F486038

General Info

Members Datasets Scaffolds Average Seq Length
931 342 906 413

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10017466|Ga0157370_100174666
Length 450
Sequence LQITDDREIEINEMKKEKIDAGLDTQLRDVQSFSNSHVELIIGLFGFGVVGEGLYKVLKQTPSLKASIKKVCIKNYDKRRDAPASLFTTDKNELLDDRDINVIVEVINDCEAAFEIVSIALKNGKHVVSASKRMIAEHLPDLLLLQQETGRSFLYESAACASIPVIRNLEEYYDNDLLHSIRAIVNGSTNFILTRIFEDGLNFREALLLAQQAGFAETDPRLDVEGYDAVSKWSFLLTHAYGILARPGDILFNGIQHIKKEDAVLAASREQEIRLVACAQKLKDGKVAAFVLPQFVRKDDHLAFVKNEYNGVVIESSFADKQFFYGKGAGSFPTASAVLSDIAALRYNYKYEXKKLYHHQPHEITDDLYLRVFVSFDDLSRVPRDNFEWIEEWHADLDRKWLIGVIHFSELKKYSWWKQENTSLILAADPIVEDIETRKLKRKSLELAGV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
8 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
9 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
10 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
11 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
12 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
13 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
14 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
15 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
16 2914759650 Rhizosphaericola mali Isolate Rhizosphere
17 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
18 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
19 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
20 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
21 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
22 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
23 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
24 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
25 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
29 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
30 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
36 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
214 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
241 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
242 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
306 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
307 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
312 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
324 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
325 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
326 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
327 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
328 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
331 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
332 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
333 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
334 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
335 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
336 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
337 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
338 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
339 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 0
Rhizoplane 0.32
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1239318 2162886007 Bacteria 1524
2 SwRhRL2b_contig_1759593 2162886007 Bacteria 266684
3 JGI24740J21852_10000358 3300001979 Bacteria 19557
4 JGI24740J21852_10037900 3300001979 Bacteria 1484
5 JGI24739J22299_10000433 3300001989 Bacteria 14530
6 JGI24751J29686_10002215 3300002459 Bacteria 3937
7 JGI25154J39366_1000007 3300002738 Bacteria 335932
8 JGI25406J46586_10004160 3300003203 Bacteria 6754
9 JGI25153J46596_10001828 3300003215 Bacteria 12620
10 JGI25153J46596_10018062 3300003215 Bacteria 2753
11 rootH2_10020884 3300003320 Bacteria 5195
12 rootH2_10056261 3300003320 Bacteria 14958
13 rootH2_10100645 3300003320 Bacteria 10994
14 rootL2_10022865 3300003322 Bacteria 7745
15 rootL2_10140272 3300003322 Bacteria 3928
16 rootL2_10163823 3300003322 Bacteria 2021
17 rootH1_10005865 3300003323 Bacteria 31302
18 rootH1_10046794 3300003323 Bacteria 11572
19 rootH1_10135802 3300003323 Bacteria 4034
20 JGI25160J50197_1001383 3300003354 Bacteria 12214
21 JGI25160J50197_1003564 3300003354 Bacteria 6924
22 JGI25160J50197_1011746 3300003354 Bacteria 3080
23 JGI25160J50197_1015956 3300003354 Bacteria 2443
24 Ga0055535_1003112 3300003761 Bacteria 4990
25 Ga0055526_1011071 3300003771 Bacteria 4115
26 Ga0055528_1015931 3300003790 Bacteria 2686
27 Ga0055530_10001252 3300003791 Bacteria 19331
28 Ga0055531_10000020 3300003794 Bacteria 170186
29 Ga0055531_10031189 3300003794 Bacteria 1771
30 Ga0065165_1000010 3300005262 Bacteria 323737
31 Ga0065165_1009228 3300005262 Bacteria 4460
32 Ga0065714_10017635 3300005288 Bacteria 1889
33 Ga0065704_10070133 3300005289 Bacteria 1266035
34 Ga0065704_10073952 3300005289 Bacteria 6644
35 Ga0065704_10075046 3300005289 Bacteria 5824
36 Ga0065712_10007993 3300005290 Bacteria 3304
37 Ga0065715_10093864 3300005293 Bacteria 4520
38 Ga0065715_10098173 3300005293 Bacteria 3586
39 Ga0070658_10058958 3300005327 Bacteria 3126
40 Ga0070658_10075475 3300005327 Bacteria 2765
41 Ga0070658_10179516 3300005327 Bacteria 1781
42 Ga0070658_10214036 3300005327 Bacteria 1628
43 Ga0070676_10004661 3300005328 Bacteria 7243
44 Ga0070683_100001844 3300005329 Bacteria 16533
45 Ga0070683_100003744 3300005329 Bacteria 12409
46 Ga0070683_100018837 3300005329 Bacteria 6123
47 Ga0070683_100020019 3300005329 Bacteria 5950
48 Ga0070690_100016948 3300005330 Bacteria 4373
49 Ga0070690_100032271 3300005330 Bacteria 3270
50 Ga0070690_100112891 3300005330 Bacteria 1816
51 Ga0070670_100026565 3300005331 Bacteria 4980
52 Ga0070670_100027222 3300005331 Bacteria 4918
53 Ga0070670_100038903 3300005331 Bacteria 4090
54 Ga0070670_100059185 3300005331 Bacteria 3288
55 Ga0070670_100080565 3300005331 Bacteria 2798
56 Ga0070670_100297706 3300005331 Bacteria 1411
57 Ga0068869_100002681 3300005334 Bacteria 10764
58 Ga0068869_100009889 3300005334 Bacteria 6196
59 Ga0068869_100016541 3300005334 Bacteria 4973
60 Ga0068869_100034075 3300005334 Bacteria 3600
61 Ga0068869_100084756 3300005334 Unclassified 2372
62 Ga0068869_100186944 3300005334 Unclassified 1627
63 Ga0070666_10026338 3300005335 Bacteria 3798
64 Ga0070666_10030778 3300005335 Bacteria 3538
65 Ga0070666_10095753 3300005335 Bacteria 2043
66 Ga0070680_100011958 3300005336 Bacteria 6734
67 Ga0070680_100130702 3300005336 Bacteria 2101
68 Ga0070680_100163013 3300005336 Bacteria 1874
69 Ga0070680_100217863 3300005336 Unclassified 1611
70 Ga0070682_100000018 3300005337 Bacteria 229427
71 Ga0070682_100013032 3300005337 Bacteria 4774
72 Ga0070682_100072253 3300005337 Bacteria 2211
73 Ga0068868_100008559 3300005338 Bacteria 7326
74 Ga0068868_100063499 3300005338 Bacteria 2929
75 Ga0068868_100107795 3300005338 Bacteria 2261
76 Ga0070660_100001278 3300005339 Bacteria 17159
77 Ga0070660_100005738 3300005339 Bacteria 8598
78 Ga0070660_100041472 3300005339 Bacteria 3509
79 Ga0070660_100067403 3300005339 Bacteria 2788
80 Ga0070660_100072985 3300005339 Bacteria 2682
81 Ga0070660_100092127 3300005339 Bacteria 2392
82 Ga0070689_100035493 3300005340 Bacteria 3810
83 Ga0070689_100039392 3300005340 Bacteria 3618
84 Ga0070689_100088598 3300005340 Bacteria 2436
85 Ga0070691_10001047 3300005341 Bacteria 11397
86 Ga0070661_100018952 3300005344 Bacteria 4900
87 Ga0070668_100008170 3300005347 Bacteria 7771
88 Ga0070669_100017590 3300005353 Bacteria 5099
89 Ga0070669_100021311 3300005353 Bacteria 4632
90 Ga0070669_100074842 3300005353 Bacteria 2510
91 Ga0070669_100166113 3300005353 Bacteria 1718
92 Ga0070675_100007148 3300005354 Bacteria 8599
93 Ga0070675_100016579 3300005354 Bacteria 5849
94 Ga0070675_100323480 3300005354 Bacteria 1363
95 Ga0070671_100017404 3300005355 Bacteria 5821
96 Ga0070671_100100027 3300005355 Bacteria 2433
97 Ga0070674_100053564 3300005356 Bacteria 2787
98 Ga0070674_100145194 3300005356 Bacteria 1785
99 Ga0070673_100013654 3300005364 Bacteria 5629
100 Ga0070673_100034796 3300005364 Bacteria 3816
101 Ga0070673_100049925 3300005364 Bacteria 3269
102 Ga0070673_100062303 3300005364 Bacteria 2963
103 Ga0070673_100089685 3300005364 Bacteria 2510
104 Ga0070673_100177729 3300005364 Bacteria 1820
105 Ga0070688_100005858 3300005365 Bacteria 6504
106 Ga0070688_100007595 3300005365 Bacteria 5852
107 Ga0070688_100132491 3300005365 Bacteria 1684
108 Ga0070659_100002027 3300005366 Bacteria 14487
109 Ga0070659_100005677 3300005366 Bacteria 8974
110 Ga0070659_100010931 3300005366 Bacteria 6699
111 Ga0070659_100081983 3300005366 Bacteria 2577
112 Ga0070659_100167753 3300005366 Bacteria 1797
113 Ga0070667_100012198 3300005367 Bacteria 7110
114 Ga0070667_100012604 3300005367 Bacteria 6992
115 Ga0070667_100053963 3300005367 Bacteria 3393
116 Ga0070667_100103445 3300005367 Unclassified 2462
117 Ga0070667_100108956 3300005367 Bacteria 2400
118 Ga0070667_100112696 3300005367 Bacteria 2360
119 Ga0070667_100136993 3300005367 Bacteria 2141
120 Ga0070667_100156773 3300005367 Bacteria 2003
121 Ga0070701_10006632 3300005438 Bacteria 4884
122 Ga0070663_100089989 3300005455 Bacteria 2272
123 Ga0070678_100021106 3300005456 Bacteria 4288
124 Ga0070678_100061577 3300005456 Bacteria 2767
125 Ga0070678_100088451 3300005456 Bacteria 2368
126 Ga0070678_100208121 3300005456 Bacteria 1619
127 Ga0070662_100002931 3300005457 Bacteria 10611
128 Ga0070662_100004967 3300005457 Bacteria 8451
129 Ga0070662_100007145 3300005457 Bacteria 7230
130 Ga0070662_100009392 3300005457 Bacteria 6392
131 Ga0070662_100016106 3300005457 Bacteria 5015
132 Ga0070662_100111416 3300005457 Bacteria 2085
133 Ga0070681_10032814 3300005458 Bacteria 5213
134 Ga0070681_10065886 3300005458 Unclassified 3591
135 Ga0070681_10074057 3300005458 Bacteria 3367
136 Ga0068867_100059343 3300005459 Bacteria 2836
137 Ga0068867_100074463 3300005459 Bacteria 2545
138 Ga0070685_10024229 3300005466 Bacteria 3331
139 Ga0070685_10069976 3300005466 Bacteria 2077
140 Ga0070698_100003400 3300005471 Bacteria 17500
141 Ga0070679_100001044 3300005530 Bacteria 24138
142 Ga0070679_100004008 3300005530 Bacteria 13562
143 Ga0070679_100073106 3300005530 Bacteria 3421
144 Ga0070679_100157594 3300005530 Bacteria 2245
145 Ga0070684_100001070 3300005535 Bacteria 19608
146 Ga0070684_100012432 3300005535 Bacteria 6823
147 Ga0070684_100014413 3300005535 Bacteria 6405
148 Ga0070684_100055619 3300005535 Bacteria 3450
149 Ga0070684_100061868 3300005535 Bacteria 3278
150 Ga0070684_100120096 3300005535 Unclassified 2364
151 Ga0068853_100001291 3300005539 Bacteria 17981
152 Ga0068853_100006484 3300005539 Bacteria 9307
153 Ga0068853_100022502 3300005539 Bacteria 5265
154 Ga0068853_100044640 3300005539 Bacteria 3794
155 Ga0070672_100001603 3300005543 Bacteria 14052
156 Ga0070672_100214597 3300005543 Bacteria 1613
157 Ga0070693_100050821 3300005547 Bacteria 2371
158 Ga0070665_100000008 3300005548 Bacteria 606341
159 Ga0070665_100003504 3300005548 Bacteria 16699
160 Ga0070665_100109195 3300005548 Bacteria 2769
161 Ga0070665_100114404 3300005548 Bacteria 2701
162 Ga0070704_100025018 3300005549 Bacteria 3926
163 Ga0068855_100000329 3300005563 Bacteria 58994
164 Ga0068855_100000406 3300005563 Bacteria 53320
165 Ga0068855_100013158 3300005563 Bacteria 9980
166 Ga0068855_100013953 3300005563 Bacteria 9688
167 Ga0068855_100017499 3300005563 Bacteria 8619
168 Ga0068855_100056531 3300005563 Bacteria 4604
169 Ga0068855_100064457 3300005563 Bacteria 4273
170 Ga0068855_100108409 3300005563 Bacteria 3190
171 Ga0068855_100111470 3300005563 Bacteria 3141
172 Ga0068855_100143074 3300005563 Bacteria 2724
173 Ga0068855_100183932 3300005563 Bacteria 2362
174 Ga0070664_100008883 3300005564 Bacteria 8141
175 Ga0070664_100026666 3300005564 Bacteria 4796
176 Ga0070664_100031978 3300005564 Bacteria 4401
177 Ga0070664_100061377 3300005564 Unclassified 3204
178 Ga0070664_100067420 3300005564 Bacteria 3058
179 Ga0070664_100346098 3300005564 Bacteria 1351
180 Ga0068857_100004345 3300005577 Bacteria 11963
181 Ga0068857_100004830 3300005577 Bacteria 11421
182 Ga0068857_100015114 3300005577 Bacteria 6737
183 Ga0068857_100022205 3300005577 Bacteria 5582
184 Ga0068857_100080583 3300005577 Bacteria 2907
185 Ga0068857_100130731 3300005577 Bacteria 2264
186 Ga0068857_100132320 3300005577 Bacteria 2250
187 Ga0068854_100006808 3300005578 Bacteria 7287
188 Ga0068854_100022079 3300005578 Bacteria 4328
189 Ga0068854_100031903 3300005578 Bacteria 3663
190 Ga0068854_100073428 3300005578 Bacteria 2507
191 Ga0068854_100144895 3300005578 Bacteria 1826
192 Ga0068854_100208667 3300005578 Bacteria 1540
193 Ga0068856_100034788 3300005614 Bacteria 4935
194 Ga0068856_100035282 3300005614 Bacteria 4900
195 Ga0068856_100131052 3300005614 Bacteria 2512
196 Ga0070702_100046856 3300005615 Bacteria 2452
197 Ga0068852_100006208 3300005616 Bacteria 8614
198 Ga0068852_100008807 3300005616 Bacteria 7466
199 Ga0068852_100015602 3300005616 Bacteria 5900
200 Ga0068852_100020725 3300005616 Bacteria 5231
201 Ga0068852_100138617 3300005616 Bacteria 2249
202 Ga0068852_100175196 3300005616 Bacteria 2013
203 Ga0068852_100184164 3300005616 Bacteria 1966
204 Ga0068859_100000023 3300005617 Bacteria 221914
205 Ga0068859_100000859 3300005617 Bacteria 30939
206 Ga0068859_100020142 3300005617 Bacteria 6697
207 Ga0068859_100058275 3300005617 Bacteria 3890
208 Ga0068859_100134287 3300005617 Bacteria 2546
209 Ga0068859_100176293 3300005617 Unclassified 2219
210 Ga0068859_100187243 3300005617 Bacteria 2154
211 Ga0068864_100009349 3300005618 Bacteria 8085
212 Ga0068864_100056257 3300005618 Bacteria 3399
213 Ga0068864_100153429 3300005618 Unclassified 2088
214 Ga0068866_10017119 3300005718 Bacteria 3254
215 Ga0068866_10040962 3300005718 Bacteria 2296
216 Ga0068861_100047027 3300005719 Bacteria 3256
217 Ga0068861_100059398 3300005719 Bacteria 2928
218 Ga0068861_100256002 3300005719 Unclassified 1496
219 Ga0068851_10002822 3300005834 Bacteria 7654
220 Ga0068851_10053510 3300005834 Bacteria 2055
221 Ga0068870_10030301 3300005840 Bacteria 2733
222 Ga0068870_10041365 3300005840 Bacteria 2394
223 Ga0068863_100000424 3300005841 Bacteria 42794
224 Ga0068863_100065852 3300005841 Bacteria 3428
225 Ga0068863_100193970 3300005841 Bacteria 1952
226 Ga0068863_100306769 3300005841 Bacteria 1540
227 Ga0068860_100000059 3300005843 Bacteria 196400
228 Ga0068860_100001384 3300005843 Bacteria 26311
229 Ga0068860_100009247 3300005843 Bacteria 9797
230 Ga0068860_100011810 3300005843 Bacteria 8607
231 Ga0068860_100013541 3300005843 Bacteria 7996
232 Ga0068860_100015628 3300005843 Bacteria 7411
233 Ga0068860_100024851 3300005843 Bacteria 5783
234 Ga0068860_100029257 3300005843 Bacteria 5298
235 Ga0068860_100034335 3300005843 Unclassified 4864
236 Ga0068860_100063750 3300005843 Bacteria 3500
237 Ga0068860_100153902 3300005843 Bacteria 2215
238 Ga0068862_100004782 3300005844 Bacteria 11396
239 Ga0068862_100061946 3300005844 Bacteria 3216
240 Ga0081539_10001000 3300005985 Bacteria 52492
241 Ga0081539_10012887 3300005985 Bacteria 6367
242 Ga0070716_100103258 3300006173 Bacteria 1752
243 Ga0075366_10017853 3300006195 Bacteria 4091
244 Ga0075366_10091015 3300006195 Bacteria 1827
245 Ga0097621_100000487 3300006237 Bacteria 27766
246 Ga0097621_100028199 3300006237 Bacteria 4424
247 Ga0097621_100071294 3300006237 Bacteria 2871
248 Ga0097621_100078691 3300006237 Bacteria 2739
249 Ga0097621_100089616 3300006237 Bacteria 2572
250 Ga0097621_100114598 3300006237 Bacteria 2281
251 Ga0097621_100119702 3300006237 Bacteria 2232
252 Ga0097621_100259683 3300006237 Bacteria 1523
253 Ga0068871_100024719 3300006358 Unclassified 4662
254 Ga0068871_100097088 3300006358 Bacteria 2462
255 Ga0068871_100189196 3300006358 Bacteria 1772
256 Ga0075428_100006657 3300006844 Bacteria 12851
257 Ga0075428_100079725 3300006844 Bacteria 3573
258 Ga0075428_100102763 3300006844 Bacteria 3117
259 Ga0075430_100029748 3300006846 Bacteria 4636
260 Ga0075431_100032992 3300006847 Bacteria 5336
261 Ga0075431_100165692 3300006847 Bacteria 2272
262 Ga0075429_100006669 3300006880 Bacteria 10009
263 Ga0075429_100027628 3300006880 Bacteria 4926
264 Ga0068865_100008569 3300006881 Bacteria 6321
265 Ga0068865_100098462 3300006881 Bacteria 2137
266 Ga0068865_100211413 3300006881 Bacteria 1512
267 Ga0097620_100000023 3300006931 Bacteria 221914
268 Ga0097620_100000859 3300006931 Bacteria 30939
269 Ga0097620_100020142 3300006931 Bacteria 6697
270 Ga0097620_100058269 3300006931 Bacteria 3890
271 Ga0097620_100134284 3300006931 Bacteria 2546
272 Ga0097620_100176303 3300006931 Unclassified 2219
273 Ga0097620_100187246 3300006931 Bacteria 2154
274 Ga0105240_10000011 3300009093 Bacteria 523646
275 Ga0105240_10000767 3300009093 Bacteria 58332
276 Ga0105240_10002681 3300009093 Bacteria 28340
277 Ga0105240_10008492 3300009093 Bacteria 14688
278 Ga0105240_10009313 3300009093 Bacteria 13924
279 Ga0105240_10009560 3300009093 Bacteria 13726
280 Ga0105240_10016269 3300009093 Bacteria 10076
281 Ga0105240_10064033 3300009093 Bacteria 4570
282 Ga0105240_10182785 3300009093 Bacteria 2473
283 Ga0111539_10006433 3300009094 Bacteria 15147
284 Ga0111539_10022168 3300009094 Bacteria 7807
285 Ga0105245_10317179 3300009098 Bacteria 1534
286 Ga0105247_10024168 3300009101 Bacteria 3661
287 Ga0114129_10003306 3300009147 Bacteria 22637
288 Ga0114129_10182219 3300009147 Bacteria 2857
289 Ga0114129_10206848 3300009147 Bacteria 2655
290 Ga0105241_10000861 3300009174 Bacteria 23026
291 Ga0105241_10010072 3300009174 Bacteria 6941
292 Ga0105241_10018003 3300009174 Bacteria 5193
293 Ga0105241_10024675 3300009174 Bacteria 4466
294 Ga0105241_10133889 3300009174 Bacteria 2010
295 Ga0105242_10005203 3300009176 Bacteria 10041
296 Ga0105242_10027845 3300009176 Bacteria 4493
297 Ga0105242_10035959 3300009176 Bacteria 3971
298 Ga0105242_10066012 3300009176 Bacteria 2987
299 Ga0105242_10094343 3300009176 Bacteria 2524
300 Ga0105242_10257862 3300009176 Bacteria 1574
301 Ga0105248_10040274 3300009177 Bacteria 5237
302 Ga0105237_10000128 3300009545 Bacteria 106338
303 Ga0105237_10001750 3300009545 Bacteria 28065
304 Ga0105237_10006346 3300009545 Bacteria 13145
305 Ga0105237_10007600 3300009545 Bacteria 11844
306 Ga0105237_10007857 3300009545 Bacteria 11628
307 Ga0105237_10040418 3300009545 Bacteria 4703
308 Ga0105237_10112647 3300009545 Bacteria 2713
309 Ga0105237_10139842 3300009545 Unclassified 2415
310 Ga0105237_10143287 3300009545 Bacteria 2384
311 Ga0105238_10013311 3300009551 Bacteria 8299
312 Ga0105238_10023664 3300009551 Bacteria 6259
313 Ga0105238_10082937 3300009551 Unclassified 3195
314 Ga0105249_10002037 3300009553 Bacteria 17526
315 Ga0105249_10002885 3300009553 Bacteria 14839
316 Ga0105249_10008554 3300009553 Bacteria 8924
317 Ga0105249_10010023 3300009553 Bacteria 8315
318 Ga0105249_10019818 3300009553 Bacteria 6005
319 Ga0105249_10025260 3300009553 Bacteria 5346
320 Ga0105249_10119485 3300009553 Bacteria 2503
321 Ga0105239_10000052 3300010375 Bacteria 164624
322 Ga0105239_10000263 3300010375 Bacteria 78014
323 Ga0105239_10000748 3300010375 Bacteria 46087
324 Ga0105239_10002485 3300010375 Bacteria 23480
325 Ga0105239_10003037 3300010375 Bacteria 20874
326 Ga0105239_10016636 3300010375 Bacteria 8130
327 Ga0105239_10025164 3300010375 Bacteria 6556
328 Ga0105239_10103105 3300010375 Bacteria 3157
329 Ga0105239_10121663 3300010375 Bacteria 2899
330 Ga0105239_10129240 3300010375 Bacteria 2808
331 Ga0105239_10180254 3300010375 Bacteria 2363
332 Ga0105246_10000127 3300011119 Bacteria 35078
333 Ga0105246_10007561 3300011119 Bacteria 6667
334 Ga0105246_10099983 3300011119 Bacteria 2109
335 Ga0157373_10001583 3300013100 Bacteria 17384
336 Ga0157373_10004754 3300013100 Bacteria 10220
337 Ga0157373_10089780 3300013100 Unclassified 2164
338 Ga0157373_10135784 3300013100 Bacteria 1729
339 Ga0157373_10161231 3300013100 Bacteria 1578
340 Ga0157371_10000651 3300013102 Bacteria 41136
341 Ga0157371_10000874 3300013102 Bacteria 34176
342 Ga0157371_10002691 3300013102 Bacteria 16786
343 Ga0157371_10003885 3300013102 Bacteria 13319
344 Ga0157371_10012057 3300013102 Bacteria 6625
345 Ga0157371_10014455 3300013102 Bacteria 5956
346 Ga0157371_10015537 3300013102 Bacteria 5710
347 Ga0157371_10026427 3300013102 Bacteria 4220
348 Ga0157371_10031082 3300013102 Bacteria 3847
349 Ga0157371_10044799 3300013102 Bacteria 3149
350 Ga0157371_10053023 3300013102 Unclassified 2880
351 Ga0157371_10116551 3300013102 Bacteria 1898
352 Ga0157371_10153838 3300013102 Bacteria 1641
353 Ga0157370_10010139 3300013104 Bacteria 9950
354 Ga0157370_10017466 3300013104 Bacteria 7238
355 Ga0157370_10019741 3300013104 Bacteria 6747
356 Ga0157370_10027186 3300013104 Bacteria 5641
357 Ga0157370_10032940 3300013104 Bacteria 5055
358 Ga0157370_10060071 3300013104 Bacteria 3610
359 Ga0157370_10067521 3300013104 Bacteria 3380
360 Ga0157370_10101118 3300013104 Bacteria 2700
361 Ga0157370_10103180 3300013104 Bacteria 2670
362 Ga0157370_10175087 3300013104 Bacteria 1994
363 Ga0157369_10016571 3300013105 Bacteria 8283
364 Ga0157369_10066270 3300013105 Bacteria 3885
365 Ga0157369_10124521 3300013105 Bacteria 2733
366 Ga0157369_10288447 3300013105 Bacteria 1709
367 Ga0157374_10000009 3300013296 Bacteria 564330
368 Ga0157374_10002136 3300013296 Bacteria 16661
369 Ga0157374_10017972 3300013296 Bacteria 6234
370 Ga0157374_10050185 3300013296 Bacteria 3878
371 Ga0157374_10050987 3300013296 Bacteria 3850
372 Ga0157374_10071492 3300013296 Unclassified 3271
373 Ga0157374_10152858 3300013296 Bacteria 2245
374 Ga0157374_10311262 3300013296 Bacteria 1559
375 Ga0157378_10003896 3300013297 Bacteria 13218
376 Ga0157378_10004726 3300013297 Bacteria 11942
377 Ga0157378_10005272 3300013297 Bacteria 11353
378 Ga0157378_10025100 3300013297 Bacteria 5251
379 Ga0157378_10025456 3300013297 Bacteria 5210
380 Ga0157378_10044912 3300013297 Bacteria 3924
381 Ga0157378_10175156 3300013297 Bacteria 2014
382 Ga0157378_10284351 3300013297 Bacteria 1595
383 Ga0163162_10000164 3300013306 Bacteria 60866
384 Ga0163162_10000373 3300013306 Bacteria 40682
385 Ga0163162_10000413 3300013306 Bacteria 39230
386 Ga0163162_10000697 3300013306 Bacteria 31013
387 Ga0163162_10000856 3300013306 Bacteria 28341
388 Ga0163162_10002755 3300013306 Bacteria 16693
389 Ga0163162_10007340 3300013306 Bacteria 10714
390 Ga0163162_10060105 3300013306 Bacteria 3834
391 Ga0163162_10141353 3300013306 Bacteria 2521
392 Ga0163162_10151709 3300013306 Bacteria 2436
393 Ga0163162_10222422 3300013306 Bacteria 2018
394 Ga0163162_10237579 3300013306 Bacteria 1953
395 Ga0163162_10253355 3300013306 Bacteria 1892
396 Ga0163162_10287102 3300013306 Bacteria 1777
397 Ga0157372_10000361 3300013307 Bacteria 50140
398 Ga0157372_10000676 3300013307 Bacteria 37536
399 Ga0157372_10004620 3300013307 Bacteria 14640
400 Ga0157372_10007453 3300013307 Bacteria 11638
401 Ga0157372_10016144 3300013307 Bacteria 8012
402 Ga0157372_10032100 3300013307 Bacteria 5755
403 Ga0157372_10041530 3300013307 Bacteria 5086
404 Ga0157372_10046886 3300013307 Bacteria 4799
405 Ga0157372_10050674 3300013307 Bacteria 4617
406 Ga0157372_10061020 3300013307 Bacteria 4220
407 Ga0157372_10143700 3300013307 Unclassified 2751
408 Ga0157372_10147340 3300013307 Bacteria 2715
409 Ga0157372_10155238 3300013307 Bacteria 2643
410 Ga0157372_10172947 3300013307 Bacteria 2499
411 Ga0157372_10256260 3300013307 Bacteria 2031
412 Ga0157372_10434942 3300013307 Bacteria 1529
413 Ga0157372_10465252 3300013307 Bacteria 1474
414 Ga0157375_10019779 3300013308 Bacteria 6135
415 Ga0157375_10129843 3300013308 Bacteria 2638
416 Ga0157375_10155632 3300013308 Bacteria 2424
417 Ga0157375_10169648 3300013308 Bacteria 2329
418 Ga0157375_10281391 3300013308 Bacteria 1826
419 Ga0163163_10000560 3300014325 Bacteria 32679
420 Ga0163163_10002603 3300014325 Bacteria 15288
421 Ga0163163_10012527 3300014325 Bacteria 7732
422 Ga0157380_10020668 3300014326 Bacteria 4923
423 Ga0157380_10035702 3300014326 Bacteria 3841
424 Ga0157380_10068775 3300014326 Bacteria 2855
425 Ga0157380_10098766 3300014326 Bacteria 2426
426 Ga0157380_10126642 3300014326 Bacteria 2172
427 Ga0157380_10190663 3300014326 Bacteria 1809
428 Ga0157377_10004008 3300014745 Bacteria 6716
429 Ga0157377_10030917 3300014745 Bacteria 2905
430 Ga0157377_10034815 3300014745 Bacteria 2757
431 Ga0157377_10035061 3300014745 Bacteria 2750
432 Ga0157377_10073216 3300014745 Bacteria 1985
433 Ga0157377_10147612 3300014745 Bacteria 1451
434 Ga0157379_10016875 3300014968 Bacteria 6426
435 Ga0157379_10034273 3300014968 Bacteria 4525
436 Ga0157379_10048438 3300014968 Bacteria 3793
437 Ga0157379_10149386 3300014968 Bacteria 2107
438 Ga0157376_10002437 3300014969 Bacteria 12579
439 Ga0157376_10003607 3300014969 Bacteria 10680
440 Ga0157376_10007147 3300014969 Bacteria 7933
441 Ga0157376_10065638 3300014969 Bacteria 3066
442 Ga0157376_10113436 3300014969 Bacteria 2390
443 Ga0157376_10179106 3300014969 Bacteria 1936
444 Ga0182005_1000215 3300015265 Bacteria 38214
445 Ga0163161_10001190 3300017792 Bacteria 19553
446 Ga0163161_10006822 3300017792 Bacteria 7896
447 Ga0163161_10030521 3300017792 Bacteria 3837
448 Ga0163161_10042807 3300017792 Bacteria 3258
449 Ga0163161_10108419 3300017792 Unclassified 2074
450 Ga0209436_110381 3300025208 Bacteria 1707
451 Ga0209258_102250 3300025242 Bacteria 5201
452 Ga0209646_1000002 3300025246 Bacteria 1425781
453 Ga0209646_1002397 3300025246 Bacteria 4188
454 Ga0209026_1000545 3300025250 Bacteria 25918
455 Ga0209148_1000283 3300025254 Bacteria 77780
456 Ga0209673_1000082 3300025273 Bacteria 219716
457 Ga0209130_1004066 3300025284 Bacteria 5780
458 Ga0209564_1002231 3300025295 Bacteria 15987
459 Ga0209758_1015206 3300025297 Bacteria 4010
460 Ga0209758_1039797 3300025297 Bacteria 1782
461 Ga0209050_1000389 3300025298 Bacteria 82517
462 Ga0207426_1000040 3300025302 Bacteria 433920
463 Ga0207426_1000341 3300025302 Bacteria 87735
464 Ga0207426_1000951 3300025302 Bacteria 28622
465 Ga0207426_1002430 3300025302 Bacteria 11906
466 Ga0207426_1040618 3300025302 Bacteria 1448
467 Ga0209257_1000001 3300025304 Bacteria 2274655
468 Ga0209257_1003759 3300025304 Bacteria 12538
469 Ga0207697_10081107 3300025315 Unclassified 1367
470 Ga0207656_10039892 3300025321 Bacteria 1989
471 Ga0207682_10013516 3300025893 Bacteria 3181
472 Ga0207642_10012939 3300025899 Bacteria 3028
473 Ga0207710_10002430 3300025900 Bacteria 8659
474 Ga0207710_10034808 3300025900 Bacteria 2214
475 Ga0207680_10107618 3300025903 Bacteria 1802
476 Ga0207647_10000139 3300025904 Bacteria 57477
477 Ga0207647_10000485 3300025904 Bacteria 31915
478 Ga0207647_10016694 3300025904 Bacteria 5004
479 Ga0207647_10038075 3300025904 Bacteria 3043
480 Ga0207647_10077222 3300025904 Bacteria 2002
481 Ga0207647_10083236 3300025904 Unclassified 1916
482 Ga0207645_10000093 3300025907 Bacteria 64854
483 Ga0207645_10008549 3300025907 Bacteria 7135
484 Ga0207645_10045019 3300025907 Bacteria 2821
485 Ga0207643_10003399 3300025908 Bacteria 8581
486 Ga0207705_10007859 3300025909 Bacteria 7832
487 Ga0207705_10014478 3300025909 Bacteria 5676
488 Ga0207705_10097990 3300025909 Bacteria 2154
489 Ga0207705_10100159 3300025909 Bacteria 2131
490 Ga0207654_10009898 3300025911 Bacteria 4848
491 Ga0207654_10014620 3300025911 Bacteria 4057
492 Ga0207654_10020576 3300025911 Bacteria 3500
493 Ga0207707_10003165 3300025912 Bacteria 14612
494 Ga0207707_10084908 3300025912 Unclassified 2766
495 Ga0207707_10173295 3300025912 Bacteria 1885
496 Ga0207707_10219642 3300025912 Bacteria 1654
497 Ga0207695_10000010 3300025913 Bacteria 981919
498 Ga0207695_10000051 3300025913 Bacteria 399641
499 Ga0207695_10000056 3300025913 Bacteria 382433
500 Ga0207695_10000081 3300025913 Bacteria 284797
501 Ga0207695_10000425 3300025913 Bacteria 93523
502 Ga0207695_10000446 3300025913 Bacteria 90493
503 Ga0207695_10000873 3300025913 Bacteria 54922
504 Ga0207695_10011272 3300025913 Bacteria 10839
505 Ga0207695_10013688 3300025913 Bacteria 9656
506 Ga0207695_10025625 3300025913 Bacteria 6597
507 Ga0207695_10147130 3300025913 Bacteria 2299
508 Ga0207671_10000150 3300025914 Bacteria 107685
509 Ga0207671_10001329 3300025914 Bacteria 28904
510 Ga0207671_10001864 3300025914 Bacteria 23482
511 Ga0207671_10007560 3300025914 Bacteria 9410
512 Ga0207671_10007853 3300025914 Bacteria 9167
513 Ga0207671_10033040 3300025914 Bacteria 3851
514 Ga0207671_10068398 3300025914 Unclassified 2646
515 Ga0207671_10085591 3300025914 Bacteria 2369
516 Ga0207660_10023446 3300025917 Bacteria 4168
517 Ga0207660_10034825 3300025917 Bacteria 3492
518 Ga0207660_10097456 3300025917 Unclassified 2191
519 Ga0207660_10141570 3300025917 Bacteria 1839
520 Ga0207662_10004373 3300025918 Bacteria 7423
521 Ga0207657_10002529 3300025919 Bacteria 19785
522 Ga0207657_10008447 3300025919 Bacteria 10445
523 Ga0207657_10021296 3300025919 Bacteria 6105
524 Ga0207657_10025251 3300025919 Bacteria 5482
525 Ga0207657_10106366 3300025919 Bacteria 2321
526 Ga0207657_10125502 3300025919 Bacteria 2108
527 Ga0207657_10233751 3300025919 Bacteria 1469
528 Ga0207649_10037474 3300025920 Bacteria 2929
529 Ga0207649_10090252 3300025920 Bacteria 2005
530 Ga0207652_10000051 3300025921 Bacteria 120327
531 Ga0207652_10000770 3300025921 Bacteria 30686
532 Ga0207652_10014831 3300025921 Bacteria 6319
533 Ga0207652_10031057 3300025921 Bacteria 4482
534 Ga0207652_10170711 3300025921 Unclassified 1951
535 Ga0207652_10253698 3300025921 Bacteria 1586
536 Ga0207681_10046890 3300025923 Bacteria 2908
537 Ga0207681_10150737 3300025923 Bacteria 1742
538 Ga0207681_10204681 3300025923 Bacteria 1517
539 Ga0207650_10011838 3300025925 Bacteria 6011
540 Ga0207650_10132943 3300025925 Bacteria 1949
541 Ga0207650_10150314 3300025925 Bacteria 1837
542 Ga0207650_10168551 3300025925 Bacteria 1739
543 Ga0207659_10027614 3300025926 Bacteria 3846
544 Ga0207659_10033230 3300025926 Bacteria 3548
545 Ga0207659_10035683 3300025926 Unclassified 3439
546 Ga0207659_10058149 3300025926 Bacteria 2775
547 Ga0207644_10039114 3300025931 Bacteria 3346
548 Ga0207690_10043628 3300025932 Bacteria 2952
549 Ga0207706_10002738 3300025933 Bacteria 17152
550 Ga0207706_10006740 3300025933 Bacteria 10620
551 Ga0207706_10131229 3300025933 Unclassified 2204
552 Ga0207686_10002397 3300025934 Bacteria 10219
553 Ga0207686_10077169 3300025934 Bacteria 2162
554 Ga0207686_10106606 3300025934 Bacteria 1881
555 Ga0207670_10061498 3300025936 Bacteria 2563
556 Ga0207670_10099288 3300025936 Bacteria 2076
557 Ga0207670_10170353 3300025936 Bacteria 1632
558 Ga0207669_10029661 3300025937 Bacteria 3029
559 Ga0207691_10000426 3300025940 Bacteria 41840
560 Ga0207691_10003790 3300025940 Bacteria 14676
561 Ga0207691_10007792 3300025940 Bacteria 10312
562 Ga0207691_10024512 3300025940 Bacteria 5673
563 Ga0207691_10060213 3300025940 Bacteria 3451
564 Ga0207689_10005494 3300025942 Bacteria 11337
565 Ga0207689_10006819 3300025942 Bacteria 10044
566 Ga0207689_10008379 3300025942 Bacteria 9004
567 Ga0207689_10009613 3300025942 Bacteria 8338
568 Ga0207689_10012042 3300025942 Bacteria 7413
569 Ga0207689_10012253 3300025942 Bacteria 7334
570 Ga0207689_10031011 3300025942 Bacteria 4454
571 Ga0207689_10033385 3300025942 Bacteria 4276
572 Ga0207689_10132984 3300025942 Unclassified 2048
573 Ga0207661_10000433 3300025944 Bacteria 26991
574 Ga0207661_10002197 3300025944 Bacteria 13471
575 Ga0207661_10009778 3300025944 Bacteria 6888
576 Ga0207661_10020079 3300025944 Bacteria 4990
577 Ga0207661_10023880 3300025944 Unclassified 4625
578 Ga0207661_10055866 3300025944 Bacteria 3168
579 Ga0207679_10013842 3300025945 Bacteria 5291
580 Ga0207679_10077602 3300025945 Bacteria 2528
581 Ga0207667_10000324 3300025949 Bacteria 66282
582 Ga0207667_10001491 3300025949 Bacteria 29391
583 Ga0207667_10004916 3300025949 Bacteria 16320
584 Ga0207667_10020765 3300025949 Bacteria 7296
585 Ga0207667_10026416 3300025949 Bacteria 6344
586 Ga0207667_10040176 3300025949 Bacteria 4982
587 Ga0207667_10064453 3300025949 Unclassified 3826
588 Ga0207667_10117410 3300025949 Bacteria 2742
589 Ga0207667_10142548 3300025949 Bacteria 2467
590 Ga0207667_10177385 3300025949 Bacteria 2189
591 Ga0207651_10019691 3300025960 Bacteria 4052
592 Ga0207651_10160551 3300025960 Bacteria 1762
593 Ga0207651_10223247 3300025960 Bacteria 1524
594 Ga0207712_10001684 3300025961 Bacteria 14843
595 Ga0207712_10016183 3300025961 Bacteria 4823
596 Ga0207712_10026360 3300025961 Unclassified 3871
597 Ga0207712_10115538 3300025961 Bacteria 2020
598 Ga0207668_10001372 3300025972 Bacteria 14346
599 Ga0207668_10090396 3300025972 Bacteria 2247
600 Ga0207640_10069448 3300025981 Bacteria 2366
601 Ga0207640_10146916 3300025981 Bacteria 1726
602 Ga0207658_10080361 3300025986 Bacteria 2497
603 Ga0207658_10082255 3300025986 Unclassified 2472
604 Ga0207677_10017319 3300026023 Bacteria 4292
605 Ga0207677_10143755 3300026023 Bacteria 1830
606 Ga0207677_10197704 3300026023 Bacteria 1595
607 Ga0207677_10256903 3300026023 Bacteria 1422
608 Ga0207703_10008491 3300026035 Bacteria 8116
609 Ga0207639_10009587 3300026041 Bacteria 6685
610 Ga0207639_10015801 3300026041 Bacteria 5329
611 Ga0207639_10021022 3300026041 Bacteria 4681
612 Ga0207639_10041256 3300026041 Bacteria 3451
613 Ga0207639_10049836 3300026041 Bacteria 3178
614 Ga0207639_10068456 3300026041 Bacteria 2766
615 Ga0207639_10075282 3300026041 Bacteria 2654
616 Ga0207639_10129745 3300026041 Bacteria 2085
617 Ga0207639_10214078 3300026041 Bacteria 1660
618 Ga0207639_10236119 3300026041 Bacteria 1587
619 Ga0207678_10040611 3300026067 Bacteria 4034
620 Ga0207702_10038469 3300026078 Bacteria 4006
621 Ga0207702_10043851 3300026078 Bacteria 3757
622 Ga0207702_10086312 3300026078 Unclassified 2736
623 Ga0207641_10000250 3300026088 Bacteria 68774
624 Ga0207641_10003419 3300026088 Bacteria 14064
625 Ga0207641_10003961 3300026088 Bacteria 12936
626 Ga0207641_10111397 3300026088 Bacteria 2427
627 Ga0207648_10004739 3300026089 Bacteria 13898
628 Ga0207648_10010083 3300026089 Bacteria 8982
629 Ga0207648_10022313 3300026089 Bacteria 5687
630 Ga0207648_10025344 3300026089 Bacteria 5285
631 Ga0207648_10037061 3300026089 Bacteria 4295
632 Ga0207648_10044331 3300026089 Bacteria 3902
633 Ga0207648_10066688 3300026089 Bacteria 3139
634 Ga0207648_10107713 3300026089 Bacteria 2446
635 Ga0207676_10013866 3300026095 Bacteria 5787
636 Ga0207676_10024842 3300026095 Bacteria 4439
637 Ga0207676_10028937 3300026095 Bacteria 4144
638 Ga0207676_10030918 3300026095 Bacteria 4023
639 Ga0207676_10050380 3300026095 Bacteria 3246
640 Ga0207676_10099684 3300026095 Unclassified 2405
641 Ga0207674_10004594 3300026116 Bacteria 16575
642 Ga0207674_10008341 3300026116 Bacteria 11989
643 Ga0207674_10030768 3300026116 Bacteria 5642
644 Ga0207674_10033858 3300026116 Bacteria 5345
645 Ga0207674_10123089 3300026116 Bacteria 2559
646 Ga0207674_10250770 3300026116 Bacteria 1717
647 Ga0207675_100000599 3300026118 Bacteria 35195
648 Ga0207675_100008087 3300026118 Bacteria 9907
649 Ga0207675_100040059 3300026118 Bacteria 4372
650 Ga0207675_100040594 3300026118 Bacteria 4346
651 Ga0207675_100429898 3300026118 Bacteria 1305
652 Ga0207683_10011150 3300026121 Bacteria 7662
653 Ga0207683_10037056 3300026121 Bacteria 4247
654 Ga0207683_10081531 3300026121 Bacteria 2872
655 Ga0207683_10112392 3300026121 Bacteria 2439
656 Ga0207683_10133738 3300026121 Bacteria 2232
657 Ga0207683_10305745 3300026121 Bacteria 1455
658 Ga0207683_10313671 3300026121 Unclassified 1436
659 Ga0207698_10002595 3300026142 Bacteria 10744
660 Ga0207698_10084196 3300026142 Unclassified 2577
661 Ga0207698_10127667 3300026142 Unclassified 2166
662 Ga0207698_10175597 3300026142 Bacteria 1891
663 Ga0207428_10101572 3300027907 Bacteria 2222
664 Ga0268266_10000016 3300028379 Bacteria 629101
665 Ga0268266_10007816 3300028379 Bacteria 9585
666 Ga0268266_10214932 3300028379 Bacteria 1765
667 Ga0268265_10042632 3300028380 Bacteria 3368
668 Ga0268265_10260802 3300028380 Bacteria 1541
669 Ga0268264_10000015 3300028381 Bacteria 508501
670 Ga0268264_10001580 3300028381 Bacteria 21079
671 Ga0268264_10003253 3300028381 Bacteria 14053
672 Ga0268264_10003762 3300028381 Bacteria 13023
673 Ga0268264_10023117 3300028381 Bacteria 5072
674 Ga0268264_10027215 3300028381 Bacteria 4669
675 Ga0268264_10027753 3300028381 Unclassified 4628
676 Ga0268264_10049065 3300028381 Bacteria 3511
677 Ga0268264_10139530 3300028381 Bacteria 2160
678 Ga0307517_10015597 3300028786 Bacteria 10079
679 Ga0307515_10000010 3300028794 Bacteria 651586
680 Ga0307515_10000057 3300028794 Bacteria 261695
681 Ga0265338_10079195 3300028800 Bacteria 2766
682 Ga0265324_10023935 3300029957 Bacteria 2172
683 Ga0307511_10000024 3300030521 Bacteria 112616
684 Ga0265330_10000013 3300031235 Bacteria 177129
685 Ga0265332_10000019 3300031238 Bacteria 222130
686 Ga0265328_10004579 3300031239 Bacteria 5995
687 Ga0265320_10008899 3300031240 Bacteria 6102
688 Ga0265325_10008789 3300031241 Bacteria 5937
689 Ga0265329_10004580 3300031242 Bacteria 5718
690 Ga0265339_10023126 3300031249 Bacteria 3595
691 Ga0265327_10000006 3300031251 Bacteria 693716
692 Ga0265327_10000046 3300031251 Bacteria 280722
693 Ga0265327_10000239 3300031251 Bacteria 109804
694 Ga0265327_10000618 3300031251 Bacteria 58585
695 Ga0265327_10000726 3300031251 Bacteria 51653
696 Ga0265327_10031497 3300031251 Bacteria 2978
697 Ga0265316_10000111 3300031344 Bacteria 87754
698 Ga0307509_10102308 3300031507 Bacteria 2897
699 Ga0307509_10290150 3300031507 Unclassified 1391
700 Ga0307508_10001247 3300031616 Bacteria 29056
701 Ga0265314_10000004 3300031711 Bacteria 939480
702 Ga0265342_10000017 3300031712 Bacteria 180644
703 Ga0307516_10002738 3300031730 Bacteria 23246
704 Ga0307516_10052934 3300031730 Bacteria 3972
705 Ga0307516_10221684 3300031730 Bacteria 1600
706 Ga0307405_10000001 3300031731 Bacteria 1731270
707 Ga0307406_10017842 3300031901 Bacteria 4139
708 Ga0307414_10072314 3300032004 Bacteria 2491
709 Ga0307510_10000042 3300033180 Bacteria 100951
710 Ga0373923_0036518 3300035111 Bacteria 2006
711 Ga0373935_0178506 3300035692 Bacteria 1457
712 Ga0373927_0019498 3300035695 Bacteria 4447
713 Ga0373937_0002128 3300036401 Bacteria 16559
714 Ga0395899_0011662 3300037312 Bacteria 6727
715 Ga0395899_0035366 3300037312 Bacteria 3750
716 Ga0395899_0039531 3300037312 Bacteria 3531
717 Ga0395899_0047757 3300037312 Bacteria 3186
718 Ga0395899_0110395 3300037312 Bacteria 1978
719 Ga0395900_0010950 3300037418 Bacteria 9275
720 Ga0395900_0011050 3300037418 Bacteria 9226
721 Ga0395900_0165276 3300037418 Bacteria 2255
722 Ga0395900_0391710 3300037418 Bacteria 1355
723 Ga0395898_0001697 3300037466 Bacteria 29404
724 Ga0395898_0045358 3300037466 Bacteria 4321
725 Ga0395898_0053988 3300037466 Bacteria 3922
726 Ga0395898_0132518 3300037466 Bacteria 2386
727 Ga0395905_0019301 3300037471 Bacteria 6463
728 Ga0395905_0065228 3300037471 Bacteria 3409
729 Ga0395905_0116178 3300037471 Bacteria 2515
730 Ga0395905_0242968 3300037471 Bacteria 1682
731 Ga0395905_0277475 3300037471 Bacteria 1562
732 Ga0395901_0079052 3300038443 Unclassified 3434
733 Ga0395901_0086677 3300038443 Bacteria 3274
734 Ga0395901_0088589 3300038443 Bacteria 3237
735 Ga0436365_1889064 3300039437 Bacteria 17551
736 Ga0436365_1892627 3300039437 Bacteria 12715
737 Ga0439436_0001903 3300041404 Bacteria 6174
738 Ga0439439_0013021 3300041406 Bacteria 2014
739 Ga0439441_005992 3300042001 Bacteria 1910
740 Ga0439442_005454 3300042002 Unclassified 2544
741 Ga0450923_009304 3300042125 Bacteria 1715
742 Ga0451577_0015486 3300042876 Bacteria 7094
743 Ga0451577_0273802 3300042876 Bacteria 1529
744 Ga0466969_0000132 3300044656 Bacteria 40569
745 Ga0466969_0035045 3300044656 Bacteria 2541
746 Ga0466972_0000095 3300044658 Bacteria 77981
747 Ga0466972_0000205 3300044658 Bacteria 43008
748 Ga0466972_0000946 3300044658 Bacteria 13963
749 Ga0466966_0000239 3300044684 Bacteria 36312
750 Ga0466961_0016781 3300044693 Bacteria 4708
751 Ga0466964_0019963 3300044706 Bacteria 2578
752 Ga0453684_0021683 3300044712 Bacteria 9579
753 Ga0453684_0023757 3300044712 Bacteria 9004
754 Ga0453684_0024881 3300044712 Bacteria 8719
755 Ga0453684_0027420 3300044712 Bacteria 8171
756 Ga0453684_0030202 3300044712 Bacteria 7663
757 Ga0453684_0041437 3300044712 Bacteria 6228
758 Ga0453684_0136521 3300044712 Bacteria 2936
759 Ga0466968_0009777 3300044735 Bacteria 3701
760 Ga0466968_0035392 3300044735 Bacteria 2089
761 Ga0466970_0000529 3300044765 Bacteria 18707
762 Ga0466970_0108824 3300044765 Bacteria 1513
763 Ga0466957_0007324 3300044842 Bacteria 6235
764 Ga0466957_0010280 3300044842 Bacteria 5364
765 Ga0466957_0043397 3300044842 Bacteria 2723
766 Ga0466959_0000031 3300045049 Bacteria 111271
767 Ga0466959_0000501 3300045049 Bacteria 22709
768 Ga0466959_0057953 3300045049 Bacteria 2823
769 Ga0451576_0082567 3300045051 Bacteria 3342
770 Ga0495638_0044936 3300046460 Bacteria 2781
771 Ga0495638_0071636 3300046460 Unclassified 2120
772 Ga0495653_0064989 3300046463 Bacteria 2747
773 Ga0495650_0022359 3300046471 Bacteria 3034
774 Ga0495582_0126018 3300046473 Bacteria 1445
775 Ga0495607_0143172 3300046501 Bacteria 1231
776 Ga0495606_0040930 3300046507 Bacteria 3110
777 Ga0495606_0069818 3300046507 Bacteria 2218
778 Ga0495608_0085406 3300046511 Bacteria 2046
779 Ga0495618_0094930 3300046514 Bacteria 1907
780 Ga0495643_0000392 3300046522 Bacteria 57744
781 Ga0495648_0002775 3300046524 Bacteria 15798
782 Ga0495587_0082808 3300046536 Bacteria 1859
783 Ga0495598_0035309 3300046537 Bacteria 1431
784 Ga0495633_0000090 3300046558 Bacteria 122693
785 Ga0495668_0000138 3300046616 Bacteria 109654
786 Ga0495668_0000268 3300046616 Bacteria 73486
787 Ga0495668_0002233 3300046616 Bacteria 16405
788 Ga0495611_0000086 3300046648 Bacteria 66762
789 Ga0495625_0044931 3300046660 Bacteria 3196
790 Ga0495635_0071624 3300046663 Bacteria 2376
791 Ga0495623_0076293 3300046679 Unclassified 2080
792 Ga0495658_0048030 3300046683 Unclassified 2405
793 Ga0495613_0099140 3300046689 Bacteria 2105
794 Ga0495649_0063746 3300046694 Bacteria 1980
795 Ga0495636_0000082 3300047318 Bacteria 40011
796 Ga0495674_0014078 3300047319 Bacteria 7498
797 Ga0495672_0022692 3300047320 Bacteria 4075
798 Ga0495672_0035473 3300047320 Bacteria 3072
799 Ga0495687_000004 3300047443 Bacteria 779298
800 Ga0495684_0104665 3300047471 Bacteria 2139
801 Ga0495686_0000128 3300047472 Bacteria 156223
802 Ga0495686_0002851 3300047472 Bacteria 15578
803 Ga0495686_0051739 3300047472 Bacteria 2577
804 Ga0495686_0143147 3300047472 Bacteria 1409
805 Ga0495602_0240779 3300048088 Bacteria 1354
806 Ga0496114_0002926 3300048917 Bacteria 13088
807 Ga0496114_0045155 3300048917 Bacteria 3659
808 Ga0496115_0037645 3300048918 Bacteria 3835
809 Ga0496121_0000020 3300048924 Bacteria 498732
810 Ga0496125_0000443 3300048928 Bacteria 75675
811 Ga0496126_0024161 3300048929 Bacteria 5871
812 Ga0496126_0031463 3300048929 Bacteria 5013
813 Ga0501031_0039040 3300049568 Bacteria 3097
814 Ga0501032_0000789 3300049569 Bacteria 25632
815 Ga0501032_0070324 3300049569 Bacteria 2334
816 Ga0501032_0091219 3300049569 Unclassified 2021
817 Ga0501033_0127944 3300049570 Unclassified 1841
818 Ga0501034_0003172 3300049571 Bacteria 18908
819 Ga0501034_0006168 3300049571 Bacteria 12923
820 Ga0501034_0008905 3300049571 Bacteria 10548
821 Ga0501034_0050586 3300049571 Bacteria 4190
822 Ga0501034_0243265 3300049571 Bacteria 1745
823 Ga0501036_0001149 3300049572 Bacteria 20161
824 Ga0501037_0004723 3300049573 Bacteria 9900
825 Ga0501038_0011400 3300049574 Bacteria 8113
826 Ga0501038_0044610 3300049574 Bacteria 3850
827 Ga0501039_0005691 3300049575 Bacteria 9441
828 Ga0501043_0011111 3300049579 Bacteria 7054
829 Ga0501043_0013354 3300049579 Bacteria 6422
830 Ga0501043_0026299 3300049579 Bacteria 4566
831 Ga0501043_0026464 3300049579 Bacteria 4550
832 Ga0501043_0087724 3300049579 Bacteria 2445
833 Ga0501046_0012945 3300049580 Bacteria 7088
834 Ga0501047_0003691 3300049581 Bacteria 14416
835 Ga0501047_0007639 3300049581 Bacteria 10181
836 Ga0501047_0010562 3300049581 Bacteria 8732
837 Ga0501047_0064339 3300049581 Bacteria 3537
838 Ga0501047_0088305 3300049581 Bacteria 2977
839 Ga0501048_0003076 3300049582 Bacteria 12717
840 Ga0501070_0090044 3300049586 Bacteria 2539
841 Ga0501070_0097839 3300049586 Bacteria 2427
842 Ga0501072_0153911 3300049588 Bacteria 1834
843 Ga0501073_0002127 3300049589 Bacteria 14843
844 Ga0501073_0010834 3300049589 Bacteria 6677
845 Ga0501074_0000268 3300049590 Bacteria 29703
846 Ga0501074_0054393 3300049590 Bacteria 2887
847 Ga0501235_006460 3300049669 Bacteria 2554
848 Ga0501257_012348 3300049686 Bacteria 1954
849 Ga0501225_0000589 3300049705 Bacteria 11341
850 Ga0501079_0028531 3300049741 Bacteria 4283
851 Ga0501080_0009651 3300049742 Bacteria 8812
852 Ga0501080_0130042 3300049742 Bacteria 2331
853 Ga0501083_0002364 3300049744 Bacteria 12916
854 Ga0501241_000384 3300049758 Bacteria 9683
855 Ga0501266_003293 3300049763 Bacteria 2009
856 Ga0501035_0006540 3300049822 Bacteria 10934
857 Ga0501035_0037819 3300049822 Bacteria 4368
858 Ga0501035_0095205 3300049822 Bacteria 2618
859 Ga0501035_0121557 3300049822 Unclassified 2282
860 Ga0501044_0006312 3300049823 Bacteria 13108
861 Ga0501044_0008384 3300049823 Bacteria 11335
862 Ga0501044_0009325 3300049823 Bacteria 10708
863 Ga0501044_0020523 3300049823 Bacteria 7056
864 Ga0501044_0037083 3300049823 Bacteria 5097
865 Ga0501044_0171853 3300049823 Bacteria 2138
866 Ga0501284_00008 3300050005 Bacteria 143517
867 nmdc:mga0k408_28094_c1 3300050493 Bacteria 3197
868 nmdc:mga0k408_67998_c1 3300050493 Bacteria 2077
869 nmdc:mga05p37_2260_c1 3300050507 Bacteria 22440
870 nmdc:mga05p37_239788_c1 3300050507 Bacteria 2181
871 nmdc:mga09592_29361_c1 3300050508 Bacteria 4574
872 nmdc:mga09592_33001_c1 3300050508 Bacteria 4319
873 nmdc:mga0qj67_49668_c1 3300050509 Bacteria 3315
874 nmdc:mga0qj67_8348_c1 3300050509 Bacteria 7679
875 nmdc:mga06r32_137630_c1 3300050510 Bacteria 2417
876 nmdc:mga06r32_25308_c1 3300050510 Bacteria 5521
877 nmdc:mga08y16_5732_c1 3300050511 Bacteria 13017
878 nmdc:mga08y16_66728_c1 3300050511 Bacteria 3755
879 Ga0500578_0000119 3300053086 Bacteria 95584
880 Ga0500644_0000279 3300053088 Bacteria 28337
881 Ga0500583_0000010 3300053092 Bacteria 160546
882 Ga0500583_0003806 3300053092 Bacteria 4821
883 Ga0500641_0000073 3300053096 Bacteria 40903
884 Ga0500641_0036900 3300053096 Bacteria 1957
885 Ga0500569_000815 3300053109 Bacteria 5503
886 Ga0500642_0005679 3300053130 Bacteria 4048
887 Ga0500658_0001824 3300053134 Bacteria 8394
888 Ga0500568_0000641 3300053139 Bacteria 25249
889 Ga0500568_0005236 3300053139 Bacteria 6742
890 Ga0500577_0000916 3300053142 Bacteria 7637
891 Ga0500588_0001353 3300053146 Bacteria 4631
892 Ga0500589_011051 3300053147 Bacteria 3890
893 Ga0500604_0023314 3300053151 Bacteria 1765
894 Ga0500616_0002914 3300053153 Bacteria 13661
895 Ga0500616_0022029 3300053153 Bacteria 3563
896 Ga0500616_0061009 3300053153 Bacteria 1954
897 Ga0500622_0000176 3300053156 Bacteria 69125
898 Ga0500622_0000488 3300053156 Bacteria 37136
899 Ga0500622_0003314 3300053156 Bacteria 10885
900 Ga0500622_0047892 3300053156 Bacteria 2206
901 Ga0500627_0003198 3300053158 Bacteria 5026
902 Ga0500633_0006823 3300053160 Bacteria 2830
903 Ga0500636_0032081 3300053177 Bacteria 3109
904 Ga0500611_000020 3300053727 Bacteria 105250
905 Ga0501082_0040431 3300060353 Bacteria 4022
906 Ga0466962_0055837 3300061719 Bacteria 1887

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0143172 Ga0495607_0143172_190_1221 331
2 3300047320 Ga0495672_0035473 Ga0495672_0035473_41_1213 360
3 3300026118 Ga0207675_100429898 Ga0207675_1004298981 362
4 3300044765 Ga0466970_0108824 Ga0466970_0108824_39_1223 367
5 3300005327 Ga0070658_10179516 Ga0070658_101795161 373
6 3300005339 Ga0070660_100072985 Ga0070660_1000729854 373
7 3300013104 Ga0157370_10019741 Ga0157370_100197415 373
8 3300013104 Ga0157370_10101118 Ga0157370_101011182 373
9 3300025961 Ga0207712_10026360 Ga0207712_100263603 374
10 3300053139 Ga0500568_0000641 Ga0500568_0000641_15907_17163 374
11 3300005334 Ga0068869_100084756 Ga0068869_1000847562 375
12 3300005618 Ga0068864_100153429 Ga0068864_1001534292 375
13 3300005843 Ga0068860_100029257 Ga0068860_1000292572 375
14 3300009553 Ga0105249_10002037 Ga0105249_100020378 375
15 3300013306 Ga0163162_10253355 Ga0163162_102533552 375
16 3300014968 Ga0157379_10016875 Ga0157379_100168752 375
17 3300025900 Ga0207710_10002430 Ga0207710_100024305 375
18 3300025942 Ga0207689_10132984 Ga0207689_101329842 375
19 3300026095 Ga0207676_10099684 Ga0207676_100996842 375
20 3300047472 Ga0495686_0143147 Ga0495686_0143147_13_1269 375
21 3300005578 Ga0068854_100031903 Ga0068854_1000319034 376
22 3300006195 Ga0075366_10091015 Ga0075366_100910152 376
23 3300049588 Ga0501072_0153911 Ga0501072_0153911_600_1811 376
24 3300006844 Ga0075428_100102763 Ga0075428_1001027632 378
25 3300006880 Ga0075429_100027628 Ga0075429_1000276286 378
26 3300009094 Ga0111539_10022168 Ga0111539_100221683 378
27 3300013102 Ga0157371_10000651 Ga0157371_1000065131 378
28 3300033180 Ga0307510_10000042 Ga0307510_1000004270 378
29 3300046507 Ga0495606_0040930 Ga0495606_0040930_455_1708 378
30 3300050510 nmdc:mga06r32_25308_c1 nmdc:mga06r32_25308_c1_1122_2387 378
31 3300050511 nmdc:mga08y16_66728_c1 nmdc:mga08y16_66728_c1_405_1673 378
32 3300003322 rootL2_10163823 rootL2_101638231 379
33 3300005719 Ga0068861_100256002 Ga0068861_1002560022 379
34 3300025899 Ga0207642_10012939 Ga0207642_100129392 379
35 3300026089 Ga0207648_10004739 Ga0207648_100047395 379
36 3300053139 Ga0500568_0005236 Ga0500568_0005236_3949_5256 379
37 3300030521 Ga0307511_10000024 Ga0307511_100000244 380
38 3300005331 Ga0070670_100038903 Ga0070670_1000389033 381
39 3300025936 Ga0207670_10099288 Ga0207670_100992882 381
40 3300025960 Ga0207651_10019691 Ga0207651_100196912 381
41 3300027907 Ga0207428_10101572 Ga0207428_101015722 381
42 3300005577 Ga0068857_100004830 Ga0068857_1000048305 382
43 3300005578 Ga0068854_100073428 Ga0068854_1000734283 382
44 3300005614 Ga0068856_100035282 Ga0068856_1000352824 382
45 3300005616 Ga0068852_100006208 Ga0068852_1000062082 382
46 3300009545 Ga0105237_10007600 Ga0105237_1000760011 382
47 3300013307 Ga0157372_10000676 Ga0157372_1000067637 382
48 3300025904 Ga0207647_10016694 Ga0207647_100166942 382
49 3300025914 Ga0207671_10007560 Ga0207671_100075607 382
50 3300025949 Ga0207667_10001491 Ga0207667_100014918 382
51 3300025981 Ga0207640_10069448 Ga0207640_100694481 382
52 3300026041 Ga0207639_10075282 Ga0207639_100752822 382
53 3300026116 Ga0207674_10004594 Ga0207674_100045945 382
54 3300026142 Ga0207698_10002595 Ga0207698_100025959 382
55 3300005331 Ga0070670_100080565 Ga0070670_1000805652 383
56 3300005356 Ga0070674_100145194 Ga0070674_1001451941 383
57 3300006237 Ga0097621_100000487 Ga0097621_1000004875 383
58 3300009177 Ga0105248_10040274 Ga0105248_100402744 383
59 3300013297 Ga0157378_10004726 Ga0157378_100047265 383
60 3300013306 Ga0163162_10000856 Ga0163162_100008565 383
61 3300014325 Ga0163163_10000560 Ga0163163_100005602 383
62 3300014968 Ga0157379_10048438 Ga0157379_100484382 383
63 3300014969 Ga0157376_10003607 Ga0157376_100036075 383
64 3300017792 Ga0163161_10001190 Ga0163161_1000119010 383
65 3300025925 Ga0207650_10132943 Ga0207650_101329432 383
66 3300026121 Ga0207683_10037056 Ga0207683_100370562 383
67 3300044712 Ga0453684_0027420 Ga0453684_0027420_2428_3612 383
68 3300048917 Ga0496114_0045155 Ga0496114_0045155_460_1719 383
69 3300003320 rootH2_10056261 rootH2_100562612 384
70 3300003320 rootH2_10100645 rootH2_101006453 384
71 3300005367 Ga0070667_100136993 Ga0070667_1001369932 384
72 3300005614 Ga0068856_100131052 Ga0068856_1001310522 384
73 3300014326 Ga0157380_10068775 Ga0157380_100687752 384
74 3300025923 Ga0207681_10150737 Ga0207681_101507371 384
75 3300025925 Ga0207650_10150314 Ga0207650_101503142 384
76 3300025942 Ga0207689_10008379 Ga0207689_100083793 384
77 3300026078 Ga0207702_10043851 Ga0207702_100438512 384
78 3300026116 Ga0207674_10250770 Ga0207674_102507702 384
79 3300047472 Ga0495686_0000128 Ga0495686_0000128_17199_18455 384
80 3300049571 Ga0501034_0008905 Ga0501034_0008905_2887_4062 384
81 3300053096 Ga0500641_0036900 Ga0500641_0036900_390_1646 384
82 3300042876 Ga0451577_0273802 Ga0451577_0273802_268_1452 385
83 3300044712 Ga0453684_0023757 Ga0453684_0023757_1708_2892 385
84 3300005578 Ga0068854_100144895 Ga0068854_1001448952 386
85 3300013104 Ga0157370_10010139 Ga0157370_100101394 386
86 3300049568 Ga0501031_0039040 Ga0501031_0039040_899_2155 386
87 3300049569 Ga0501032_0070324 Ga0501032_0070324_716_1972 386
88 3300049571 Ga0501034_0050586 Ga0501034_0050586_1872_3128 386
89 3300049574 Ga0501038_0044610 Ga0501038_0044610_1224_2480 386
90 3300049579 Ga0501043_0026464 Ga0501043_0026464_1842_3098 386
91 3300049822 Ga0501035_0037819 Ga0501035_0037819_44_1300 386
92 3300049823 Ga0501044_0020523 Ga0501044_0020523_4565_5821 386
93 3300005329 Ga0070683_100001844 Ga0070683_10000184413 387
94 3300005535 Ga0070684_100014413 Ga0070684_1000144136 387
95 3300005563 Ga0068855_100000406 Ga0068855_10000040622 387
96 3300005577 Ga0068857_100132320 Ga0068857_1001323202 387
97 3300005578 Ga0068854_100208667 Ga0068854_1002086671 387
98 3300005617 Ga0068859_100187243 Ga0068859_1001872432 387
99 3300005843 Ga0068860_100063750 Ga0068860_1000637502 387
100 3300006931 Ga0097620_100187246 Ga0097620_1001872462 387
101 3300009093 Ga0105240_10008492 Ga0105240_100084922 387
102 3300009545 Ga0105237_10006346 Ga0105237_100063465 387
103 3300013104 Ga0157370_10067521 Ga0157370_100675212 387
104 3300013297 Ga0157378_10025100 Ga0157378_100251003 387
105 3300013306 Ga0163162_10007340 Ga0163162_100073409 387
106 3300013306 Ga0163162_10141353 Ga0163162_101413532 387
107 3300013307 Ga0157372_10041530 Ga0157372_100415303 387
108 3300025913 Ga0207695_10000051 Ga0207695_10000051225 387
109 3300025913 Ga0207695_10000056 Ga0207695_1000005616 387
110 3300025913 Ga0207695_10000081 Ga0207695_10000081225 387
111 3300025914 Ga0207671_10000150 Ga0207671_1000015031 387
112 3300025944 Ga0207661_10002197 Ga0207661_1000219711 387
113 3300025949 Ga0207667_10000324 Ga0207667_1000032419 387
114 3300028381 Ga0268264_10049065 Ga0268264_100490652 387
115 3300047320 Ga0495672_0022692 Ga0495672_0022692_1199_2455 387
116 3300005843 Ga0068860_100009247 Ga0068860_1000092471 388
117 3300005985 Ga0081539_10012887 Ga0081539_100128876 388
118 3300009551 Ga0105238_10082937 Ga0105238_100829373 388
119 3300013307 Ga0157372_10000361 Ga0157372_1000036118 388
120 3300025904 Ga0207647_10077222 Ga0207647_100772222 388
121 3300044656 Ga0466969_0035045 Ga0466969_0035045_90_1346 388
122 3300044693 Ga0466961_0016781 Ga0466961_0016781_1405_2661 388
123 3300045049 Ga0466959_0000501 Ga0466959_0000501_1738_2994 388
124 3300005563 Ga0068855_100143074 Ga0068855_1001430742 389
125 3300009093 Ga0105240_10064033 Ga0105240_100640333 389
126 3300009545 Ga0105237_10143287 Ga0105237_101432871 389
127 3300010375 Ga0105239_10000263 Ga0105239_1000026334 389
128 3300025914 Ga0207671_10085591 Ga0207671_100855911 389
129 3300025949 Ga0207667_10117410 Ga0207667_101174102 389
130 3300031507 Ga0307509_10102308 Ga0307509_101023082 389
131 3300031730 Ga0307516_10052934 Ga0307516_100529341 389
132 3300042002 Ga0439442_005454 Ga0439442_005454_805_2061 389
133 3300042876 Ga0451577_0015486 Ga0451577_0015486_5141_6400 389
134 3300050005 Ga0501284_00008 Ga0501284_00008_57937_59193 389
135 iso_pu_bacteria 2818991442 2819573758 389
136 iso_pu_bacteria 2818991460 2819680515 389
137 iso_pu_bacteria 2821136567 2821137092 389
138 iso_pu_bacteria 2840677318 2840677608 389
139 iso_pu_bacteria 2884791551 2884798073 389
140 iso_pu_bacteria 2890804823 2890807106 389
141 iso_pu_bacteria 2896085136 2896085426 389
142 iso_pu_bacteria 2904467357 2904468166 389
143 iso_pu_bacteria 2929177148 2929182809 389
144 iso_pu_bacteria 2929921140 2929923394 389
145 iso_pu_bacteria 2945977869 2945978763 389
146 iso_pu_bacteria 2946013367 2946015370 389
147 iso_pu_bacteria 8003151029 8003152795 389
148 3300005293 Ga0065715_10098173 Ga0065715_100981733 390
149 3300005331 Ga0070670_100026565 Ga0070670_1000265653 390
150 3300005336 Ga0070680_100011958 Ga0070680_1000119584 390
151 3300005340 Ga0070689_100039392 Ga0070689_1000393922 390
152 3300005341 Ga0070691_10001047 Ga0070691_100010478 390
153 3300005353 Ga0070669_100021311 Ga0070669_1000213114 390
154 3300005354 Ga0070675_100007148 Ga0070675_1000071487 390
155 3300005364 Ga0070673_100013654 Ga0070673_1000136542 390
156 3300005365 Ga0070688_100005858 Ga0070688_1000058585 390
157 3300005457 Ga0070662_100009392 Ga0070662_1000093922 390
158 3300005535 Ga0070684_100055619 Ga0070684_1000556192 390
159 3300005539 Ga0068853_100001291 Ga0068853_10000129121 390
160 3300005548 Ga0070665_100000008 Ga0070665_100000008463 390
161 3300005548 Ga0070665_100109195 Ga0070665_1001091952 390
162 3300005577 Ga0068857_100015114 Ga0068857_1000151146 390
163 3300005617 Ga0068859_100058275 Ga0068859_1000582753 390
164 3300005617 Ga0068859_100176293 Ga0068859_1001762932 390
165 3300005618 Ga0068864_100056257 Ga0068864_1000562573 390
166 3300005843 Ga0068860_100000059 Ga0068860_10000005967 390
167 3300005843 Ga0068860_100034335 Ga0068860_1000343351 390
168 3300005844 Ga0068862_100061946 Ga0068862_1000619462 390
169 3300006931 Ga0097620_100058269 Ga0097620_1000582692 390
170 3300006931 Ga0097620_100176303 Ga0097620_1001763032 390
171 3300009093 Ga0105240_10002681 Ga0105240_100026815 390
172 3300009093 Ga0105240_10009313 Ga0105240_100093135 390
173 3300009093 Ga0105240_10009560 Ga0105240_100095603 390
174 3300009094 Ga0111539_10006433 Ga0111539_1000643311 390
175 3300009174 Ga0105241_10010072 Ga0105241_100100724 390
176 3300009545 Ga0105237_10000128 Ga0105237_1000012843 390
177 3300009545 Ga0105237_10007857 Ga0105237_100078578 390
178 3300009545 Ga0105237_10139842 Ga0105237_101398424 390
179 3300009551 Ga0105238_10023664 Ga0105238_100236645 390
180 3300010375 Ga0105239_10000748 Ga0105239_1000074852 390
181 3300010375 Ga0105239_10003037 Ga0105239_1000303723 390
182 3300010375 Ga0105239_10025164 Ga0105239_100251642 390
183 3300013104 Ga0157370_10060071 Ga0157370_100600714 390
184 3300013306 Ga0163162_10000164 Ga0163162_1000016428 390
185 3300013306 Ga0163162_10060105 Ga0163162_100601052 390
186 3300013306 Ga0163162_10151709 Ga0163162_101517092 390
187 3300013307 Ga0157372_10143700 Ga0157372_101437004 390
188 3300014326 Ga0157380_10020668 Ga0157380_100206683 390
189 3300014745 Ga0157377_10004008 Ga0157377_100040084 390
190 3300025911 Ga0207654_10020576 Ga0207654_100205763 390
191 3300025912 Ga0207707_10003165 Ga0207707_100031659 390
192 3300025913 Ga0207695_10000446 Ga0207695_1000044657 390
193 3300025913 Ga0207695_10000873 Ga0207695_1000087331 390
194 3300025913 Ga0207695_10011272 Ga0207695_100112723 390
195 3300025913 Ga0207695_10025625 Ga0207695_100256256 390
196 3300025914 Ga0207671_10001329 Ga0207671_1000132913 390
197 3300025914 Ga0207671_10007853 Ga0207671_100078539 390
198 3300025917 Ga0207660_10097456 Ga0207660_100974561 390
199 3300025921 Ga0207652_10031057 Ga0207652_100310574 390
200 3300025926 Ga0207659_10033230 Ga0207659_100332302 390
201 3300025926 Ga0207659_10035683 Ga0207659_100356833 390
202 3300025933 Ga0207706_10002738 Ga0207706_100027385 390
203 3300025940 Ga0207691_10060213 Ga0207691_100602132 390
204 3300026041 Ga0207639_10009587 Ga0207639_100095872 390
205 3300026041 Ga0207639_10129745 Ga0207639_101297452 390
206 3300026089 Ga0207648_10044331 Ga0207648_100443312 390
207 3300026095 Ga0207676_10013866 Ga0207676_100138665 390
208 3300026116 Ga0207674_10030768 Ga0207674_100307685 390
209 3300026118 Ga0207675_100000599 Ga0207675_10000059919 390
210 3300028379 Ga0268266_10000016 Ga0268266_10000016461 390
211 3300028380 Ga0268265_10042632 Ga0268265_100426322 390
212 3300028381 Ga0268264_10000015 Ga0268264_10000015406 390
213 3300028381 Ga0268264_10003253 Ga0268264_1000325312 390
214 3300028381 Ga0268264_10023117 Ga0268264_100231172 390
215 3300028786 Ga0307517_10015597 Ga0307517_100155974 390
216 3300044706 Ga0466964_0019963 Ga0466964_0019963_1071_2327 390
217 3300046648 Ga0495611_0000086 Ga0495611_0000086_20362_21618 390
218 3300047443 Ga0495687_000004 Ga0495687_000004_620394_621650 390
219 3300049586 Ga0501070_0090044 Ga0501070_0090044_734_1990 390
220 3300049589 Ga0501073_0010834 Ga0501073_0010834_2640_3896 390
221 3300049590 Ga0501074_0054393 Ga0501074_0054393_492_1748 390
222 3300050493 nmdc:mga0k408_28094_c1 nmdc:mga0k408_28094_c1_1903_3159 390
223 3300050511 nmdc:mga08y16_5732_c1 nmdc:mga08y16_5732_c1_11221_12477 390
224 3300053092 Ga0500583_0000010 Ga0500583_0000010_127518_128774 390
225 3300053092 Ga0500583_0003806 Ga0500583_0003806_1608_2864 390
226 3300053147 Ga0500589_011051 Ga0500589_011051_2412_3668 390
227 3300053151 Ga0500604_0023314 Ga0500604_0023314_415_1671 390
228 3300053156 Ga0500622_0047892 Ga0500622_0047892_457_1713 390
229 3300060353 Ga0501082_0040431 Ga0501082_0040431_82_1395 390
230 iso_pu_bacteria 2883068021 2883072988 390
231 iso_pu_bacteria 2896109856 2896113612 390
232 iso_pu_bacteria 2929239360 2929241373 390
233 3300005330 Ga0070690_100016948 Ga0070690_1000169483 391
234 3300005334 Ga0068869_100034075 Ga0068869_1000340752 391
235 3300005335 Ga0070666_10026338 Ga0070666_100263382 391
236 3300005337 Ga0070682_100013032 Ga0070682_1000130323 391
237 3300005338 Ga0068868_100008559 Ga0068868_1000085594 391
238 3300005365 Ga0070688_100132491 Ga0070688_1001324912 391
239 3300005367 Ga0070667_100012198 Ga0070667_1000121983 391
240 3300005367 Ga0070667_100156773 Ga0070667_1001567731 391
241 3300005456 Ga0070678_100021106 Ga0070678_1000211064 391
242 3300005457 Ga0070662_100002931 Ga0070662_1000029319 391
243 3300005457 Ga0070662_100016106 Ga0070662_1000161065 391
244 3300005459 Ga0068867_100074463 Ga0068867_1000744632 391
245 3300005535 Ga0070684_100001070 Ga0070684_10000107011 391
246 3300005539 Ga0068853_100006484 Ga0068853_1000064843 391
247 3300005563 Ga0068855_100111470 Ga0068855_1001114703 391
248 3300005564 Ga0070664_100008883 Ga0070664_1000088836 391
249 3300005564 Ga0070664_100061377 Ga0070664_1000613772 391
250 3300005577 Ga0068857_100004345 Ga0068857_1000043456 391
251 3300005578 Ga0068854_100022079 Ga0068854_1000220792 391
252 3300006237 Ga0097621_100071294 Ga0097621_1000712943 391
253 3300006237 Ga0097621_100089616 Ga0097621_1000896162 391
254 3300006358 Ga0068871_100189196 Ga0068871_1001891962 391
255 3300009174 Ga0105241_10133889 Ga0105241_101338892 391
256 3300009176 Ga0105242_10027845 Ga0105242_100278452 391
257 3300009553 Ga0105249_10119485 Ga0105249_101194851 391
258 3300010375 Ga0105239_10129240 Ga0105239_101292402 391
259 3300013296 Ga0157374_10000009 Ga0157374_10000009394 391
260 3300013296 Ga0157374_10002136 Ga0157374_100021368 391
261 3300013306 Ga0163162_10000413 Ga0163162_1000041315 391
262 3300013308 Ga0157375_10019779 Ga0157375_100197794 391
263 3300014745 Ga0157377_10034815 Ga0157377_100348152 391
264 3300014745 Ga0157377_10147612 Ga0157377_101476121 391
265 3300014969 Ga0157376_10007147 Ga0157376_100071476 391
266 3300014969 Ga0157376_10065638 Ga0157376_100656382 391
267 3300025315 Ga0207697_10081107 Ga0207697_100811071 391
268 3300025907 Ga0207645_10008549 Ga0207645_100085492 391
269 3300025913 Ga0207695_10147130 Ga0207695_101471303 391
270 3300025919 Ga0207657_10233751 Ga0207657_102337511 391
271 3300025920 Ga0207649_10037474 Ga0207649_100374742 391
272 3300025933 Ga0207706_10006740 Ga0207706_1000674010 391
273 3300025934 Ga0207686_10077169 Ga0207686_100771692 391
274 3300025942 Ga0207689_10009613 Ga0207689_100096138 391
275 3300025942 Ga0207689_10012042 Ga0207689_100120423 391
276 3300025944 Ga0207661_10000433 Ga0207661_1000043322 391
277 3300025961 Ga0207712_10115538 Ga0207712_101155382 391
278 3300025986 Ga0207658_10080361 Ga0207658_100803612 391
279 3300026023 Ga0207677_10017319 Ga0207677_100173191 391
280 3300026041 Ga0207639_10049836 Ga0207639_100498361 391
281 3300026089 Ga0207648_10025344 Ga0207648_100253443 391
282 3300026089 Ga0207648_10037061 Ga0207648_100370614 391
283 3300026116 Ga0207674_10008341 Ga0207674_100083416 391
284 3300026121 Ga0207683_10081531 Ga0207683_100815312 391
285 3300028380 Ga0268265_10260802 Ga0268265_102608021 391
286 3300035111 Ga0373923_0036518 Ga0373923_0036518_499_1755 391
287 3300035692 Ga0373935_0178506 Ga0373935_0178506_156_1412 391
288 3300036401 Ga0373937_0002128 Ga0373937_0002128_5041_6297 391
289 3300044658 Ga0466972_0000946 Ga0466972_0000946_3897_5153 391
290 3300044735 Ga0466968_0035392 Ga0466968_0035392_507_1763 391
291 3300046460 Ga0495638_0044936 Ga0495638_0044936_530_1786 391
292 3300046460 Ga0495638_0071636 Ga0495638_0071636_55_1311 391
293 3300046463 Ga0495653_0064989 Ga0495653_0064989_1324_2580 391
294 3300046511 Ga0495608_0085406 Ga0495608_0085406_560_1816 391
295 3300046514 Ga0495618_0094930 Ga0495618_0094930_325_1581 391
296 3300046524 Ga0495648_0002775 Ga0495648_0002775_9739_10995 391
297 3300046536 Ga0495587_0082808 Ga0495587_0082808_35_1291 391
298 3300046663 Ga0495635_0071624 Ga0495635_0071624_203_1459 391
299 3300046689 Ga0495613_0099140 Ga0495613_0099140_672_1928 391
300 3300047471 Ga0495684_0104665 Ga0495684_0104665_322_1578 391
301 3300049571 Ga0501034_0243265 Ga0501034_0243265_488_1720 391
302 3300053086 Ga0500578_0000119 Ga0500578_0000119_91035_92291 391
303 3300053156 Ga0500622_0003314 Ga0500622_0003314_9574_10830 391
304 3300003323 rootH1_10005865 rootH1_1000586511 392
305 3300005331 Ga0070670_100027222 Ga0070670_1000272223 392
306 3300005336 Ga0070680_100130702 Ga0070680_1001307022 392
307 3300005336 Ga0070680_100217863 Ga0070680_1002178632 392
308 3300005339 Ga0070660_100092127 Ga0070660_1000921273 392
309 3300005456 Ga0070678_100061577 Ga0070678_1000615772 392
310 3300005458 Ga0070681_10065886 Ga0070681_100658862 392
311 3300005563 Ga0068855_100056531 Ga0068855_1000565315 392
312 3300005563 Ga0068855_100064457 Ga0068855_1000644574 392
313 3300005563 Ga0068855_100183932 Ga0068855_1001839324 392
314 3300005577 Ga0068857_100080583 Ga0068857_1000805832 392
315 3300005616 Ga0068852_100020725 Ga0068852_1000207255 392
316 3300006195 Ga0075366_10017853 Ga0075366_100178532 392
317 3300009093 Ga0105240_10000767 Ga0105240_100007677 392
318 3300009147 Ga0114129_10003306 Ga0114129_1000330617 392
319 3300009174 Ga0105241_10018003 Ga0105241_100180035 392
320 3300009174 Ga0105241_10024675 Ga0105241_100246753 392
321 3300009545 Ga0105237_10040418 Ga0105237_100404183 392
322 3300009545 Ga0105237_10112647 Ga0105237_101126472 392
323 3300009551 Ga0105238_10013311 Ga0105238_100133117 392
324 3300010375 Ga0105239_10002485 Ga0105239_100024857 392
325 3300013100 Ga0157373_10004754 Ga0157373_100047544 392
326 3300013102 Ga0157371_10053023 Ga0157371_100530234 392
327 3300013104 Ga0157370_10032940 Ga0157370_100329404 392
328 3300013306 Ga0163162_10000697 Ga0163162_100006977 392
329 3300013307 Ga0157372_10155238 Ga0157372_101552382 392
330 3300014969 Ga0157376_10179106 Ga0157376_101791062 392
331 3300017792 Ga0163161_10108419 Ga0163161_101084192 392
332 3300025246 Ga0209646_1002397 Ga0209646_10023972 392
333 3300025909 Ga0207705_10100159 Ga0207705_101001592 392
334 3300025911 Ga0207654_10009898 Ga0207654_100098983 392
335 3300025911 Ga0207654_10014620 Ga0207654_100146203 392
336 3300025912 Ga0207707_10084908 Ga0207707_100849082 392
337 3300025913 Ga0207695_10000425 Ga0207695_1000042565 392
338 3300025919 Ga0207657_10021296 Ga0207657_100212961 392
339 3300025921 Ga0207652_10014831 Ga0207652_100148316 392
340 3300025921 Ga0207652_10170711 Ga0207652_101707111 392
341 3300025949 Ga0207667_10004916 Ga0207667_100049161 392
342 3300025949 Ga0207667_10020765 Ga0207667_100207654 392
343 3300025949 Ga0207667_10064453 Ga0207667_100644532 392
344 3300026041 Ga0207639_10021022 Ga0207639_100210225 392
345 3300026067 Ga0207678_10040611 Ga0207678_100406113 392
346 3300026078 Ga0207702_10086312 Ga0207702_100863124 392
347 3300026116 Ga0207674_10123089 Ga0207674_101230892 392
348 3300026142 Ga0207698_10084196 Ga0207698_100841962 392
349 3300028794 Ga0307515_10000057 Ga0307515_10000057109 392
350 3300031616 Ga0307508_10001247 Ga0307508_1000124723 392
351 3300031730 Ga0307516_10002738 Ga0307516_1000273811 392
352 3300035695 Ga0373927_0019498 Ga0373927_0019498_1244_2500 392
353 3300041404 Ga0439436_0001903 Ga0439436_0001903_2541_3797 392
354 3300041406 Ga0439439_0013021 Ga0439439_0013021_409_1665 392
355 3300044656 Ga0466969_0000132 Ga0466969_0000132_21898_23154 392
356 3300044658 Ga0466972_0000095 Ga0466972_0000095_43823_45079 392
357 3300044684 Ga0466966_0000239 Ga0466966_0000239_11780_13036 392
358 3300044712 Ga0453684_0021683 Ga0453684_0021683_3910_5106 392
359 3300044735 Ga0466968_0009777 Ga0466968_0009777_934_2190 392
360 3300044842 Ga0466957_0007324 Ga0466957_0007324_4145_5401 392
361 3300044842 Ga0466957_0010280 Ga0466957_0010280_859_2115 392
362 3300045049 Ga0466959_0000031 Ga0466959_0000031_4913_6169 392
363 3300046660 Ga0495625_0044931 Ga0495625_0044931_204_1466 392
364 3300046694 Ga0495649_0063746 Ga0495649_0063746_668_1930 392
365 3300047472 Ga0495686_0051739 Ga0495686_0051739_1083_2339 392
366 3300049686 Ga0501257_012348 Ga0501257_012348_181_1437 392
367 3300049705 Ga0501225_0000589 Ga0501225_0000589_6407_7663 392
368 3300050493 nmdc:mga0k408_67998_c1 nmdc:mga0k408_67998_c1_445_1758 392
369 3300050507 nmdc:mga05p37_2260_c1 nmdc:mga05p37_2260_c1_4833_6095 392
370 3300053146 Ga0500588_0001353 Ga0500588_0001353_743_2005 392
371 3300053727 Ga0500611_000020 Ga0500611_000020_7558_8814 392
372 3300061719 Ga0466962_0055837 Ga0466962_0055837_38_1294 392
373 3300001979 JGI24740J21852_10000358 JGI24740J21852_100003583 393
374 3300001989 JGI24739J22299_10000433 JGI24739J22299_100004332 393
375 3300002738 JGI25154J39366_1000007 JGI25154J39366_100000758 393
376 3300003215 JGI25153J46596_10001828 JGI25153J46596_100018289 393
377 3300003215 JGI25153J46596_10018062 JGI25153J46596_100180622 393
378 3300003320 rootH2_10020884 rootH2_100208842 393
379 3300003323 rootH1_10046794 rootH1_100467946 393
380 3300003354 JGI25160J50197_1001383 JGI25160J50197_100138310 393
381 3300003354 JGI25160J50197_1011746 JGI25160J50197_10117462 393
382 3300003354 JGI25160J50197_1015956 JGI25160J50197_10159562 393
383 3300003771 Ga0055526_1011071 Ga0055526_10110712 393
384 3300003790 Ga0055528_1015931 Ga0055528_10159312 393
385 3300003791 Ga0055530_10001252 Ga0055530_1000125218 393
386 3300003794 Ga0055531_10031189 Ga0055531_100311891 393
387 3300005262 Ga0065165_1000010 Ga0065165_1000010218 393
388 3300005262 Ga0065165_1009228 Ga0065165_10092284 393
389 3300013104 Ga0157370_10027186 Ga0157370_100271863 393
390 3300013306 Ga0163162_10237579 Ga0163162_102375792 393
391 3300015265 Ga0182005_1000215 Ga0182005_100021519 393
392 3300017792 Ga0163161_10006822 Ga0163161_100068223 393
393 3300025208 Ga0209436_110381 Ga0209436_1103812 393
394 3300025246 Ga0209646_1000002 Ga0209646_1000002664 393
395 3300025250 Ga0209026_1000545 Ga0209026_100054516 393
396 3300025273 Ga0209673_1000082 Ga0209673_1000082191 393
397 3300025284 Ga0209130_1004066 Ga0209130_10040664 393
398 3300025295 Ga0209564_1002231 Ga0209564_10022317 393
399 3300025297 Ga0209758_1015206 Ga0209758_10152062 393
400 3300025297 Ga0209758_1039797 Ga0209758_10397972 393
401 3300025298 Ga0209050_1000389 Ga0209050_100038933 393
402 3300025302 Ga0207426_1000341 Ga0207426_100034130 393
403 3300025302 Ga0207426_1000951 Ga0207426_10009517 393
404 3300025302 Ga0207426_1002430 Ga0207426_10024306 393
405 3300025302 Ga0207426_1040618 Ga0207426_10406181 393
406 3300025304 Ga0209257_1003759 Ga0209257_10037592 393
407 3300044842 Ga0466957_0043397 Ga0466957_0043397_826_2007 393
408 3300045049 Ga0466959_0057953 Ga0466959_0057953_658_1839 393
409 3300046507 Ga0495606_0069818 Ga0495606_0069818_492_1727 393
410 3300046522 Ga0495643_0000392 Ga0495643_0000392_30659_31903 393
411 3300046558 Ga0495633_0000090 Ga0495633_0000090_71989_73170 393
412 3300048924 Ga0496121_0000020 Ga0496121_0000020_342082_343263 393
413 3300049581 Ga0501047_0064339 Ga0501047_0064339_1993_3174 393
414 iso_pu_bacteria 2881955468 2881957182 393
415 iso_pu_bacteria 2965320100 2965323596 393
416 3300003761 Ga0055535_1003112 Ga0055535_10031125 394
417 3300005289 Ga0065704_10073952 Ga0065704_100739527 394
418 3300025242 Ga0209258_102250 Ga0209258_1022505 394
419 3300025254 Ga0209148_1000283 Ga0209148_100028370 394
420 3300048918 Ga0496115_0037645 Ga0496115_0037645_1213_2481 394
421 3300053088 Ga0500644_0000279 Ga0500644_0000279_11616_12800 394
422 3300053109 Ga0500569_000815 Ga0500569_000815_2096_3280 394
423 3300053134 Ga0500658_0001824 Ga0500658_0001824_6768_7952 394
424 3300053142 Ga0500577_0000916 Ga0500577_0000916_459_1643 394
425 3300053153 Ga0500616_0061009 Ga0500616_0061009_60_1244 394
426 3300053160 Ga0500633_0006823 Ga0500633_0006823_1408_2592 394
427 3300053177 Ga0500636_0032081 Ga0500636_0032081_976_2160 394
428 iso_pu_bacteria 2738541278 2738729013 394
429 iso_pu_bacteria 2818991444 2819587877 394
430 iso_pu_bacteria 2881247448 2881249428 394
431 iso_pu_bacteria 2914759650 2914762852 394
432 iso_pu_bacteria 2919509842 2919511006 394
433 iso_pu_bacteria 2929154850 2929158096 394
434 iso_pu_bacteria 2958512119 2958512782 394
435 3300013100 Ga0157373_10001583 Ga0157373_100015839 395
436 3300013102 Ga0157371_10002691 Ga0157371_100026912 395
437 3300013105 Ga0157369_10124521 Ga0157369_101245212 395
438 3300013307 Ga0157372_10256260 Ga0157372_102562602 395
439 3300037418 Ga0395900_0011050 Ga0395900_0011050_1467_2735 395
440 3300037466 Ga0395898_0132518 Ga0395898_0132518_941_2209 395
441 3300037471 Ga0395905_0242968 Ga0395905_0242968_210_1478 395
442 3300038443 Ga0395901_0088589 Ga0395901_0088589_774_2042 395
443 3300044712 Ga0453684_0024881 Ga0453684_0024881_6326_7513 395
444 2162886007 SwRhRL2b_contig_1759593 SwRhRL2b_0521.00009920 396
445 3300003322 rootL2_10022865 rootL2_100228654 396
446 3300003322 rootL2_10140272 rootL2_101402725 396
447 3300003794 Ga0055531_10000020 Ga0055531_1000002078 396
448 3300005289 Ga0065704_10070133 Ga0065704_10070133209 396
449 3300005329 Ga0070683_100003744 Ga0070683_1000037447 396
450 3300005366 Ga0070659_100010931 Ga0070659_1000109315 396
451 3300005367 Ga0070667_100108956 Ga0070667_1001089562 396
452 3300005616 Ga0068852_100175196 Ga0068852_1001751962 396
453 3300005843 Ga0068860_100011810 Ga0068860_1000118107 396
454 3300006358 Ga0068871_100024719 Ga0068871_1000247192 396
455 3300010375 Ga0105239_10016636 Ga0105239_100166367 396
456 3300013100 Ga0157373_10089780 Ga0157373_100897802 396
457 3300013102 Ga0157371_10044799 Ga0157371_100447992 396
458 3300013105 Ga0157369_10288447 Ga0157369_102884472 396
459 3300013306 Ga0163162_10002755 Ga0163162_100027558 396
460 3300013306 Ga0163162_10222422 Ga0163162_102224222 396
461 3300013307 Ga0157372_10007453 Ga0157372_100074537 396
462 3300014325 Ga0163163_10012527 Ga0163163_100125272 396
463 3300017792 Ga0163161_10042807 Ga0163161_100428073 396
464 3300025304 Ga0209257_1000001 Ga0209257_10000011306 396
465 3300025904 Ga0207647_10000485 Ga0207647_1000048510 396
466 3300025920 Ga0207649_10090252 Ga0207649_100902522 396
467 3300025944 Ga0207661_10023880 Ga0207661_100238803 396
468 3300025945 Ga0207679_10013842 Ga0207679_100138423 396
469 3300026142 Ga0207698_10127667 Ga0207698_101276672 396
470 3300028381 Ga0268264_10027215 Ga0268264_100272151 396
471 3300028381 Ga0268264_10027753 Ga0268264_100277534 396
472 3300031235 Ga0265330_10000013 Ga0265330_1000001389 396
473 3300031238 Ga0265332_10000019 Ga0265332_1000001973 396
474 3300031239 Ga0265328_10004579 Ga0265328_100045794 396
475 3300031240 Ga0265320_10008899 Ga0265320_100088992 396
476 3300031241 Ga0265325_10008789 Ga0265325_100087894 396
477 3300031242 Ga0265329_10004580 Ga0265329_100045804 396
478 3300031249 Ga0265339_10023126 Ga0265339_100231262 396
479 3300031251 Ga0265327_10000006 Ga0265327_10000006102 396
480 3300031251 Ga0265327_10000046 Ga0265327_10000046142 396
481 3300031344 Ga0265316_10000111 Ga0265316_1000011113 396
482 3300031711 Ga0265314_10000004 Ga0265314_10000004458 396
483 3300031712 Ga0265342_10000017 Ga0265342_1000001763 396
484 3300032004 Ga0307414_10072314 Ga0307414_100723142 396
485 3300037471 Ga0395905_0116178 Ga0395905_0116178_179_1438 396
486 3300044712 Ga0453684_0041437 Ga0453684_0041437_4076_5335 396
487 3300048917 Ga0496114_0002926 Ga0496114_0002926_9967_11217 396
488 3300048929 Ga0496126_0031463 Ga0496126_0031463_3584_4780 396
489 3300049579 Ga0501043_0087724 Ga0501043_0087724_531_1790 396
490 3300049758 Ga0501241_000384 Ga0501241_000384_95_1291 396
491 3300049822 Ga0501035_0095205 Ga0501035_0095205_1262_2518 396
492 3300049823 Ga0501044_0171853 Ga0501044_0171853_71_1327 396
493 3300053156 Ga0500622_0000488 Ga0500622_0000488_3074_4270 396
494 3300001979 JGI24740J21852_10037900 JGI24740J21852_100379001 397
495 3300002459 JGI24751J29686_10002215 JGI24751J29686_100022153 397
496 3300003203 JGI25406J46586_10004160 JGI25406J46586_100041605 397
497 3300003323 rootH1_10135802 rootH1_101358024 397
498 3300003354 JGI25160J50197_1003564 JGI25160J50197_10035642 397
499 3300005288 Ga0065714_10017635 Ga0065714_100176352 397
500 3300005290 Ga0065712_10007993 Ga0065712_100079932 397
501 3300005293 Ga0065715_10093864 Ga0065715_100938642 397
502 3300005327 Ga0070658_10058958 Ga0070658_100589582 397
503 3300005327 Ga0070658_10075475 Ga0070658_100754754 397
504 3300005327 Ga0070658_10214036 Ga0070658_102140362 397
505 3300005328 Ga0070676_10004661 Ga0070676_100046614 397
506 3300005329 Ga0070683_100018837 Ga0070683_1000188372 397
507 3300005329 Ga0070683_100020019 Ga0070683_1000200193 397
508 3300005330 Ga0070690_100032271 Ga0070690_1000322713 397
509 3300005330 Ga0070690_100112891 Ga0070690_1001128912 397
510 3300005331 Ga0070670_100059185 Ga0070670_1000591852 397
511 3300005331 Ga0070670_100297706 Ga0070670_1002977061 397
512 3300005334 Ga0068869_100002681 Ga0068869_1000026813 397
513 3300005334 Ga0068869_100009889 Ga0068869_1000098892 397
514 3300005334 Ga0068869_100016541 Ga0068869_1000165416 397
515 3300005334 Ga0068869_100186944 Ga0068869_1001869442 397
516 3300005335 Ga0070666_10030778 Ga0070666_100307781 397
517 3300005335 Ga0070666_10095753 Ga0070666_100957532 397
518 3300005336 Ga0070680_100163013 Ga0070680_1001630132 397
519 3300005337 Ga0070682_100000018 Ga0070682_10000001822 397
520 3300005337 Ga0070682_100072253 Ga0070682_1000722532 397
521 3300005338 Ga0068868_100063499 Ga0068868_1000634992 397
522 3300005338 Ga0068868_100107795 Ga0068868_1001077952 397
523 3300005339 Ga0070660_100001278 Ga0070660_1000012788 397
524 3300005339 Ga0070660_100005738 Ga0070660_1000057385 397
525 3300005339 Ga0070660_100041472 Ga0070660_1000414723 397
526 3300005339 Ga0070660_100067403 Ga0070660_1000674032 397
527 3300005340 Ga0070689_100035493 Ga0070689_1000354932 397
528 3300005340 Ga0070689_100088598 Ga0070689_1000885983 397
529 3300005344 Ga0070661_100018952 Ga0070661_1000189524 397
530 3300005347 Ga0070668_100008170 Ga0070668_1000081704 397
531 3300005353 Ga0070669_100017590 Ga0070669_1000175903 397
532 3300005353 Ga0070669_100074842 Ga0070669_1000748423 397
533 3300005353 Ga0070669_100166113 Ga0070669_1001661132 397
534 3300005354 Ga0070675_100016579 Ga0070675_1000165792 397
535 3300005354 Ga0070675_100323480 Ga0070675_1003234801 397
536 3300005355 Ga0070671_100017404 Ga0070671_1000174042 397
537 3300005355 Ga0070671_100100027 Ga0070671_1001000272 397
538 3300005356 Ga0070674_100053564 Ga0070674_1000535642 397
539 3300005364 Ga0070673_100034796 Ga0070673_1000347961 397
540 3300005364 Ga0070673_100049925 Ga0070673_1000499251 397
541 3300005364 Ga0070673_100062303 Ga0070673_1000623032 397
542 3300005364 Ga0070673_100089685 Ga0070673_1000896852 397
543 3300005364 Ga0070673_100177729 Ga0070673_1001777292 397
544 3300005365 Ga0070688_100007595 Ga0070688_1000075956 397
545 3300005366 Ga0070659_100002027 Ga0070659_1000020272 397
546 3300005366 Ga0070659_100005677 Ga0070659_1000056772 397
547 3300005366 Ga0070659_100081983 Ga0070659_1000819832 397
548 3300005366 Ga0070659_100167753 Ga0070659_1001677532 397
549 3300005367 Ga0070667_100012604 Ga0070667_1000126043 397
550 3300005367 Ga0070667_100053963 Ga0070667_1000539633 397
551 3300005367 Ga0070667_100103445 Ga0070667_1001034452 397
552 3300005367 Ga0070667_100112696 Ga0070667_1001126962 397
553 3300005438 Ga0070701_10006632 Ga0070701_100066323 397
554 3300005455 Ga0070663_100089989 Ga0070663_1000899892 397
555 3300005456 Ga0070678_100088451 Ga0070678_1000884513 397
556 3300005456 Ga0070678_100208121 Ga0070678_1002081212 397
557 3300005457 Ga0070662_100004967 Ga0070662_1000049674 397
558 3300005457 Ga0070662_100007145 Ga0070662_1000071455 397
559 3300005457 Ga0070662_100111416 Ga0070662_1001114162 397
560 3300005458 Ga0070681_10032814 Ga0070681_100328146 397
561 3300005458 Ga0070681_10074057 Ga0070681_100740573 397
562 3300005459 Ga0068867_100059343 Ga0068867_1000593432 397
563 3300005466 Ga0070685_10024229 Ga0070685_100242292 397
564 3300005466 Ga0070685_10069976 Ga0070685_100699762 397
565 3300005471 Ga0070698_100003400 Ga0070698_1000034006 397
566 3300005530 Ga0070679_100001044 Ga0070679_1000010446 397
567 3300005530 Ga0070679_100004008 Ga0070679_1000040083 397
568 3300005530 Ga0070679_100073106 Ga0070679_1000731063 397
569 3300005530 Ga0070679_100157594 Ga0070679_1001575941 397
570 3300005535 Ga0070684_100012432 Ga0070684_1000124325 397
571 3300005535 Ga0070684_100061868 Ga0070684_1000618682 397
572 3300005535 Ga0070684_100120096 Ga0070684_1001200962 397
573 3300005539 Ga0068853_100022502 Ga0068853_1000225023 397
574 3300005539 Ga0068853_100044640 Ga0068853_1000446402 397
575 3300005543 Ga0070672_100001603 Ga0070672_10000160312 397
576 3300005543 Ga0070672_100214597 Ga0070672_1002145971 397
577 3300005547 Ga0070693_100050821 Ga0070693_1000508212 397
578 3300005548 Ga0070665_100003504 Ga0070665_1000035045 397
579 3300005548 Ga0070665_100114404 Ga0070665_1001144042 397
580 3300005549 Ga0070704_100025018 Ga0070704_1000250181 397
581 3300005563 Ga0068855_100000329 Ga0068855_10000032937 397
582 3300005563 Ga0068855_100013158 Ga0068855_10001315812 397
583 3300005563 Ga0068855_100013953 Ga0068855_1000139535 397
584 3300005563 Ga0068855_100017499 Ga0068855_1000174995 397
585 3300005563 Ga0068855_100108409 Ga0068855_1001084094 397
586 3300005564 Ga0070664_100026666 Ga0070664_1000266663 397
587 3300005564 Ga0070664_100031978 Ga0070664_1000319783 397
588 3300005564 Ga0070664_100067420 Ga0070664_1000674202 397
589 3300005564 Ga0070664_100346098 Ga0070664_1003460981 397
590 3300005577 Ga0068857_100022205 Ga0068857_1000222056 397
591 3300005577 Ga0068857_100130731 Ga0068857_1001307312 397
592 3300005578 Ga0068854_100006808 Ga0068854_1000068082 397
593 3300005614 Ga0068856_100034788 Ga0068856_1000347882 397
594 3300005615 Ga0070702_100046856 Ga0070702_1000468562 397
595 3300005616 Ga0068852_100008807 Ga0068852_1000088076 397
596 3300005616 Ga0068852_100015602 Ga0068852_1000156024 397
597 3300005616 Ga0068852_100138617 Ga0068852_1001386172 397
598 3300005616 Ga0068852_100184164 Ga0068852_1001841642 397
599 3300005617 Ga0068859_100000023 Ga0068859_10000002399 397
600 3300005617 Ga0068859_100000859 Ga0068859_10000085930 397
601 3300005617 Ga0068859_100020142 Ga0068859_1000201425 397
602 3300005617 Ga0068859_100134287 Ga0068859_1001342873 397
603 3300005618 Ga0068864_100009349 Ga0068864_1000093497 397
604 3300005718 Ga0068866_10017119 Ga0068866_100171192 397
605 3300005718 Ga0068866_10040962 Ga0068866_100409622 397
606 3300005719 Ga0068861_100047027 Ga0068861_1000470272 397
607 3300005719 Ga0068861_100059398 Ga0068861_1000593983 397
608 3300005834 Ga0068851_10002822 Ga0068851_100028224 397
609 3300005834 Ga0068851_10053510 Ga0068851_100535102 397
610 3300005840 Ga0068870_10030301 Ga0068870_100303012 397
611 3300005840 Ga0068870_10041365 Ga0068870_100413652 397
612 3300005841 Ga0068863_100000424 Ga0068863_10000042440 397
613 3300005841 Ga0068863_100065852 Ga0068863_1000658523 397
614 3300005841 Ga0068863_100193970 Ga0068863_1001939701 397
615 3300005841 Ga0068863_100306769 Ga0068863_1003067691 397
616 3300005843 Ga0068860_100001384 Ga0068860_1000013849 397
617 3300005843 Ga0068860_100013541 Ga0068860_1000135414 397
618 3300005843 Ga0068860_100015628 Ga0068860_1000156281 397
619 3300005843 Ga0068860_100024851 Ga0068860_1000248513 397
620 3300005843 Ga0068860_100153902 Ga0068860_1001539022 397
621 3300005844 Ga0068862_100004782 Ga0068862_1000047825 397
622 3300005985 Ga0081539_10001000 Ga0081539_1000100016 397
623 3300006173 Ga0070716_100103258 Ga0070716_1001032582 397
624 3300006237 Ga0097621_100028199 Ga0097621_1000281992 397
625 3300006237 Ga0097621_100078691 Ga0097621_1000786912 397
626 3300006237 Ga0097621_100114598 Ga0097621_1001145982 397
627 3300006237 Ga0097621_100119702 Ga0097621_1001197023 397
628 3300006237 Ga0097621_100259683 Ga0097621_1002596831 397
629 3300006358 Ga0068871_100097088 Ga0068871_1000970881 397
630 3300006844 Ga0075428_100006657 Ga0075428_1000066574 397
631 3300006844 Ga0075428_100079725 Ga0075428_1000797253 397
632 3300006846 Ga0075430_100029748 Ga0075430_1000297483 397
633 3300006847 Ga0075431_100032992 Ga0075431_1000329922 397
634 3300006847 Ga0075431_100165692 Ga0075431_1001656922 397
635 3300006880 Ga0075429_100006669 Ga0075429_1000066698 397
636 3300006881 Ga0068865_100008569 Ga0068865_1000085695 397
637 3300006881 Ga0068865_100098462 Ga0068865_1000984622 397
638 3300006881 Ga0068865_100211413 Ga0068865_1002114131 397
639 3300006931 Ga0097620_100000023 Ga0097620_10000002399 397
640 3300006931 Ga0097620_100000859 Ga0097620_10000085930 397
641 3300006931 Ga0097620_100020142 Ga0097620_1000201425 397
642 3300006931 Ga0097620_100134284 Ga0097620_1001342843 397
643 3300009093 Ga0105240_10000011 Ga0105240_10000011163 397
644 3300009093 Ga0105240_10016269 Ga0105240_100162692 397
645 3300009093 Ga0105240_10182785 Ga0105240_101827852 397
646 3300009098 Ga0105245_10317179 Ga0105245_103171792 397
647 3300009101 Ga0105247_10024168 Ga0105247_100241682 397
648 3300009147 Ga0114129_10182219 Ga0114129_101822192 397
649 3300009147 Ga0114129_10206848 Ga0114129_102068483 397
650 3300009174 Ga0105241_10000861 Ga0105241_1000086112 397
651 3300009176 Ga0105242_10005203 Ga0105242_100052036 397
652 3300009176 Ga0105242_10035959 Ga0105242_100359592 397
653 3300009176 Ga0105242_10066012 Ga0105242_100660122 397
654 3300009176 Ga0105242_10094343 Ga0105242_100943432 397
655 3300009176 Ga0105242_10257862 Ga0105242_102578621 397
656 3300009545 Ga0105237_10001750 Ga0105237_100017508 397
657 3300009553 Ga0105249_10002885 Ga0105249_1000288512 397
658 3300009553 Ga0105249_10008554 Ga0105249_100085545 397
659 3300009553 Ga0105249_10010023 Ga0105249_100100235 397
660 3300009553 Ga0105249_10019818 Ga0105249_100198183 397
661 3300009553 Ga0105249_10025260 Ga0105249_100252602 397
662 3300010375 Ga0105239_10000052 Ga0105239_10000052152 397
663 3300010375 Ga0105239_10103105 Ga0105239_101031054 397
664 3300010375 Ga0105239_10121663 Ga0105239_101216632 397
665 3300010375 Ga0105239_10180254 Ga0105239_101802541 397
666 3300011119 Ga0105246_10000127 Ga0105246_1000012711 397
667 3300011119 Ga0105246_10007561 Ga0105246_100075611 397
668 3300011119 Ga0105246_10099983 Ga0105246_100999832 397
669 3300013100 Ga0157373_10135784 Ga0157373_101357842 397
670 3300013100 Ga0157373_10161231 Ga0157373_101612311 397
671 3300013102 Ga0157371_10000874 Ga0157371_100008741 397
672 3300013102 Ga0157371_10003885 Ga0157371_100038859 397
673 3300013102 Ga0157371_10012057 Ga0157371_100120574 397
674 3300013102 Ga0157371_10014455 Ga0157371_100144554 397
675 3300013102 Ga0157371_10015537 Ga0157371_100155375 397
676 3300013102 Ga0157371_10026427 Ga0157371_100264273 397
677 3300013102 Ga0157371_10031082 Ga0157371_100310822 397
678 3300013102 Ga0157371_10116551 Ga0157371_101165512 397
679 3300013102 Ga0157371_10153838 Ga0157371_101538382 397
680 3300013104 Ga0157370_10017466 Ga0157370_100174666 397
681 3300013104 Ga0157370_10103180 Ga0157370_101031802 397
682 3300013104 Ga0157370_10175087 Ga0157370_101750872 397
683 3300013105 Ga0157369_10016571 Ga0157369_100165716 397
684 3300013105 Ga0157369_10066270 Ga0157369_100662702 397
685 3300013296 Ga0157374_10017972 Ga0157374_100179723 397
686 3300013296 Ga0157374_10050185 Ga0157374_100501852 397
687 3300013296 Ga0157374_10050987 Ga0157374_100509873 397
688 3300013296 Ga0157374_10071492 Ga0157374_100714923 397
689 3300013296 Ga0157374_10152858 Ga0157374_101528582 397
690 3300013296 Ga0157374_10311262 Ga0157374_103112621 397
691 3300013297 Ga0157378_10003896 Ga0157378_100038969 397
692 3300013297 Ga0157378_10005272 Ga0157378_100052725 397
693 3300013297 Ga0157378_10025456 Ga0157378_100254563 397
694 3300013297 Ga0157378_10044912 Ga0157378_100449123 397
695 3300013297 Ga0157378_10175156 Ga0157378_101751562 397
696 3300013297 Ga0157378_10284351 Ga0157378_102843512 397
697 3300013306 Ga0163162_10000373 Ga0163162_1000037319 397
698 3300013306 Ga0163162_10287102 Ga0163162_102871021 397
699 3300013307 Ga0157372_10004620 Ga0157372_100046206 397
700 3300013307 Ga0157372_10016144 Ga0157372_100161444 397
701 3300013307 Ga0157372_10032100 Ga0157372_100321003 397
702 3300013307 Ga0157372_10046886 Ga0157372_100468865 397
703 3300013307 Ga0157372_10050674 Ga0157372_100506745 397
704 3300013307 Ga0157372_10061020 Ga0157372_100610202 397
705 3300013307 Ga0157372_10147340 Ga0157372_101473402 397
706 3300013307 Ga0157372_10172947 Ga0157372_101729472 397
707 3300013307 Ga0157372_10434942 Ga0157372_104349422 397
708 3300013307 Ga0157372_10465252 Ga0157372_104652521 397
709 3300013308 Ga0157375_10129843 Ga0157375_101298432 397
710 3300013308 Ga0157375_10155632 Ga0157375_101556323 397
711 3300013308 Ga0157375_10169648 Ga0157375_101696482 397
712 3300013308 Ga0157375_10281391 Ga0157375_102813911 397
713 3300014325 Ga0163163_10002603 Ga0163163_1000260312 397
714 3300014326 Ga0157380_10035702 Ga0157380_100357024 397
715 3300014326 Ga0157380_10098766 Ga0157380_100987662 397
716 3300014326 Ga0157380_10126642 Ga0157380_101266422 397
717 3300014326 Ga0157380_10190663 Ga0157380_101906632 397
718 3300014745 Ga0157377_10030917 Ga0157377_100309172 397
719 3300014745 Ga0157377_10035061 Ga0157377_100350612 397
720 3300014745 Ga0157377_10073216 Ga0157377_100732162 397
721 3300014968 Ga0157379_10034273 Ga0157379_100342734 397
722 3300014968 Ga0157379_10149386 Ga0157379_101493862 397
723 3300014969 Ga0157376_10002437 Ga0157376_100024372 397
724 3300014969 Ga0157376_10113436 Ga0157376_101134361 397
725 3300017792 Ga0163161_10030521 Ga0163161_100305213 397
726 3300025302 Ga0207426_1000040 Ga0207426_1000040133 397
727 3300025321 Ga0207656_10039892 Ga0207656_100398921 397
728 3300025893 Ga0207682_10013516 Ga0207682_100135162 397
729 3300025900 Ga0207710_10034808 Ga0207710_100348082 397
730 3300025903 Ga0207680_10107618 Ga0207680_101076182 397
731 3300025904 Ga0207647_10000139 Ga0207647_100001395 397
732 3300025904 Ga0207647_10038075 Ga0207647_100380752 397
733 3300025904 Ga0207647_10083236 Ga0207647_100832362 397
734 3300025907 Ga0207645_10000093 Ga0207645_100000935 397
735 3300025907 Ga0207645_10045019 Ga0207645_100450192 397
736 3300025908 Ga0207643_10003399 Ga0207643_100033992 397
737 3300025909 Ga0207705_10007859 Ga0207705_100078595 397
738 3300025909 Ga0207705_10014478 Ga0207705_100144786 397
739 3300025909 Ga0207705_10097990 Ga0207705_100979902 397
740 3300025912 Ga0207707_10173295 Ga0207707_101732951 397
741 3300025912 Ga0207707_10219642 Ga0207707_102196421 397
742 3300025913 Ga0207695_10000010 Ga0207695_10000010552 397
743 3300025913 Ga0207695_10013688 Ga0207695_100136885 397
744 3300025914 Ga0207671_10001864 Ga0207671_100018648 397
745 3300025914 Ga0207671_10033040 Ga0207671_100330402 397
746 3300025914 Ga0207671_10068398 Ga0207671_100683982 397
747 3300025917 Ga0207660_10023446 Ga0207660_100234466 397
748 3300025917 Ga0207660_10034825 Ga0207660_100348254 397
749 3300025917 Ga0207660_10141570 Ga0207660_101415702 397
750 3300025918 Ga0207662_10004373 Ga0207662_100043735 397
751 3300025919 Ga0207657_10002529 Ga0207657_100025298 397
752 3300025919 Ga0207657_10008447 Ga0207657_100084475 397
753 3300025919 Ga0207657_10025251 Ga0207657_100252513 397
754 3300025919 Ga0207657_10106366 Ga0207657_101063662 397
755 3300025919 Ga0207657_10125502 Ga0207657_101255022 397
756 3300025921 Ga0207652_10000051 Ga0207652_1000005137 397
757 3300025921 Ga0207652_10000770 Ga0207652_1000077024 397
758 3300025921 Ga0207652_10253698 Ga0207652_102536981 397
759 3300025923 Ga0207681_10046890 Ga0207681_100468902 397
760 3300025923 Ga0207681_10204681 Ga0207681_102046812 397
761 3300025925 Ga0207650_10011838 Ga0207650_100118382 397
762 3300025925 Ga0207650_10168551 Ga0207650_101685511 397
763 3300025926 Ga0207659_10027614 Ga0207659_100276143 397
764 3300025926 Ga0207659_10058149 Ga0207659_100581492 397
765 3300025931 Ga0207644_10039114 Ga0207644_100391142 397
766 3300025932 Ga0207690_10043628 Ga0207690_100436282 397
767 3300025933 Ga0207706_10131229 Ga0207706_101312292 397
768 3300025934 Ga0207686_10002397 Ga0207686_100023972 397
769 3300025934 Ga0207686_10106606 Ga0207686_101066062 397
770 3300025936 Ga0207670_10061498 Ga0207670_100614981 397
771 3300025936 Ga0207670_10170353 Ga0207670_101703532 397
772 3300025937 Ga0207669_10029661 Ga0207669_100296612 397
773 3300025940 Ga0207691_10000426 Ga0207691_100004266 397
774 3300025940 Ga0207691_10003790 Ga0207691_100037903 397
775 3300025940 Ga0207691_10007792 Ga0207691_100077928 397
776 3300025940 Ga0207691_10024512 Ga0207691_100245122 397
777 3300025942 Ga0207689_10005494 Ga0207689_100054941 397
778 3300025942 Ga0207689_10006819 Ga0207689_100068194 397
779 3300025942 Ga0207689_10012253 Ga0207689_100122535 397
780 3300025942 Ga0207689_10031011 Ga0207689_100310112 397
781 3300025942 Ga0207689_10033385 Ga0207689_100333854 397
782 3300025944 Ga0207661_10009778 Ga0207661_100097784 397
783 3300025944 Ga0207661_10020079 Ga0207661_100200793 397
784 3300025944 Ga0207661_10055866 Ga0207661_100558662 397
785 3300025945 Ga0207679_10077602 Ga0207679_100776022 397
786 3300025949 Ga0207667_10026416 Ga0207667_100264164 397
787 3300025949 Ga0207667_10040176 Ga0207667_100401765 397
788 3300025949 Ga0207667_10142548 Ga0207667_101425481 397
789 3300025949 Ga0207667_10177385 Ga0207667_101773852 397
790 3300025960 Ga0207651_10160551 Ga0207651_101605511 397
791 3300025960 Ga0207651_10223247 Ga0207651_102232472 397
792 3300025961 Ga0207712_10001684 Ga0207712_1000168412 397
793 3300025961 Ga0207712_10016183 Ga0207712_100161833 397
794 3300025972 Ga0207668_10001372 Ga0207668_1000137212 397
795 3300025972 Ga0207668_10090396 Ga0207668_100903962 397
796 3300025981 Ga0207640_10146916 Ga0207640_101469162 397
797 3300025986 Ga0207658_10082255 Ga0207658_100822552 397
798 3300026023 Ga0207677_10143755 Ga0207677_101437552 397
799 3300026023 Ga0207677_10197704 Ga0207677_101977041 397
800 3300026023 Ga0207677_10256903 Ga0207677_102569031 397
801 3300026035 Ga0207703_10008491 Ga0207703_100084913 397
802 3300026041 Ga0207639_10015801 Ga0207639_100158015 397
803 3300026041 Ga0207639_10041256 Ga0207639_100412562 397
804 3300026041 Ga0207639_10068456 Ga0207639_100684563 397
805 3300026041 Ga0207639_10214078 Ga0207639_102140781 397
806 3300026041 Ga0207639_10236119 Ga0207639_102361191 397
807 3300026078 Ga0207702_10038469 Ga0207702_100384692 397
808 3300026088 Ga0207641_10000250 Ga0207641_1000025055 397
809 3300026088 Ga0207641_10003419 Ga0207641_100034192 397
810 3300026088 Ga0207641_10003961 Ga0207641_100039616 397
811 3300026088 Ga0207641_10111397 Ga0207641_101113973 397
812 3300026089 Ga0207648_10010083 Ga0207648_100100836 397
813 3300026089 Ga0207648_10022313 Ga0207648_100223136 397
814 3300026089 Ga0207648_10066688 Ga0207648_100666883 397
815 3300026089 Ga0207648_10107713 Ga0207648_101077133 397
816 3300026095 Ga0207676_10024842 Ga0207676_100248422 397
817 3300026095 Ga0207676_10028937 Ga0207676_100289371 397
818 3300026095 Ga0207676_10030918 Ga0207676_100309181 397
819 3300026095 Ga0207676_10050380 Ga0207676_100503803 397
820 3300026116 Ga0207674_10033858 Ga0207674_100338582 397
821 3300026118 Ga0207675_100008087 Ga0207675_1000080873 397
822 3300026118 Ga0207675_100040059 Ga0207675_1000400592 397
823 3300026118 Ga0207675_100040594 Ga0207675_1000405943 397
824 3300026121 Ga0207683_10011150 Ga0207683_100111505 397
825 3300026121 Ga0207683_10112392 Ga0207683_101123922 397
826 3300026121 Ga0207683_10133738 Ga0207683_101337382 397
827 3300026121 Ga0207683_10305745 Ga0207683_103057451 397
828 3300026121 Ga0207683_10313671 Ga0207683_103136711 397
829 3300026142 Ga0207698_10175597 Ga0207698_101755972 397
830 3300028379 Ga0268266_10007816 Ga0268266_100078166 397
831 3300028379 Ga0268266_10214932 Ga0268266_102149322 397
832 3300028381 Ga0268264_10001580 Ga0268264_100015809 397
833 3300028381 Ga0268264_10003762 Ga0268264_100037629 397
834 3300028381 Ga0268264_10139530 Ga0268264_101395302 397
835 3300028794 Ga0307515_10000010 Ga0307515_10000010300 397
836 3300028800 Ga0265338_10079195 Ga0265338_100791952 397
837 3300029957 Ga0265324_10023935 Ga0265324_100239352 397
838 3300031251 Ga0265327_10000239 Ga0265327_100002393 397
839 3300031251 Ga0265327_10000618 Ga0265327_1000061841 397
840 3300031251 Ga0265327_10000726 Ga0265327_100007268 397
841 3300031251 Ga0265327_10031497 Ga0265327_100314971 397
842 3300031507 Ga0307509_10290150 Ga0307509_102901501 397
843 3300031730 Ga0307516_10221684 Ga0307516_102216842 397
844 3300037312 Ga0395899_0011662 Ga0395899_0011662_2389_3663 397
845 3300037312 Ga0395899_0035366 Ga0395899_0035366_2128_3402 397
846 3300037312 Ga0395899_0039531 Ga0395899_0039531_1207_2481 397
847 3300037312 Ga0395899_0047757 Ga0395899_0047757_1775_3049 397
848 3300037312 Ga0395899_0110395 Ga0395899_0110395_561_1835 397
849 3300037418 Ga0395900_0010950 Ga0395900_0010950_349_1623 397
850 3300037418 Ga0395900_0165276 Ga0395900_0165276_468_1742 397
851 3300037418 Ga0395900_0391710 Ga0395900_0391710_79_1341 397
852 3300037466 Ga0395898_0001697 Ga0395898_0001697_12452_13726 397
853 3300037466 Ga0395898_0045358 Ga0395898_0045358_10_1284 397
854 3300037466 Ga0395898_0053988 Ga0395898_0053988_341_1615 397
855 3300037471 Ga0395905_0019301 Ga0395905_0019301_1665_2927 397
856 3300037471 Ga0395905_0065228 Ga0395905_0065228_1226_2488 397
857 3300037471 Ga0395905_0277475 Ga0395905_0277475_74_1348 397
858 3300038443 Ga0395901_0079052 Ga0395901_0079052_1331_2605 397
859 3300038443 Ga0395901_0086677 Ga0395901_0086677_69_1343 397
860 3300039437 Ga0436365_1889064 Ga0436365_1889064_7855_9111 397
861 3300039437 Ga0436365_1892627 Ga0436365_1892627_843_2114 397
862 3300042001 Ga0439441_005992 Ga0439441_005992_502_1761 397
863 3300042125 Ga0450923_009304 Ga0450923_009304_286_1545 397
864 3300044658 Ga0466972_0000205 Ga0466972_0000205_19888_21144 397
865 3300044712 Ga0453684_0030202 Ga0453684_0030202_5571_6827 397
866 3300044712 Ga0453684_0136521 Ga0453684_0136521_724_1980 397
867 3300044765 Ga0466970_0000529 Ga0466970_0000529_4163_5419 397
868 3300046471 Ga0495650_0022359 Ga0495650_0022359_778_2034 397
869 3300046473 Ga0495582_0126018 Ga0495582_0126018_164_1420 397
870 3300046537 Ga0495598_0035309 Ga0495598_0035309_123_1382 397
871 3300046616 Ga0495668_0000138 Ga0495668_0000138_20390_21655 397
872 3300046616 Ga0495668_0000268 Ga0495668_0000268_32603_33892 397
873 3300046616 Ga0495668_0002233 Ga0495668_0002233_14890_16146 397
874 3300046679 Ga0495623_0076293 Ga0495623_0076293_107_1363 397
875 3300046683 Ga0495658_0048030 Ga0495658_0048030_21_1277 397
876 3300047318 Ga0495636_0000082 Ga0495636_0000082_23932_25197 397
877 3300047319 Ga0495674_0014078 Ga0495674_0014078_4381_5637 397
878 3300047472 Ga0495686_0002851 Ga0495686_0002851_3377_4645 397
879 3300048088 Ga0495602_0240779 Ga0495602_0240779_48_1304 397
880 3300049569 Ga0501032_0000789 Ga0501032_0000789_20330_21586 397
881 3300049569 Ga0501032_0091219 Ga0501032_0091219_735_2000 397
882 3300049570 Ga0501033_0127944 Ga0501033_0127944_143_1408 397
883 3300049571 Ga0501034_0003172 Ga0501034_0003172_12558_13823 397
884 3300049571 Ga0501034_0006168 Ga0501034_0006168_7765_9021 397
885 3300049572 Ga0501036_0001149 Ga0501036_0001149_10722_11978 397
886 3300049573 Ga0501037_0004723 Ga0501037_0004723_5355_6620 397
887 3300049574 Ga0501038_0011400 Ga0501038_0011400_4122_5387 397
888 3300049575 Ga0501039_0005691 Ga0501039_0005691_4297_5562 397
889 3300049579 Ga0501043_0011111 Ga0501043_0011111_4097_5362 397
890 3300049579 Ga0501043_0013354 Ga0501043_0013354_431_1687 397
891 3300049579 Ga0501043_0026299 Ga0501043_0026299_2126_3391 397
892 3300049580 Ga0501046_0012945 Ga0501046_0012945_2842_4098 397
893 3300049581 Ga0501047_0003691 Ga0501047_0003691_4048_5304 397
894 3300049581 Ga0501047_0007639 Ga0501047_0007639_6539_7795 397
895 3300049581 Ga0501047_0010562 Ga0501047_0010562_5057_6322 397
896 3300049581 Ga0501047_0088305 Ga0501047_0088305_1380_2636 397
897 3300049582 Ga0501048_0003076 Ga0501048_0003076_7775_9031 397
898 3300049586 Ga0501070_0097839 Ga0501070_0097839_716_1972 397
899 3300049589 Ga0501073_0002127 Ga0501073_0002127_4343_5599 397
900 3300049590 Ga0501074_0000268 Ga0501074_0000268_6569_7825 397
901 3300049669 Ga0501235_006460 Ga0501235_006460_974_2236 397
902 3300049741 Ga0501079_0028531 Ga0501079_0028531_2293_3549 397
903 3300049742 Ga0501080_0009651 Ga0501080_0009651_3509_4765 397
904 3300049742 Ga0501080_0130042 Ga0501080_0130042_19_1275 397
905 3300049744 Ga0501083_0002364 Ga0501083_0002364_8438_9694 397
906 3300049763 Ga0501266_003293 Ga0501266_003293_297_1559 397
907 3300049822 Ga0501035_0006540 Ga0501035_0006540_4513_5769 397
908 3300049822 Ga0501035_0121557 Ga0501035_0121557_639_1922 397
909 3300049823 Ga0501044_0006312 Ga0501044_0006312_10559_11824 397
910 3300049823 Ga0501044_0008384 Ga0501044_0008384_3840_5096 397
911 3300049823 Ga0501044_0009325 Ga0501044_0009325_6953_8209 397
912 3300049823 Ga0501044_0037083 Ga0501044_0037083_2164_3420 397
913 3300050507 nmdc:mga05p37_239788_c1 nmdc:mga05p37_239788_c1_93_1352 397
914 3300050508 nmdc:mga09592_29361_c1 nmdc:mga09592_29361_c1_821_2080 397
915 3300050508 nmdc:mga09592_33001_c1 nmdc:mga09592_33001_c1_1018_2277 397
916 3300050509 nmdc:mga0qj67_49668_c1 nmdc:mga0qj67_49668_c1_1305_2564 397
917 3300050509 nmdc:mga0qj67_8348_c1 nmdc:mga0qj67_8348_c1_5708_6967 397
918 3300050510 nmdc:mga06r32_137630_c1 nmdc:mga06r32_137630_c1_1011_2270 397
919 3300053130 Ga0500642_0005679 Ga0500642_0005679_2110_3375 397
920 3300053153 Ga0500616_0002914 Ga0500616_0002914_11439_12704 397
921 3300053153 Ga0500616_0022029 Ga0500616_0022029_981_2240 397
922 3300053156 Ga0500622_0000176 Ga0500622_0000176_66440_67699 397
923 3300053158 Ga0500627_0003198 Ga0500627_0003198_638_1903 397
924 2162886007 SwRhRL2b_contig_1239318 SwRhRL2b_0887.00007170 398
925 3300005289 Ga0065704_10075046 Ga0065704_100750463 398
926 3300031731 Ga0307405_10000001 Ga0307405_100000011292 398
927 3300031901 Ga0307406_10017842 Ga0307406_100178422 398
928 3300045051 Ga0451576_0082567 Ga0451576_0082567_1476_2729 398
929 3300048928 Ga0496125_0000443 Ga0496125_0000443_45486_46721 398
930 3300048929 Ga0496126_0024161 Ga0496126_0024161_1518_2753 398
931 3300053096 Ga0500641_0000073 Ga0500641_0000073_38820_40055 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00742

Homoserine_dh

Homoserine dehydrogenase

164

343

0.99

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

46

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a0r-assembly1.cif.gz_A-2 homoserine dehydrogenase from thermus thermophilus hb8 unliganded form 0.9168 6 316
5xdf-assembly1.cif.gz_A homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse 0.9088 6 316
6dzs-assembly1.cif.gz_B mycobacterial homoserine dehydrogenase thra in complex with nadp 0.8735 4 395
6dzs-assembly2.cif.gz_C mycobacterial homoserine dehydrogenase thra in complex with nadp 0.8705 4 395
6dzs-assembly2.cif.gz_D mycobacterial homoserine dehydrogenase thra in complex with nadp 0.867 4 395
ID Description Score Start End Superfamily
af_Q2FYV4_151_297_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9609 145 290 3.30.360.10
af_P9WPX1_139_304_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9456 130 290 3.30.360.10
af_Q2FYV4_151_297_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.942 145 290 3.30.360.10
3mtjA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9387 129 290 3.30.360.10
6dzsB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9332 4 128 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A136P9J0-F1-model_v4 Homoserine dehydrogenase 0.98 4 112 GO:0004412
GO:0009088
GO:0050661
AF-A0A4Q3RPB9-F1-model_v4 Homoserine dehydrogenase (EC 1.1.1.3) 0.9754 2 310 GO:0004412
GO:0009086
GO:0009088
GO:0050661
AF-A0A2B7ZTL4-F1-model_v4 Homoserine dehydrogenase (EC 1.1.1.3) 0.9733 3 331 GO:0004412
GO:0009086
GO:0009088
GO:0050661
AF-A0A519W233-F1-model_v4 Homoserine dehydrogenase 0.9732 1 139 GO:0004412
GO:0009088
GO:0050661
AF-A0A1W1VSI3-F1-model_v4 Homoserine dehydrogenase (EC 1.1.1.3) 0.9693 4 323 GO:0004412
GO:0009086
GO:0009088
GO:0050661

Feature Viewer

pLDDT pTM Quality
93.7 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map