044799 | Ga0157371_100447992 | 396 |
| 458 | 3300013105 | Ga0157369_10288447 | Ga0157369_102884472 | 396 |
| 459 | 3300013306 | Ga0163162_10002755 | Ga0163162_100027558 | 396 |
| 460 | 3300013306 | Ga0163162_10222422 | Ga0163162_102224222 | 396 |
| 461 | 3300013307 | Ga0157372_10007453 | Ga0157372_100074537 | 396 |
| 462 | 3300014325 | Ga0163163_10012527 | Ga0163163_100125272 | 396 |
| 463 | 3300017792 | Ga0163161_10042807 | Ga0163161_100428073 | 396 |
| 464 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011306 | 396 |
| 465 | 3300025904 | Ga0207647_10000485 | Ga0207647_1000048510 | 396 |
| 466 | 3300025920 | Ga0207649_10090252 | Ga0207649_100902522 | 396 |
| 467 | 3300025944 | Ga0207661_10023880 | Ga0207661_100238803 | 396 |
| 468 | 3300025945 | Ga0207679_10013842 | Ga0207679_100138423 | 396 |
| 469 | 3300026142 | Ga0207698_10127667 | Ga0207698_101276672 | 396 |
| 470 | 3300028381 | Ga0268264_10027215 | Ga0268264_100272151 | 396 |
| 471 | 3300028381 | Ga0268264_10027753 | Ga0268264_100277534 | 396 |
| 472 | 3300031235 | Ga0265330_10000013 | Ga0265330_1000001389 | 396 |
| 473 | 3300031238 | Ga0265332_10000019 | Ga0265332_1000001973 | 396 |
| 474 | 3300031239 | Ga0265328_10004579 | Ga0265328_100045794 | 396 |
| 475 | 3300031240 | Ga0265320_10008899 | Ga0265320_100088992 | 396 |
| 476 | 3300031241 | Ga0265325_10008789 | Ga0265325_100087894 | 396 |
| 477 | 3300031242 | Ga0265329_10004580 | Ga0265329_100045804 | 396 |
| 478 | 3300031249 | Ga0265339_10023126 | Ga0265339_100231262 | 396 |
| 479 | 3300031251 | Ga0265327_10000006 | Ga0265327_10000006102 | 396 |
| 480 | 3300031251 | Ga0265327_10000046 | Ga0265327_10000046142 | 396 |
| 481 | 3300031344 | Ga0265316_10000111 | Ga0265316_1000011113 | 396 |
| 482 | 3300031711 | Ga0265314_10000004 | Ga0265314_10000004458 | 396 |
| 483 | 3300031712 | Ga0265342_10000017 | Ga0265342_1000001763 | 396 |
| 484 | 3300032004 | Ga0307414_10072314 | Ga0307414_100723142 | 396 |
| 485 | 3300037471 | Ga0395905_0116178 | Ga0395905_0116178_179_1438 | 396 |
| 486 | 3300044712 | Ga0453684_0041437 | Ga0453684_0041437_4076_5335 | 396 |
| 487 | 3300048917 | Ga0496114_0002926 | Ga0496114_0002926_9967_11217 | 396 |
| 488 | 3300048929 | Ga0496126_0031463 | Ga0496126_0031463_3584_4780 | 396 |
| 489 | 3300049579 | Ga0501043_0087724 | Ga0501043_0087724_531_1790 | 396 |
| 490 | 3300049758 | Ga0501241_000384 | Ga0501241_000384_95_1291 | 396 |
| 491 | 3300049822 | Ga0501035_0095205 | Ga0501035_0095205_1262_2518 | 396 |
| 492 | 3300049823 | Ga0501044_0171853 | Ga0501044_0171853_71_1327 | 396 |
| 493 | 3300053156 | Ga0500622_0000488 | Ga0500622_0000488_3074_4270 | 396 |
| 494 | 3300001979 | JGI24740J21852_10037900 | JGI24740J21852_100379001 | 397 |
| 495 | 3300002459 | JGI24751J29686_10002215 | JGI24751J29686_100022153 | 397 |
| 496 | 3300003203 | JGI25406J46586_10004160 | JGI25406J46586_100041605 | 397 |
| 497 | 3300003323 | rootH1_10135802 | rootH1_101358024 | 397 |
| 498 | 3300003354 | JGI25160J50197_1003564 | JGI25160J50197_10035642 | 397 |
| 499 | 3300005288 | Ga0065714_10017635 | Ga0065714_100176352 | 397 |
| 500 | 3300005290 | Ga0065712_10007993 | Ga0065712_100079932 | 397 |
| 501 | 3300005293 | Ga0065715_10093864 | Ga0065715_100938642 | 397 |
| 502 | 3300005327 | Ga0070658_10058958 | Ga0070658_100589582 | 397 |
| 503 | 3300005327 | Ga0070658_10075475 | Ga0070658_100754754 | 397 |
| 504 | 3300005327 | Ga0070658_10214036 | Ga0070658_102140362 | 397 |
| 505 | 3300005328 | Ga0070676_10004661 | Ga0070676_100046614 | 397 |
| 506 | 3300005329 | Ga0070683_100018837 | Ga0070683_1000188372 | 397 |
| 507 | 3300005329 | Ga0070683_100020019 | Ga0070683_1000200193 | 397 |
| 508 | 3300005330 | Ga0070690_100032271 | Ga0070690_1000322713 | 397 |
| 509 | 3300005330 | Ga0070690_100112891 | Ga0070690_1001128912 | 397 |
| 510 | 3300005331 | Ga0070670_100059185 | Ga0070670_1000591852 | 397 |
| 511 | 3300005331 | Ga0070670_100297706 | Ga0070670_1002977061 | 397 |
| 512 | 3300005334 | Ga0068869_100002681 | Ga0068869_1000026813 | 397 |
| 513 | 3300005334 | Ga0068869_100009889 | Ga0068869_1000098892 | 397 |
| 514 | 3300005334 | Ga0068869_100016541 | Ga0068869_1000165416 | 397 |
| 515 | 3300005334 | Ga0068869_100186944 | Ga0068869_1001869442 | 397 |
| 516 | 3300005335 | Ga0070666_10030778 | Ga0070666_100307781 | 397 |
| 517 | 3300005335 | Ga0070666_10095753 | Ga0070666_100957532 | 397 |
| 518 | 3300005336 | Ga0070680_100163013 | Ga0070680_1001630132 | 397 |
| 519 | 3300005337 | Ga0070682_100000018 | Ga0070682_10000001822 | 397 |
| 520 | 3300005337 | Ga0070682_100072253 | Ga0070682_1000722532 | 397 |
| 521 | 3300005338 | Ga0068868_100063499 | Ga0068868_1000634992 | 397 |
| 522 | 3300005338 | Ga0068868_100107795 | Ga0068868_1001077952 | 397 |
| 523 | 3300005339 | Ga0070660_100001278 | Ga0070660_1000012788 | 397 |
| 524 | 3300005339 | Ga0070660_100005738 | Ga0070660_1000057385 | 397 |
| 525 | 3300005339 | Ga0070660_100041472 | Ga0070660_1000414723 | 397 |
| 526 | 3300005339 | Ga0070660_100067403 | Ga0070660_1000674032 | 397 |
| 527 | 3300005340 | Ga0070689_100035493 | Ga0070689_1000354932 | 397 |
| 528 | 3300005340 | Ga0070689_100088598 | Ga0070689_1000885983 | 397 |
| 529 | 3300005344 | Ga0070661_100018952 | Ga0070661_1000189524 | 397 |
| 530 | 3300005347 | Ga0070668_100008170 | Ga0070668_1000081704 | 397 |
| 531 | 3300005353 | Ga0070669_100017590 | Ga0070669_1000175903 | 397 |
| 532 | 3300005353 | Ga0070669_100074842 | Ga0070669_1000748423 | 397 |
| 533 | 3300005353 | Ga0070669_100166113 | Ga0070669_1001661132 | 397 |
| 534 | 3300005354 | Ga0070675_100016579 | Ga0070675_1000165792 | 397 |
| 535 | 3300005354 | Ga0070675_100323480 | Ga0070675_1003234801 | 397 |
| 536 | 3300005355 | Ga0070671_100017404 | Ga0070671_1000174042 | 397 |
| 537 | 3300005355 | Ga0070671_100100027 | Ga0070671_1001000272 | 397 |
| 538 | 3300005356 | Ga0070674_100053564 | Ga0070674_1000535642 | 397 |
| 539 | 3300005364 | Ga0070673_100034796 | Ga0070673_1000347961 | 397 |
| 540 | 3300005364 | Ga0070673_100049925 | Ga0070673_1000499251 | 397 |
| 541 | 3300005364 | Ga0070673_100062303 | Ga0070673_1000623032 | 397 |
| 542 | 3300005364 | Ga0070673_100089685 | Ga0070673_1000896852 | 397 |
| 543 | 3300005364 | Ga0070673_100177729 | Ga0070673_1001777292 | 397 |
| 544 | 3300005365 | Ga0070688_100007595 | Ga0070688_1000075956 | 397 |
| 545 | 3300005366 | Ga0070659_100002027 | Ga0070659_1000020272 | 397 |
| 546 | 3300005366 | Ga0070659_100005677 | Ga0070659_1000056772 | 397 |
| 547 | 3300005366 | Ga0070659_100081983 | Ga0070659_1000819832 | 397 |
| 548 | 3300005366 | Ga0070659_100167753 | Ga0070659_1001677532 | 397 |
| 549 | 3300005367 | Ga0070667_100012604 | Ga0070667_1000126043 | 397 |
| 550 | 3300005367 | Ga0070667_100053963 | Ga0070667_1000539633 | 397 |
| 551 | 3300005367 | Ga0070667_100103445 | Ga0070667_1001034452 | 397 |
| 552 | 3300005367 | Ga0070667_100112696 | Ga0070667_1001126962 | 397 |
| 553 | 3300005438 | Ga0070701_10006632 | Ga0070701_100066323 | 397 |
| 554 | 3300005455 | Ga0070663_100089989 | Ga0070663_1000899892 | 397 |
| 555 | 3300005456 | Ga0070678_100088451 | Ga0070678_1000884513 | 397 |
| 556 | 3300005456 | Ga0070678_100208121 | Ga0070678_1002081212 | 397 |
| 557 | 3300005457 | Ga0070662_100004967 | Ga0070662_1000049674 | 397 |
| 558 | 3300005457 | Ga0070662_100007145 | Ga0070662_1000071455 | 397 |
| 559 | 3300005457 | Ga0070662_100111416 | Ga0070662_1001114162 | 397 |
| 560 | 3300005458 | Ga0070681_10032814 | Ga0070681_100328146 | 397 |
| 561 | 3300005458 | Ga0070681_10074057 | Ga0070681_100740573 | 397 |
| 562 | 3300005459 | Ga0068867_100059343 | Ga0068867_1000593432 | 397 |
| 563 | 3300005466 | Ga0070685_10024229 | Ga0070685_100242292 | 397 |
| 564 | 3300005466 | Ga0070685_10069976 | Ga0070685_100699762 | 397 |
| 565 | 3300005471 | Ga0070698_100003400 | Ga0070698_1000034006 | 397 |
| 566 | 3300005530 | Ga0070679_100001044 | Ga0070679_1000010446 | 397 |
| 567 | 3300005530 | Ga0070679_100004008 | Ga0070679_1000040083 | 397 |
| 568 | 3300005530 | Ga0070679_100073106 | Ga0070679_1000731063 | 397 |
| 569 | 3300005530 | Ga0070679_100157594 | Ga0070679_1001575941 | 397 |
| 570 | 3300005535 | Ga0070684_100012432 | Ga0070684_1000124325 | 397 |
| 571 | 3300005535 | Ga0070684_100061868 | Ga0070684_1000618682 | 397 |
| 572 | 3300005535 | Ga0070684_100120096 | Ga0070684_1001200962 | 397 |
| 573 | 3300005539 | Ga0068853_100022502 | Ga0068853_1000225023 | 397 |
| 574 | 3300005539 | Ga0068853_100044640 | Ga0068853_1000446402 | 397 |
| 575 | 3300005543 | Ga0070672_100001603 | Ga0070672_10000160312 | 397 |
| 576 | 3300005543 | Ga0070672_100214597 | Ga0070672_1002145971 | 397 |
| 577 | 3300005547 | Ga0070693_100050821 | Ga0070693_1000508212 | 397 |
| 578 | 3300005548 | Ga0070665_100003504 | Ga0070665_1000035045 | 397 |
| 579 | 3300005548 | Ga0070665_100114404 | Ga0070665_1001144042 | 397 |
| 580 | 3300005549 | Ga0070704_100025018 | Ga0070704_1000250181 | 397 |
| 581 | 3300005563 | Ga0068855_100000329 | Ga0068855_10000032937 | 397 |
| 582 | 3300005563 | Ga0068855_100013158 | Ga0068855_10001315812 | 397 |
| 583 | 3300005563 | Ga0068855_100013953 | Ga0068855_1000139535 | 397 |
| 584 | 3300005563 | Ga0068855_100017499 | Ga0068855_1000174995 | 397 |
| 585 | 3300005563 | Ga0068855_100108409 | Ga0068855_1001084094 | 397 |
| 586 | 3300005564 | Ga0070664_100026666 | Ga0070664_1000266663 | 397 |
| 587 | 3300005564 | Ga0070664_100031978 | Ga0070664_1000319783 | 397 |
| 588 | 3300005564 | Ga0070664_100067420 | Ga0070664_1000674202 | 397 |
| 589 | 3300005564 | Ga0070664_100346098 | Ga0070664_1003460981 | 397 |
| 590 | 3300005577 | Ga0068857_100022205 | Ga0068857_1000222056 | 397 |
| 591 | 3300005577 | Ga0068857_100130731 | Ga0068857_1001307312 | 397 |
| 592 | 3300005578 | Ga0068854_100006808 | Ga0068854_1000068082 | 397 |
| 593 | 3300005614 | Ga0068856_100034788 | Ga0068856_1000347882 | 397 |
| 594 | 3300005615 | Ga0070702_100046856 | Ga0070702_1000468562 | 397 |
| 595 | 3300005616 | Ga0068852_100008807 | Ga0068852_1000088076 | 397 |
| 596 | 3300005616 | Ga0068852_100015602 | Ga0068852_1000156024 | 397 |
| 597 | 3300005616 | Ga0068852_100138617 | Ga0068852_1001386172 | 397 |
| 598 | 3300005616 | Ga0068852_100184164 | Ga0068852_1001841642 | 397 |
| 599 | 3300005617 | Ga0068859_100000023 | Ga0068859_10000002399 | 397 |
| 600 | 3300005617 | Ga0068859_100000859 | Ga0068859_10000085930 | 397 |
| 601 | 3300005617 | Ga0068859_100020142 | Ga0068859_1000201425 | 397 |
| 602 | 3300005617 | Ga0068859_100134287 | Ga0068859_1001342873 | 397 |
| 603 | 3300005618 | Ga0068864_100009349 | Ga0068864_1000093497 | 397 |
| 604 | 3300005718 | Ga0068866_10017119 | Ga0068866_100171192 | 397 |
| 605 | 3300005718 | Ga0068866_10040962 | Ga0068866_100409622 | 397 |
| 606 | 3300005719 | Ga0068861_100047027 | Ga0068861_1000470272 | 397 |
| 607 | 3300005719 | Ga0068861_100059398 | Ga0068861_1000593983 | 397 |
| 608 | 3300005834 | Ga0068851_10002822 | Ga0068851_100028224 | 397 |
| 609 | 3300005834 | Ga0068851_10053510 | Ga0068851_100535102 | 397 |
| 610 | 3300005840 | Ga0068870_10030301 | Ga0068870_100303012 | 397 |
| 611 | 3300005840 | Ga0068870_10041365 | Ga0068870_100413652 | 397 |
| 612 | 3300005841 | Ga0068863_100000424 | Ga0068863_10000042440 | 397 |
| 613 | 3300005841 | Ga0068863_100065852 | Ga0068863_1000658523 | 397 |
| 614 | 3300005841 | Ga0068863_100193970 | Ga0068863_1001939701 | 397 |
| 615 | 3300005841 | Ga0068863_100306769 | Ga0068863_1003067691 | 397 |
| 616 | 3300005843 | Ga0068860_100001384 | Ga0068860_1000013849 | 397 |
| 617 | 3300005843 | Ga0068860_100013541 | Ga0068860_1000135414 | 397 |
| 618 | 3300005843 | Ga0068860_100015628 | Ga0068860_1000156281 | 397 |
| 619 | 3300005843 | Ga0068860_100024851 | Ga0068860_1000248513 | 397 |
| 620 | 3300005843 | Ga0068860_100153902 | Ga0068860_1001539022 | 397 |
| 621 | 3300005844 | Ga0068862_100004782 | Ga0068862_1000047825 | 397 |
| 622 | 3300005985 | Ga0081539_10001000 | Ga0081539_1000100016 | 397 |
| 623 | 3300006173 | Ga0070716_100103258 | Ga0070716_1001032582 | 397 |
| 624 | 3300006237 | Ga0097621_100028199 | Ga0097621_1000281992 | 397 |
| 625 | 3300006237 | Ga0097621_100078691 | Ga0097621_1000786912 | 397 |
| 626 | 3300006237 | Ga0097621_100114598 | Ga0097621_1001145982 | 397 |
| 627 | 3300006237 | Ga0097621_100119702 | Ga0097621_1001197023 | 397 |
| 628 | 3300006237 | Ga0097621_100259683 | Ga0097621_1002596831 | 397 |
| 629 | 3300006358 | Ga0068871_100097088 | Ga0068871_1000970881 | 397 |
| 630 | 3300006844 | Ga0075428_100006657 | Ga0075428_1000066574 | 397 |
| 631 | 3300006844 | Ga0075428_100079725 | Ga0075428_1000797253 | 397 |
| 632 | 3300006846 | Ga0075430_100029748 | Ga0075430_1000297483 | 397 |
| 633 | 3300006847 | Ga0075431_100032992 | Ga0075431_1000329922 | 397 |
| 634 | 3300006847 | Ga0075431_100165692 | Ga0075431_1001656922 | 397 |
| 635 | 3300006880 | Ga0075429_100006669 | Ga0075429_1000066698 | 397 |
| 636 | 3300006881 | Ga0068865_100008569 | Ga0068865_1000085695 | 397 |
| 637 | 3300006881 | Ga0068865_100098462 | Ga0068865_1000984622 | 397 |
| 638 | 3300006881 | Ga0068865_100211413 | Ga0068865_1002114131 | 397 |
| 639 | 3300006931 | Ga0097620_100000023 | Ga0097620_10000002399 | 397 |
| 640 | 3300006931 | Ga0097620_100000859 | Ga0097620_10000085930 | 397 |
| 641 | 3300006931 | Ga0097620_100020142 | Ga0097620_1000201425 | 397 |
| 642 | 3300006931 | Ga0097620_100134284 | Ga0097620_1001342843 | 397 |
| 643 | 3300009093 | Ga0105240_10000011 | Ga0105240_10000011163 | 397 |
| 644 | 3300009093 | Ga0105240_10016269 | Ga0105240_100162692 | 397 |
| 645 | 3300009093 | Ga0105240_10182785 | Ga0105240_101827852 | 397 |
| 646 | 3300009098 | Ga0105245_10317179 | Ga0105245_103171792 | 397 |
| 647 | 3300009101 | Ga0105247_10024168 | Ga0105247_100241682 | 397 |
| 648 | 3300009147 | Ga0114129_10182219 | Ga0114129_101822192 | 397 |
| 649 | 3300009147 | Ga0114129_10206848 | Ga0114129_102068483 | 397 |
| 650 | 3300009174 | Ga0105241_10000861 | Ga0105241_1000086112 | 397 |
| 651 | 3300009176 | Ga0105242_10005203 | Ga0105242_100052036 | 397 |
| 652 | 3300009176 | Ga0105242_10035959 | Ga0105242_100359592 | 397 |
| 653 | 3300009176 | Ga0105242_10066012 | Ga0105242_100660122 | 397 |
| 654 | 3300009176 | Ga0105242_10094343 | Ga0105242_100943432 | 397 |
| 655 | 3300009176 | Ga0105242_10257862 | Ga0105242_102578621 | 397 |
| 656 | 3300009545 | Ga0105237_10001750 | Ga0105237_100017508 | 397 |
| 657 | 3300009553 | Ga0105249_10002885 | Ga0105249_1000288512 | 397 |
| 658 | 3300009553 | Ga0105249_10008554 | Ga0105249_100085545 | 397 |
| 659 | 3300009553 | Ga0105249_10010023 | Ga0105249_100100235 | 397 |
| 660 | 3300009553 | Ga0105249_10019818 | Ga0105249_100198183 | 397 |
| 661 | 3300009553 | Ga0105249_10025260 | Ga0105249_100252602 | 397 |
| 662 | 3300010375 | Ga0105239_10000052 | Ga0105239_10000052152 | 397 |
| 663 | 3300010375 | Ga0105239_10103105 | Ga0105239_101031054 | 397 |
| 664 | 3300010375 | Ga0105239_10121663 | Ga0105239_101216632 | 397 |
| 665 | 3300010375 | Ga0105239_10180254 | Ga0105239_101802541 | 397 |
| 666 | 3300011119 | Ga0105246_10000127 | Ga0105246_1000012711 | 397 |
| 667 | 3300011119 | Ga0105246_10007561 | Ga0105246_100075611 | 397 |
| 668 | 3300011119 | Ga0105246_10099983 | Ga0105246_100999832 | 397 |
| 669 | 3300013100 | Ga0157373_10135784 | Ga0157373_101357842 | 397 |
| 670 | 3300013100 | Ga0157373_10161231 | Ga0157373_101612311 | 397 |
| 671 | 3300013102 | Ga0157371_10000874 | Ga0157371_100008741 | 397 |
| 672 | 3300013102 | Ga0157371_10003885 | Ga0157371_100038859 | 397 |
| 673 | 3300013102 | Ga0157371_10012057 | Ga0157371_100120574 | 397 |
| 674 | 3300013102 | Ga0157371_10014455 | Ga0157371_100144554 | 397 |
| 675 | 3300013102 | Ga0157371_10015537 | Ga0157371_100155375 | 397 |
| 676 | 3300013102 | Ga0157371_10026427 | Ga0157371_100264273 | 397 |
| 677 | 3300013102 | Ga0157371_10031082 | Ga0157371_100310822 | 397 |
| 678 | 3300013102 | Ga0157371_10116551 | Ga0157371_101165512 | 397 |
| 679 | 3300013102 | Ga0157371_10153838 | Ga0157371_101538382 | 397 |
| 680 | 3300013104 | Ga0157370_10017466 | Ga0157370_100174666 | 397 |
| 681 | 3300013104 | Ga0157370_10103180 | Ga0157370_101031802 | 397 |
| 682 | 3300013104 | Ga0157370_10175087 | Ga0157370_101750872 | 397 |
| 683 | 3300013105 | Ga0157369_10016571 | Ga0157369_100165716 | 397 |
| 684 | 3300013105 | Ga0157369_10066270 | Ga0157369_100662702 | 397 |
| 685 | 3300013296 | Ga0157374_10017972 | Ga0157374_100179723 | 397 |
| 686 | 3300013296 | Ga0157374_10050185 | Ga0157374_100501852 | 397 |
| 687 | 3300013296 | Ga0157374_10050987 | Ga0157374_100509873 | 397 |
| 688 | 3300013296 | Ga0157374_10071492 | Ga0157374_100714923 | 397 |
| 689 | 3300013296 | Ga0157374_10152858 | Ga0157374_101528582 | 397 |
| 690 | 3300013296 | Ga0157374_10311262 | Ga0157374_103112621 | 397 |
| 691 | 3300013297 | Ga0157378_10003896 | Ga0157378_100038969 | 397 |
| 692 | 3300013297 | Ga0157378_10005272 | Ga0157378_100052725 | 397 |
| 693 | 3300013297 | Ga0157378_10025456 | Ga0157378_100254563 | 397 |
| 694 | 3300013297 | Ga0157378_10044912 | Ga0157378_100449123 | 397 |
| 695 | 3300013297 | Ga0157378_10175156 | Ga0157378_101751562 | 397 |
| 696 | 3300013297 | Ga0157378_10284351 | Ga0157378_102843512 | 397 |
| 697 | 3300013306 | Ga0163162_10000373 | Ga0163162_1000037319 | 397 |
| 698 | 3300013306 | Ga0163162_10287102 | Ga0163162_102871021 | 397 |
| 699 | 3300013307 | Ga0157372_10004620 | Ga0157372_100046206 | 397 |
| 700 | 3300013307 | Ga0157372_10016144 | Ga0157372_100161444 | 397 |
| 701 | 3300013307 | Ga0157372_10032100 | Ga0157372_100321003 | 397 |
| 702 | 3300013307 | Ga0157372_10046886 | Ga0157372_100468865 | 397 |
| 703 | 3300013307 | Ga0157372_10050674 | Ga0157372_100506745 | 397 |
| 704 | 3300013307 | Ga0157372_10061020 | Ga0157372_100610202 | 397 |
| 705 | 3300013307 | Ga0157372_10147340 | Ga0157372_101473402 | 397 |
| 706 | 3300013307 | Ga0157372_10172947 | Ga0157372_101729472 | 397 |
| 707 | 3300013307 | Ga0157372_10434942 | Ga0157372_104349422 | 397 |
| 708 | 3300013307 | Ga0157372_10465252 | Ga0157372_104652521 | 397 |
| 709 | 3300013308 | Ga0157375_10129843 | Ga0157375_101298432 | 397 |
| 710 | 3300013308 | Ga0157375_10155632 | Ga0157375_101556323 | 397 |
| 711 | 3300013308 | Ga0157375_10169648 | Ga0157375_101696482 | 397 |
| 712 | 3300013308 | Ga0157375_10281391 | Ga0157375_102813911 | 397 |
| 713 | 3300014325 | Ga0163163_10002603 | Ga0163163_1000260312 | 397 |
| 714 | 3300014326 | Ga0157380_10035702 | Ga0157380_100357024 | 397 |
| 715 | 3300014326 | Ga0157380_10098766 | Ga0157380_100987662 | 397 |
| 716 | 3300014326 | Ga0157380_10126642 | Ga0157380_101266422 | 397 |
| 717 | 3300014326 | Ga0157380_10190663 | Ga0157380_101906632 | 397 |
| 718 | 3300014745 | Ga0157377_10030917 | Ga0157377_100309172 | 397 |
| 719 | 3300014745 | Ga0157377_10035061 | Ga0157377_100350612 | 397 |
| 720 | 3300014745 | Ga0157377_10073216 | Ga0157377_100732162 | 397 |
| 721 | 3300014968 | Ga0157379_10034273 | Ga0157379_100342734 | 397 |
| 722 | 3300014968 | Ga0157379_10149386 | Ga0157379_101493862 | 397 |
| 723 | 3300014969 | Ga0157376_10002437 | Ga0157376_100024372 | 397 |
| 724 | 3300014969 | Ga0157376_10113436 | Ga0157376_101134361 | 397 |
| 725 | 3300017792 | Ga0163161_10030521 | Ga0163161_100305213 | 397 |
| 726 | 3300025302 | Ga0207426_1000040 | Ga0207426_1000040133 | 397 |
| 727 | 3300025321 | Ga0207656_10039892 | Ga0207656_100398921 | 397 |
| 728 | 3300025893 | Ga0207682_10013516 | Ga0207682_100135162 | 397 |
| 729 | 3300025900 | Ga0207710_10034808 | Ga0207710_100348082 | 397 |
| 730 | 3300025903 | Ga0207680_10107618 | Ga0207680_101076182 | 397 |
| 731 | 3300025904 | Ga0207647_10000139 | Ga0207647_100001395 | 397 |
| 732 | 3300025904 | Ga0207647_10038075 | Ga0207647_100380752 | 397 |
| 733 | 3300025904 | Ga0207647_10083236 | Ga0207647_100832362 | 397 |
| 734 | 3300025907 | Ga0207645_10000093 | Ga0207645_100000935 | 397 |
| 735 | 3300025907 | Ga0207645_10045019 | Ga0207645_100450192 | 397 |
| 736 | 3300025908 | Ga0207643_10003399 | Ga0207643_100033992 | 397 |
| 737 | 3300025909 | Ga0207705_10007859 | Ga0207705_100078595 | 397 |
| 738 | 3300025909 | Ga0207705_10014478 | Ga0207705_100144786 | 397 |
| 739 | 3300025909 | Ga0207705_10097990 | Ga0207705_100979902 | 397 |
| 740 | 3300025912 | Ga0207707_10173295 | Ga0207707_101732951 | 397 |
| 741 | 3300025912 | Ga0207707_10219642 | Ga0207707_102196421 | 397 |
| 742 | 3300025913 | Ga0207695_10000010 | Ga0207695_10000010552 | 397 |
| 743 | 3300025913 | Ga0207695_10013688 | Ga0207695_100136885 | 397 |
| 744 | 3300025914 | Ga0207671_10001864 | Ga0207671_100018648 | 397 |
| 745 | 3300025914 | Ga0207671_10033040 | Ga0207671_100330402 | 397 |
| 746 | 3300025914 | Ga0207671_10068398 | Ga0207671_100683982 | 397 |
| 747 | 3300025917 | Ga0207660_10023446 | Ga0207660_100234466 | 397 |
| 748 | 3300025917 | Ga0207660_10034825 | Ga0207660_100348254 | 397 |
| 749 | 3300025917 | Ga0207660_10141570 | Ga0207660_101415702 | 397 |
| 750 | 3300025918 | Ga0207662_10004373 | Ga0207662_100043735 | 397 |
| 751 | 3300025919 | Ga0207657_10002529 | Ga0207657_100025298 | 397 |
| 752 | 3300025919 | Ga0207657_10008447 | Ga0207657_100084475 | 397 |
| 753 | 3300025919 | Ga0207657_10025251 | Ga0207657_100252513 | 397 |
| 754 | 3300025919 | Ga0207657_10106366 | Ga0207657_101063662 | 397 |
| 755 | 3300025919 | Ga0207657_10125502 | Ga0207657_101255022 | 397 |
| 756 | 3300025921 | Ga0207652_10000051 | Ga0207652_1000005137 | 397 |
| 757 | 3300025921 | Ga0207652_10000770 | Ga0207652_1000077024 | 397 |
| 758 | 3300025921 | Ga0207652_10253698 | Ga0207652_102536981 | 397 |
| 759 | 3300025923 | Ga0207681_10046890 | Ga0207681_100468902 | 397 |
| 760 | 3300025923 | Ga0207681_10204681 | Ga0207681_102046812 | 397 |
| 761 | 3300025925 | Ga0207650_10011838 | Ga0207650_100118382 | 397 |
| 762 | 3300025925 | Ga0207650_10168551 | Ga0207650_101685511 | 397 |
| 763 | 3300025926 | Ga0207659_10027614 | Ga0207659_100276143 | 397 |
| 764 | 3300025926 | Ga0207659_10058149 | Ga0207659_100581492 | 397 |
| 765 | 3300025931 | Ga0207644_10039114 | Ga0207644_100391142 | 397 |
| 766 | 3300025932 | Ga0207690_10043628 | Ga0207690_100436282 | 397 |
| 767 | 3300025933 | Ga0207706_10131229 | Ga0207706_101312292 | 397 |
| 768 | 3300025934 | Ga0207686_10002397 | Ga0207686_100023972 | 397 |
| 769 | 3300025934 | Ga0207686_10106606 | Ga0207686_101066062 | 397 |
| 770 | 3300025936 | Ga0207670_10061498 | Ga0207670_100614981 | 397 |
| 771 | 3300025936 | Ga0207670_10170353 | Ga0207670_101703532 | 397 |
| 772 | 3300025937 | Ga0207669_10029661 | Ga0207669_100296612 | 397 |
| 773 | 3300025940 | Ga0207691_10000426 | Ga0207691_100004266 | 397 |
| 774 | 3300025940 | Ga0207691_10003790 | Ga0207691_100037903 | 397 |
| 775 | 3300025940 | Ga0207691_10007792 | Ga0207691_100077928 | 397 |
| 776 | 3300025940 | Ga0207691_10024512 | Ga0207691_100245122 | 397 |
| 777 | 3300025942 | Ga0207689_10005494 | Ga0207689_100054941 | 397 |
| 778 | 3300025942 | Ga0207689_10006819 | Ga0207689_100068194 | 397 |
| 779 | 3300025942 | Ga0207689_10012253 | Ga0207689_100122535 | 397 |
| 780 | 3300025942 | Ga0207689_10031011 | Ga0207689_100310112 | 397 |
| 781 | 3300025942 | Ga0207689_10033385 | Ga0207689_100333854 | 397 |
| 782 | 3300025944 | Ga0207661_10009778 | Ga0207661_100097784 | 397 |
| 783 | 3300025944 | Ga0207661_10020079 | Ga0207661_100200793 | 397 |
| 784 | 3300025944 | Ga0207661_10055866 | Ga0207661_100558662 | 397 |
| 785 | 3300025945 | Ga0207679_10077602 | Ga0207679_100776022 | 397 |
| 786 | 3300025949 | Ga0207667_10026416 | Ga0207667_100264164 | 397 |
| 787 | 3300025949 | Ga0207667_10040176 | Ga0207667_100401765 | 397 |
| 788 | 3300025949 | Ga0207667_10142548 | Ga0207667_101425481 | 397 |
| 789 | 3300025949 | Ga0207667_10177385 | Ga0207667_101773852 | 397 |
| 790 | 3300025960 | Ga0207651_10160551 | Ga0207651_101605511 | 397 |
| 791 | 3300025960 | Ga0207651_10223247 | Ga0207651_102232472 | 397 |
| 792 | 3300025961 | Ga0207712_10001684 | Ga0207712_1000168412 | 397 |
| 793 | 3300025961 | Ga0207712_10016183 | Ga0207712_100161833 | 397 |
| 794 | 3300025972 | Ga0207668_10001372 | Ga0207668_1000137212 | 397 |
| 795 | 3300025972 | Ga0207668_10090396 | Ga0207668_100903962 | 397 |
| 796 | 3300025981 | Ga0207640_10146916 | Ga0207640_101469162 | 397 |
| 797 | 3300025986 | Ga0207658_10082255 | Ga0207658_100822552 | 397 |
| 798 | 3300026023 | Ga0207677_10143755 | Ga0207677_101437552 | 397 |
| 799 | 3300026023 | Ga0207677_10197704 | Ga0207677_101977041 | 397 |
| 800 | 3300026023 | Ga0207677_10256903 | Ga0207677_102569031 | 397 |
| 801 | 3300026035 | Ga0207703_10008491 | Ga0207703_100084913 | 397 |
| 802 | 3300026041 | Ga0207639_10015801 | Ga0207639_100158015 | 397 |
| 803 | 3300026041 | Ga0207639_10041256 | Ga0207639_100412562 | 397 |
| 804 | 3300026041 | Ga0207639_10068456 | Ga0207639_100684563 | 397 |
| 805 | 3300026041 | Ga0207639_10214078 | Ga0207639_102140781 | 397 |
| 806 | 3300026041 | Ga0207639_10236119 | Ga0207639_102361191 | 397 |
| 807 | 3300026078 | Ga0207702_10038469 | Ga0207702_100384692 | 397 |
| 808 | 3300026088 | Ga0207641_10000250 | Ga0207641_1000025055 | 397 |
| 809 | 3300026088 | Ga0207641_10003419 | Ga0207641_100034192 | 397 |
| 810 | 3300026088 | Ga0207641_10003961 | Ga0207641_100039616 | 397 |
| 811 | 3300026088 | Ga0207641_10111397 | Ga0207641_101113973 | 397 |
| 812 | 3300026089 | Ga0207648_10010083 | Ga0207648_100100836 | 397 |
| 813 | 3300026089 | Ga0207648_10022313 | Ga0207648_100223136 | 397 |
| 814 | 3300026089 | Ga0207648_10066688 | Ga0207648_100666883 | 397 |
| 815 | 3300026089 | Ga0207648_10107713 | Ga0207648_101077133 | 397 |
| 816 | 3300026095 | Ga0207676_10024842 | Ga0207676_100248422 | 397 |
| 817 | 3300026095 | Ga0207676_10028937 | Ga0207676_100289371 | 397 |
| 818 | 3300026095 | Ga0207676_10030918 | Ga0207676_100309181 | 397 |
| 819 | 3300026095 | Ga0207676_10050380 | Ga0207676_100503803 | 397 |
| 820 | 3300026116 | Ga0207674_10033858 | Ga0207674_100338582 | 397 |
| 821 | 3300026118 | Ga0207675_100008087 | Ga0207675_1000080873 | 397 |
| 822 | 3300026118 | Ga0207675_100040059 | Ga0207675_1000400592 | 397 |
| 823 | 3300026118 | Ga0207675_100040594 | Ga0207675_1000405943 | 397 |
| 824 | 3300026121 | Ga0207683_10011150 | Ga0207683_100111505 | 397 |
| 825 | 3300026121 | Ga0207683_10112392 | Ga0207683_101123922 | 397 |
| 826 | 3300026121 | Ga0207683_10133738 | Ga0207683_101337382 | 397 |
| 827 | 3300026121 | Ga0207683_10305745 | Ga0207683_103057451 | 397 |
| 828 | 3300026121 | Ga0207683_10313671 | Ga0207683_103136711 | 397 |
| 829 | 3300026142 | Ga0207698_10175597 | Ga0207698_101755972 | 397 |
| 830 | 3300028379 | Ga0268266_10007816 | Ga0268266_100078166 | 397 |
| 831 | 3300028379 | Ga0268266_10214932 | Ga0268266_102149322 | 397 |
| 832 | 3300028381 | Ga0268264_10001580 | Ga0268264_100015809 | 397 |
| 833 | 3300028381 | Ga0268264_10003762 | Ga0268264_100037629 | 397 |
| 834 | 3300028381 | Ga0268264_10139530 | Ga0268264_101395302 | 397 |
| 835 | 3300028794 | Ga0307515_10000010 | Ga0307515_10000010300 | 397 |
| 836 | 3300028800 | Ga0265338_10079195 | Ga0265338_100791952 | 397 |
| 837 | 3300029957 | Ga0265324_10023935 | Ga0265324_100239352 | 397 |
| 838 | 3300031251 | Ga0265327_10000239 | Ga0265327_100002393 | 397 |
| 839 | 3300031251 | Ga0265327_10000618 | Ga0265327_1000061841 | 397 |
| 840 | 3300031251 | Ga0265327_10000726 | Ga0265327_100007268 | 397 |
| 841 | 3300031251 | Ga0265327_10031497 | Ga0265327_100314971 | 397 |
| 842 | 3300031507 | Ga0307509_10290150 | Ga0307509_102901501 | 397 |
| 843 | 3300031730 | Ga0307516_10221684 | Ga0307516_102216842 | 397 |
| 844 | 3300037312 | Ga0395899_0011662 | Ga0395899_0011662_2389_3663 | 397 |
| 845 | 3300037312 | Ga0395899_0035366 | Ga0395899_0035366_2128_3402 | 397 |
| 846 | 3300037312 | Ga0395899_0039531 | Ga0395899_0039531_1207_2481 | 397 |
| 847 | 3300037312 | Ga0395899_0047757 | Ga0395899_0047757_1775_3049 | 397 |
| 848 | 3300037312 | Ga0395899_0110395 | Ga0395899_0110395_561_1835 | 397 |
| 849 | 3300037418 | Ga0395900_0010950 | Ga0395900_0010950_349_1623 | 397 |
| 850 | 3300037418 | Ga0395900_0165276 | Ga0395900_0165276_468_1742 | 397 |
| 851 | 3300037418 | Ga0395900_0391710 | Ga0395900_0391710_79_1341 | 397 |
| 852 | 3300037466 | Ga0395898_0001697 | Ga0395898_0001697_12452_13726 | 397 |
| 853 | 3300037466 | Ga0395898_0045358 | Ga0395898_0045358_10_1284 | 397 |
| 854 | 3300037466 | Ga0395898_0053988 | Ga0395898_0053988_341_1615 | 397 |
| 855 | 3300037471 | Ga0395905_0019301 | Ga0395905_0019301_1665_2927 | 397 |
| 856 | 3300037471 | Ga0395905_0065228 | Ga0395905_0065228_1226_2488 | 397 |
| 857 | 3300037471 | Ga0395905_0277475 | Ga0395905_0277475_74_1348 | 397 |
| 858 | 3300038443 | Ga0395901_0079052 | Ga0395901_0079052_1331_2605 | 397 |
| 859 | 3300038443 | Ga0395901_0086677 | Ga0395901_0086677_69_1343 | 397 |
| 860 | 3300039437 | Ga0436365_1889064 | Ga0436365_1889064_7855_9111 | 397 |
| 861 | 3300039437 | Ga0436365_1892627 | Ga0436365_1892627_843_2114 | 397 |
| 862 | 3300042001 | Ga0439441_005992 | Ga0439441_005992_502_1761 | 397 |
| 863 | 3300042125 | Ga0450923_009304 | Ga0450923_009304_286_1545 | 397 |
| 864 | 3300044658 | Ga0466972_0000205 | Ga0466972_0000205_19888_21144 | 397 |
| 865 | 3300044712 | Ga0453684_0030202 | Ga0453684_0030202_5571_6827 | 397 |
| 866 | 3300044712 | Ga0453684_0136521 | Ga0453684_0136521_724_1980 | 397 |
| 867 | 3300044765 | Ga0466970_0000529 | Ga0466970_0000529_4163_5419 | 397 |
| 868 | 3300046471 | Ga0495650_0022359 | Ga0495650_0022359_778_2034 | 397 |
| 869 | 3300046473 | Ga0495582_0126018 | Ga0495582_0126018_164_1420 | 397 |
| 870 | 3300046537 | Ga0495598_0035309 | Ga0495598_0035309_123_1382 | 397 |
| 871 | 3300046616 | Ga0495668_0000138 | Ga0495668_0000138_20390_21655 | 397 |
| 872 | 3300046616 | Ga0495668_0000268 | Ga0495668_0000268_32603_33892 | 397 |
| 873 | 3300046616 | Ga0495668_0002233 | Ga0495668_0002233_14890_16146 | 397 |
| 874 | 3300046679 | Ga0495623_0076293 | Ga0495623_0076293_107_1363 | 397 |
| 875 | 3300046683 | Ga0495658_0048030 | Ga0495658_0048030_21_1277 | 397 |
| 876 | 3300047318 | Ga0495636_0000082 | Ga0495636_0000082_23932_25197 | 397 |
| 877 | 3300047319 | Ga0495674_0014078 | Ga0495674_0014078_4381_5637 | 397 |
| 878 | 3300047472 | Ga0495686_0002851 | Ga0495686_0002851_3377_4645 | 397 |
| 879 | 3300048088 | Ga0495602_0240779 | Ga0495602_0240779_48_1304 | 397 |
| 880 | 3300049569 | Ga0501032_0000789 | Ga0501032_0000789_20330_21586 | 397 |
| 881 | 3300049569 | Ga0501032_0091219 | Ga0501032_0091219_735_2000 | 397 |
| 882 | 3300049570 | Ga0501033_0127944 | Ga0501033_0127944_143_1408 | 397 |
| 883 | 3300049571 | Ga0501034_0003172 | Ga0501034_0003172_12558_13823 | 397 |
| 884 | 3300049571 | Ga0501034_0006168 | Ga0501034_0006168_7765_9021 | 397 |
| 885 | 3300049572 | Ga0501036_0001149 | Ga0501036_0001149_10722_11978 | 397 |
| 886 | 3300049573 | Ga0501037_0004723 | Ga0501037_0004723_5355_6620 | 397 |
| 887 | 3300049574 | Ga0501038_0011400 | Ga0501038_0011400_4122_5387 | 397 |
| 888 | 3300049575 | Ga0501039_0005691 | Ga0501039_0005691_4297_5562 | 397 |
| 889 | 3300049579 | Ga0501043_0011111 | Ga0501043_0011111_4097_5362 | 397 |
| 890 | 3300049579 | Ga0501043_0013354 | Ga0501043_0013354_431_1687 | 397 |
| 891 | 3300049579 | Ga0501043_0026299 | Ga0501043_0026299_2126_3391 | 397 |
| 892 | 3300049580 | Ga0501046_0012945 | Ga0501046_0012945_2842_4098 | 397 |
| 893 | 3300049581 | Ga0501047_0003691 | Ga0501047_0003691_4048_5304 | 397 |
| 894 | 3300049581 | Ga0501047_0007639 | Ga0501047_0007639_6539_7795 | 397 |
| 895 | 3300049581 | Ga0501047_0010562 | Ga0501047_0010562_5057_6322 | 397 |
| 896 | 3300049581 | Ga0501047_0088305 | Ga0501047_0088305_1380_2636 | 397 |
| 897 | 3300049582 | Ga0501048_0003076 | Ga0501048_0003076_7775_9031 | 397 |
| 898 | 3300049586 | Ga0501070_0097839 | Ga0501070_0097839_716_1972 | 397 |
| 899 | 3300049589 | Ga0501073_0002127 | Ga0501073_0002127_4343_5599 | 397 |
| 900 | 3300049590 | Ga0501074_0000268 | Ga0501074_0000268_6569_7825 | 397 |
| 901 | 3300049669 | Ga0501235_006460 | Ga0501235_006460_974_2236 | 397 |
| 902 | 3300049741 | Ga0501079_0028531 | Ga0501079_0028531_2293_3549 | 397 |
| 903 | 3300049742 | Ga0501080_0009651 | Ga0501080_0009651_3509_4765 | 397 |
| 904 | 3300049742 | Ga0501080_0130042 | Ga0501080_0130042_19_1275 | 397 |
| 905 | 3300049744 | Ga0501083_0002364 | Ga0501083_0002364_8438_9694 | 397 |
| 906 | 3300049763 | Ga0501266_003293 | Ga0501266_003293_297_1559 | 397 |
| 907 | 3300049822 | Ga0501035_0006540 | Ga0501035_0006540_4513_5769 | 397 |
| 908 | 3300049822 | Ga0501035_0121557 | Ga0501035_0121557_639_1922 | 397 |
| 909 | 3300049823 | Ga0501044_0006312 | Ga0501044_0006312_10559_11824 | 397 |
| 910 | 3300049823 | Ga0501044_0008384 | Ga0501044_0008384_3840_5096 | 397 |
| 911 | 3300049823 | Ga0501044_0009325 | Ga0501044_0009325_6953_8209 | 397 |
| 912 | 3300049823 | Ga0501044_0037083 | Ga0501044_0037083_2164_3420 | 397 |
| 913 | 3300050507 | nmdc:mga05p37_239788_c1 | nmdc:mga05p37_239788_c1_93_1352 | 397 |
| 914 | 3300050508 | nmdc:mga09592_29361_c1 | nmdc:mga09592_29361_c1_821_2080 | 397 |
| 915 | 3300050508 | nmdc:mga09592_33001_c1 | nmdc:mga09592_33001_c1_1018_2277 | 397 |
| 916 | 3300050509 | nmdc:mga0qj67_49668_c1 | nmdc:mga0qj67_49668_c1_1305_2564 | 397 |
| 917 | 3300050509 | nmdc:mga0qj67_8348_c1 | nmdc:mga0qj67_8348_c1_5708_6967 | 397 |
| 918 | 3300050510 | nmdc:mga06r32_137630_c1 | nmdc:mga06r32_137630_c1_1011_2270 | 397 |
| 919 | 3300053130 | Ga0500642_0005679 | Ga0500642_0005679_2110_3375 | 397 |
| 920 | 3300053153 | Ga0500616_0002914 | Ga0500616_0002914_11439_12704 | 397 |
| 921 | 3300053153 | Ga0500616_0022029 | Ga0500616_0022029_981_2240 | 397 |
| 922 | 3300053156 | Ga0500622_0000176 | Ga0500622_0000176_66440_67699 | 397 |
| 923 | 3300053158 | Ga0500627_0003198 | Ga0500627_0003198_638_1903 | 397 |
| 924 | 2162886007 | SwRhRL2b_contig_1239318 | SwRhRL2b_0887.00007170 | 398 |
| 925 | 3300005289 | Ga0065704_10075046 | Ga0065704_100750463 | 398 |
| 926 | 3300031731 | Ga0307405_10000001 | Ga0307405_100000011292 | 398 |
| 927 | 3300031901 | Ga0307406_10017842 | Ga0307406_100178422 | 398 |
| 928 | 3300045051 | Ga0451576_0082567 | Ga0451576_0082567_1476_2729 | 398 |
| 929 | 3300048928 | Ga0496125_0000443 | Ga0496125_0000443_45486_46721 | 398 |
| 930 | 3300048929 | Ga0496126_0024161 | Ga0496126_0024161_1518_2753 | 398 |
| 931 | 3300053096 | Ga0500641_0000073 | Ga0500641_0000073_38820_40055 | 398 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6a0r-assembly1.cif.gz_A-2 | homoserine dehydrogenase from thermus thermophilus hb8 unliganded form | 0.9168 | 6 | 316 |
| 5xdf-assembly1.cif.gz_A | homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse | 0.9088 | 6 | 316 |
| 6dzs-assembly1.cif.gz_B | mycobacterial homoserine dehydrogenase thra in complex with nadp | 0.8735 | 4 | 395 |
| 6dzs-assembly2.cif.gz_C | mycobacterial homoserine dehydrogenase thra in complex with nadp | 0.8705 | 4 | 395 |
| 6dzs-assembly2.cif.gz_D | mycobacterial homoserine dehydrogenase thra in complex with nadp | 0.867 | 4 | 395 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYV4_151_297_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9609 | 145 | 290 | 3.30.360.10 |
| af_P9WPX1_139_304_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9456 | 130 | 290 | 3.30.360.10 |
| af_Q2FYV4_151_297_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.942 | 145 | 290 | 3.30.360.10 |
| 3mtjA02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9387 | 129 | 290 | 3.30.360.10 |
| 6dzsB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9332 | 4 | 128 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A136P9J0-F1-model_v4 | Homoserine dehydrogenase | 0.98 | 4 | 112 |
GO:0004412
GO:0009088 GO:0050661 |
| AF-A0A4Q3RPB9-F1-model_v4 | Homoserine dehydrogenase (EC 1.1.1.3) | 0.9754 | 2 | 310 |
GO:0004412
GO:0009086 GO:0009088 GO:0050661 |
| AF-A0A2B7ZTL4-F1-model_v4 | Homoserine dehydrogenase (EC 1.1.1.3) | 0.9733 | 3 | 331 |
GO:0004412
GO:0009086 GO:0009088 GO:0050661 |
| AF-A0A519W233-F1-model_v4 | Homoserine dehydrogenase | 0.9732 | 1 | 139 |
GO:0004412
GO:0009088 GO:0050661 |
| AF-A0A1W1VSI3-F1-model_v4 | Homoserine dehydrogenase (EC 1.1.1.3) | 0.9693 | 4 | 323 |
GO:0004412
GO:0009086 GO:0009088 GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar