F486012

General Info

Members Datasets Scaffolds Average Seq Length
930 290 1860 150

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100791937|Ga0070690_1007919371
Length 169
Sequence MTNEHLCNLWMDLNEENEMGKHHDAELILKLYDLRREKTMRDARNWFFQFNPKGKEDFIDVLTSDKSGLYRMVISYWDMACSFVNNGAIDAQMFNDANGEHLFVYAKLEPFLPALREEMGNPNFLGHLEKVVKECPDYETKIANIRTRMAKLIELYQQRAAAQAAAAGN

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
207 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
228 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
229 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
230 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
231 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
232 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
239 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
240 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
241 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
242 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
243 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
244 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
245 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
246 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
247 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
248 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
251 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
252 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
253 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
254 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
255 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
256 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
257 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
258 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
259 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
260 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
261 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
262 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
265 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
266 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
267 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
268 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
269 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
270 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
271 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 2.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.58
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 18.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100791937 3300005330 Unclassified 735
2 CNAas_1000591 3300000532 Bacteria 3512
3 JGI24749J21850_1058742 3300002076 Bacteria 582
4 Ga0058859_11531803 3300004798 Unclassified 640
5 Ga0058861_11829353 3300004800 Bacteria 1158
6 Ga0058862_11139853 3300004803 Unclassified 817
7 Ga0058862_12343778 3300004803 Bacteria 2629
8 Ga0065714_10167095 3300005288 Bacteria 1000
9 Ga0065714_10428383 3300005288 Unclassified 569
10 Ga0065704_10027349 3300005289 Bacteria 1295
11 Ga0065704_10076100 3300005289 Bacteria 5265
12 Ga0065712_10008278 3300005290 Bacteria 2259
13 Ga0065712_10024545 3300005290 Bacteria 1733
14 Ga0065712_10414465 3300005290 Bacteria 718
15 Ga0065715_10002353 3300005293 Bacteria 5948
16 Ga0065715_10010790 3300005293 Bacteria 2366
17 Ga0065715_10020967 3300005293 Bacteria 1875
18 Ga0065715_10058884 3300005293 Bacteria 811
19 Ga0065715_10099595 3300005293 Bacteria 3393
20 Ga0065715_10254463 3300005293 Bacteria 1157
21 Ga0065707_10001074 3300005295 Bacteria 8790
22 Ga0065707_10094200 3300005295 Bacteria 3527
23 Ga0065707_10173371 3300005295 Bacteria 1468
24 Ga0065707_10254350 3300005295 Bacteria 1115
25 Ga0065707_10556571 3300005295 Bacteria 717
26 Ga0070676_10051594 3300005328 Bacteria 2416
27 Ga0070676_10576108 3300005328 Unclassified 809
28 Ga0070690_100002046 3300005330 Bacteria 10757
29 Ga0070690_100158830 3300005330 Bacteria 1547
30 Ga0070690_100862401 3300005330 Bacteria 706
31 Ga0070690_100963302 3300005330 Unclassified 670
32 Ga0070670_100043106 3300005331 Bacteria 3879
33 Ga0070670_100076223 3300005331 Bacteria 2881
34 Ga0070670_100195668 3300005331 Bacteria 1756
35 Ga0070670_100466323 3300005331 Bacteria 1120
36 Ga0070670_100610942 3300005331 Bacteria 976
37 Ga0070670_100713134 3300005331 Bacteria 902
38 Ga0070670_100869578 3300005331 Unclassified 816
39 Ga0068869_100028521 3300005334 Bacteria 3901
40 Ga0068869_100076607 3300005334 Bacteria 2486
41 Ga0068869_100169945 3300005334 Bacteria 1703
42 Ga0068869_100236812 3300005334 Bacteria 1453
43 Ga0068869_100276725 3300005334 Bacteria 1348
44 Ga0068869_100606590 3300005334 Bacteria 925
45 Ga0068869_101372383 3300005334 Bacteria 625
46 Ga0068869_101487996 3300005334 Unclassified 601
47 Ga0070666_10083565 3300005335 Bacteria 2184
48 Ga0070680_100002291 3300005336 Bacteria 14159
49 Ga0070680_100013792 3300005336 Bacteria 6303
50 Ga0070680_100198643 3300005336 Bacteria 1691
51 Ga0070682_100003075 3300005337 Bacteria 9240
52 Ga0070682_100012020 3300005337 Bacteria 4953
53 Ga0068868_100013823 3300005338 Bacteria 5932
54 Ga0068868_100098872 3300005338 Bacteria 2360
55 Ga0070660_100084633 3300005339 Bacteria 2493
56 Ga0070689_100001670 3300005340 Bacteria 14162
57 Ga0070689_100098137 3300005340 Bacteria 2317
58 Ga0070689_100262499 3300005340 Bacteria 1428
59 Ga0070689_100349524 3300005340 Bacteria 1240
60 Ga0070691_10051733 3300005341 Bacteria 1963
61 Ga0070687_100848084 3300005343 Unclassified 651
62 Ga0070687_100849522 3300005343 Unclassified 651
63 Ga0070661_100071885 3300005344 Bacteria 2546
64 Ga0070661_100720862 3300005344 Bacteria 814
65 Ga0070692_10023495 3300005345 Bacteria 3021
66 Ga0070692_10260291 3300005345 Unclassified 1042
67 Ga0070692_10305400 3300005345 Bacteria 973
68 Ga0070692_10340225 3300005345 Bacteria 929
69 Ga0070692_10391134 3300005345 Unclassified 875
70 Ga0070692_10822461 3300005345 Bacteria 636
71 Ga0070668_100280205 3300005347 Bacteria 1392
72 Ga0070669_100015712 3300005353 Bacteria 5398
73 Ga0070669_100029288 3300005353 Bacteria 3968
74 Ga0070669_101153406 3300005353 Unclassified 668
75 Ga0070675_100067028 3300005354 Bacteria 2969
76 Ga0070675_101531907 3300005354 Bacteria 615
77 Ga0070671_100009911 3300005355 Bacteria 7653
78 Ga0070671_100040309 3300005355 Bacteria 3878
79 Ga0070671_100346586 3300005355 Bacteria 1267
80 Ga0070671_100417834 3300005355 Bacteria 1148
81 Ga0070674_100102038 3300005356 Bacteria 2092
82 Ga0070674_100310568 3300005356 Bacteria 1260
83 Ga0070674_100510275 3300005356 Bacteria 1003
84 Ga0070673_100024266 3300005364 Bacteria 4444
85 Ga0070673_100058908 3300005364 Bacteria 3038
86 Ga0070673_100212487 3300005364 Bacteria 1671
87 Ga0070673_100484643 3300005364 Bacteria 1117
88 Ga0070673_100693256 3300005364 Bacteria 935
89 Ga0070673_102117349 3300005364 Bacteria 534
90 Ga0070688_100018619 3300005365 Bacteria 4010
91 Ga0070688_100115624 3300005365 Bacteria 1790
92 Ga0070659_100075203 3300005366 Bacteria 2692
93 Ga0070659_100147729 3300005366 Bacteria 1916
94 Ga0070659_100792310 3300005366 Unclassified 824
95 Ga0070659_101657799 3300005366 Bacteria 571
96 Ga0070667_100060874 3300005367 Bacteria 3195
97 Ga0070667_100365529 3300005367 Unclassified 1308
98 Ga0070703_10009050 3300005406 Bacteria 2808
99 Ga0070701_10107210 3300005438 Bacteria 1556
100 Ga0070701_10729707 3300005438 Bacteria 669
101 Ga0070711_101425002 3300005439 Unclassified 603
102 Ga0070705_100003684 3300005440 Bacteria 7500
103 Ga0070705_100084892 3300005440 Bacteria 1955
104 Ga0070705_100240855 3300005440 Bacteria 1264
105 Ga0070705_100425818 3300005440 Unclassified 989
106 Ga0070700_100000079 3300005441 Bacteria 64802
107 Ga0070700_100003949 3300005441 Bacteria 7701
108 Ga0070700_100003968 3300005441 Bacteria 7684
109 Ga0070700_100045611 3300005441 Bacteria 2704
110 Ga0070700_100089925 3300005441 Bacteria 2001
111 Ga0070700_100156879 3300005441 Bacteria 1563
112 Ga0070700_100237492 3300005441 Bacteria 1300
113 Ga0070694_100015314 3300005444 Bacteria 4814
114 Ga0070694_100090005 3300005444 Bacteria 2151
115 Ga0070694_100102317 3300005444 Bacteria 2028
116 Ga0070694_100201223 3300005444 Bacteria 1485
117 Ga0070694_100229501 3300005444 Bacteria 1396
118 Ga0070694_100258329 3300005444 Bacteria 1320
119 Ga0070694_100341781 3300005444 Bacteria 1157
120 Ga0070694_100371063 3300005444 Bacteria 1114
121 Ga0070694_100483483 3300005444 Unclassified 983
122 Ga0070694_101041971 3300005444 Unclassified 680
123 Ga0070694_101062103 3300005444 Unclassified 674
124 Ga0070694_101595822 3300005444 Unclassified 553
125 Ga0070708_100082706 3300005445 Bacteria 2909
126 Ga0070708_100236922 3300005445 Bacteria 1713
127 Ga0070663_100294992 3300005455 Unclassified 1296
128 Ga0070678_100271395 3300005456 Bacteria 1431
129 Ga0070678_100529499 3300005456 Bacteria 1044
130 Ga0070662_100049632 3300005457 Bacteria 3026
131 Ga0070662_100064896 3300005457 Bacteria 2675
132 Ga0070681_10000108 3300005458 Bacteria 61616
133 Ga0070681_10005435 3300005458 Bacteria 12306
134 Ga0070681_10012071 3300005458 Bacteria 8567
135 Ga0070681_10505520 3300005458 Bacteria 1122
136 Ga0068867_100055259 3300005459 Bacteria 2935
137 Ga0068867_100064832 3300005459 Bacteria 2716
138 Ga0068867_100631323 3300005459 Bacteria 938
139 Ga0068867_100873851 3300005459 Unclassified 807
140 Ga0068867_100941703 3300005459 Bacteria 780
141 Ga0068867_101417959 3300005459 Unclassified 645
142 Ga0068867_102107937 3300005459 Unclassified 534
143 Ga0070685_10001769 3300005466 Bacteria 11302
144 Ga0070706_100000216 3300005467 Bacteria 71047
145 Ga0070706_100064121 3300005467 Bacteria 3396
146 Ga0070707_100099007 3300005468 Bacteria 2824
147 Ga0070707_100116787 3300005468 Bacteria 2590
148 Ga0070707_100423384 3300005468 Bacteria 1292
149 Ga0070698_100004504 3300005471 Bacteria 15321
150 Ga0070698_100032020 3300005471 Bacteria 5449
151 Ga0070698_100040616 3300005471 Bacteria 4780
152 Ga0070699_100010387 3300005518 Bacteria 8054
153 Ga0070699_100039638 3300005518 Bacteria 4078
154 Ga0070699_100411974 3300005518 Bacteria 1223
155 Ga0070679_100000130 3300005530 Bacteria 60396
156 Ga0070679_100028227 3300005530 Bacteria 5531
157 Ga0070679_100146061 3300005530 Bacteria 2343
158 Ga0070684_100045868 3300005535 Bacteria 3786
159 Ga0070684_100199779 3300005535 Bacteria 1821
160 Ga0070684_101363732 3300005535 Unclassified 668
161 Ga0070697_100129740 3300005536 Bacteria 2114
162 Ga0068853_100117874 3300005539 Bacteria 2365
163 Ga0068853_100154606 3300005539 Bacteria 2066
164 Ga0068853_100234475 3300005539 Bacteria 1680
165 Ga0068853_100324911 3300005539 Bacteria 1427
166 Ga0068853_100722396 3300005539 Bacteria 951
167 Ga0068853_102300210 3300005539 Unclassified 522
168 Ga0070672_100394245 3300005543 Bacteria 1186
169 Ga0070672_100980093 3300005543 Unclassified 749
170 Ga0070686_100001598 3300005544 Bacteria 12742
171 Ga0070695_100045331 3300005545 Bacteria 2802
172 Ga0070695_100054098 3300005545 Bacteria 2582
173 Ga0070695_100160516 3300005545 Bacteria 1577
174 Ga0070695_100246359 3300005545 Bacteria 1299
175 Ga0070695_100282847 3300005545 Unclassified 1219
176 Ga0070695_100356754 3300005545 Bacteria 1097
177 Ga0070695_100578949 3300005545 Bacteria 879
178 Ga0070695_100747660 3300005545 Unclassified 780
179 Ga0070695_101221874 3300005545 Bacteria 619
180 Ga0070695_101246325 3300005545 Unclassified 613
181 Ga0070696_100046086 3300005546 Bacteria 3022
182 Ga0070696_100224889 3300005546 Unclassified 1409
183 Ga0070696_100446497 3300005546 Bacteria 1020
184 Ga0070696_100569588 3300005546 Unclassified 910
185 Ga0070696_100693277 3300005546 Unclassified 829
186 Ga0070696_101100530 3300005546 Bacteria 668
187 Ga0070696_101259167 3300005546 Bacteria 627
188 Ga0070696_101387522 3300005546 Bacteria 599
189 Ga0070693_100008761 3300005547 Bacteria 5010
190 Ga0070693_100034933 3300005547 Bacteria 2785
191 Ga0070693_100087810 3300005547 Bacteria 1868
192 Ga0070693_100251052 3300005547 Unclassified 1172
193 Ga0070693_100453918 3300005547 Bacteria 900
194 Ga0070693_101256876 3300005547 Unclassified 571
195 Ga0070665_100054607 3300005548 Bacteria 4007
196 Ga0070665_101532719 3300005548 Unclassified 675
197 Ga0070704_100114233 3300005549 Bacteria 2061
198 Ga0070704_100127580 3300005549 Bacteria 1965
199 Ga0070704_100866134 3300005549 Unclassified 811
200 Ga0070704_101044087 3300005549 Unclassified 741
201 Ga0070704_101126517 3300005549 Bacteria 713
202 Ga0070704_101203074 3300005549 Bacteria 691
203 Ga0070704_101361630 3300005549 Unclassified 650
204 Ga0070704_101480064 3300005549 Bacteria 624
205 Ga0070704_101605693 3300005549 Unclassified 600
206 Ga0068855_100612640 3300005563 Bacteria 1173
207 Ga0068855_100704015 3300005563 Unclassified 1081
208 Ga0068855_100918596 3300005563 Bacteria 924
209 Ga0068855_101502028 3300005563 Unclassified 692
210 Ga0070664_100003909 3300005564 Bacteria 12022
211 Ga0070664_100420641 3300005564 Bacteria 1224
212 Ga0070664_100471314 3300005564 Bacteria 1155
213 Ga0070664_100728768 3300005564 Bacteria 925
214 Ga0070664_101118410 3300005564 Unclassified 742
215 Ga0068857_100009445 3300005577 Bacteria 8468
216 Ga0068857_100465223 3300005577 Bacteria 1184
217 Ga0068857_100469549 3300005577 Unclassified 1178
218 Ga0068857_100530165 3300005577 Bacteria 1107
219 Ga0068857_101193224 3300005577 Unclassified 737
220 Ga0068857_101212588 3300005577 Bacteria 731
221 Ga0068857_101751965 3300005577 Unclassified 608
222 Ga0068857_101769563 3300005577 Unclassified 605
223 Ga0068854_100286467 3300005578 Bacteria 1328
224 Ga0068854_100371867 3300005578 Bacteria 1175
225 Ga0068854_100439974 3300005578 Bacteria 1087
226 Ga0068854_100560388 3300005578 Bacteria 970
227 Ga0068854_100752265 3300005578 Unclassified 846
228 Ga0068854_100836593 3300005578 Unclassified 805
229 Ga0068856_100022206 3300005614 Bacteria 6170
230 Ga0070702_100032596 3300005615 Bacteria 2860
231 Ga0070702_100058802 3300005615 Bacteria 2229
232 Ga0070702_100101243 3300005615 Bacteria 1767
233 Ga0070702_100108900 3300005615 Unclassified 1714
234 Ga0070702_100153529 3300005615 Bacteria 1481
235 Ga0070702_100188762 3300005615 Bacteria 1354
236 Ga0070702_100350383 3300005615 Bacteria 1040
237 Ga0070702_100576530 3300005615 Unclassified 839
238 Ga0070702_100972194 3300005615 Bacteria 670
239 Ga0068852_100090297 3300005616 Bacteria 2739
240 Ga0068852_100212027 3300005616 Bacteria 1838
241 Ga0068852_100685271 3300005616 Bacteria 1034
242 Ga0068852_100908025 3300005616 Unclassified 898
243 Ga0068859_100020874 3300005617 Bacteria 6573
244 Ga0068859_100057491 3300005617 Bacteria 3918
245 Ga0068859_100091379 3300005617 Bacteria 3095
246 Ga0068859_100126945 3300005617 Bacteria 2620
247 Ga0068859_100134368 3300005617 Bacteria 2545
248 Ga0068859_100147338 3300005617 Bacteria 2429
249 Ga0068859_100171679 3300005617 Bacteria 2249
250 Ga0068859_100200045 3300005617 Bacteria 2083
251 Ga0068859_100343244 3300005617 Bacteria 1587
252 Ga0068859_100360280 3300005617 Bacteria 1549
253 Ga0068859_100736194 3300005617 Unclassified 1075
254 Ga0068859_100922202 3300005617 Bacteria 958
255 Ga0068859_100958632 3300005617 Bacteria 938
256 Ga0068859_101192326 3300005617 Bacteria 838
257 Ga0068859_101356034 3300005617 Unclassified 784
258 Ga0068859_101410739 3300005617 Unclassified 768
259 Ga0068864_100008882 3300005618 Bacteria 8287
260 Ga0068864_100047755 3300005618 Bacteria 3678
261 Ga0068864_100055434 3300005618 Bacteria 3423
262 Ga0068864_100087598 3300005618 Bacteria 2741
263 Ga0068864_100150240 3300005618 Bacteria 2109
264 Ga0068864_100217006 3300005618 Bacteria 1763
265 Ga0068864_100359082 3300005618 Bacteria 1376
266 Ga0068864_100373167 3300005618 Bacteria 1350
267 Ga0068864_101000340 3300005618 Unclassified 829
268 Ga0068864_101086550 3300005618 Unclassified 796
269 Ga0068864_101194964 3300005618 Unclassified 759
270 Ga0068864_101314552 3300005618 Bacteria 723
271 Ga0068864_102323866 3300005618 Unclassified 542
272 Ga0068866_10008767 3300005718 Bacteria 4273
273 Ga0068866_10026310 3300005718 Bacteria 2746
274 Ga0068861_100006559 3300005719 Bacteria 7939
275 Ga0068861_100080485 3300005719 Bacteria 2548
276 Ga0068861_100338740 3300005719 Bacteria 1316
277 Ga0068861_100791379 3300005719 Bacteria 889
278 Ga0068861_100854766 3300005719 Bacteria 858
279 Ga0068851_10005871 3300005834 Bacteria 5591
280 Ga0068870_10029915 3300005840 Bacteria 2749
281 Ga0068870_10041823 3300005840 Bacteria 2383
282 Ga0068863_100024487 3300005841 Bacteria 5756
283 Ga0068863_100031235 3300005841 Bacteria 5084
284 Ga0068863_100037146 3300005841 Bacteria 4638
285 Ga0068863_100250463 3300005841 Bacteria 1711
286 Ga0068863_100308608 3300005841 Bacteria 1535
287 Ga0068863_100588680 3300005841 Bacteria 1100
288 Ga0068863_100687235 3300005841 Bacteria 1017
289 Ga0068863_100800789 3300005841 Unclassified 940
290 Ga0068863_100911330 3300005841 Unclassified 880
291 Ga0068858_100027035 3300005842 Bacteria 5329
292 Ga0068858_100148403 3300005842 Bacteria 2203
293 Ga0068858_100148487 3300005842 Bacteria 2203
294 Ga0068858_100186070 3300005842 Bacteria 1961
295 Ga0068858_100229051 3300005842 Bacteria 1761
296 Ga0068858_100460193 3300005842 Bacteria 1227
297 Ga0068858_100539913 3300005842 Bacteria 1128
298 Ga0068858_100833286 3300005842 Bacteria 900
299 Ga0068858_101762575 3300005842 Bacteria 612
300 Ga0068860_100010673 3300005843 Bacteria 9072
301 Ga0068860_100022053 3300005843 Bacteria 6165
302 Ga0068860_100076261 3300005843 Bacteria 3188
303 Ga0068860_100148209 3300005843 Bacteria 2259
304 Ga0068860_100195569 3300005843 Bacteria 1958
305 Ga0068860_100251399 3300005843 Bacteria 1721
306 Ga0068860_100492889 3300005843 Bacteria 1222
307 Ga0068860_100720380 3300005843 Bacteria 1008
308 Ga0068862_100035903 3300005844 Bacteria 4199
309 Ga0068862_100087511 3300005844 Bacteria 2710
310 Ga0068862_101181197 3300005844 Bacteria 763
311 Ga0081455_10384106 3300005937 Bacteria 980
312 Ga0081539_10001600 3300005985 Bacteria 37341
313 Ga0081539_10002160 3300005985 Bacteria 28960
314 Ga0081539_10046832 3300005985 Bacteria 2475
315 Ga0075432_10145828 3300006058 Bacteria 906
316 Ga0097621_100021446 3300006237 Bacteria 4997
317 Ga0097621_100037541 3300006237 Bacteria 3883
318 Ga0097621_100207620 3300006237 Bacteria 1703
319 Ga0097621_100306674 3300006237 Bacteria 1403
320 Ga0068871_100012372 3300006358 Bacteria 6287
321 Ga0068871_100044378 3300006358 Bacteria 3575
322 Ga0068871_100152311 3300006358 Bacteria 1973
323 Ga0068871_100167738 3300006358 Bacteria 1880
324 Ga0068871_100409064 3300006358 Unclassified 1209
325 Ga0068871_101057807 3300006358 Bacteria 758
326 Ga0075428_100250737 3300006844 Bacteria 1908
327 Ga0075428_100348532 3300006844 Bacteria 1589
328 Ga0075428_100412126 3300006844 Bacteria 1448
329 Ga0075428_100453981 3300006844 Bacteria 1373
330 Ga0075428_101676143 3300006844 Bacteria 664
331 Ga0075430_100035860 3300006846 Bacteria 4206
332 Ga0075430_100046091 3300006846 Bacteria 3681
333 Ga0075430_100807819 3300006846 Unclassified 773
334 Ga0075431_100010768 3300006847 Bacteria 9195
335 Ga0075431_100145002 3300006847 Bacteria 2447
336 Ga0075431_101042177 3300006847 Bacteria 784
337 Ga0075433_10002990 3300006852 Bacteria 12983
338 Ga0075433_10010053 3300006852 Bacteria 7583
339 Ga0075433_10087429 3300006852 Bacteria 2752
340 Ga0075433_10108152 3300006852 Bacteria 2466
341 Ga0075433_10451686 3300006852 Bacteria 1133
342 Ga0075433_10681373 3300006852 Bacteria 901
343 Ga0075434_100054360 3300006871 Bacteria 3978
344 Ga0075434_100264992 3300006871 Bacteria 1737
345 Ga0075434_100431151 3300006871 Bacteria 1339
346 Ga0075434_100467973 3300006871 Bacteria 1282
347 Ga0075429_100016544 3300006880 Bacteria 6389
348 Ga0075429_100066116 3300006880 Bacteria 3147
349 Ga0075429_100627088 3300006880 Bacteria 942
350 Ga0075429_100688359 3300006880 Bacteria 896
351 Ga0068865_100003965 3300006881 Bacteria 8878
352 Ga0075436_100047717 3300006914 Bacteria 2954
353 Ga0097620_100020874 3300006931 Bacteria 6573
354 Ga0097620_100057486 3300006931 Bacteria 3918
355 Ga0097620_100091382 3300006931 Bacteria 3095
356 Ga0097620_100126944 3300006931 Bacteria 2620
357 Ga0097620_100129603 3300006931 Bacteria 2593
358 Ga0097620_100134362 3300006931 Bacteria 2545
359 Ga0097620_100147329 3300006931 Bacteria 2429
360 Ga0097620_100171678 3300006931 Bacteria 2249
361 Ga0097620_100200038 3300006931 Bacteria 2083
362 Ga0097620_100343224 3300006931 Bacteria 1587
363 Ga0097620_100360302 3300006931 Bacteria 1549
364 Ga0097620_100736157 3300006931 Unclassified 1075
365 Ga0097620_100922189 3300006931 Bacteria 958
366 Ga0097620_100958624 3300006931 Bacteria 938
367 Ga0097620_101192269 3300006931 Bacteria 838
368 Ga0097620_101355900 3300006931 Unclassified 784
369 Ga0097620_101410867 3300006931 Unclassified 768
370 Ga0105251_10078083 3300009011 Bacteria 1533
371 Ga0105251_10392823 3300009011 Unclassified 637
372 Ga0105240_10118643 3300009093 Bacteria 3188
373 Ga0105240_10776644 3300009093 Bacteria 1039
374 Ga0111539_10001071 3300009094 Bacteria 36121
375 Ga0111539_10011514 3300009094 Bacteria 11099
376 Ga0111539_10113969 3300009094 Bacteria 3171
377 Ga0111539_10120496 3300009094 Bacteria 3074
378 Ga0111539_10707327 3300009094 Bacteria 1173
379 Ga0105245_10569097 3300009098 Bacteria 1157
380 Ga0105245_10953559 3300009098 Bacteria 901
381 Ga0105245_11065950 3300009098 Unclassified 854
382 Ga0105245_11412091 3300009098 Bacteria 746
383 Ga0105245_11771919 3300009098 Unclassified 670
384 Ga0105247_10054744 3300009101 Bacteria 2462
385 Ga0105247_10055000 3300009101 Bacteria 2456
386 Ga0105247_10104496 3300009101 Bacteria 1815
387 Ga0105247_10236162 3300009101 Bacteria 1243
388 Ga0105247_10425456 3300009101 Bacteria 952
389 Ga0105247_10556756 3300009101 Unclassified 844
390 Ga0105247_10965701 3300009101 Unclassified 663
391 Ga0114129_10008912 3300009147 Bacteria 14306
392 Ga0114129_10034273 3300009147 Bacteria 7171
393 Ga0114129_10324516 3300009147 Bacteria 2046
394 Ga0114129_10380428 3300009147 Bacteria 1864
395 Ga0114129_10937281 3300009147 Bacteria 1095
396 Ga0114129_12793131 3300009147 Unclassified 581
397 Ga0105243_10013526 3300009148 Bacteria 6173
398 Ga0105243_10014083 3300009148 Bacteria 6051
399 Ga0105243_10454264 3300009148 Bacteria 1203
400 Ga0105243_10469353 3300009148 Bacteria 1185
401 Ga0105243_10744099 3300009148 Unclassified 960
402 Ga0105243_10850058 3300009148 Unclassified 903
403 Ga0105241_10046420 3300009174 Bacteria 3299
404 Ga0105241_10069462 3300009174 Bacteria 2731
405 Ga0105241_10101326 3300009174 Bacteria 2289
406 Ga0105241_10135649 3300009174 Bacteria 1998
407 Ga0105241_10197935 3300009174 Bacteria 1676
408 Ga0105241_10199556 3300009174 Bacteria 1670
409 Ga0105241_10394660 3300009174 Bacteria 1212
410 Ga0105241_10465823 3300009174 Bacteria 1120
411 Ga0105241_10649944 3300009174 Bacteria 958
412 Ga0105242_10002366 3300009176 Bacteria 14883
413 Ga0105242_10087822 3300009176 Bacteria 2611
414 Ga0105242_10529950 3300009176 Bacteria 1125
415 Ga0105242_11224938 3300009176 Bacteria 771
416 Ga0105242_11359529 3300009176 Unclassified 736
417 Ga0105248_10002567 3300009177 Bacteria 20197
418 Ga0105248_10015622 3300009177 Bacteria 8369
419 Ga0105248_10061588 3300009177 Bacteria 4214
420 Ga0105248_10098012 3300009177 Bacteria 3303
421 Ga0105248_10107055 3300009177 Bacteria 3153
422 Ga0105248_10113253 3300009177 Bacteria 3059
423 Ga0105248_10141034 3300009177 Bacteria 2719
424 Ga0105248_10178706 3300009177 Bacteria 2392
425 Ga0105248_10688537 3300009177 Bacteria 1153
426 Ga0105248_11937656 3300009177 Bacteria 669
427 Ga0105237_10004453 3300009545 Bacteria 16203
428 Ga0105237_10034694 3300009545 Bacteria 5107
429 Ga0105237_10240332 3300009545 Bacteria 1812
430 Ga0105237_10796217 3300009545 Bacteria 952
431 Ga0105238_10012469 3300009551 Bacteria 8573
432 Ga0105238_10235171 3300009551 Bacteria 1809
433 Ga0105238_11281171 3300009551 Bacteria 759
434 Ga0105249_10029885 3300009553 Bacteria 4923
435 Ga0105249_10048239 3300009553 Bacteria 3883
436 Ga0105249_10245793 3300009553 Bacteria 1771
437 Ga0105249_10822565 3300009553 Unclassified 993
438 Ga0105249_11606091 3300009553 Bacteria 723
439 Ga0105249_12577882 3300009553 Bacteria 581
440 Ga0105239_10042885 3300010375 Bacteria 4957
441 Ga0105239_10078860 3300010375 Bacteria 3624
442 Ga0105239_10388652 3300010375 Bacteria 1578
443 Ga0105239_10770143 3300010375 Bacteria 1102
444 Ga0105239_10808758 3300010375 Bacteria 1074
445 Ga0105239_11355618 3300010375 Unclassified 821
446 Ga0105246_10104096 3300011119 Bacteria 2072
447 Ga0105246_10131643 3300011119 Bacteria 1869
448 Ga0105246_10240117 3300011119 Bacteria 1432
449 Ga0105246_10424439 3300011119 Bacteria 1111
450 Ga0105246_10576839 3300011119 Unclassified 968
451 Ga0105246_10746799 3300011119 Bacteria 863
452 Ga0157337_1036895 3300012483 Unclassified 524
453 Ga0157373_10023676 3300013100 Bacteria 4451
454 Ga0157373_10212604 3300013100 Bacteria 1364
455 Ga0157373_10240496 3300013100 Bacteria 1280
456 Ga0157373_10288553 3300013100 Bacteria 1164
457 Ga0157373_10750650 3300013100 Unclassified 717
458 Ga0157373_10952230 3300013100 Unclassified 639
459 Ga0157373_11264965 3300013100 Unclassified 558
460 Ga0157371_10687917 3300013102 Bacteria 765
461 Ga0157371_10967081 3300013102 Unclassified 648
462 Ga0157374_10037850 3300013296 Bacteria 4431
463 Ga0157374_10679619 3300013296 Bacteria 1042
464 Ga0157374_11065602 3300013296 Unclassified 828
465 Ga0157374_11211944 3300013296 Unclassified 776
466 Ga0157378_10003275 3300013297 Bacteria 14395
467 Ga0157378_10008574 3300013297 Bacteria 8898
468 Ga0157378_10102828 3300013297 Bacteria 2610
469 Ga0157378_11436347 3300013297 Unclassified 733
470 Ga0157378_12056147 3300013297 Bacteria 621
471 Ga0157378_12941595 3300013297 Unclassified 528
472 Ga0163162_10002858 3300013306 Bacteria 16436
473 Ga0163162_10037108 3300013306 Bacteria 4860
474 Ga0163162_10066693 3300013306 Bacteria 3648
475 Ga0163162_10136189 3300013306 Bacteria 2567
476 Ga0163162_10383566 3300013306 Bacteria 1538
477 Ga0163162_10720997 3300013306 Bacteria 1118
478 Ga0163162_10777319 3300013306 Bacteria 1076
479 Ga0163162_10981471 3300013306 Bacteria 955
480 Ga0163162_11079799 3300013306 Bacteria 909
481 Ga0157372_10022901 3300013307 Bacteria 6764
482 Ga0157372_10570533 3300013307 Bacteria 1319
483 Ga0157372_10729210 3300013307 Bacteria 1153
484 Ga0157372_10756693 3300013307 Bacteria 1130
485 Ga0157372_10840509 3300013307 Bacteria 1066
486 Ga0157372_10990275 3300013307 Unclassified 974
487 Ga0157372_11705090 3300013307 Bacteria 725
488 Ga0157375_10263309 3300013308 Bacteria 1886
489 Ga0157375_10282152 3300013308 Bacteria 1824
490 Ga0157375_10305161 3300013308 Bacteria 1756
491 Ga0157375_10456522 3300013308 Bacteria 1443
492 Ga0157375_10822387 3300013308 Bacteria 1077
493 Ga0157375_10935749 3300013308 Bacteria 1009
494 Ga0157375_12739059 3300013308 Bacteria 589
495 Ga0163163_10026807 3300014325 Bacteria 5512
496 Ga0163163_10031976 3300014325 Bacteria 5082
497 Ga0163163_10032836 3300014325 Bacteria 5016
498 Ga0163163_10039747 3300014325 Bacteria 4592
499 Ga0163163_10060967 3300014325 Bacteria 3737
500 Ga0163163_10062410 3300014325 Bacteria 3692
501 Ga0163163_10111416 3300014325 Bacteria 2765
502 Ga0163163_10450514 3300014325 Bacteria 1347
503 Ga0163163_10540986 3300014325 Bacteria 1227
504 Ga0163163_10767386 3300014325 Bacteria 1028
505 Ga0163163_11417625 3300014325 Bacteria 756
506 Ga0163163_11542947 3300014325 Unclassified 725
507 Ga0163163_11850651 3300014325 Bacteria 664
508 Ga0157380_10021329 3300014326 Bacteria 4856
509 Ga0157380_10173089 3300014326 Bacteria 1889
510 Ga0157380_10488610 3300014326 Bacteria 1193
511 Ga0157380_10744844 3300014326 Unclassified 990
512 Ga0182008_10125581 3300014497 Bacteria 1277
513 Ga0157377_10001638 3300014745 Bacteria 9768
514 Ga0157377_10038767 3300014745 Bacteria 2633
515 Ga0157377_10055400 3300014745 Bacteria 2248
516 Ga0157377_10397565 3300014745 Unclassified 938
517 Ga0157377_10526529 3300014745 Bacteria 831
518 Ga0157379_10093487 3300014968 Bacteria 2698
519 Ga0157379_10101239 3300014968 Bacteria 2586
520 Ga0157379_10249942 3300014968 Bacteria 1610
521 Ga0157376_10004566 3300014969 Bacteria 9640
522 Ga0157376_10234641 3300014969 Bacteria 1706
523 Ga0157376_10384362 3300014969 Bacteria 1353
524 Ga0163161_10027067 3300017792 Bacteria 4066
525 Ga0207697_10005421 3300025315 Bacteria 5930
526 Ga0207656_10006622 3300025321 Bacteria 4181
527 Ga0207656_10525318 3300025321 Bacteria 602
528 Ga0207713_1207308 3300025735 Unclassified 598
529 Ga0207653_10002330 3300025885 Bacteria 6056
530 Ga0207653_10157924 3300025885 Bacteria 838
531 Ga0207642_10010113 3300025899 Bacteria 3309
532 Ga0207710_10004903 3300025900 Bacteria 5802
533 Ga0207688_10150825 3300025901 Bacteria 1373
534 Ga0207688_10233773 3300025901 Bacteria 1110
535 Ga0207680_10061292 3300025903 Bacteria 2294
536 Ga0207680_10330373 3300025903 Bacteria 1068
537 Ga0207647_10005002 3300025904 Bacteria 9772
538 Ga0207647_10067400 3300025904 Bacteria 2169
539 Ga0207647_10400529 3300025904 Bacteria 773
540 Ga0207645_10055837 3300025907 Bacteria 2521
541 Ga0207645_10291166 3300025907 Unclassified 1086
542 Ga0207643_10002327 3300025908 Bacteria 10343
543 Ga0207643_10023342 3300025908 Bacteria 3409
544 Ga0207643_10043077 3300025908 Bacteria 2546
545 Ga0207643_10160996 3300025908 Bacteria 1350
546 Ga0207684_10000117 3300025910 Bacteria 148207
547 Ga0207654_10021458 3300025911 Bacteria 3434
548 Ga0207654_10037730 3300025911 Bacteria 2706
549 Ga0207654_10118253 3300025911 Bacteria 1660
550 Ga0207654_10134671 3300025911 Bacteria 1568
551 Ga0207654_10209123 3300025911 Bacteria 1288
552 Ga0207654_10229245 3300025911 Bacteria 1236
553 Ga0207654_10419630 3300025911 Unclassified 933
554 Ga0207654_10563349 3300025911 Unclassified 810
555 Ga0207707_10000013 3300025912 Bacteria 264517
556 Ga0207707_10009149 3300025912 Bacteria 8603
557 Ga0207707_10024810 3300025912 Bacteria 5246
558 Ga0207707_10103842 3300025912 Bacteria 2484
559 Ga0207707_10874085 3300025912 Unclassified 745
560 Ga0207695_10095466 3300025913 Bacteria 2977
561 Ga0207695_10265406 3300025913 Bacteria 1613
562 Ga0207695_11384810 3300025913 Unclassified 584
563 Ga0207671_10002628 3300025914 Bacteria 18914
564 Ga0207671_10336384 3300025914 Bacteria 1196
565 Ga0207671_10611243 3300025914 Bacteria 869
566 Ga0207671_10698488 3300025914 Bacteria 807
567 Ga0207660_10002487 3300025917 Bacteria 12112
568 Ga0207660_10007233 3300025917 Bacteria 7185
569 Ga0207660_10131890 3300025917 Bacteria 1903
570 Ga0207662_10014250 3300025918 Bacteria 4458
571 Ga0207662_10058848 3300025918 Bacteria 2301
572 Ga0207662_10358866 3300025918 Bacteria 980
573 Ga0207657_10139145 3300025919 Bacteria 1984
574 Ga0207649_10145010 3300025920 Bacteria 1629
575 Ga0207652_10000071 3300025921 Bacteria 109636
576 Ga0207652_10129046 3300025921 Bacteria 2254
577 Ga0207646_10083854 3300025922 Bacteria 2850
578 Ga0207681_10025909 3300025923 Bacteria 3777
579 Ga0207681_10034333 3300025923 Bacteria 3334
580 Ga0207681_10515313 3300025923 Bacteria 981
581 Ga0207681_11247776 3300025923 Unclassified 624
582 Ga0207694_10111284 3300025924 Bacteria 2179
583 Ga0207694_10117583 3300025924 Bacteria 2120
584 Ga0207650_10000028 3300025925 Bacteria 236867
585 Ga0207650_10062216 3300025925 Bacteria 2788
586 Ga0207650_10112106 3300025925 Bacteria 2113
587 Ga0207650_10508348 3300025925 Bacteria 1007
588 Ga0207659_10806777 3300025926 Bacteria 806
589 Ga0207687_10232978 3300025927 Bacteria 1455
590 Ga0207687_10499540 3300025927 Bacteria 1015
591 Ga0207687_11033502 3300025927 Unclassified 705
592 Ga0207644_10004129 3300025931 Bacteria 9416
593 Ga0207644_10011552 3300025931 Bacteria 5846
594 Ga0207644_10160336 3300025931 Bacteria 1748
595 Ga0207644_10282293 3300025931 Bacteria 1333
596 Ga0207644_11590537 3300025931 Bacteria 548
597 Ga0207644_11717140 3300025931 Bacteria 526
598 Ga0207690_10051530 3300025932 Bacteria 2753
599 Ga0207690_10101894 3300025932 Bacteria 2052
600 Ga0207690_10805088 3300025932 Unclassified 777
601 Ga0207706_10046434 3300025933 Bacteria 3845
602 Ga0207706_10296928 3300025933 Bacteria 1408
603 Ga0207686_10053671 3300025934 Bacteria 2521
604 Ga0207686_10149530 3300025934 Bacteria 1624
605 Ga0207686_10227531 3300025934 Bacteria 1350
606 Ga0207686_10901972 3300025934 Bacteria 713
607 Ga0207709_10003038 3300025935 Bacteria 10177
608 Ga0207709_10031060 3300025935 Bacteria 3115
609 Ga0207709_10710108 3300025935 Unclassified 805
610 Ga0207709_11716191 3300025935 Unclassified 522
611 Ga0207670_10000292 3300025936 Bacteria 30537
612 Ga0207670_10508405 3300025936 Bacteria 979
613 Ga0207670_10666156 3300025936 Unclassified 859
614 Ga0207670_11003005 3300025936 Bacteria 702
615 Ga0207669_10258965 3300025937 Bacteria 1300
616 Ga0207669_10445908 3300025937 Bacteria 1024
617 Ga0207704_10051664 3300025938 Bacteria 2487
618 Ga0207704_10064892 3300025938 Bacteria 2284
619 Ga0207665_10104173 3300025939 Bacteria 1985
620 Ga0207665_10510402 3300025939 Bacteria 930
621 Ga0207691_10002251 3300025940 Bacteria 18930
622 Ga0207691_10618051 3300025940 Bacteria 917
623 Ga0207711_10000824 3300025941 Bacteria 30305
624 Ga0207711_10025383 3300025941 Bacteria 4972
625 Ga0207711_10034166 3300025941 Bacteria 4307
626 Ga0207711_10052318 3300025941 Bacteria 3499
627 Ga0207711_10428837 3300025941 Bacteria 1230
628 Ga0207711_10779861 3300025941 Unclassified 890
629 Ga0207689_10005061 3300025942 Bacteria 11882
630 Ga0207689_10030136 3300025942 Bacteria 4522
631 Ga0207689_10049647 3300025942 Bacteria 3461
632 Ga0207689_10058312 3300025942 Bacteria 3175
633 Ga0207689_10063847 3300025942 Bacteria 3030
634 Ga0207689_10180263 3300025942 Bacteria 1742
635 Ga0207689_10265549 3300025942 Bacteria 1420
636 Ga0207689_10300743 3300025942 Bacteria 1330
637 Ga0207689_10346363 3300025942 Bacteria 1235
638 Ga0207689_10443651 3300025942 Bacteria 1084
639 Ga0207689_10736518 3300025942 Bacteria 832
640 Ga0207689_10878250 3300025942 Bacteria 757
641 Ga0207689_11014759 3300025942 Bacteria 700
642 Ga0207689_11226765 3300025942 Bacteria 631
643 Ga0207679_10011379 3300025945 Bacteria 5759
644 Ga0207679_10769798 3300025945 Bacteria 876
645 Ga0207679_10955192 3300025945 Unclassified 785
646 Ga0207679_11048470 3300025945 Bacteria 748
647 Ga0207679_11168726 3300025945 Bacteria 706
648 Ga0207651_10071322 3300025960 Bacteria 2462
649 Ga0207651_10074444 3300025960 Bacteria 2418
650 Ga0207651_10124310 3300025960 Bacteria 1963
651 Ga0207651_10127762 3300025960 Bacteria 1940
652 Ga0207651_10152235 3300025960 Bacteria 1802
653 Ga0207651_10409642 3300025960 Bacteria 1155
654 Ga0207651_10822401 3300025960 Bacteria 824
655 Ga0207651_10882862 3300025960 Unclassified 796
656 Ga0207651_11469852 3300025960 Unclassified 614
657 Ga0207712_10006611 3300025961 Bacteria 7316
658 Ga0207712_10042663 3300025961 Bacteria 3126
659 Ga0207712_10106423 3300025961 Bacteria 2095
660 Ga0207712_10406132 3300025961 Bacteria 1146
661 Ga0207712_10687208 3300025961 Bacteria 892
662 Ga0207712_10948032 3300025961 Bacteria 762
663 Ga0207640_10490603 3300025981 Bacteria 1021
664 Ga0207640_10548229 3300025981 Bacteria 971
665 Ga0207640_10581714 3300025981 Bacteria 945
666 Ga0207640_10756910 3300025981 Bacteria 838
667 Ga0207640_10770702 3300025981 Unclassified 831
668 Ga0207658_10093291 3300025986 Bacteria 2340
669 Ga0207658_10170548 3300025986 Bacteria 1792
670 Ga0207677_10049798 3300026023 Bacteria 2829
671 Ga0207703_10414592 3300026035 Bacteria 1252
672 Ga0207703_10638387 3300026035 Bacteria 1009
673 Ga0207703_10813785 3300026035 Unclassified 892
674 Ga0207703_10840829 3300026035 Unclassified 877
675 Ga0207703_11553226 3300026035 Bacteria 637
676 Ga0207639_10030450 3300026041 Bacteria 3957
677 Ga0207639_10149804 3300026041 Bacteria 1953
678 Ga0207639_10452091 3300026041 Unclassified 1166
679 Ga0207639_10499512 3300026041 Bacteria 1111
680 Ga0207639_11384818 3300026041 Unclassified 660
681 Ga0207678_11006373 3300026067 Unclassified 738
682 Ga0207678_11211691 3300026067 Unclassified 668
683 Ga0207678_11262645 3300026067 Bacteria 654
684 Ga0207708_10000057 3300026075 Bacteria 97103
685 Ga0207708_10009147 3300026075 Bacteria 7331
686 Ga0207708_10014904 3300026075 Bacteria 5821
687 Ga0207708_10060602 3300026075 Bacteria 2888
688 Ga0207708_10080691 3300026075 Bacteria 2500
689 Ga0207708_10273641 3300026075 Bacteria 1366
690 Ga0207708_10499076 3300026075 Bacteria 1020
691 Ga0207702_10278863 3300026078 Unclassified 1579
692 Ga0207641_10010732 3300026088 Bacteria 7510
693 Ga0207641_10079994 3300026088 Bacteria 2834
694 Ga0207641_10254392 3300026088 Bacteria 1642
695 Ga0207641_10340779 3300026088 Bacteria 1426
696 Ga0207641_10390440 3300026088 Bacteria 1335
697 Ga0207641_10610382 3300026088 Bacteria 1069
698 Ga0207641_10639340 3300026088 Bacteria 1044
699 Ga0207648_10067571 3300026089 Bacteria 3116
700 Ga0207648_10179491 3300026089 Bacteria 1874
701 Ga0207648_10319111 3300026089 Bacteria 1396
702 Ga0207648_10553003 3300026089 Bacteria 1057
703 Ga0207676_10009460 3300026095 Bacteria 6937
704 Ga0207676_10010192 3300026095 Bacteria 6689
705 Ga0207676_10012616 3300026095 Bacteria 6061
706 Ga0207676_10019944 3300026095 Bacteria 4897
707 Ga0207676_10029285 3300026095 Bacteria 4120
708 Ga0207676_10047811 3300026095 Bacteria 3317
709 Ga0207676_10074058 3300026095 Bacteria 2742
710 Ga0207676_10119596 3300026095 Bacteria 2219
711 Ga0207676_10350324 3300026095 Bacteria 1365
712 Ga0207676_10414970 3300026095 Bacteria 1261
713 Ga0207676_10446665 3300026095 Bacteria 1218
714 Ga0207676_10755640 3300026095 Unclassified 946
715 Ga0207676_11855822 3300026095 Bacteria 601
716 Ga0207674_10000136 3300026116 Bacteria 84993
717 Ga0207674_10192447 3300026116 Bacteria 1990
718 Ga0207674_10204427 3300026116 Bacteria 1924
719 Ga0207674_10519333 3300026116 Bacteria 1150
720 Ga0207674_10533275 3300026116 Bacteria 1134
721 Ga0207674_10635030 3300026116 Unclassified 1031
722 Ga0207674_10635306 3300026116 Unclassified 1031
723 Ga0207674_10842237 3300026116 Unclassified 884
724 Ga0207674_11916249 3300026116 Unclassified 559
725 Ga0207675_100005168 3300026118 Bacteria 12566
726 Ga0207675_100082073 3300026118 Bacteria 3023
727 Ga0207675_100090867 3300026118 Bacteria 2871
728 Ga0207675_100200928 3300026118 Bacteria 1914
729 Ga0207675_100260247 3300026118 Bacteria 1681
730 Ga0207675_100794003 3300026118 Bacteria 960
731 Ga0207675_101238262 3300026118 Unclassified 767
732 Ga0207683_10067772 3300026121 Bacteria 3149
733 Ga0207683_10571534 3300026121 Bacteria 1046
734 Ga0207698_10268460 3300026142 Bacteria 1571
735 Ga0207698_10647186 3300026142 Bacteria 1047
736 Ga0207428_10003466 3300027907 Bacteria 15310
737 Ga0207428_10041118 3300027907 Bacteria 3745
738 Ga0268266_10573779 3300028379 Bacteria 1082
739 Ga0268265_10053692 3300028380 Bacteria 3054
740 Ga0268265_10063965 3300028380 Bacteria 2832
741 Ga0268265_10195888 3300028380 Bacteria 1749
742 Ga0268264_10130960 3300028381 Bacteria 2223
743 Ga0268264_10135437 3300028381 Bacteria 2189
744 Ga0268264_10185147 3300028381 Bacteria 1894
745 Ga0268264_10240583 3300028381 Bacteria 1676
746 Ga0268264_10441580 3300028381 Bacteria 1259
747 Ga0268264_10578772 3300028381 Unclassified 1104
748 Ga0268264_10843845 3300028381 Bacteria 917
749 Ga0268264_11419676 3300028381 Unclassified 705
750 Ga0316178_1156277 3300030735 Unclassified 1041
751 Ga0307408_100059929 3300031548 Bacteria 2772
752 Ga0307405_10024023 3300031731 Bacteria 3475
753 Ga0307413_10016595 3300031824 Bacteria 3809
754 Ga0307410_10571806 3300031852 Unclassified 939
755 Ga0307406_10689919 3300031901 Unclassified 851
756 Ga0307407_10217313 3300031903 Bacteria 1290
757 Ga0307407_10264873 3300031903 Bacteria 1184
758 Ga0307412_10013676 3300031911 Bacteria 4768
759 Ga0307412_10168417 3300031911 Bacteria 1636
760 Ga0307416_100349013 3300032002 Bacteria 1496
761 Ga0307416_100361004 3300032002 Bacteria 1475
762 Ga0307414_10211754 3300032004 Bacteria 1584
763 Ga0307414_10270862 3300032004 Bacteria 1422
764 Ga0307411_10131874 3300032005 Bacteria 1828
765 Ga0307411_11534652 3300032005 Unclassified 613
766 Ga0307415_100002573 3300032126 Bacteria 9067
767 Ga0307415_100009289 3300032126 Bacteria 5500
768 Ga0307415_100182659 3300032126 Bacteria 1647
769 Ga0373940_0170514 3300035088 Unclassified 703
770 Ga0373949_0008548 3300035090 Bacteria 2240
771 Ga0373951_0002285 3300035091 Bacteria 4877
772 Ga0373941_0003583 3300035115 Bacteria 3532
773 Ga0373960_0080544 3300035121 Bacteria 1025
774 Ga0373961_0048755 3300035241 Bacteria 1249
775 Ga0373931_0520169 3300035691 Bacteria 770
776 Ga0395900_0241646 3300037418 Bacteria 1811
777 Ga0395898_0143802 3300037466 Bacteria 2283
778 Ga0395898_0981717 3300037466 Unclassified 781
779 Ga0395901_0033090 3300038443 Bacteria 5335
780 Ga0395901_0038383 3300038443 Bacteria 4954
781 Ga0395901_0669665 3300038443 Bacteria 1039
782 Ga0242422_01576 3300038699 Bacteria 1573
783 Ga0242420_002990 3300038996 Bacteria 2469
784 Ga0439448_0016348 3300042005 Bacteria 2257
785 Ga0439455_0001218 3300042012 Bacteria 4203
786 Ga0450914_002751 3300042118 Bacteria 1289
787 Ga0453683_0073803 3300044673 Bacteria 2136
788 Ga0495603_0662116 3300046455 Unclassified 597
789 Ga0495580_0530452 3300046472 Unclassified 783
790 Ga0495669_0277152 3300046684 Bacteria 806
791 Ga0496102_0009169 3300048905 Bacteria 8490
792 Ga0496104_0083425 3300048907 Bacteria 3048
793 Ga0496104_0123357 3300048907 Bacteria 2487
794 Ga0496104_1135810 3300048907 Bacteria 685
795 Ga0496106_0046779 3300048909 Bacteria 3254
796 Ga0496106_0879656 3300048909 Unclassified 708
797 Ga0496107_0846406 3300048910 Unclassified 668
798 Ga0496108_0125553 3300048911 Bacteria 2203
799 Ga0496108_0259790 3300048911 Bacteria 1511
800 Ga0496108_0646650 3300048911 Unclassified 919
801 Ga0496108_1235101 3300048911 Bacteria 631
802 Ga0496109_0220682 3300048912 Bacteria 1783
803 Ga0496110_0163204 3300048913 Bacteria 2020
804 Ga0496112_0076731 3300048915 Bacteria 3305
805 Ga0496112_0193348 3300048915 Bacteria 1996
806 Ga0496112_0194408 3300048915 Bacteria 1990
807 Ga0496112_0287990 3300048915 Bacteria 1589
808 Ga0496112_0288137 3300048915 Bacteria 1588
809 Ga0496112_0574709 3300048915 Bacteria 1060
810 Ga0496112_1054812 3300048915 Unclassified 732
811 Ga0496112_1435723 3300048915 Unclassified 604
812 Ga0496112_1474673 3300048915 Unclassified 594
813 Ga0496113_0042184 3300048916 Bacteria 3370
814 Ga0496113_0272182 3300048916 Bacteria 1354
815 Ga0501309_047275 3300049129 Unclassified 669
816 Ga0501310_022871 3300049130 Unclassified 792
817 Ga0501307_030754 3300049162 Unclassified 743
818 Ga0501307_033579 3300049162 Bacteria 721
819 Ga0501292_010399 3300049515 Bacteria 1392
820 Ga0501292_115564 3300049515 Unclassified 543
821 Ga0501296_000123 3300049519 Bacteria 9037
822 Ga0501298_019415 3300049521 Bacteria 1259
823 Ga0501298_027063 3300049521 Bacteria 1107
824 Ga0501299_001997 3300049522 Bacteria 2762
825 Ga0501299_011767 3300049522 Bacteria 1482
826 Ga0501303_043854 3300049526 Unclassified 568
827 Ga0501303_060622 3300049526 Unclassified 516
828 Ga0501311_048495 3300049527 Unclassified 661
829 Ga0501312_019496 3300049528 Unclassified 996
830 Ga0501320_049576 3300049536 Unclassified 569
831 Ga0501321_029725 3300049537 Unclassified 724
832 Ga0501038_0062503 3300049574 Bacteria 3181
833 Ga0501075_0233085 3300049591 Bacteria 1404
834 Ga0501198_020287 3300049649 Bacteria 1052
835 Ga0501198_146859 3300049649 Unclassified 516
836 Ga0501201_031284 3300049651 Unclassified 607
837 Ga0501202_017047 3300049652 Bacteria 1415
838 Ga0501202_024008 3300049652 Bacteria 1234
839 Ga0501206_033743 3300049653 Unclassified 769
840 Ga0501214_040909 3300049659 Unclassified 673
841 Ga0501217_006653 3300049661 Bacteria 2463
842 Ga0501217_008118 3300049661 Bacteria 2263
843 Ga0501217_015473 3300049661 Bacteria 1737
844 Ga0501224_036995 3300049664 Bacteria 734
845 Ga0501224_038440 3300049664 Unclassified 721
846 Ga0501227_001565 3300049665 Bacteria 5094
847 Ga0501227_019061 3300049665 Bacteria 1562
848 Ga0501227_057917 3300049665 Bacteria 988
849 Ga0501228_015161 3300049666 Bacteria 820
850 Ga0501230_004047 3300049667 Bacteria 1989
851 Ga0501230_026251 3300049667 Bacteria 1056
852 Ga0501233_013432 3300049668 Bacteria 1660
853 Ga0501235_005770 3300049669 Bacteria 2692
854 Ga0501235_017184 3300049669 Bacteria 1600
855 Ga0501236_076183 3300049670 Unclassified 622
856 Ga0501239_033709 3300049672 Unclassified 682
857 Ga0501240_009978 3300049673 Bacteria 1253
858 Ga0501243_009570 3300049675 Bacteria 1506
859 Ga0501243_010871 3300049675 Bacteria 1424
860 Ga0501243_027090 3300049675 Unclassified 966
861 Ga0501246_009351 3300049676 Bacteria 880
862 Ga0501249_020570 3300049679 Bacteria 1435
863 Ga0501249_033352 3300049679 Bacteria 1153
864 Ga0501249_093986 3300049679 Bacteria 713
865 Ga0501251_077052 3300049681 Unclassified 579
866 Ga0501255_089009 3300049684 Unclassified 527
867 Ga0501256_035000 3300049685 Unclassified 579
868 Ga0501257_019261 3300049686 Bacteria 1596
869 Ga0501257_023471 3300049686 Bacteria 1463
870 Ga0501257_083976 3300049686 Bacteria 823
871 Ga0501257_167313 3300049686 Unclassified 615
872 Ga0501260_011237 3300049689 Bacteria 904
873 Ga0501260_053455 3300049689 Unclassified 514
874 Ga0501261_040691 3300049690 Bacteria 732
875 Ga0501221_014151 3300049704 Bacteria 1479
876 Ga0501221_121085 3300049704 Unclassified 669
877 Ga0501225_0004609 3300049705 Bacteria 4100
878 Ga0501225_0058641 3300049705 Bacteria 1080
879 Ga0501234_003589 3300049707 Bacteria 2439
880 Ga0501234_043895 3300049707 Unclassified 735
881 Ga0501232_035122 3300049757 Bacteria 715
882 Ga0501263_030752 3300049760 Bacteria 758
883 Ga0501266_027351 3300049763 Bacteria 802
884 Ga0501273_010687 3300049770 Bacteria 1132
885 Ga0501283_086242 3300049779 Unclassified 596
886 Ga0501212_003386 3300049851 Bacteria 1997
887 Ga0501212_014999 3300049851 Bacteria 1152
888 Ga0501212_050346 3300049851 Unclassified 705
889 Ga0501226_006710 3300049853 Bacteria 1301
890 nmdc:mga05p37_1035288_c1 3300050507 Bacteria 868
891 nmdc:mga05p37_121849_c1 3300050507 Bacteria 3203
892 nmdc:mga05p37_165524_c1 3300050507 Bacteria 2699
893 nmdc:mga05p37_1844906_c1 3300050507 Unclassified 581
894 nmdc:mga05p37_248379_c1 3300050507 Bacteria 2135
895 nmdc:mga05p37_50495_c1 3300050507 Bacteria 5116
896 nmdc:mga09592_571682_c1 3300050508 Bacteria 970
897 nmdc:mga09592_66187_c1 3300050508 Bacteria 3062
898 nmdc:mga0qj67_141128_c1 3300050509 Bacteria 1954
899 nmdc:mga06r32_1786650_c1 3300050510 Bacteria 551
900 nmdc:mga06r32_211577_c1 3300050510 Bacteria 1927
901 nmdc:mga06r32_557119_c1 3300050510 Bacteria 1120
902 nmdc:mga08y16_1116617_c1 3300050511 Unclassified 763
903 nmdc:mga08y16_14429_c1 3300050511 Bacteria 8312
904 nmdc:mga08y16_160004_c1 3300050511 Bacteria 2339
905 nmdc:mga08y16_18628_c1 3300050511 Bacteria 7313
906 nmdc:mga0n895_179432_c1 3300050512 Bacteria 2149
907 nmdc:mga0n895_237954_c1 3300050512 Bacteria 1848
908 nmdc:mga0n895_322216_c1 3300050512 Bacteria 1566
909 nmdc:mga0rr50_63618_c1 3300050513 Bacteria 2787
910 nmdc:mga0rr50_80486_c1 3300050513 Bacteria 2511
911 nmdc:mga08x19_40165_c1 3300050514 Bacteria 2977
912 nmdc:mga0a205_1090364_c1 3300050515 Bacteria 646
913 nmdc:mga0a205_129465_c1 3300050515 Bacteria 2425
914 nmdc:mga0a205_29101_c1 3300050515 Bacteria 5286
915 nmdc:mga0a205_358970_c1 3300050515 Bacteria 1324
916 nmdc:mga0a205_381615_c1 3300050515 Bacteria 1274
917 nmdc:mga0a205_386310_c1 3300050515 Bacteria 1265
918 nmdc:mga0a205_47677_c1 3300050515 Bacteria 4135
919 nmdc:mga0a205_56485_c1 3300050515 Bacteria 3790
920 Ga0501084_0438143 3300054114 Bacteria 1105
921 Ga0587084_140376 3300059477 Unclassified 523
922 Ga0587093_072295 3300059478 Unclassified 582
923 Ga0587094_064973 3300059513 Bacteria 646
924 Ga0587101_058345 3300059623 Unclassified 683
925 Ga0587109_104968 3300059624 Unclassified 654
926 Ga0587076_054299 3300059645 Bacteria 790
927 Ga0587079_121515 3300059647 Unclassified 646
928 Ga0587079_209823 3300059647 Bacteria 536
929 Ga0587111_0122818 3300060346 Unclassified 671
930 Ga0530510_0020314 3300061734 Bacteria 4722
931 Ga0070690_100791937
932 CNAas_1000591
933 JGI24749J21850_1058742
934 Ga0058859_11531803
935 Ga0058861_11829353
936 Ga0058862_11139853
937 Ga0058862_12343778
938 Ga0065714_10167095
939 Ga0065714_10428383
940 Ga0065704_10027349
941 Ga0065704_10076100
942 Ga0065712_10008278
943 Ga0065712_10024545
944 Ga0065712_10414465
945 Ga0065715_10002353
946 Ga0065715_10010790
947 Ga0065715_10020967
948 Ga0065715_10058884
949 Ga0065715_10099595
950 Ga0065715_10254463
951 Ga0065707_10001074
952 Ga0065707_10094200
953 Ga0065707_10173371
954 Ga0065707_10254350
955 Ga0065707_10556571
956 Ga0070676_10051594
957 Ga0070676_10576108
958 Ga0070690_100002046
959 Ga0070690_100158830
960 Ga0070690_100862401
961 Ga0070690_100963302
962 Ga0070670_100043106
963 Ga0070670_100076223
964 Ga0070670_100195668
965 Ga0070670_100466323
966 Ga0070670_100610942
967 Ga0070670_100713134
968 Ga0070670_100869578
969 Ga0068869_100028521
970 Ga0068869_100076607
971 Ga0068869_100169945
972 Ga0068869_100236812
973 Ga0068869_100276725
974 Ga0068869_100606590
975 Ga0068869_101372383
976 Ga0068869_101487996
977 Ga0070666_10083565
978 Ga0070680_100002291
979 Ga0070680_100013792
980 Ga0070680_100198643
981 Ga0070682_100003075
982 Ga0070682_100012020
983 Ga0068868_100013823
984 Ga0068868_100098872
985 Ga0070660_100084633
986 Ga0070689_100001670
987 Ga0070689_100098137
988 Ga0070689_100262499
989 Ga0070689_100349524
990 Ga0070691_10051733
991 Ga0070687_100848084
992 Ga0070687_100849522
993 Ga0070661_100071885
994 Ga0070661_100720862
995 Ga0070692_10023495
996 Ga0070692_10260291
997 Ga0070692_10305400
998 Ga0070692_10340225
999 Ga0070692_10391134
1000 Ga0070692_10822461
1001 Ga0070668_100280205
1002 Ga0070669_100015712
1003 Ga0070669_100029288
1004 Ga0070669_101153406
1005 Ga0070675_100067028
1006 Ga0070675_101531907
1007 Ga0070671_100009911
1008 Ga0070671_100040309
1009 Ga0070671_100346586
1010 Ga0070671_100417834
1011 Ga0070674_100102038
1012 Ga0070674_100310568
1013 Ga0070674_100510275
1014 Ga0070673_100024266
1015 Ga0070673_100058908
1016 Ga0070673_100212487
1017 Ga0070673_100484643
1018 Ga0070673_100693256
1019 Ga0070673_102117349
1020 Ga0070688_100018619
1021 Ga0070688_100115624
1022 Ga0070659_100075203
1023 Ga0070659_100147729
1024 Ga0070659_100792310
1025 Ga0070659_101657799
1026 Ga0070667_100060874
1027 Ga0070667_100365529
1028 Ga0070703_10009050
1029 Ga0070701_10107210
1030 Ga0070701_10729707
1031 Ga0070711_101425002
1032 Ga0070705_100003684
1033 Ga0070705_100084892
1034 Ga0070705_100240855
1035 Ga0070705_100425818
1036 Ga0070700_100000079
1037 Ga0070700_100003949
1038 Ga0070700_100003968
1039 Ga0070700_100045611
1040 Ga0070700_100089925
1041 Ga0070700_100156879
1042 Ga0070700_100237492
1043 Ga0070694_100015314
1044 Ga0070694_100090005
1045 Ga0070694_100102317
1046 Ga0070694_100201223
1047 Ga0070694_100229501
1048 Ga0070694_100258329
1049 Ga0070694_100341781
1050 Ga0070694_100371063
1051 Ga0070694_100483483
1052 Ga0070694_101041971
1053 Ga0070694_101062103
1054 Ga0070694_101595822
1055 Ga0070708_100082706
1056 Ga0070708_100236922
1057 Ga0070663_100294992
1058 Ga0070678_100271395
1059 Ga0070678_100529499
1060 Ga0070662_100049632
1061 Ga0070662_100064896
1062 Ga0070681_10000108
1063 Ga0070681_10005435
1064 Ga0070681_10012071
1065 Ga0070681_10505520
1066 Ga0068867_100055259
1067 Ga0068867_100064832
1068 Ga0068867_100631323
1069 Ga0068867_100873851
1070 Ga0068867_100941703
1071 Ga0068867_101417959
1072 Ga0068867_102107937
1073 Ga0070685_10001769
1074 Ga0070706_100000216
1075 Ga0070706_100064121
1076 Ga0070707_100099007
1077 Ga0070707_100116787
1078 Ga0070707_100423384
1079 Ga0070698_100004504
1080 Ga0070698_100032020
1081 Ga0070698_100040616
1082 Ga0070699_100010387
1083 Ga0070699_100039638
1084 Ga0070699_100411974
1085 Ga0070679_100000130
1086 Ga0070679_100028227
1087 Ga0070679_100146061
1088 Ga0070684_100045868
1089 Ga0070684_100199779
1090 Ga0070684_101363732
1091 Ga0070697_100129740
1092 Ga0068853_100117874
1093 Ga0068853_100154606
1094 Ga0068853_100234475
1095 Ga0068853_100324911
1096 Ga0068853_100722396
1097 Ga0068853_102300210
1098 Ga0070672_100394245
1099 Ga0070672_100980093
1100 Ga0070686_100001598
1101 Ga0070695_100045331
1102 Ga0070695_100054098
1103 Ga0070695_100160516
1104 Ga0070695_100246359
1105 Ga0070695_100282847
1106 Ga0070695_100356754
1107 Ga0070695_100578949
1108 Ga0070695_100747660
1109 Ga0070695_101221874
1110 Ga0070695_101246325
1111 Ga0070696_100046086
1112 Ga0070696_100224889
1113 Ga0070696_100446497
1114 Ga0070696_100569588
1115 Ga0070696_100693277
1116 Ga0070696_101100530
1117 Ga0070696_101259167
1118 Ga0070696_101387522
1119 Ga0070693_100008761
1120 Ga0070693_100034933
1121 Ga0070693_100087810
1122 Ga0070693_100251052
1123 Ga0070693_100453918
1124 Ga0070693_101256876
1125 Ga0070665_100054607
1126 Ga0070665_101532719
1127 Ga0070704_100114233
1128 Ga0070704_100127580
1129 Ga0070704_100866134
1130 Ga0070704_101044087
1131 Ga0070704_101126517
1132 Ga0070704_101203074
1133 Ga0070704_101361630
1134 Ga0070704_101480064
1135 Ga0070704_101605693
1136 Ga0068855_100612640
1137 Ga0068855_100704015
1138 Ga0068855_100918596
1139 Ga0068855_101502028
1140 Ga0070664_100003909
1141 Ga0070664_100420641
1142 Ga0070664_100471314
1143 Ga0070664_100728768
1144 Ga0070664_101118410
1145 Ga0068857_100009445
1146 Ga0068857_100465223
1147 Ga0068857_100469549
1148 Ga0068857_100530165
1149 Ga0068857_101193224
1150 Ga0068857_101212588
1151 Ga0068857_101751965
1152 Ga0068857_101769563
1153 Ga0068854_100286467
1154 Ga0068854_100371867
1155 Ga0068854_100439974
1156 Ga0068854_100560388
1157 Ga0068854_100752265
1158 Ga0068854_100836593
1159 Ga0068856_100022206
1160 Ga0070702_100032596
1161 Ga0070702_100058802
1162 Ga0070702_100101243
1163 Ga0070702_100108900
1164 Ga0070702_100153529
1165 Ga0070702_100188762
1166 Ga0070702_100350383
1167 Ga0070702_100576530
1168 Ga0070702_100972194
1169 Ga0068852_100090297
1170 Ga0068852_100212027
1171 Ga0068852_100685271
1172 Ga0068852_100908025
1173 Ga0068859_100020874
1174 Ga0068859_100057491
1175 Ga0068859_100091379
1176 Ga0068859_100126945
1177 Ga0068859_100134368
1178 Ga0068859_100147338
1179 Ga0068859_100171679
1180 Ga0068859_100200045
1181 Ga0068859_100343244
1182 Ga0068859_100360280
1183 Ga0068859_100736194
1184 Ga0068859_100922202
1185 Ga0068859_100958632
1186 Ga0068859_101192326
1187 Ga0068859_101356034
1188 Ga0068859_101410739
1189 Ga0068864_100008882
1190 Ga0068864_100047755
1191 Ga0068864_100055434
1192 Ga0068864_100087598
1193 Ga0068864_100150240
1194 Ga0068864_100217006
1195 Ga0068864_100359082
1196 Ga0068864_100373167
1197 Ga0068864_101000340
1198 Ga0068864_101086550
1199 Ga0068864_101194964
1200 Ga0068864_101314552
1201 Ga0068864_102323866
1202 Ga0068866_10008767
1203 Ga0068866_10026310
1204 Ga0068861_100006559
1205 Ga0068861_100080485
1206 Ga0068861_100338740
1207 Ga0068861_100791379
1208 Ga0068861_100854766
1209 Ga0068851_10005871
1210 Ga0068870_10029915
1211 Ga0068870_10041823
1212 Ga0068863_100024487
1213 Ga0068863_100031235
1214 Ga0068863_100037146
1215 Ga0068863_100250463
1216 Ga0068863_100308608
1217 Ga0068863_100588680
1218 Ga0068863_100687235
1219 Ga0068863_100800789
1220 Ga0068863_100911330
1221 Ga0068858_100027035
1222 Ga0068858_100148403
1223 Ga0068858_100148487
1224 Ga0068858_100186070
1225 Ga0068858_100229051
1226 Ga0068858_100460193
1227 Ga0068858_100539913
1228 Ga0068858_100833286
1229 Ga0068858_101762575
1230 Ga0068860_100010673
1231 Ga0068860_100022053
1232 Ga0068860_100076261
1233 Ga0068860_100148209
1234 Ga0068860_100195569
1235 Ga0068860_100251399
1236 Ga0068860_100492889
1237 Ga0068860_100720380
1238 Ga0068862_100035903
1239 Ga0068862_100087511
1240 Ga0068862_101181197
1241 Ga0081455_10384106
1242 Ga0081539_10001600
1243 Ga0081539_10002160
1244 Ga0081539_10046832
1245 Ga0075432_10145828
1246 Ga0097621_100021446
1247 Ga0097621_100037541
1248 Ga0097621_100207620
1249 Ga0097621_100306674
1250 Ga0068871_100012372
1251 Ga0068871_100044378
1252 Ga0068871_100152311
1253 Ga0068871_100167738
1254 Ga0068871_100409064
1255 Ga0068871_101057807
1256 Ga0075428_100250737
1257 Ga0075428_100348532
1258 Ga0075428_100412126
1259 Ga0075428_100453981
1260 Ga0075428_101676143
1261 Ga0075430_100035860
1262 Ga0075430_100046091
1263 Ga0075430_100807819
1264 Ga0075431_100010768
1265 Ga0075431_100145002
1266 Ga0075431_101042177
1267 Ga0075433_10002990
1268 Ga0075433_10010053
1269 Ga0075433_10087429
1270 Ga0075433_10108152
1271 Ga0075433_10451686
1272 Ga0075433_10681373
1273 Ga0075434_100054360
1274 Ga0075434_100264992
1275 Ga0075434_100431151
1276 Ga0075434_100467973
1277 Ga0075429_100016544
1278 Ga0075429_100066116
1279 Ga0075429_100627088
1280 Ga0075429_100688359
1281 Ga0068865_100003965
1282 Ga0075436_100047717
1283 Ga0097620_100020874
1284 Ga0097620_100057486
1285 Ga0097620_100091382
1286 Ga0097620_100126944
1287 Ga0097620_100129603
1288 Ga0097620_100134362
1289 Ga0097620_100147329
1290 Ga0097620_100171678
1291 Ga0097620_100200038
1292 Ga0097620_100343224
1293 Ga0097620_100360302
1294 Ga0097620_100736157
1295 Ga0097620_100922189
1296 Ga0097620_100958624
1297 Ga0097620_101192269
1298 Ga0097620_101355900
1299 Ga0097620_101410867
1300 Ga0105251_10078083
1301 Ga0105251_10392823
1302 Ga0105240_10118643
1303 Ga0105240_10776644
1304 Ga0111539_10001071
1305 Ga0111539_10011514
1306 Ga0111539_10113969
1307 Ga0111539_10120496
1308 Ga0111539_10707327
1309 Ga0105245_10569097
1310 Ga0105245_10953559
1311 Ga0105245_11065950
1312 Ga0105245_11412091
1313 Ga0105245_11771919
1314 Ga0105247_10054744
1315 Ga0105247_10055000
1316 Ga0105247_10104496
1317 Ga0105247_10236162
1318 Ga0105247_10425456
1319 Ga0105247_10556756
1320 Ga0105247_10965701
1321 Ga0114129_10008912
1322 Ga0114129_10034273
1323 Ga0114129_10324516
1324 Ga0114129_10380428
1325 Ga0114129_10937281
1326 Ga0114129_12793131
1327 Ga0105243_10013526
1328 Ga0105243_10014083
1329 Ga0105243_10454264
1330 Ga0105243_10469353
1331 Ga0105243_10744099
1332 Ga0105243_10850058
1333 Ga0105241_10046420
1334 Ga0105241_10069462
1335 Ga0105241_10101326
1336 Ga0105241_10135649
1337 Ga0105241_10197935
1338 Ga0105241_10199556
1339 Ga0105241_10394660
1340 Ga0105241_10465823
1341 Ga0105241_10649944
1342 Ga0105242_10002366
1343 Ga0105242_10087822
1344 Ga0105242_10529950
1345 Ga0105242_11224938
1346 Ga0105242_11359529
1347 Ga0105248_10002567
1348 Ga0105248_10015622
1349 Ga0105248_10061588
1350 Ga0105248_10098012
1351 Ga0105248_10107055
1352 Ga0105248_10113253
1353 Ga0105248_10141034
1354 Ga0105248_10178706
1355 Ga0105248_10688537
1356 Ga0105248_11937656
1357 Ga0105237_10004453
1358 Ga0105237_10034694
1359 Ga0105237_10240332
1360 Ga0105237_10796217
1361 Ga0105238_10012469
1362 Ga0105238_10235171
1363 Ga0105238_11281171
1364 Ga0105249_10029885
1365 Ga0105249_10048239
1366 Ga0105249_10245793
1367 Ga0105249_10822565
1368 Ga0105249_11606091
1369 Ga0105249_12577882
1370 Ga0105239_10042885
1371 Ga0105239_10078860
1372 Ga0105239_10388652
1373 Ga0105239_10770143
1374 Ga0105239_10808758
1375 Ga0105239_11355618
1376 Ga0105246_10104096
1377 Ga0105246_10131643
1378 Ga0105246_10240117
1379 Ga0105246_10424439
1380 Ga0105246_10576839
1381 Ga0105246_10746799
1382 Ga0157337_1036895
1383 Ga0157373_10023676
1384 Ga0157373_10212604
1385 Ga0157373_10240496
1386 Ga0157373_10288553
1387 Ga0157373_10750650
1388 Ga0157373_10952230
1389 Ga0157373_11264965
1390 Ga0157371_10687917
1391 Ga0157371_10967081
1392 Ga0157374_10037850
1393 Ga0157374_10679619
1394 Ga0157374_11065602
1395 Ga0157374_11211944
1396 Ga0157378_10003275
1397 Ga0157378_10008574
1398 Ga0157378_10102828
1399 Ga0157378_11436347
1400 Ga0157378_12056147
1401 Ga0157378_12941595
1402 Ga0163162_10002858
1403 Ga0163162_10037108
1404 Ga0163162_10066693
1405 Ga0163162_10136189
1406 Ga0163162_10383566
1407 Ga0163162_10720997
1408 Ga0163162_10777319
1409 Ga0163162_10981471
1410 Ga0163162_11079799
1411 Ga0157372_10022901
1412 Ga0157372_10570533
1413 Ga0157372_10729210
1414 Ga0157372_10756693
1415 Ga0157372_10840509
1416 Ga0157372_10990275
1417 Ga0157372_11705090
1418 Ga0157375_10263309
1419 Ga0157375_10282152
1420 Ga0157375_10305161
1421 Ga0157375_10456522
1422 Ga0157375_10822387
1423 Ga0157375_10935749
1424 Ga0157375_12739059
1425 Ga0163163_10026807
1426 Ga0163163_10031976
1427 Ga0163163_10032836
1428 Ga0163163_10039747
1429 Ga0163163_10060967
1430 Ga0163163_10062410
1431 Ga0163163_10111416
1432 Ga0163163_10450514
1433 Ga0163163_10540986
1434 Ga0163163_10767386
1435 Ga0163163_11417625
1436 Ga0163163_11542947
1437 Ga0163163_11850651
1438 Ga0157380_10021329
1439 Ga0157380_10173089
1440 Ga0157380_10488610
1441 Ga0157380_10744844
1442 Ga0182008_10125581
1443 Ga0157377_10001638
1444 Ga0157377_10038767
1445 Ga0157377_10055400
1446 Ga0157377_10397565
1447 Ga0157377_10526529
1448 Ga0157379_10093487
1449 Ga0157379_10101239
1450 Ga0157379_10249942
1451 Ga0157376_10004566
1452 Ga0157376_10234641
1453 Ga0157376_10384362
1454 Ga0163161_10027067
1455 Ga0207697_10005421
1456 Ga0207656_10006622
1457 Ga0207656_10525318
1458 Ga0207713_1207308
1459 Ga0207653_10002330
1460 Ga0207653_10157924
1461 Ga0207642_10010113
1462 Ga0207710_10004903
1463 Ga0207688_10150825
1464 Ga0207688_10233773
1465 Ga0207680_10061292
1466 Ga0207680_10330373
1467 Ga0207647_10005002
1468 Ga0207647_10067400
1469 Ga0207647_10400529
1470 Ga0207645_10055837
1471 Ga0207645_10291166
1472 Ga0207643_10002327
1473 Ga0207643_10023342
1474 Ga0207643_10043077
1475 Ga0207643_10160996
1476 Ga0207684_10000117
1477 Ga0207654_10021458
1478 Ga0207654_10037730
1479 Ga0207654_10118253
1480 Ga0207654_10134671
1481 Ga0207654_10209123
1482 Ga0207654_10229245
1483 Ga0207654_10419630
1484 Ga0207654_10563349
1485 Ga0207707_10000013
1486 Ga0207707_10009149
1487 Ga0207707_10024810
1488 Ga0207707_10103842
1489 Ga0207707_10874085
1490 Ga0207695_10095466
1491 Ga0207695_10265406
1492 Ga0207695_11384810
1493 Ga0207671_10002628
1494 Ga0207671_10336384
1495 Ga0207671_10611243
1496 Ga0207671_10698488
1497 Ga0207660_10002487
1498 Ga0207660_10007233
1499 Ga0207660_10131890
1500 Ga0207662_10014250
1501 Ga0207662_10058848
1502 Ga0207662_10358866
1503 Ga0207657_10139145
1504 Ga0207649_10145010
1505 Ga0207652_10000071
1506 Ga0207652_10129046
1507 Ga0207646_10083854
1508 Ga0207681_10025909
1509 Ga0207681_10034333
1510 Ga0207681_10515313
1511 Ga0207681_11247776
1512 Ga0207694_10111284
1513 Ga0207694_10117583
1514 Ga0207650_10000028
1515 Ga0207650_10062216
1516 Ga0207650_10112106
1517 Ga0207650_10508348
1518 Ga0207659_10806777
1519 Ga0207687_10232978
1520 Ga0207687_10499540
1521 Ga0207687_11033502
1522 Ga0207644_10004129
1523 Ga0207644_10011552
1524 Ga0207644_10160336
1525 Ga0207644_10282293
1526 Ga0207644_11590537
1527 Ga0207644_11717140
1528 Ga0207690_10051530
1529 Ga0207690_10101894
1530 Ga0207690_10805088
1531 Ga0207706_10046434
1532 Ga0207706_10296928
1533 Ga0207686_10053671
1534 Ga0207686_10149530
1535 Ga0207686_10227531
1536 Ga0207686_10901972
1537 Ga0207709_10003038
1538 Ga0207709_10031060
1539 Ga0207709_10710108
1540 Ga0207709_11716191
1541 Ga0207670_10000292
1542 Ga0207670_10508405
1543 Ga0207670_10666156
1544 Ga0207670_11003005
1545 Ga0207669_10258965
1546 Ga0207669_10445908
1547 Ga0207704_10051664
1548 Ga0207704_10064892
1549 Ga0207665_10104173
1550 Ga0207665_10510402
1551 Ga0207691_10002251
1552 Ga0207691_10618051
1553 Ga0207711_10000824
1554 Ga0207711_10025383
1555 Ga0207711_10034166
1556 Ga0207711_10052318
1557 Ga0207711_10428837
1558 Ga0207711_10779861
1559 Ga0207689_10005061
1560 Ga0207689_10030136
1561 Ga0207689_10049647
1562 Ga0207689_10058312
1563 Ga0207689_10063847
1564 Ga0207689_10180263
1565 Ga0207689_10265549
1566 Ga0207689_10300743
1567 Ga0207689_10346363
1568 Ga0207689_10443651
1569 Ga0207689_10736518
1570 Ga0207689_10878250
1571 Ga0207689_11014759
1572 Ga0207689_11226765
1573 Ga0207679_10011379
1574 Ga0207679_10769798
1575 Ga0207679_10955192
1576 Ga0207679_11048470
1577 Ga0207679_11168726
1578 Ga0207651_10071322
1579 Ga0207651_10074444
1580 Ga0207651_10124310
1581 Ga0207651_10127762
1582 Ga0207651_10152235
1583 Ga0207651_10409642
1584 Ga0207651_10822401
1585 Ga0207651_10882862
1586 Ga0207651_11469852
1587 Ga0207712_10006611
1588 Ga0207712_10042663
1589 Ga0207712_10106423
1590 Ga0207712_10406132
1591 Ga0207712_10687208
1592 Ga0207712_10948032
1593 Ga0207640_10490603
1594 Ga0207640_10548229
1595 Ga0207640_10581714
1596 Ga0207640_10756910
1597 Ga0207640_10770702
1598 Ga0207658_10093291
1599 Ga0207658_10170548
1600 Ga0207677_10049798
1601 Ga0207703_10414592
1602 Ga0207703_10638387
1603 Ga0207703_10813785
1604 Ga0207703_10840829
1605 Ga0207703_11553226
1606 Ga0207639_10030450
1607 Ga0207639_10149804
1608 Ga0207639_10452091
1609 Ga0207639_10499512
1610 Ga0207639_11384818
1611 Ga0207678_11006373
1612 Ga0207678_11211691
1613 Ga0207678_11262645
1614 Ga0207708_10000057
1615 Ga0207708_10009147
1616 Ga0207708_10014904
1617 Ga0207708_10060602
1618 Ga0207708_10080691
1619 Ga0207708_10273641
1620 Ga0207708_10499076
1621 Ga0207702_10278863
1622 Ga0207641_10010732
1623 Ga0207641_10079994
1624 Ga0207641_10254392
1625 Ga0207641_10340779
1626 Ga0207641_10390440
1627 Ga0207641_10610382
1628 Ga0207641_10639340
1629 Ga0207648_10067571
1630 Ga0207648_10179491
1631 Ga0207648_10319111
1632 Ga0207648_10553003
1633 Ga0207676_10009460
1634 Ga0207676_10010192
1635 Ga0207676_10012616
1636 Ga0207676_10019944
1637 Ga0207676_10029285
1638 Ga0207676_10047811
1639 Ga0207676_10074058
1640 Ga0207676_10119596
1641 Ga0207676_10350324
1642 Ga0207676_10414970
1643 Ga0207676_10446665
1644 Ga0207676_10755640
1645 Ga0207676_11855822
1646 Ga0207674_10000136
1647 Ga0207674_10192447
1648 Ga0207674_10204427
1649 Ga0207674_10519333
1650 Ga0207674_10533275
1651 Ga0207674_10635030
1652 Ga0207674_10635306
1653 Ga0207674_10842237
1654 Ga0207674_11916249
1655 Ga0207675_100005168
1656 Ga0207675_100082073
1657 Ga0207675_100090867
1658 Ga0207675_100200928
1659 Ga0207675_100260247
1660 Ga0207675_100794003
1661 Ga0207675_101238262
1662 Ga0207683_10067772
1663 Ga0207683_10571534
1664 Ga0207698_10268460
1665 Ga0207698_10647186
1666 Ga0207428_10003466
1667 Ga0207428_10041118
1668 Ga0268266_10573779
1669 Ga0268265_10053692
1670 Ga0268265_10063965
1671 Ga0268265_10195888
1672 Ga0268264_10130960
1673 Ga0268264_10135437
1674 Ga0268264_10185147
1675 Ga0268264_10240583
1676 Ga0268264_10441580
1677 Ga0268264_10578772
1678 Ga0268264_10843845
1679 Ga0268264_11419676
1680 Ga0316178_1156277
1681 Ga0307408_100059929
1682 Ga0307405_10024023
1683 Ga0307413_10016595
1684 Ga0307410_10571806
1685 Ga0307406_10689919
1686 Ga0307407_10217313
1687 Ga0307407_10264873
1688 Ga0307412_10013676
1689 Ga0307412_10168417
1690 Ga0307416_100349013
1691 Ga0307416_100361004
1692 Ga0307414_10211754
1693 Ga0307414_10270862
1694 Ga0307411_10131874
1695 Ga0307411_11534652
1696 Ga0307415_100002573
1697 Ga0307415_100009289
1698 Ga0307415_100182659
1699 Ga0373940_0170514
1700 Ga0373949_0008548
1701 Ga0373951_0002285
1702 Ga0373941_0003583
1703 Ga0373960_0080544
1704 Ga0373961_0048755
1705 Ga0373931_0520169
1706 Ga0395900_0241646
1707 Ga0395898_0143802
1708 Ga0395898_0981717
1709 Ga0395901_0033090
1710 Ga0395901_0038383
1711 Ga0395901_0669665
1712 Ga0242422_01576
1713 Ga0242420_002990
1714 Ga0439448_0016348
1715 Ga0439455_0001218
1716 Ga0450914_002751
1717 Ga0453683_0073803
1718 Ga0495603_0662116
1719 Ga0495580_0530452
1720 Ga0495669_0277152
1721 Ga0496102_0009169
1722 Ga0496104_0083425
1723 Ga0496104_0123357
1724 Ga0496104_1135810
1725 Ga0496106_0046779
1726 Ga0496106_0879656
1727 Ga0496107_0846406
1728 Ga0496108_0125553
1729 Ga0496108_0259790
1730 Ga0496108_0646650
1731 Ga0496108_1235101
1732 Ga0496109_0220682
1733 Ga0496110_0163204
1734 Ga0496112_0076731
1735 Ga0496112_0193348
1736 Ga0496112_0194408
1737 Ga0496112_0287990
1738 Ga0496112_0288137
1739 Ga0496112_0574709
1740 Ga0496112_1054812
1741 Ga0496112_1435723
1742 Ga0496112_1474673
1743 Ga0496113_0042184
1744 Ga0496113_0272182
1745 Ga0501309_047275
1746 Ga0501310_022871
1747 Ga0501307_030754
1748 Ga0501307_033579
1749 Ga0501292_010399
1750 Ga0501292_115564
1751 Ga0501296_000123
1752 Ga0501298_019415
1753 Ga0501298_027063
1754 Ga0501299_001997
1755 Ga0501299_011767
1756 Ga0501303_043854
1757 Ga0501303_060622
1758 Ga0501311_048495
1759 Ga0501312_019496
1760 Ga0501320_049576
1761 Ga0501321_029725
1762 Ga0501038_0062503
1763 Ga0501075_0233085
1764 Ga0501198_020287
1765 Ga0501198_146859
1766 Ga0501201_031284
1767 Ga0501202_017047
1768 Ga0501202_024008
1769 Ga0501206_033743
1770 Ga0501214_040909
1771 Ga0501217_006653
1772 Ga0501217_008118
1773 Ga0501217_015473
1774 Ga0501224_036995
1775 Ga0501224_038440
1776 Ga0501227_001565
1777 Ga0501227_019061
1778 Ga0501227_057917
1779 Ga0501228_015161
1780 Ga0501230_004047
1781 Ga0501230_026251
1782 Ga0501233_013432
1783 Ga0501235_005770
1784 Ga0501235_017184
1785 Ga0501236_076183
1786 Ga0501239_033709
1787 Ga0501240_009978
1788 Ga0501243_009570
1789 Ga0501243_010871
1790 Ga0501243_027090
1791 Ga0501246_009351
1792 Ga0501249_020570
1793 Ga0501249_033352
1794 Ga0501249_093986
1795 Ga0501251_077052
1796 Ga0501255_089009
1797 Ga0501256_035000
1798 Ga0501257_019261
1799 Ga0501257_023471
1800 Ga0501257_083976
1801 Ga0501257_167313
1802 Ga0501260_011237
1803 Ga0501260_053455
1804 Ga0501261_040691
1805 Ga0501221_014151
1806 Ga0501221_121085
1807 Ga0501225_0004609
1808 Ga0501225_0058641
1809 Ga0501234_003589
1810 Ga0501234_043895
1811 Ga0501232_035122
1812 Ga0501263_030752
1813 Ga0501266_027351
1814 Ga0501273_010687
1815 Ga0501283_086242
1816 Ga0501212_003386
1817 Ga0501212_014999
1818 Ga0501212_050346
1819 Ga0501226_006710
1820 nmdc:mga05p37_1035288_c1
1821 nmdc:mga05p37_121849_c1
1822 nmdc:mga05p37_165524_c1
1823 nmdc:mga05p37_1844906_c1
1824 nmdc:mga05p37_248379_c1
1825 nmdc:mga05p37_50495_c1
1826 nmdc:mga09592_571682_c1
1827 nmdc:mga09592_66187_c1
1828 nmdc:mga0qj67_141128_c1
1829 nmdc:mga06r32_1786650_c1
1830 nmdc:mga06r32_211577_c1
1831 nmdc:mga06r32_557119_c1
1832 nmdc:mga08y16_1116617_c1
1833 nmdc:mga08y16_14429_c1
1834 nmdc:mga08y16_160004_c1
1835 nmdc:mga08y16_18628_c1
1836 nmdc:mga0n895_179432_c1
1837 nmdc:mga0n895_237954_c1
1838 nmdc:mga0n895_322216_c1
1839 nmdc:mga0rr50_63618_c1
1840 nmdc:mga0rr50_80486_c1
1841 nmdc:mga08x19_40165_c1
1842 nmdc:mga0a205_1090364_c1
1843 nmdc:mga0a205_129465_c1
1844 nmdc:mga0a205_29101_c1
1845 nmdc:mga0a205_358970_c1
1846 nmdc:mga0a205_381615_c1
1847 nmdc:mga0a205_386310_c1
1848 nmdc:mga0a205_47677_c1
1849 nmdc:mga0a205_56485_c1
1850 Ga0501084_0438143
1851 Ga0587084_140376
1852 Ga0587093_072295
1853 Ga0587094_064973
1854 Ga0587101_058345
1855 Ga0587109_104968
1856 Ga0587076_054299
1857 Ga0587079_121515
1858 Ga0587079_209823
1859 Ga0587111_0122818
1860 Ga0530510_0020314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15956

DUF4760

Domain of unknown function (DUF4760)

21

135

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tjs-assembly1.cif.gz_AAA-2 gstf1 from alopecurus myosuroides 0.5131 2 127
8agq-assembly1.cif.gz_A crystal structure of anthocyanin-related gstf8 from populus trichocarpa in complex with (-)-catechin and glutathione 0.4433 1 127
6tjs-assembly1.cif.gz_AAA-2 gstf1 from alopecurus myosuroides 0.4036 2 127
8agq-assembly1.cif.gz_A crystal structure of anthocyanin-related gstf8 from populus trichocarpa in complex with (-)-catechin and glutathione 0.389 1 127
7nzz-assembly2.cif.gz_B ras1 guanine nucleotide exchange factor cdc25 (rem and catalytic domains) 0.3845 30 116
ID Description Score Start End Superfamily
af_Q54VB5_799_1028_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4505 38 141 1.25.10.10
af_Q499T5_2_77_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.4282 80 143 1.20.58.80
af_A4I8P2_312_450_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.4011 18 140 1.20.1050.10
af_A4I8P2_312_450_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.3642 18 140 1.20.1050.10
af_Q499T5_2_77_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.3631 80 143 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A2G9NG49-F1-model_v4 Uncharacterized protein 0.9821 1 130
AF-A0A7W0RTJ8-F1-model_v4 Uncharacterized protein 0.9796 2 113
AF-A0A1Q7YFN6-F1-model_v4 Uncharacterized protein 0.9778 1 148
AF-A0A2V7LG91-F1-model_v4 Uncharacterized protein 0.9731 1 127
AF-A0A2V7SRE0-F1-model_v4 Uncharacterized protein 0.9729 1 126

Map