F485947
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 927 | 424 | 868 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10123717|Ga0157378_101237172 |
| Length | 160 |
| Sequence | MGAGIAETDLDDDSDFAESHEINVTPFIDVILVLLIIFMVAAPLSTVDLPIDLPTSTAIPQKKPDKPTYVSIKPDLAVAIGENPVKRVDLVSSLDAMADSNKDRFIFLRADRAVPYGELMSVLEILRAGGYSKIKLVALEGVPDATASPAAPANPERGQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 10 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 11 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 12 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 13 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 14 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 15 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 16 | 2791355199 | |||
| 17 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 18 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 19 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 20 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 21 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 22 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 23 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 24 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 25 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 26 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 27 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 28 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 29 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 30 | 2906610324 | |||
| 31 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 32 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 33 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 34 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 35 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 36 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 37 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 38 | 2922425934 | |||
| 39 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 40 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 41 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 42 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 43 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 44 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 45 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 46 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 47 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 48 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 49 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 50 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 51 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 216 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 222 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 252 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 256 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 257 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 381 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 385 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 388 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 389 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 390 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 391 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 393 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 395 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 396 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 397 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 398 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 400 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 402 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 403 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 404 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 406 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 413 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 414 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 415 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 416 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 417 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 418 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 419 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 420 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 421 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 422 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 423 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 424 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.72 |
| Metatranscriptomes | 0.22 |
| Isolates | 6.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.15 |
| Nodule | 4.21 |
| Rhizoplane | 6.15 |
| Rhizosphere | 77.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1007436 | 3300000549 | Bacteria | 1347 |
| 2 | JGI24740J21852_10159770 | 3300001979 | Bacteria | 559 |
| 3 | JGI25406J46586_10000288 | 3300003203 | Bacteria | 22623 |
| 4 | JGI25404J52841_10000065 | 3300003659 | Bacteria | 9238 |
| 5 | JGI25404J52841_10003688 | 3300003659 | Bacteria | 3046 |
| 6 | Ga0070658_10024846 | 3300005327 | Bacteria | 4805 |
| 7 | Ga0070658_10171288 | 3300005327 | Bacteria | 1824 |
| 8 | Ga0070676_10612375 | 3300005328 | Bacteria | 787 |
| 9 | Ga0070683_101072321 | 3300005329 | Bacteria | 774 |
| 10 | Ga0070690_100123939 | 3300005330 | Bacteria | 1737 |
| 11 | Ga0070670_100048669 | 3300005331 | Bacteria | 3647 |
| 12 | Ga0070670_100762239 | 3300005331 | Bacteria | 872 |
| 13 | Ga0068869_100094348 | 3300005334 | Bacteria | 2256 |
| 14 | Ga0068869_100962100 | 3300005334 | Bacteria | 742 |
| 15 | Ga0070666_10370711 | 3300005335 | Bacteria | 1027 |
| 16 | Ga0070680_100024742 | 3300005336 | Bacteria | 4799 |
| 17 | Ga0070680_100310978 | 3300005336 | Bacteria | 1337 |
| 18 | Ga0070680_100335246 | 3300005336 | Bacteria | 1285 |
| 19 | Ga0070682_100307357 | 3300005337 | Bacteria | 1166 |
| 20 | Ga0070682_100532842 | 3300005337 | Bacteria | 916 |
| 21 | Ga0068868_100173474 | 3300005338 | Bacteria | 1786 |
| 22 | Ga0068868_100307046 | 3300005338 | Bacteria | 1349 |
| 23 | Ga0068868_101034850 | 3300005338 | Bacteria | 753 |
| 24 | Ga0070660_101226708 | 3300005339 | Bacteria | 636 |
| 25 | Ga0070689_100120995 | 3300005340 | Bacteria | 2091 |
| 26 | Ga0070689_100531686 | 3300005340 | Bacteria | 1011 |
| 27 | Ga0070687_100236636 | 3300005343 | Bacteria | 1127 |
| 28 | Ga0070692_10141081 | 3300005345 | Bacteria | 1364 |
| 29 | Ga0070668_100720672 | 3300005347 | Bacteria | 881 |
| 30 | Ga0070675_100621497 | 3300005354 | Bacteria | 981 |
| 31 | Ga0070671_100010357 | 3300005355 | Bacteria | 7480 |
| 32 | Ga0070671_100058408 | 3300005355 | Bacteria | 3212 |
| 33 | Ga0070674_100053701 | 3300005356 | Bacteria | 2783 |
| 34 | Ga0070674_100521125 | 3300005356 | Bacteria | 993 |
| 35 | Ga0070673_100596988 | 3300005364 | Bacteria | 1007 |
| 36 | Ga0070673_100722654 | 3300005364 | Bacteria | 916 |
| 37 | Ga0070673_101336152 | 3300005364 | Bacteria | 674 |
| 38 | Ga0070688_100005941 | 3300005365 | Bacteria | 6468 |
| 39 | Ga0070688_100779813 | 3300005365 | Bacteria | 746 |
| 40 | Ga0070659_100059496 | 3300005366 | Bacteria | 3017 |
| 41 | Ga0070667_100574908 | 3300005367 | Bacteria | 1037 |
| 42 | Ga0070667_101844773 | 3300005367 | Bacteria | 569 |
| 43 | Ga0070709_10032762 | 3300005434 | Bacteria | 3136 |
| 44 | Ga0070709_11428067 | 3300005434 | Bacteria | 561 |
| 45 | Ga0070714_100004035 | 3300005435 | Bacteria | 11037 |
| 46 | Ga0070714_100575669 | 3300005435 | Bacteria | 1080 |
| 47 | Ga0070714_102023696 | 3300005435 | Bacteria | 562 |
| 48 | Ga0070713_100002369 | 3300005436 | Bacteria | 12291 |
| 49 | Ga0070713_100044765 | 3300005436 | Bacteria | 3623 |
| 50 | Ga0070713_100050453 | 3300005436 | Bacteria | 3437 |
| 51 | Ga0070713_101303800 | 3300005436 | Bacteria | 704 |
| 52 | Ga0070710_10000567 | 3300005437 | Bacteria | 17537 |
| 53 | Ga0070711_100003229 | 3300005439 | Bacteria | 9465 |
| 54 | Ga0070711_100117149 | 3300005439 | Bacteria | 1964 |
| 55 | Ga0070711_100797184 | 3300005439 | Bacteria | 801 |
| 56 | Ga0070711_101267762 | 3300005439 | Bacteria | 639 |
| 57 | Ga0070700_100213896 | 3300005441 | Bacteria | 1362 |
| 58 | Ga0070700_100549624 | 3300005441 | Bacteria | 897 |
| 59 | Ga0070694_101376505 | 3300005444 | Bacteria | 595 |
| 60 | Ga0070663_100034607 | 3300005455 | Bacteria | 3500 |
| 61 | Ga0070663_100770942 | 3300005455 | Bacteria | 823 |
| 62 | Ga0070663_101214682 | 3300005455 | Bacteria | 663 |
| 63 | Ga0070678_100098322 | 3300005456 | Bacteria | 2262 |
| 64 | Ga0070678_100281854 | 3300005456 | Bacteria | 1406 |
| 65 | Ga0070662_100274675 | 3300005457 | Bacteria | 1362 |
| 66 | Ga0070662_100744628 | 3300005457 | Bacteria | 831 |
| 67 | Ga0070681_10158175 | 3300005458 | Bacteria | 2190 |
| 68 | Ga0068867_101051230 | 3300005459 | Bacteria | 741 |
| 69 | Ga0070685_10098612 | 3300005466 | Bacteria | 1780 |
| 70 | Ga0070698_100708697 | 3300005471 | Bacteria | 949 |
| 71 | Ga0070679_100062502 | 3300005530 | Bacteria | 3712 |
| 72 | Ga0070684_100006295 | 3300005535 | Bacteria | 9170 |
| 73 | Ga0070684_100124186 | 3300005535 | Bacteria | 2324 |
| 74 | Ga0070684_100708302 | 3300005535 | Bacteria | 939 |
| 75 | Ga0070672_100142688 | 3300005543 | Bacteria | 1977 |
| 76 | Ga0070686_100069621 | 3300005544 | Bacteria | 2299 |
| 77 | Ga0070665_100136724 | 3300005548 | Bacteria | 2454 |
| 78 | Ga0070665_100346455 | 3300005548 | Bacteria | 1491 |
| 79 | Ga0070665_100401630 | 3300005548 | Bacteria | 1378 |
| 80 | Ga0068855_100043258 | 3300005563 | Bacteria | 5336 |
| 81 | Ga0068855_100838550 | 3300005563 | Bacteria | 975 |
| 82 | Ga0070664_101431136 | 3300005564 | Bacteria | 654 |
| 83 | Ga0068857_101018036 | 3300005577 | Bacteria | 798 |
| 84 | Ga0068854_100190036 | 3300005578 | Bacteria | 1608 |
| 85 | Ga0068856_100000020 | 3300005614 | Bacteria | 146775 |
| 86 | Ga0068856_100360813 | 3300005614 | Bacteria | 1472 |
| 87 | Ga0068856_100716684 | 3300005614 | Bacteria | 1021 |
| 88 | Ga0068856_100890985 | 3300005614 | Bacteria | 909 |
| 89 | Ga0068852_100960162 | 3300005616 | Bacteria | 873 |
| 90 | Ga0068852_101339245 | 3300005616 | Bacteria | 738 |
| 91 | Ga0068852_101942547 | 3300005616 | Bacteria | 611 |
| 92 | Ga0068864_100049091 | 3300005618 | Bacteria | 3630 |
| 93 | Ga0068851_10001206 | 3300005834 | Bacteria | 11224 |
| 94 | Ga0068863_100050091 | 3300005841 | Bacteria | 3961 |
| 95 | Ga0068858_100585417 | 3300005842 | Bacteria | 1082 |
| 96 | Ga0068858_100607961 | 3300005842 | Bacteria | 1061 |
| 97 | Ga0068860_100000435 | 3300005843 | Bacteria | 52946 |
| 98 | Ga0068860_100831490 | 3300005843 | Bacteria | 938 |
| 99 | Ga0068862_100908500 | 3300005844 | Bacteria | 866 |
| 100 | Ga0081455_10006778 | 3300005937 | Bacteria | 12220 |
| 101 | Ga0081455_10013247 | 3300005937 | Bacteria | 8167 |
| 102 | Ga0081455_10035346 | 3300005937 | Bacteria | 4468 |
| 103 | Ga0081540_1001395 | 3300005983 | Bacteria | 20932 |
| 104 | Ga0081540_1001807 | 3300005983 | Bacteria | 17952 |
| 105 | Ga0081540_1061317 | 3300005983 | Bacteria | 1793 |
| 106 | Ga0081540_1075269 | 3300005983 | Bacteria | 1543 |
| 107 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 108 | Ga0081539_10004350 | 3300005985 | Bacteria | 15796 |
| 109 | Ga0081539_10122286 | 3300005985 | Bacteria | 1291 |
| 110 | Ga0081539_10234681 | 3300005985 | Bacteria | 825 |
| 111 | Ga0070717_10002140 | 3300006028 | Bacteria | 13847 |
| 112 | Ga0070717_10005547 | 3300006028 | Bacteria | 9205 |
| 113 | Ga0070717_10006180 | 3300006028 | Bacteria | 8790 |
| 114 | Ga0070717_10022610 | 3300006028 | Bacteria | 4970 |
| 115 | Ga0070717_10767129 | 3300006028 | Bacteria | 877 |
| 116 | Ga0070717_11718690 | 3300006028 | Bacteria | 568 |
| 117 | Ga0075365_10174618 | 3300006038 | Bacteria | 1500 |
| 118 | Ga0075365_10179834 | 3300006038 | Bacteria | 1478 |
| 119 | Ga0070715_10001480 | 3300006163 | Bacteria | 6839 |
| 120 | Ga0070716_100075601 | 3300006173 | Bacteria | 1994 |
| 121 | Ga0070716_100250221 | 3300006173 | Bacteria | 1207 |
| 122 | Ga0070716_100296602 | 3300006173 | Bacteria | 1122 |
| 123 | Ga0070712_100021818 | 3300006175 | Bacteria | 4212 |
| 124 | Ga0070712_100062890 | 3300006175 | Bacteria | 2626 |
| 125 | Ga0070712_101102789 | 3300006175 | Bacteria | 689 |
| 126 | Ga0075367_10051329 | 3300006178 | Bacteria | 2437 |
| 127 | Ga0075367_10155277 | 3300006178 | Bacteria | 1421 |
| 128 | Ga0075367_10227816 | 3300006178 | Bacteria | 1167 |
| 129 | Ga0097621_100242238 | 3300006237 | Bacteria | 1577 |
| 130 | Ga0097621_100901153 | 3300006237 | Bacteria | 824 |
| 131 | Ga0075370_10513060 | 3300006353 | Bacteria | 724 |
| 132 | Ga0068871_100020724 | 3300006358 | Bacteria | 5041 |
| 133 | Ga0068871_100042693 | 3300006358 | Bacteria | 3642 |
| 134 | Ga0075431_101180052 | 3300006847 | Bacteria | 729 |
| 135 | Ga0075433_10656056 | 3300006852 | Bacteria | 920 |
| 136 | Ga0075434_100090377 | 3300006871 | Bacteria | 3064 |
| 137 | Ga0099794_10057690 | 3300007265 | Bacteria | 1881 |
| 138 | Ga0099794_10097175 | 3300007265 | Bacteria | 1467 |
| 139 | Ga0099795_10042841 | 3300007788 | Bacteria | 1618 |
| 140 | Ga0099795_10063731 | 3300007788 | Bacteria | 1375 |
| 141 | Ga0099795_10066543 | 3300007788 | Bacteria | 1350 |
| 142 | Ga0099795_10067946 | 3300007788 | Bacteria | 1338 |
| 143 | Ga0105240_10126409 | 3300009093 | Bacteria | 3072 |
| 144 | Ga0105240_10180873 | 3300009093 | Bacteria | 2488 |
| 145 | Ga0105240_10532978 | 3300009093 | Bacteria | 1301 |
| 146 | Ga0105240_11205827 | 3300009093 | Bacteria | 801 |
| 147 | Ga0105245_10010375 | 3300009098 | Bacteria | 8114 |
| 148 | Ga0105245_10175912 | 3300009098 | Bacteria | 2041 |
| 149 | Ga0105247_10014178 | 3300009101 | Bacteria | 4782 |
| 150 | Ga0105247_10043912 | 3300009101 | Bacteria | 2739 |
| 151 | Ga0105247_10232537 | 3300009101 | Bacteria | 1252 |
| 152 | Ga0105247_10445282 | 3300009101 | Bacteria | 932 |
| 153 | Ga0105243_11078470 | 3300009148 | Bacteria | 810 |
| 154 | Ga0105243_12815858 | 3300009148 | Bacteria | 527 |
| 155 | Ga0105241_10289344 | 3300009174 | Bacteria | 1402 |
| 156 | Ga0105242_10133265 | 3300009176 | Bacteria | 2148 |
| 157 | Ga0105242_11411741 | 3300009176 | Bacteria | 724 |
| 158 | Ga0105248_10398872 | 3300009177 | Bacteria | 1549 |
| 159 | Ga0105237_10118949 | 3300009545 | Bacteria | 2636 |
| 160 | Ga0105237_10990142 | 3300009545 | Bacteria | 848 |
| 161 | Ga0105237_11625872 | 3300009545 | Bacteria | 653 |
| 162 | Ga0105238_12384899 | 3300009551 | Bacteria | 564 |
| 163 | Ga0105249_10669938 | 3300009553 | Bacteria | 1096 |
| 164 | Ga0099796_10001079 | 3300010159 | Bacteria | 5207 |
| 165 | Ga0099796_10018958 | 3300010159 | Bacteria | 2077 |
| 166 | Ga0099796_10151382 | 3300010159 | Bacteria | 914 |
| 167 | Ga0099796_10204827 | 3300010159 | Bacteria | 802 |
| 168 | Ga0099796_10242542 | 3300010159 | Bacteria | 746 |
| 169 | Ga0099796_10379952 | 3300010159 | Bacteria | 615 |
| 170 | Ga0105239_10063610 | 3300010375 | Bacteria | 4051 |
| 171 | Ga0105239_10154782 | 3300010375 | Bacteria | 2560 |
| 172 | Ga0105246_10004587 | 3300011119 | Bacteria | 8412 |
| 173 | Ga0105246_10286227 | 3300011119 | Bacteria | 1324 |
| 174 | Ga0157371_10242204 | 3300013102 | Bacteria | 1298 |
| 175 | Ga0157370_10012436 | 3300013104 | Bacteria | 8824 |
| 176 | Ga0157370_10032211 | 3300013104 | Bacteria | 5120 |
| 177 | Ga0157369_10018574 | 3300013105 | Bacteria | 7794 |
| 178 | Ga0157374_10007971 | 3300013296 | Bacteria | 9048 |
| 179 | Ga0157378_10123717 | 3300013297 | Bacteria | 2387 |
| 180 | Ga0157378_10826258 | 3300013297 | Bacteria | 954 |
| 181 | Ga0157378_11705483 | 3300013297 | Bacteria | 677 |
| 182 | Ga0163162_10031396 | 3300013306 | Bacteria | 5269 |
| 183 | Ga0163162_11485112 | 3300013306 | Bacteria | 772 |
| 184 | Ga0157375_10333275 | 3300013308 | Bacteria | 1682 |
| 185 | Ga0163163_10067632 | 3300014325 | Bacteria | 3552 |
| 186 | Ga0163163_10263359 | 3300014325 | Bacteria | 1775 |
| 187 | Ga0157380_10290249 | 3300014326 | Bacteria | 1501 |
| 188 | Ga0157380_10949977 | 3300014326 | Bacteria | 889 |
| 189 | Ga0157376_10021927 | 3300014969 | Bacteria | 4969 |
| 190 | Ga0157376_10279547 | 3300014969 | Bacteria | 1571 |
| 191 | Ga0157376_11241179 | 3300014969 | Bacteria | 774 |
| 192 | Ga0163161_10146480 | 3300017792 | Bacteria | 1792 |
| 193 | Ga0163161_10494548 | 3300017792 | Bacteria | 995 |
| 194 | Ga0163161_11102398 | 3300017792 | Bacteria | 682 |
| 195 | Ga0154015_1187678 | 3300020610 | Bacteria | 815 |
| 196 | Ga0209025_1010552 | 3300025294 | Bacteria | 6248 |
| 197 | Ga0207697_10097187 | 3300025315 | Bacteria | 1253 |
| 198 | Ga0207656_10001137 | 3300025321 | Bacteria | 8748 |
| 199 | Ga0207692_10076712 | 3300025898 | Bacteria | 1776 |
| 200 | Ga0207710_10009231 | 3300025900 | Bacteria | 4147 |
| 201 | Ga0207710_10117658 | 3300025900 | Bacteria | 1266 |
| 202 | Ga0207710_10250505 | 3300025900 | Bacteria | 885 |
| 203 | Ga0207699_10003128 | 3300025906 | Bacteria | 7862 |
| 204 | Ga0207645_10444414 | 3300025907 | Bacteria | 875 |
| 205 | Ga0207643_10078551 | 3300025908 | Bacteria | 1909 |
| 206 | Ga0207643_10393508 | 3300025908 | Bacteria | 875 |
| 207 | Ga0207707_10003603 | 3300025912 | Bacteria | 13734 |
| 208 | Ga0207707_10098146 | 3300025912 | Bacteria | 2561 |
| 209 | Ga0207707_10294711 | 3300025912 | Bacteria | 1403 |
| 210 | Ga0207695_10015120 | 3300025913 | Bacteria | 9105 |
| 211 | Ga0207695_10213100 | 3300025913 | Bacteria | 1841 |
| 212 | Ga0207695_10471501 | 3300025913 | Bacteria | 1138 |
| 213 | Ga0207671_10116267 | 3300025914 | Bacteria | 2040 |
| 214 | Ga0207671_10126850 | 3300025914 | Bacteria | 1956 |
| 215 | Ga0207693_10000581 | 3300025915 | Bacteria | 32715 |
| 216 | Ga0207693_10029129 | 3300025915 | Bacteria | 4363 |
| 217 | Ga0207693_10102044 | 3300025915 | Bacteria | 2250 |
| 218 | Ga0207693_10604283 | 3300025915 | Bacteria | 854 |
| 219 | Ga0207663_10000084 | 3300025916 | Bacteria | 44454 |
| 220 | Ga0207663_10108215 | 3300025916 | Bacteria | 1882 |
| 221 | Ga0207663_10147085 | 3300025916 | Bacteria | 1648 |
| 222 | Ga0207663_10227370 | 3300025916 | Bacteria | 1361 |
| 223 | Ga0207660_10086010 | 3300025917 | Bacteria | 2320 |
| 224 | Ga0207660_10683102 | 3300025917 | Bacteria | 837 |
| 225 | Ga0207660_10699397 | 3300025917 | Bacteria | 827 |
| 226 | Ga0207662_10223347 | 3300025918 | Bacteria | 1227 |
| 227 | Ga0207649_10106432 | 3300025920 | Bacteria | 1866 |
| 228 | Ga0207652_10001857 | 3300025921 | Bacteria | 18344 |
| 229 | Ga0207652_10156454 | 3300025921 | Bacteria | 2042 |
| 230 | Ga0207652_11098652 | 3300025921 | Bacteria | 696 |
| 231 | Ga0207681_10978683 | 3300025923 | Bacteria | 709 |
| 232 | Ga0207694_10008673 | 3300025924 | Bacteria | 7674 |
| 233 | Ga0207659_10352321 | 3300025926 | Bacteria | 1222 |
| 234 | Ga0207659_10550473 | 3300025926 | Bacteria | 981 |
| 235 | Ga0207687_10091887 | 3300025927 | Bacteria | 2215 |
| 236 | Ga0207687_10809404 | 3300025927 | Bacteria | 799 |
| 237 | Ga0207700_10002410 | 3300025928 | Bacteria | 10739 |
| 238 | Ga0207700_10062075 | 3300025928 | Bacteria | 2837 |
| 239 | Ga0207700_10340756 | 3300025928 | Bacteria | 1303 |
| 240 | Ga0207700_10542432 | 3300025928 | Bacteria | 1032 |
| 241 | Ga0207664_10013665 | 3300025929 | Bacteria | 5836 |
| 242 | Ga0207664_10129229 | 3300025929 | Bacteria | 2125 |
| 243 | Ga0207664_10909507 | 3300025929 | Bacteria | 790 |
| 244 | Ga0207644_10011377 | 3300025931 | Bacteria | 5886 |
| 245 | Ga0207644_10018588 | 3300025931 | Bacteria | 4706 |
| 246 | Ga0207644_10186533 | 3300025931 | Bacteria | 1629 |
| 247 | Ga0207690_10084985 | 3300025932 | Bacteria | 2220 |
| 248 | Ga0207690_10659082 | 3300025932 | Bacteria | 858 |
| 249 | Ga0207709_11389037 | 3300025935 | Bacteria | 581 |
| 250 | Ga0207670_10008541 | 3300025936 | Bacteria | 5788 |
| 251 | Ga0207670_10118053 | 3300025936 | Bacteria | 1923 |
| 252 | Ga0207665_10001451 | 3300025939 | Bacteria | 15944 |
| 253 | Ga0207665_10127819 | 3300025939 | Bacteria | 1801 |
| 254 | Ga0207665_10139383 | 3300025939 | Bacteria | 1728 |
| 255 | Ga0207665_10155006 | 3300025939 | Bacteria | 1643 |
| 256 | Ga0207665_10264410 | 3300025939 | Bacteria | 1275 |
| 257 | Ga0207665_10419551 | 3300025939 | Bacteria | 1022 |
| 258 | Ga0207691_10536738 | 3300025940 | Bacteria | 992 |
| 259 | Ga0207711_10465755 | 3300025941 | Bacteria | 1177 |
| 260 | Ga0207689_10118168 | 3300025942 | Bacteria | 2180 |
| 261 | Ga0207661_10001574 | 3300025944 | Bacteria | 15528 |
| 262 | Ga0207661_10960747 | 3300025944 | Bacteria | 787 |
| 263 | Ga0207661_11025876 | 3300025944 | Bacteria | 760 |
| 264 | Ga0207679_10089987 | 3300025945 | Bacteria | 2371 |
| 265 | Ga0207667_10011919 | 3300025949 | Bacteria | 10067 |
| 266 | Ga0207667_10169869 | 3300025949 | Bacteria | 2241 |
| 267 | Ga0207667_10334657 | 3300025949 | Bacteria | 1545 |
| 268 | Ga0207651_10015475 | 3300025960 | Bacteria | 4434 |
| 269 | Ga0207651_10122348 | 3300025960 | Bacteria | 1976 |
| 270 | Ga0207651_10167591 | 3300025960 | Bacteria | 1729 |
| 271 | Ga0207651_10251949 | 3300025960 | Bacteria | 1445 |
| 272 | Ga0207651_10881743 | 3300025960 | Bacteria | 796 |
| 273 | Ga0207712_11022993 | 3300025961 | Bacteria | 734 |
| 274 | Ga0207668_11122512 | 3300025972 | Bacteria | 705 |
| 275 | Ga0207640_11417366 | 3300025981 | Bacteria | 623 |
| 276 | Ga0207658_10697348 | 3300025986 | Bacteria | 917 |
| 277 | Ga0207677_10105095 | 3300026023 | Bacteria | 2089 |
| 278 | Ga0207678_10085203 | 3300026067 | Bacteria | 2702 |
| 279 | Ga0207678_10101390 | 3300026067 | Bacteria | 2458 |
| 280 | Ga0207678_10202766 | 3300026067 | Bacteria | 1696 |
| 281 | Ga0207678_10915314 | 3300026067 | Bacteria | 776 |
| 282 | Ga0207708_10615165 | 3300026075 | Bacteria | 921 |
| 283 | Ga0207708_10857560 | 3300026075 | Bacteria | 784 |
| 284 | Ga0207702_10000126 | 3300026078 | Bacteria | 90550 |
| 285 | Ga0207702_10198787 | 3300026078 | Bacteria | 1857 |
| 286 | Ga0207641_10039952 | 3300026088 | Bacteria | 3925 |
| 287 | Ga0207641_11428799 | 3300026088 | Bacteria | 693 |
| 288 | Ga0207648_10675345 | 3300026089 | Bacteria | 956 |
| 289 | Ga0207676_10195304 | 3300026095 | Bacteria | 1784 |
| 290 | Ga0207674_10085956 | 3300026116 | Bacteria | 3139 |
| 291 | Ga0207674_10256881 | 3300026116 | Bacteria | 1694 |
| 292 | Ga0207683_10048423 | 3300026121 | Bacteria | 3722 |
| 293 | Ga0207683_10283213 | 3300026121 | Bacteria | 1515 |
| 294 | Ga0207698_10474898 | 3300026142 | Bacteria | 1212 |
| 295 | Ga0207698_10705681 | 3300026142 | Bacteria | 1004 |
| 296 | Ga0209588_1111659 | 3300027671 | Bacteria | 878 |
| 297 | Ga0268266_10026648 | 3300028379 | Bacteria | 4918 |
| 298 | Ga0268266_10389371 | 3300028379 | Bacteria | 1316 |
| 299 | Ga0268266_10629846 | 3300028379 | Bacteria | 1031 |
| 300 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 301 | Ga0268264_10178480 | 3300028381 | Bacteria | 1927 |
| 302 | Ga0268264_10738702 | 3300028381 | Bacteria | 980 |
| 303 | Ga0268264_10927801 | 3300028381 | Bacteria | 875 |
| 304 | Ga0307511_10113901 | 3300030521 | Bacteria | 1707 |
| 305 | Ga0307511_10132200 | 3300030521 | Bacteria | 1499 |
| 306 | Ga0265330_10034624 | 3300031235 | Bacteria | 2255 |
| 307 | Ga0265330_10036768 | 3300031235 | Bacteria | 2181 |
| 308 | Ga0265332_10000319 | 3300031238 | Bacteria | 36874 |
| 309 | Ga0265332_10005559 | 3300031238 | Bacteria | 5803 |
| 310 | Ga0265332_10033171 | 3300031238 | Bacteria | 2248 |
| 311 | Ga0265328_10156074 | 3300031239 | Bacteria | 859 |
| 312 | Ga0265325_10008748 | 3300031241 | Bacteria | 5954 |
| 313 | Ga0265325_10275592 | 3300031241 | Bacteria | 755 |
| 314 | Ga0265329_10006074 | 3300031242 | Bacteria | 4823 |
| 315 | Ga0265340_10006774 | 3300031247 | Bacteria | 6270 |
| 316 | Ga0265340_10014937 | 3300031247 | Bacteria | 4043 |
| 317 | Ga0265339_10000354 | 3300031249 | Bacteria | 36474 |
| 318 | Ga0265339_10026639 | 3300031249 | Bacteria | 3309 |
| 319 | Ga0265339_10475542 | 3300031249 | Bacteria | 578 |
| 320 | Ga0265331_10041214 | 3300031250 | Bacteria | 2244 |
| 321 | Ga0265316_10059968 | 3300031344 | Bacteria | 2958 |
| 322 | Ga0265316_10194170 | 3300031344 | Bacteria | 1507 |
| 323 | Ga0265316_10885612 | 3300031344 | Bacteria | 624 |
| 324 | Ga0307509_10250115 | 3300031507 | Bacteria | 1557 |
| 325 | Ga0307509_10300125 | 3300031507 | Bacteria | 1355 |
| 326 | Ga0307509_10418353 | 3300031507 | Bacteria | 1041 |
| 327 | Ga0265313_10029007 | 3300031595 | Bacteria | 2868 |
| 328 | Ga0265313_10197542 | 3300031595 | Bacteria | 838 |
| 329 | Ga0307508_10198560 | 3300031616 | Bacteria | 1607 |
| 330 | Ga0265314_10005412 | 3300031711 | Bacteria | 11534 |
| 331 | Ga0265314_10131439 | 3300031711 | Bacteria | 1561 |
| 332 | Ga0265342_10000050 | 3300031712 | Bacteria | 124639 |
| 333 | Ga0265342_10065394 | 3300031712 | Bacteria | 2131 |
| 334 | Ga0265342_10118566 | 3300031712 | Bacteria | 1492 |
| 335 | Ga0265342_10119550 | 3300031712 | Bacteria | 1485 |
| 336 | Ga0265342_10249906 | 3300031712 | Bacteria | 947 |
| 337 | Ga0307516_10001650 | 3300031730 | Bacteria | 30691 |
| 338 | Ga0307516_10161420 | 3300031730 | Bacteria | 1991 |
| 339 | Ga0307516_10183185 | 3300031730 | Bacteria | 1826 |
| 340 | Ga0307516_10409092 | 3300031730 | Bacteria | 1015 |
| 341 | Ga0307516_10501785 | 3300031730 | Bacteria | 868 |
| 342 | Ga0307516_10805017 | 3300031730 | Bacteria | 601 |
| 343 | Ga0307413_10104304 | 3300031824 | Bacteria | 1882 |
| 344 | Ga0307412_10687597 | 3300031911 | Bacteria | 877 |
| 345 | Ga0307412_10822095 | 3300031911 | Bacteria | 808 |
| 346 | Ga0307409_101303873 | 3300031995 | Bacteria | 751 |
| 347 | Ga0307409_101877434 | 3300031995 | Bacteria | 628 |
| 348 | Ga0307416_100896327 | 3300032002 | Bacteria | 987 |
| 349 | Ga0307415_100221837 | 3300032126 | Bacteria | 1516 |
| 350 | Ga0307507_10016040 | 3300033179 | Bacteria | 8756 |
| 351 | Ga0307510_10080137 | 3300033180 | Bacteria | 3177 |
| 352 | Ga0307510_10287945 | 3300033180 | Bacteria | 1110 |
| 353 | Ga0373926_0024022 | 3300035083 | Bacteria | 2120 |
| 354 | Ga0373934_0004350 | 3300035086 | Bacteria | 5233 |
| 355 | Ga0373934_0031073 | 3300035086 | Bacteria | 2090 |
| 356 | Ga0373934_0073779 | 3300035086 | Bacteria | 1366 |
| 357 | Ga0373944_0033628 | 3300035089 | Bacteria | 1554 |
| 358 | Ga0373923_0014524 | 3300035111 | Bacteria | 2959 |
| 359 | Ga0373923_0161892 | 3300035111 | Bacteria | 1021 |
| 360 | Ga0373923_0196408 | 3300035111 | Bacteria | 931 |
| 361 | Ga0373936_0001544 | 3300035113 | Bacteria | 8389 |
| 362 | Ga0373936_0016127 | 3300035113 | Bacteria | 2871 |
| 363 | Ga0373936_0045600 | 3300035113 | Bacteria | 1766 |
| 364 | Ga0373936_0458551 | 3300035113 | Bacteria | 590 |
| 365 | Ga0373945_0002222 | 3300035116 | Bacteria | 6067 |
| 366 | Ga0373945_0012571 | 3300035116 | Bacteria | 2814 |
| 367 | Ga0373953_0000812 | 3300035117 | Bacteria | 8708 |
| 368 | Ga0373953_0004109 | 3300035117 | Bacteria | 4614 |
| 369 | Ga0373953_0010843 | 3300035117 | Bacteria | 3183 |
| 370 | Ga0373954_0001004 | 3300035118 | Bacteria | 11147 |
| 371 | Ga0373954_0003114 | 3300035118 | Bacteria | 7002 |
| 372 | Ga0373954_0079917 | 3300035118 | Bacteria | 1561 |
| 373 | Ga0373956_0012101 | 3300035119 | Bacteria | 3569 |
| 374 | Ga0373956_0028583 | 3300035119 | Bacteria | 2427 |
| 375 | Ga0373956_0037651 | 3300035119 | Bacteria | 2138 |
| 376 | Ga0373956_0047415 | 3300035119 | Bacteria | 1922 |
| 377 | Ga0373956_0478997 | 3300035119 | Bacteria | 594 |
| 378 | Ga0373956_0528114 | 3300035119 | Bacteria | 563 |
| 379 | Ga0373957_0001219 | 3300035120 | Bacteria | 6866 |
| 380 | Ga0373957_0018766 | 3300035120 | Bacteria | 2426 |
| 381 | Ga0373957_0281374 | 3300035120 | Bacteria | 703 |
| 382 | Ga0373957_0312919 | 3300035120 | Bacteria | 667 |
| 383 | Ga0373943_0022807 | 3300035170 | Bacteria | 2905 |
| 384 | Ga0373943_0113038 | 3300035170 | Bacteria | 1434 |
| 385 | Ga0373946_0001948 | 3300035171 | Bacteria | 7225 |
| 386 | Ga0373946_0302535 | 3300035171 | Bacteria | 791 |
| 387 | Ga0373955_0000039 | 3300035172 | Bacteria | 51994 |
| 388 | Ga0373955_0010487 | 3300035172 | Bacteria | 4378 |
| 389 | Ga0373955_0021151 | 3300035172 | Bacteria | 3279 |
| 390 | Ga0373961_0094618 | 3300035241 | Bacteria | 959 |
| 391 | Ga0373924_0004875 | 3300035410 | Bacteria | 4715 |
| 392 | Ga0373924_0030479 | 3300035410 | Bacteria | 2163 |
| 393 | Ga0373924_0138135 | 3300035410 | Bacteria | 1062 |
| 394 | Ga0373924_0185259 | 3300035410 | Bacteria | 916 |
| 395 | Ga0373931_0083407 | 3300035691 | Bacteria | 1768 |
| 396 | Ga0373931_0101039 | 3300035691 | Bacteria | 1622 |
| 397 | Ga0373935_0000079 | 3300035692 | Bacteria | 41989 |
| 398 | Ga0373935_0000382 | 3300035692 | Bacteria | 22745 |
| 399 | Ga0373935_0008213 | 3300035692 | Bacteria | 6252 |
| 400 | Ga0373935_0032024 | 3300035692 | Bacteria | 3266 |
| 401 | Ga0373935_0068458 | 3300035692 | Bacteria | 2284 |
| 402 | Ga0373927_0006278 | 3300035695 | Bacteria | 8111 |
| 403 | Ga0373927_0017668 | 3300035695 | Bacteria | 4692 |
| 404 | Ga0373927_0025913 | 3300035695 | Bacteria | 3832 |
| 405 | Ga0373927_0052978 | 3300035695 | Bacteria | 2624 |
| 406 | Ga0373933_0000110 | 3300035724 | Bacteria | 52519 |
| 407 | Ga0373933_0004722 | 3300035724 | Bacteria | 7451 |
| 408 | Ga0373933_0010172 | 3300035724 | Bacteria | 5152 |
| 409 | Ga0373933_0012105 | 3300035724 | Bacteria | 4763 |
| 410 | Ga0373933_0200978 | 3300035724 | Bacteria | 1275 |
| 411 | Ga0373933_0267619 | 3300035724 | Bacteria | 1102 |
| 412 | Ga0373947_0003920 | 3300035725 | Bacteria | 8750 |
| 413 | Ga0373947_0199408 | 3300035725 | Bacteria | 1309 |
| 414 | Ga0373947_0597485 | 3300035725 | Bacteria | 752 |
| 415 | Ga0373937_0000223 | 3300036401 | Bacteria | 54957 |
| 416 | Ga0373937_0016193 | 3300036401 | Bacteria | 6615 |
| 417 | Ga0373937_0142202 | 3300036401 | Bacteria | 2245 |
| 418 | Ga0373937_0386491 | 3300036401 | Bacteria | 1327 |
| 419 | Ga0373937_0598382 | 3300036401 | Bacteria | 1047 |
| 420 | Ga0372808_012212 | 3300036459 | Bacteria | 1218 |
| 421 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 422 | Ga0373925_0013463 | 3300037068 | Bacteria | 5920 |
| 423 | Ga0373925_0017659 | 3300037068 | Bacteria | 5177 |
| 424 | Ga0373925_0027177 | 3300037068 | Bacteria | 4190 |
| 425 | Ga0373925_0070716 | 3300037068 | Bacteria | 2638 |
| 426 | Ga0373925_1224651 | 3300037068 | Bacteria | 617 |
| 427 | Ga0395898_0046725 | 3300037466 | Bacteria | 4252 |
| 428 | Ga0395898_0338844 | 3300037466 | Bacteria | 1434 |
| 429 | Ga0436365_0800516 | 3300039437 | Bacteria | 792 |
| 430 | Ga0436365_0926888 | 3300039437 | Bacteria | 1578 |
| 431 | Ga0436360_0670966 | 3300039438 | Bacteria | 1626 |
| 432 | Ga0436361_1216747 | 3300039447 | Bacteria | 884 |
| 433 | Ga0436363_0529468 | 3300039450 | Bacteria | 953 |
| 434 | Ga0436363_0538725 | 3300039450 | Bacteria | 660 |
| 435 | Ga0436362_0818857 | 3300039453 | Bacteria | 696 |
| 436 | Ga0451795_0272602 | 3300041456 | Bacteria | 757 |
| 437 | Ga0451800_0560181 | 3300041459 | Bacteria | 1418 |
| 438 | Ga0451807_2567829 | 3300041486 | Bacteria | 1392 |
| 439 | Ga0451837_0149782 | 3300041494 | Bacteria | 590 |
| 440 | Ga0466972_0021424 | 3300044658 | Bacteria | 3221 |
| 441 | Ga0466968_0056962 | 3300044735 | Bacteria | 1679 |
| 442 | Ga0466968_0404050 | 3300044735 | Bacteria | 670 |
| 443 | Ga0466960_0036712 | 3300044901 | Bacteria | 2296 |
| 444 | Ga0466959_0567829 | 3300045049 | Bacteria | 764 |
| 445 | Ga0466967_0415822 | 3300045976 | Bacteria | 1310 |
| 446 | Ga0466967_0433695 | 3300045976 | Bacteria | 1282 |
| 447 | Ga0495592_0000475 | 3300046454 | Bacteria | 29441 |
| 448 | Ga0495592_0006852 | 3300046454 | Bacteria | 8508 |
| 449 | Ga0495592_0009482 | 3300046454 | Bacteria | 7319 |
| 450 | Ga0495592_0043882 | 3300046454 | Bacteria | 3343 |
| 451 | Ga0495592_0341506 | 3300046454 | Bacteria | 962 |
| 452 | Ga0495603_0000191 | 3300046455 | Bacteria | 32052 |
| 453 | Ga0495603_0009824 | 3300046455 | Bacteria | 5790 |
| 454 | Ga0495603_0101732 | 3300046455 | Bacteria | 1677 |
| 455 | Ga0495590_0135595 | 3300046457 | Bacteria | 887 |
| 456 | Ga0495629_0000500 | 3300046459 | Bacteria | 32861 |
| 457 | Ga0495629_0001281 | 3300046459 | Bacteria | 19758 |
| 458 | Ga0495629_0007003 | 3300046459 | Bacteria | 8306 |
| 459 | Ga0495629_0255098 | 3300046459 | Bacteria | 1206 |
| 460 | Ga0495629_0402677 | 3300046459 | Bacteria | 930 |
| 461 | Ga0495641_0001436 | 3300046461 | Bacteria | 20225 |
| 462 | Ga0495641_0044832 | 3300046461 | Bacteria | 2038 |
| 463 | Ga0495641_0362520 | 3300046461 | Bacteria | 656 |
| 464 | Ga0495651_0005638 | 3300046462 | Bacteria | 9539 |
| 465 | Ga0495651_0010558 | 3300046462 | Bacteria | 7099 |
| 466 | Ga0495651_0129083 | 3300046462 | Bacteria | 1847 |
| 467 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 468 | Ga0495653_0003914 | 3300046463 | Bacteria | 12039 |
| 469 | Ga0495580_0010080 | 3300046472 | Bacteria | 7381 |
| 470 | Ga0495580_0085589 | 3300046472 | Bacteria | 2195 |
| 471 | Ga0495582_0000251 | 3300046473 | Bacteria | 29816 |
| 472 | Ga0495582_0121260 | 3300046473 | Bacteria | 1473 |
| 473 | Ga0495639_0000077 | 3300046475 | Bacteria | 46394 |
| 474 | Ga0495662_0000826 | 3300046476 | Bacteria | 15060 |
| 475 | Ga0495662_0001775 | 3300046476 | Bacteria | 10789 |
| 476 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 477 | Ga0495664_0005360 | 3300046477 | Bacteria | 7035 |
| 478 | Ga0495664_0245197 | 3300046477 | Bacteria | 1084 |
| 479 | Ga0495664_0328231 | 3300046477 | Bacteria | 922 |
| 480 | Ga0495584_0117094 | 3300046491 | Bacteria | 1349 |
| 481 | Ga0495594_0000648 | 3300046499 | Bacteria | 17955 |
| 482 | Ga0495606_0001179 | 3300046507 | Bacteria | 36884 |
| 483 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 484 | Ga0495608_0002194 | 3300046511 | Bacteria | 14100 |
| 485 | Ga0495608_0002352 | 3300046511 | Bacteria | 13621 |
| 486 | Ga0495608_0541959 | 3300046511 | Bacteria | 702 |
| 487 | Ga0495616_0295645 | 3300046513 | Bacteria | 685 |
| 488 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 489 | Ga0495618_0056355 | 3300046514 | Bacteria | 2488 |
| 490 | Ga0495618_0072979 | 3300046514 | Bacteria | 2184 |
| 491 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 492 | Ga0495628_0009404 | 3300046516 | Bacteria | 8342 |
| 493 | Ga0495628_0030315 | 3300046516 | Bacteria | 4380 |
| 494 | Ga0495630_0000240 | 3300046517 | Bacteria | 43911 |
| 495 | Ga0495630_0032298 | 3300046517 | Bacteria | 3900 |
| 496 | Ga0495630_0143217 | 3300046517 | Bacteria | 1817 |
| 497 | Ga0495648_0006022 | 3300046524 | Bacteria | 9959 |
| 498 | Ga0495666_0025194 | 3300046526 | Bacteria | 2938 |
| 499 | Ga0495666_0237580 | 3300046526 | Bacteria | 832 |
| 500 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 501 | Ga0495652_0001117 | 3300046529 | Bacteria | 30393 |
| 502 | Ga0495652_0003535 | 3300046529 | Bacteria | 15358 |
| 503 | Ga0495652_0030569 | 3300046529 | Bacteria | 4722 |
| 504 | Ga0495652_0061438 | 3300046529 | Bacteria | 3171 |
| 505 | Ga0495665_0016458 | 3300046531 | Bacteria | 3985 |
| 506 | Ga0495665_0130344 | 3300046531 | Bacteria | 1316 |
| 507 | Ga0495665_0299869 | 3300046531 | Bacteria | 823 |
| 508 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 509 | Ga0495640_0003320 | 3300046533 | Bacteria | 12954 |
| 510 | Ga0495640_0008340 | 3300046533 | Bacteria | 8125 |
| 511 | Ga0495640_0013662 | 3300046533 | Bacteria | 6171 |
| 512 | Ga0495640_0018138 | 3300046533 | Bacteria | 5229 |
| 513 | Ga0495586_0034576 | 3300046535 | Bacteria | 2715 |
| 514 | Ga0495586_0268095 | 3300046535 | Bacteria | 976 |
| 515 | Ga0495586_0275461 | 3300046535 | Bacteria | 962 |
| 516 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 517 | Ga0495587_0048810 | 3300046536 | Bacteria | 2506 |
| 518 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 519 | Ga0495645_0022506 | 3300046543 | Bacteria | 4560 |
| 520 | Ga0495645_0252854 | 3300046543 | Bacteria | 1170 |
| 521 | Ga0495622_0020648 | 3300046557 | Bacteria | 3067 |
| 522 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 523 | Ga0495667_0001890 | 3300046559 | Bacteria | 13905 |
| 524 | Ga0495667_0007037 | 3300046559 | Bacteria | 7634 |
| 525 | Ga0495667_0020775 | 3300046559 | Bacteria | 4430 |
| 526 | Ga0495667_0449706 | 3300046559 | Bacteria | 809 |
| 527 | Ga0495656_0052411 | 3300046615 | Bacteria | 1750 |
| 528 | Ga0495634_0000129 | 3300046642 | Bacteria | 65082 |
| 529 | Ga0495634_0000440 | 3300046642 | Bacteria | 41444 |
| 530 | Ga0495634_0006578 | 3300046642 | Bacteria | 8814 |
| 531 | Ga0495634_0039133 | 3300046642 | Bacteria | 3230 |
| 532 | Ga0495635_0000020 | 3300046663 | Bacteria | 189698 |
| 533 | Ga0495635_0000425 | 3300046663 | Bacteria | 26748 |
| 534 | Ga0495635_0018106 | 3300046663 | Bacteria | 4919 |
| 535 | Ga0495635_0086616 | 3300046663 | Bacteria | 2143 |
| 536 | Ga0495588_0001638 | 3300046674 | Bacteria | 9590 |
| 537 | Ga0495588_0409162 | 3300046674 | Bacteria | 712 |
| 538 | Ga0495657_0000240 | 3300046675 | Bacteria | 49927 |
| 539 | Ga0495657_0014186 | 3300046675 | Bacteria | 5856 |
| 540 | Ga0495657_0014528 | 3300046675 | Bacteria | 5777 |
| 541 | Ga0495657_0023164 | 3300046675 | Bacteria | 4440 |
| 542 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 543 | Ga0495599_0004705 | 3300046678 | Bacteria | 8102 |
| 544 | Ga0495599_0025144 | 3300046678 | Bacteria | 3726 |
| 545 | Ga0495599_0040272 | 3300046678 | Bacteria | 2934 |
| 546 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 547 | Ga0495623_0052608 | 3300046679 | Bacteria | 2572 |
| 548 | Ga0495623_0108149 | 3300046679 | Bacteria | 1688 |
| 549 | Ga0495646_0000013 | 3300046680 | Bacteria | 159700 |
| 550 | Ga0495646_0005175 | 3300046680 | Bacteria | 8224 |
| 551 | Ga0495646_0005468 | 3300046680 | Bacteria | 8028 |
| 552 | Ga0495646_0166781 | 3300046680 | Bacteria | 1216 |
| 553 | Ga0495646_0233902 | 3300046680 | Bacteria | 989 |
| 554 | Ga0495647_0003601 | 3300046681 | Bacteria | 4968 |
| 555 | Ga0495647_0112912 | 3300046681 | Bacteria | 1136 |
| 556 | Ga0495658_0002435 | 3300046683 | Bacteria | 9368 |
| 557 | Ga0495658_0107561 | 3300046683 | Bacteria | 1673 |
| 558 | Ga0495658_0497733 | 3300046683 | Bacteria | 779 |
| 559 | Ga0495613_0010577 | 3300046689 | Bacteria | 6844 |
| 560 | Ga0495613_0080447 | 3300046689 | Bacteria | 2368 |
| 561 | Ga0495613_0265426 | 3300046689 | Bacteria | 1195 |
| 562 | Ga0495624_0000818 | 3300046690 | Bacteria | 24567 |
| 563 | Ga0495600_0000041 | 3300046809 | Bacteria | 75747 |
| 564 | Ga0495600_0032884 | 3300046809 | Bacteria | 3365 |
| 565 | Ga0495600_0034137 | 3300046809 | Bacteria | 3302 |
| 566 | Ga0495600_0205380 | 3300046809 | Bacteria | 1264 |
| 567 | Ga0495600_0587577 | 3300046809 | Bacteria | 678 |
| 568 | Ga0495581_0020734 | 3300047315 | Bacteria | 3810 |
| 569 | Ga0495581_0044348 | 3300047315 | Bacteria | 2572 |
| 570 | Ga0495581_0191251 | 3300047315 | Bacteria | 1197 |
| 571 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 572 | Ga0495604_0017963 | 3300047317 | Bacteria | 5659 |
| 573 | Ga0495604_0047819 | 3300047317 | Bacteria | 3330 |
| 574 | Ga0495604_0406191 | 3300047317 | Bacteria | 896 |
| 575 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 576 | Ga0495674_0001342 | 3300047319 | Bacteria | 23999 |
| 577 | Ga0495674_0050291 | 3300047319 | Bacteria | 3678 |
| 578 | Ga0495674_0233939 | 3300047319 | Bacteria | 1516 |
| 579 | Ga0495674_0463858 | 3300047319 | Bacteria | 1016 |
| 580 | Ga0495676_0066921 | 3300047321 | Bacteria | 2781 |
| 581 | Ga0495676_0202401 | 3300047321 | Bacteria | 1379 |
| 582 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 583 | Ga0495680_0002310 | 3300047322 | Bacteria | 19589 |
| 584 | Ga0495680_0013256 | 3300047322 | Bacteria | 7202 |
| 585 | Ga0495680_0157954 | 3300047322 | Bacteria | 1648 |
| 586 | Ga0495675_0000383 | 3300047444 | Bacteria | 30552 |
| 587 | Ga0495675_0120178 | 3300047444 | Bacteria | 1636 |
| 588 | Ga0495675_0283899 | 3300047444 | Bacteria | 986 |
| 589 | Ga0495684_0000020 | 3300047471 | Bacteria | 148507 |
| 590 | Ga0495684_0003601 | 3300047471 | Bacteria | 12078 |
| 591 | Ga0495684_0055791 | 3300047471 | Bacteria | 3013 |
| 592 | Ga0495684_0464766 | 3300047471 | Bacteria | 876 |
| 593 | Ga0495593_0000192 | 3300047673 | Bacteria | 32140 |
| 594 | Ga0495593_0002191 | 3300047673 | Bacteria | 11688 |
| 595 | Ga0495593_0004378 | 3300047673 | Bacteria | 8399 |
| 596 | Ga0495593_0090816 | 3300047673 | Bacteria | 1573 |
| 597 | Ga0495602_0000027 | 3300048088 | Bacteria | 145010 |
| 598 | Ga0495602_0001747 | 3300048088 | Bacteria | 21667 |
| 599 | Ga0495602_0148139 | 3300048088 | Bacteria | 1848 |
| 600 | Ga0495602_0359047 | 3300048088 | Bacteria | 1049 |
| 601 | Ga0495614_0143135 | 3300048089 | Bacteria | 1063 |
| 602 | Ga0496100_0005558 | 3300048903 | Bacteria | 6803 |
| 603 | Ga0496100_0062256 | 3300048903 | Bacteria | 2462 |
| 604 | Ga0496100_0079263 | 3300048903 | Bacteria | 2213 |
| 605 | Ga0496100_0913220 | 3300048903 | Bacteria | 690 |
| 606 | Ga0496100_1659527 | 3300048903 | Bacteria | 505 |
| 607 | Ga0496101_0006237 | 3300048904 | Bacteria | 7667 |
| 608 | Ga0496101_0111706 | 3300048904 | Bacteria | 2058 |
| 609 | Ga0496101_0183028 | 3300048904 | Bacteria | 1614 |
| 610 | Ga0496101_0786063 | 3300048904 | Bacteria | 751 |
| 611 | Ga0496101_1268995 | 3300048904 | Bacteria | 576 |
| 612 | Ga0496102_0002444 | 3300048905 | Bacteria | 15846 |
| 613 | Ga0496102_0130392 | 3300048905 | Bacteria | 2353 |
| 614 | Ga0496103_0077882 | 3300048906 | Bacteria | 2082 |
| 615 | Ga0496104_0004215 | 3300048907 | Bacteria | 12487 |
| 616 | Ga0496104_0135359 | 3300048907 | Bacteria | 2367 |
| 617 | Ga0496104_0328582 | 3300048907 | Bacteria | 1442 |
| 618 | Ga0496104_0666798 | 3300048907 | Bacteria | 949 |
| 619 | Ga0496105_0008253 | 3300048908 | Bacteria | 8098 |
| 620 | Ga0496106_0000645 | 3300048909 | Bacteria | 24977 |
| 621 | Ga0496106_0045251 | 3300048909 | Bacteria | 3306 |
| 622 | Ga0496107_0006772 | 3300048910 | Bacteria | 7887 |
| 623 | Ga0496107_0047582 | 3300048910 | Bacteria | 3088 |
| 624 | Ga0496107_0063699 | 3300048910 | Bacteria | 2672 |
| 625 | Ga0496107_0321313 | 3300048910 | Bacteria | 1152 |
| 626 | Ga0496107_0493880 | 3300048910 | Bacteria | 908 |
| 627 | Ga0496108_0000515 | 3300048911 | Bacteria | 30277 |
| 628 | Ga0496108_0008972 | 3300048911 | Bacteria | 8106 |
| 629 | Ga0496108_0286731 | 3300048911 | Bacteria | 1433 |
| 630 | Ga0496108_1652776 | 3300048911 | Bacteria | 529 |
| 631 | Ga0496109_0002891 | 3300048912 | Bacteria | 14365 |
| 632 | Ga0496109_0031689 | 3300048912 | Bacteria | 4747 |
| 633 | Ga0496109_0236351 | 3300048912 | Bacteria | 1719 |
| 634 | Ga0496110_0006362 | 3300048913 | Bacteria | 9335 |
| 635 | Ga0496110_0064722 | 3300048913 | Bacteria | 3232 |
| 636 | Ga0496110_0071115 | 3300048913 | Bacteria | 3084 |
| 637 | Ga0496110_0353814 | 3300048913 | Bacteria | 1338 |
| 638 | Ga0496111_0039295 | 3300048914 | Bacteria | 3392 |
| 639 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 640 | Ga0496112_0009417 | 3300048915 | Bacteria | 8799 |
| 641 | Ga0496112_0010399 | 3300048915 | Bacteria | 8437 |
| 642 | Ga0496112_0017028 | 3300048915 | Bacteria | 6823 |
| 643 | Ga0496112_0382543 | 3300048915 | Bacteria | 1348 |
| 644 | Ga0496112_1386347 | 3300048915 | Bacteria | 618 |
| 645 | Ga0496113_0122408 | 3300048916 | Bacteria | 2035 |
| 646 | Ga0496113_0713298 | 3300048916 | Bacteria | 800 |
| 647 | Ga0496114_0015589 | 3300048917 | Bacteria | 6111 |
| 648 | Ga0496114_0097491 | 3300048917 | Bacteria | 2504 |
| 649 | Ga0496114_0693953 | 3300048917 | Bacteria | 893 |
| 650 | Ga0496114_0717352 | 3300048917 | Bacteria | 876 |
| 651 | Ga0496115_0004586 | 3300048918 | Bacteria | 10008 |
| 652 | Ga0496115_0079056 | 3300048918 | Bacteria | 2677 |
| 653 | Ga0496115_0412543 | 3300048918 | Bacteria | 1095 |
| 654 | Ga0496115_0883551 | 3300048918 | Bacteria | 690 |
| 655 | Ga0496117_0010119 | 3300048920 | Bacteria | 8659 |
| 656 | Ga0496118_0007230 | 3300048921 | Bacteria | 11848 |
| 657 | Ga0496119_0183634 | 3300048922 | Bacteria | 1095 |
| 658 | Ga0496120_0120517 | 3300048923 | Bacteria | 1357 |
| 659 | Ga0496121_0001276 | 3300048924 | Bacteria | 43353 |
| 660 | Ga0496121_0209113 | 3300048924 | Bacteria | 1384 |
| 661 | Ga0496124_0001454 | 3300048927 | Bacteria | 34934 |
| 662 | Ga0496125_0042211 | 3300048928 | Bacteria | 3888 |
| 663 | Ga0496126_0027808 | 3300048929 | Bacteria | 5395 |
| 664 | Ga0496126_0030336 | 3300048929 | Bacteria | 5124 |
| 665 | Ga0496126_0196151 | 3300048929 | Bacteria | 1707 |
| 666 | Ga0496126_0283942 | 3300048929 | Bacteria | 1370 |
| 667 | Ga0501031_0013431 | 3300049568 | Bacteria | 5340 |
| 668 | Ga0501031_0020234 | 3300049568 | Bacteria | 4338 |
| 669 | Ga0501031_0398278 | 3300049568 | Bacteria | 890 |
| 670 | Ga0501032_0000068 | 3300049569 | Bacteria | 89292 |
| 671 | Ga0501032_0000619 | 3300049569 | Bacteria | 28816 |
| 672 | Ga0501032_0021467 | 3300049569 | Bacteria | 4487 |
| 673 | Ga0501032_0067268 | 3300049569 | Bacteria | 2393 |
| 674 | Ga0501032_0366129 | 3300049569 | Bacteria | 928 |
| 675 | Ga0501033_0000108 | 3300049570 | Bacteria | 79903 |
| 676 | Ga0501033_0000274 | 3300049570 | Bacteria | 49649 |
| 677 | Ga0501033_0000523 | 3300049570 | Bacteria | 35975 |
| 678 | Ga0501033_0007813 | 3300049570 | Bacteria | 8287 |
| 679 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 680 | Ga0501034_0000790 | 3300049571 | Bacteria | 47085 |
| 681 | Ga0501034_0119962 | 3300049571 | Bacteria | 2616 |
| 682 | Ga0501034_0204299 | 3300049571 | Bacteria | 1932 |
| 683 | Ga0501036_0000203 | 3300049572 | Bacteria | 39418 |
| 684 | Ga0501036_0000228 | 3300049572 | Bacteria | 37800 |
| 685 | Ga0501036_0306245 | 3300049572 | Bacteria | 1328 |
| 686 | Ga0501037_0000109 | 3300049573 | Bacteria | 77490 |
| 687 | Ga0501037_0002072 | 3300049573 | Bacteria | 14545 |
| 688 | Ga0501037_0026542 | 3300049573 | Bacteria | 4281 |
| 689 | Ga0501037_0029153 | 3300049573 | Bacteria | 4077 |
| 690 | Ga0501037_0029275 | 3300049573 | Bacteria | 4068 |
| 691 | Ga0501037_0292989 | 3300049573 | Bacteria | 1131 |
| 692 | Ga0501038_0000028 | 3300049574 | Bacteria | 144481 |
| 693 | Ga0501038_0002060 | 3300049574 | Bacteria | 18617 |
| 694 | Ga0501038_0010248 | 3300049574 | Bacteria | 8577 |
| 695 | Ga0501038_0027293 | 3300049574 | Bacteria | 5081 |
| 696 | Ga0501038_0030228 | 3300049574 | Bacteria | 4795 |
| 697 | Ga0501038_0609104 | 3300049574 | Bacteria | 825 |
| 698 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 699 | Ga0501039_0001334 | 3300049575 | Bacteria | 18048 |
| 700 | Ga0501039_0035260 | 3300049575 | Bacteria | 3860 |
| 701 | Ga0501039_0046990 | 3300049575 | Bacteria | 3335 |
| 702 | Ga0501039_0299379 | 3300049575 | Bacteria | 1264 |
| 703 | Ga0501040_0055226 | 3300049576 | Bacteria | 2723 |
| 704 | Ga0501041_0027198 | 3300049577 | Bacteria | 3446 |
| 705 | Ga0501042_0019889 | 3300049578 | Bacteria | 4668 |
| 706 | Ga0501042_0067661 | 3300049578 | Bacteria | 2554 |
| 707 | Ga0501042_0082553 | 3300049578 | Bacteria | 2304 |
| 708 | Ga0501042_0134965 | 3300049578 | Bacteria | 1779 |
| 709 | Ga0501042_0210193 | 3300049578 | Bacteria | 1403 |
| 710 | Ga0501042_1254755 | 3300049578 | Bacteria | 540 |
| 711 | Ga0501043_0000085 | 3300049579 | Bacteria | 83544 |
| 712 | Ga0501043_0000122 | 3300049579 | Bacteria | 71952 |
| 713 | Ga0501043_0005228 | 3300049579 | Bacteria | 10504 |
| 714 | Ga0501043_0034754 | 3300049579 | Bacteria | 3964 |
| 715 | Ga0501043_0321070 | 3300049579 | Bacteria | 1180 |
| 716 | Ga0501046_0000032 | 3300049580 | Bacteria | 180265 |
| 717 | Ga0501046_0000426 | 3300049580 | Bacteria | 42186 |
| 718 | Ga0501046_0048182 | 3300049580 | Bacteria | 3375 |
| 719 | Ga0501047_0000221 | 3300049581 | Bacteria | 68563 |
| 720 | Ga0501047_0000543 | 3300049581 | Bacteria | 40726 |
| 721 | Ga0501047_0131111 | 3300049581 | Bacteria | 2387 |
| 722 | Ga0501047_0136998 | 3300049581 | Bacteria | 2328 |
| 723 | Ga0501047_0425278 | 3300049581 | Bacteria | 1159 |
| 724 | Ga0501048_0000621 | 3300049582 | Bacteria | 25292 |
| 725 | Ga0501048_0010200 | 3300049582 | Bacteria | 7024 |
| 726 | Ga0501048_0117599 | 3300049582 | Bacteria | 1878 |
| 727 | Ga0501048_0348836 | 3300049582 | Bacteria | 1055 |
| 728 | Ga0501048_1075839 | 3300049582 | Bacteria | 578 |
| 729 | Ga0501067_0008392 | 3300049583 | Bacteria | 5734 |
| 730 | Ga0501067_0012822 | 3300049583 | Bacteria | 4642 |
| 731 | Ga0501067_0033173 | 3300049583 | Bacteria | 2865 |
| 732 | Ga0501067_0338194 | 3300049583 | Bacteria | 839 |
| 733 | Ga0501068_0001789 | 3300049584 | Bacteria | 11428 |
| 734 | Ga0501068_0043563 | 3300049584 | Bacteria | 2700 |
| 735 | Ga0501068_0084939 | 3300049584 | Bacteria | 1947 |
| 736 | Ga0501068_0294300 | 3300049584 | Bacteria | 1038 |
| 737 | Ga0501069_0020617 | 3300049585 | Bacteria | 3572 |
| 738 | Ga0501069_0032959 | 3300049585 | Bacteria | 2851 |
| 739 | Ga0501070_0000152 | 3300049586 | Bacteria | 63679 |
| 740 | Ga0501070_0001287 | 3300049586 | Bacteria | 22514 |
| 741 | Ga0501070_0240752 | 3300049586 | Bacteria | 1481 |
| 742 | Ga0501071_0059427 | 3300049587 | Bacteria | 2766 |
| 743 | Ga0501071_0103123 | 3300049587 | Bacteria | 2104 |
| 744 | Ga0501071_0190696 | 3300049587 | Bacteria | 1537 |
| 745 | Ga0501071_1136029 | 3300049587 | Bacteria | 603 |
| 746 | Ga0501072_0012969 | 3300049588 | Bacteria | 6378 |
| 747 | Ga0501072_0094544 | 3300049588 | Bacteria | 2375 |
| 748 | Ga0501073_0000290 | 3300049589 | Bacteria | 33072 |
| 749 | Ga0501073_0053449 | 3300049589 | Bacteria | 2827 |
| 750 | Ga0501073_0089627 | 3300049589 | Bacteria | 2138 |
| 751 | Ga0501073_0207098 | 3300049589 | Bacteria | 1355 |
| 752 | Ga0501074_0000094 | 3300049590 | Bacteria | 42565 |
| 753 | Ga0501074_0011814 | 3300049590 | Bacteria | 6347 |
| 754 | Ga0501074_0030336 | 3300049590 | Bacteria | 3917 |
| 755 | Ga0501074_0490107 | 3300049590 | Bacteria | 871 |
| 756 | Ga0501075_0337392 | 3300049591 | Bacteria | 1149 |
| 757 | Ga0501075_0446227 | 3300049591 | Bacteria | 987 |
| 758 | Ga0501076_0098914 | 3300049592 | Bacteria | 2350 |
| 759 | Ga0501076_0153496 | 3300049592 | Bacteria | 1874 |
| 760 | Ga0501076_0260971 | 3300049592 | Bacteria | 1418 |
| 761 | Ga0501077_0019240 | 3300049593 | Bacteria | 4318 |
| 762 | Ga0501079_0018183 | 3300049741 | Bacteria | 5369 |
| 763 | Ga0501079_0043737 | 3300049741 | Bacteria | 3457 |
| 764 | Ga0501079_0082251 | 3300049741 | Bacteria | 2490 |
| 765 | Ga0501079_0101678 | 3300049741 | Bacteria | 2229 |
| 766 | Ga0501080_0000104 | 3300049742 | Bacteria | 57865 |
| 767 | Ga0501080_0045469 | 3300049742 | Bacteria | 4087 |
| 768 | Ga0501080_0057105 | 3300049742 | Bacteria | 3634 |
| 769 | Ga0501080_0111172 | 3300049742 | Bacteria | 2539 |
| 770 | Ga0501081_0073183 | 3300049743 | Bacteria | 2390 |
| 771 | Ga0501083_0000087 | 3300049744 | Bacteria | 62691 |
| 772 | Ga0501083_0019454 | 3300049744 | Bacteria | 4730 |
| 773 | Ga0501083_0211890 | 3300049744 | Bacteria | 1263 |
| 774 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 775 | Ga0501035_0000223 | 3300049822 | Bacteria | 67732 |
| 776 | Ga0501035_0091957 | 3300049822 | Bacteria | 2669 |
| 777 | Ga0501035_0109979 | 3300049822 | Bacteria | 2415 |
| 778 | Ga0501035_0247338 | 3300049822 | Bacteria | 1515 |
| 779 | Ga0501035_0412736 | 3300049822 | Bacteria | 1122 |
| 780 | Ga0501044_0000657 | 3300049823 | Bacteria | 41841 |
| 781 | Ga0501044_0000970 | 3300049823 | Bacteria | 34530 |
| 782 | Ga0501044_0016829 | 3300049823 | Bacteria | 7845 |
| 783 | Ga0501044_0041827 | 3300049823 | Bacteria | 4770 |
| 784 | Ga0501044_0153070 | 3300049823 | Bacteria | 2287 |
| 785 | Ga0501044_0381989 | 3300049823 | Bacteria | 1323 |
| 786 | Ga0501045_0012225 | 3300049824 | Bacteria | 6046 |
| 787 | Ga0501045_0068761 | 3300049824 | Bacteria | 2602 |
| 788 | Ga0501045_0129276 | 3300049824 | Bacteria | 1877 |
| 789 | nmdc:mga03n38_295254_c1 | 3300050490 | Bacteria | 869 |
| 790 | nmdc:mga0yw44_755199_c1 | 3300050492 | Bacteria | 661 |
| 791 | nmdc:mga06z11_466386_c1 | 3300050494 | Bacteria | 764 |
| 792 | nmdc:mga0n895_132806_c1 | 3300050512 | Bacteria | 2515 |
| 793 | nmdc:mga0rr50_550992_c1 | 3300050513 | Bacteria | 982 |
| 794 | nmdc:mga08x19_647743_c1 | 3300050514 | Bacteria | 749 |
| 795 | nmdc:mga0sz30_97539_c1 | 3300050516 | Bacteria | 1282 |
| 796 | Ga0495601_0000010 | 3300053077 | Bacteria | 266222 |
| 797 | Ga0495601_0018417 | 3300053077 | Bacteria | 4250 |
| 798 | Ga0495601_0061457 | 3300053077 | Bacteria | 2385 |
| 799 | Ga0495601_0093334 | 3300053077 | Bacteria | 1939 |
| 800 | Ga0495601_0136024 | 3300053077 | Bacteria | 1602 |
| 801 | Ga0495601_0144509 | 3300053077 | Bacteria | 1552 |
| 802 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 803 | Ga0495612_0002483 | 3300053078 | Bacteria | 7600 |
| 804 | Ga0495612_0025001 | 3300053078 | Bacteria | 2398 |
| 805 | Ga0495612_0109813 | 3300053078 | Bacteria | 1179 |
| 806 | Ga0500635_0004243 | 3300053080 | Bacteria | 3678 |
| 807 | Ga0500635_0012371 | 3300053080 | Bacteria | 2449 |
| 808 | Ga0495655_0020575 | 3300053083 | Bacteria | 1483 |
| 809 | Ga0495655_0169437 | 3300053083 | Bacteria | 698 |
| 810 | Ga0495595_0000110 | 3300053084 | Bacteria | 37533 |
| 811 | Ga0495595_0001562 | 3300053084 | Bacteria | 8936 |
| 812 | Ga0495595_0002197 | 3300053084 | Bacteria | 7581 |
| 813 | Ga0495595_0122410 | 3300053084 | Bacteria | 1268 |
| 814 | Ga0495595_0426778 | 3300053084 | Bacteria | 673 |
| 815 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 816 | Ga0495619_0028951 | 3300053085 | Bacteria | 3575 |
| 817 | Ga0495619_0143547 | 3300053085 | Bacteria | 1645 |
| 818 | Ga0495619_0167393 | 3300053085 | Bacteria | 1519 |
| 819 | Ga0500647_0156423 | 3300053091 | Bacteria | 1060 |
| 820 | Ga0500566_0000006 | 3300053094 | Bacteria | 153632 |
| 821 | Ga0500566_0006230 | 3300053094 | Bacteria | 7089 |
| 822 | Ga0500566_0153126 | 3300053094 | Bacteria | 1210 |
| 823 | Ga0500566_0306904 | 3300053094 | Bacteria | 744 |
| 824 | Ga0500640_000847 | 3300053095 | Bacteria | 8454 |
| 825 | Ga0500641_0007939 | 3300053096 | Bacteria | 3784 |
| 826 | Ga0500648_052854 | 3300053097 | Bacteria | 2304 |
| 827 | Ga0500648_066618 | 3300053097 | Bacteria | 2039 |
| 828 | Ga0500554_021852 | 3300053102 | Bacteria | 1780 |
| 829 | Ga0500558_192725 | 3300053106 | Bacteria | 717 |
| 830 | Ga0500572_000674 | 3300053111 | Bacteria | 11241 |
| 831 | Ga0500591_106953 | 3300053115 | Bacteria | 1182 |
| 832 | Ga0500595_000152 | 3300053119 | Bacteria | 45452 |
| 833 | Ga0500595_028536 | 3300053119 | Bacteria | 1902 |
| 834 | Ga0500608_078816 | 3300053122 | Bacteria | 1557 |
| 835 | Ga0500608_306052 | 3300053122 | Bacteria | 587 |
| 836 | Ga0500614_182106 | 3300053123 | Bacteria | 643 |
| 837 | Ga0500628_111595 | 3300053129 | Bacteria | 734 |
| 838 | Ga0500559_0002479 | 3300053136 | Bacteria | 9523 |
| 839 | Ga0500559_0012860 | 3300053136 | Bacteria | 3551 |
| 840 | Ga0500559_0036407 | 3300053136 | Bacteria | 2129 |
| 841 | Ga0500559_0272142 | 3300053136 | Bacteria | 797 |
| 842 | Ga0500559_0359400 | 3300053136 | Bacteria | 680 |
| 843 | Ga0500585_129378 | 3300053144 | Bacteria | 895 |
| 844 | Ga0500590_086891 | 3300053148 | Bacteria | 1525 |
| 845 | Ga0500590_087739 | 3300053148 | Bacteria | 1516 |
| 846 | Ga0500603_000582 | 3300053150 | Bacteria | 9153 |
| 847 | Ga0500603_007518 | 3300053150 | Bacteria | 2395 |
| 848 | Ga0500630_000571 | 3300053159 | Bacteria | 16714 |
| 849 | Ga0500638_000086 | 3300053162 | Bacteria | 16892 |
| 850 | Ga0500638_012783 | 3300053162 | Bacteria | 3774 |
| 851 | Ga0500639_000016 | 3300053163 | Bacteria | 118099 |
| 852 | Ga0500639_182966 | 3300053163 | Bacteria | 923 |
| 853 | Ga0500636_0041402 | 3300053177 | Bacteria | 2724 |
| 854 | Ga0500636_0116929 | 3300053177 | Bacteria | 1500 |
| 855 | Ga0500637_0005306 | 3300053178 | Bacteria | 6228 |
| 856 | Ga0500637_0009759 | 3300053178 | Bacteria | 4900 |
| 857 | Ga0500637_0111738 | 3300053178 | Bacteria | 1584 |
| 858 | Ga0500637_0134233 | 3300053178 | Bacteria | 1434 |
| 859 | Ga0500657_197405 | 3300053728 | Bacteria | 673 |
| 860 | Ga0500645_023416 | 3300053730 | Bacteria | 1892 |
| 861 | Ga0500596_005726 | 3300053735 | Bacteria | 2156 |
| 862 | Ga0501084_0008032 | 3300054114 | Bacteria | 8689 |
| 863 | Ga0501084_0445126 | 3300054114 | Bacteria | 1095 |
| 864 | Ga0501084_0943383 | 3300054114 | Bacteria | 725 |
| 865 | Ga0500661_000398 | 3300055283 | Bacteria | 8059 |
| 866 | Ga0501082_0235365 | 3300060353 | Bacteria | 1594 |
| 867 | Ga0466962_0069129 | 3300061719 | Bacteria | 1687 |
| 868 | Ga0530510_0119136 | 3300061734 | Bacteria | 1937 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050513 | nmdc:mga0rr50_550992_c1 | nmdc:mga0rr50_550992_c1_611_967 | 113 |
| 2 | 3300006173 | Ga0070716_100075601 | Ga0070716_1000756013 | 121 |
| 3 | 3300017792 | Ga0163161_10146480 | Ga0163161_101464803 | 121 |
| 4 | 3300025939 | Ga0207665_10139383 | Ga0207665_101393832 | 121 |
| 5 | 3300046455 | Ga0495603_0101732 | Ga0495603_0101732_868_1341 | 121 |
| 6 | 3300046513 | Ga0495616_0295645 | Ga0495616_0295645_66_539 | 121 |
| 7 | 3300048904 | Ga0496101_0111706 | Ga0496101_0111706_156_629 | 121 |
| 8 | 3300035119 | Ga0373956_0528114 | Ga0373956_0528114_70_543 | 123 |
| 9 | 3300036401 | Ga0373937_0598382 | Ga0373937_0598382_114_587 | 123 |
| 10 | 3300048903 | Ga0496100_0913220 | Ga0496100_0913220_92_571 | 123 |
| 11 | 3300048904 | Ga0496101_1268995 | Ga0496101_1268995_65_544 | 123 |
| 12 | 3300025907 | Ga0207645_10444414 | Ga0207645_104444142 | 128 |
| 13 | 3300046461 | Ga0495641_0044832 | Ga0495641_0044832_870_1334 | 128 |
| 14 | 3300046472 | Ga0495580_0085589 | Ga0495580_0085589_1629_2093 | 128 |
| 15 | 3300005336 | Ga0070680_100310978 | Ga0070680_1003109782 | 129 |
| 16 | 3300005458 | Ga0070681_10158175 | Ga0070681_101581753 | 129 |
| 17 | 3300025912 | Ga0207707_10098146 | Ga0207707_100981462 | 129 |
| 18 | 3300025917 | Ga0207660_10699397 | Ga0207660_106993972 | 129 |
| 19 | 3300025944 | Ga0207661_11025876 | Ga0207661_110258761 | 129 |
| 20 | 3300039437 | Ga0436365_0926888 | Ga0436365_0926888_946_1410 | 129 |
| 21 | 3300039450 | Ga0436363_0538725 | Ga0436363_0538725_127_591 | 129 |
| 22 | 3300041494 | Ga0451837_0149782 | Ga0451837_0149782_73_543 | 129 |
| 23 | 3300009545 | Ga0105237_11625872 | Ga0105237_116258722 | 130 |
| 24 | 3300031730 | Ga0307516_10161420 | Ga0307516_101614202 | 130 |
| 25 | 3300039453 | Ga0436362_0818857 | Ga0436362_0818857_72_509 | 130 |
| 26 | 3300046477 | Ga0495664_0245197 | Ga0495664_0245197_121_594 | 130 |
| 27 | 3300046543 | Ga0495645_0252854 | Ga0495645_0252854_441_914 | 130 |
| 28 | 3300047319 | Ga0495674_0233939 | Ga0495674_0233939_837_1310 | 130 |
| 29 | 3300053077 | Ga0495601_0144509 | Ga0495601_0144509_440_913 | 130 |
| 30 | 3300053078 | Ga0495612_0025001 | Ga0495612_0025001_1384_1857 | 130 |
| 31 | 3300005327 | Ga0070658_10171288 | Ga0070658_101712883 | 131 |
| 32 | 3300005335 | Ga0070666_10370711 | Ga0070666_103707111 | 131 |
| 33 | 3300005356 | Ga0070674_100521125 | Ga0070674_1005211252 | 131 |
| 34 | 3300005985 | Ga0081539_10122286 | Ga0081539_101222862 | 131 |
| 35 | 3300006038 | Ga0075365_10179834 | Ga0075365_101798342 | 131 |
| 36 | 3300006178 | Ga0075367_10227816 | Ga0075367_102278161 | 131 |
| 37 | 3300006353 | Ga0075370_10513060 | Ga0075370_105130602 | 131 |
| 38 | 3300013308 | Ga0157375_10333275 | Ga0157375_103332751 | 131 |
| 39 | 3300025915 | Ga0207693_10604283 | Ga0207693_106042831 | 131 |
| 40 | 3300025931 | Ga0207644_10186533 | Ga0207644_101865333 | 131 |
| 41 | 3300026121 | Ga0207683_10048423 | Ga0207683_100484233 | 131 |
| 42 | 3300050490 | nmdc:mga03n38_295254_c1 | nmdc:mga03n38_295254_c1_375_845 | 131 |
| 43 | 3300050516 | nmdc:mga0sz30_97539_c1 | nmdc:mga0sz30_97539_c1_756_1226 | 131 |
| 44 | 3300003659 | JGI25404J52841_10003688 | JGI25404J52841_100036882 | 132 |
| 45 | 3300005367 | Ga0070667_101844773 | Ga0070667_1018447731 | 132 |
| 46 | 3300005548 | Ga0070665_100401630 | Ga0070665_1004016302 | 132 |
| 47 | 3300005841 | Ga0068863_100050091 | Ga0068863_1000500914 | 132 |
| 48 | 3300005983 | Ga0081540_1001395 | Ga0081540_100139513 | 132 |
| 49 | 3300009545 | Ga0105237_10118949 | Ga0105237_101189492 | 132 |
| 50 | 3300025914 | Ga0207671_10116267 | Ga0207671_101162672 | 132 |
| 51 | 3300026088 | Ga0207641_10039952 | Ga0207641_100399523 | 132 |
| 52 | 3300028379 | Ga0268266_10629846 | Ga0268266_106298461 | 132 |
| 53 | 3300031730 | Ga0307516_10409092 | Ga0307516_104090922 | 132 |
| 54 | 3300053097 | Ga0500648_052854 | Ga0500648_052854_1157_1630 | 132 |
| 55 | 3300053136 | Ga0500559_0012860 | Ga0500559_0012860_28_501 | 132 |
| 56 | 3300053177 | Ga0500636_0041402 | Ga0500636_0041402_1462_1935 | 132 |
| 57 | 3300001979 | JGI24740J21852_10159770 | JGI24740J21852_101597701 | 133 |
| 58 | 3300005334 | Ga0068869_100094348 | Ga0068869_1000943483 | 133 |
| 59 | 3300005337 | Ga0070682_100307357 | Ga0070682_1003073572 | 133 |
| 60 | 3300005338 | Ga0068868_100173474 | Ga0068868_1001734743 | 133 |
| 61 | 3300005455 | Ga0070663_100034607 | Ga0070663_1000346073 | 133 |
| 62 | 3300005457 | Ga0070662_100744628 | Ga0070662_1007446281 | 133 |
| 63 | 3300005535 | Ga0070684_100124186 | Ga0070684_1001241862 | 133 |
| 64 | 3300005618 | Ga0068864_100049091 | Ga0068864_1000490913 | 133 |
| 65 | 3300005842 | Ga0068858_100585417 | Ga0068858_1005854172 | 133 |
| 66 | 3300006028 | Ga0070717_11718690 | Ga0070717_117186901 | 133 |
| 67 | 3300006038 | Ga0075365_10174618 | Ga0075365_101746182 | 133 |
| 68 | 3300006175 | Ga0070712_100062890 | Ga0070712_1000628902 | 133 |
| 69 | 3300006178 | Ga0075367_10155277 | Ga0075367_101552772 | 133 |
| 70 | 3300006358 | Ga0068871_100020724 | Ga0068871_1000207244 | 133 |
| 71 | 3300009098 | Ga0105245_10010375 | Ga0105245_100103756 | 133 |
| 72 | 3300009101 | Ga0105247_10445282 | Ga0105247_104452822 | 133 |
| 73 | 3300009176 | Ga0105242_10133265 | Ga0105242_101332653 | 133 |
| 74 | 3300009551 | Ga0105238_12384899 | Ga0105238_123848991 | 133 |
| 75 | 3300010375 | Ga0105239_10063610 | Ga0105239_100636102 | 133 |
| 76 | 3300011119 | Ga0105246_10004587 | Ga0105246_100045873 | 133 |
| 77 | 3300013296 | Ga0157374_10007971 | Ga0157374_100079713 | 133 |
| 78 | 3300013306 | Ga0163162_10031396 | Ga0163162_100313963 | 133 |
| 79 | 3300014325 | Ga0163163_10067632 | Ga0163163_100676322 | 133 |
| 80 | 3300014969 | Ga0157376_10021927 | Ga0157376_100219273 | 133 |
| 81 | 3300017792 | Ga0163161_11102398 | Ga0163161_111023982 | 133 |
| 82 | 3300025315 | Ga0207697_10097187 | Ga0207697_100971872 | 133 |
| 83 | 3300025915 | Ga0207693_10029129 | Ga0207693_100291292 | 133 |
| 84 | 3300025927 | Ga0207687_10091887 | Ga0207687_100918873 | 133 |
| 85 | 3300025928 | Ga0207700_10542432 | Ga0207700_105424322 | 133 |
| 86 | 3300025942 | Ga0207689_10118168 | Ga0207689_101181683 | 133 |
| 87 | 3300025945 | Ga0207679_10089987 | Ga0207679_100899873 | 133 |
| 88 | 3300025960 | Ga0207651_10167591 | Ga0207651_101675913 | 133 |
| 89 | 3300026023 | Ga0207677_10105095 | Ga0207677_101050952 | 133 |
| 90 | 3300026067 | Ga0207678_10085203 | Ga0207678_100852032 | 133 |
| 91 | 3300026095 | Ga0207676_10195304 | Ga0207676_101953043 | 133 |
| 92 | 3300028379 | Ga0268266_10026648 | Ga0268266_100266483 | 133 |
| 93 | 3300037068 | Ga0373925_1224651 | Ga0373925_1224651_87_554 | 133 |
| 94 | 3300048903 | Ga0496100_0005558 | Ga0496100_0005558_4167_4634 | 133 |
| 95 | 3300048904 | Ga0496101_0006237 | Ga0496101_0006237_1859_2326 | 133 |
| 96 | 3300048905 | Ga0496102_0002444 | Ga0496102_0002444_1955_2422 | 133 |
| 97 | 3300048906 | Ga0496103_0077882 | Ga0496103_0077882_363_830 | 133 |
| 98 | 3300048907 | Ga0496104_0004215 | Ga0496104_0004215_3944_4411 | 133 |
| 99 | 3300048908 | Ga0496105_0008253 | Ga0496105_0008253_2710_3177 | 133 |
| 100 | 3300048910 | Ga0496107_0006772 | Ga0496107_0006772_7104_7571 | 133 |
| 101 | 3300048911 | Ga0496108_0008972 | Ga0496108_0008972_3660_4127 | 133 |
| 102 | 3300048912 | Ga0496109_0031689 | Ga0496109_0031689_1247_1714 | 133 |
| 103 | 3300048913 | Ga0496110_0006362 | Ga0496110_0006362_1218_1685 | 133 |
| 104 | 3300048914 | Ga0496111_0039295 | Ga0496111_0039295_910_1377 | 133 |
| 105 | 3300048915 | Ga0496112_0009417 | Ga0496112_0009417_4072_4539 | 133 |
| 106 | 3300048917 | Ga0496114_0015589 | Ga0496114_0015589_1516_1983 | 133 |
| 107 | 3300048918 | Ga0496115_0004586 | Ga0496115_0004586_3306_3773 | 133 |
| 108 | 3300005329 | Ga0070683_101072321 | Ga0070683_1010723211 | 134 |
| 109 | 3300005330 | Ga0070690_100123939 | Ga0070690_1001239391 | 134 |
| 110 | 3300005334 | Ga0068869_100962100 | Ga0068869_1009621002 | 134 |
| 111 | 3300005340 | Ga0070689_100531686 | Ga0070689_1005316862 | 134 |
| 112 | 3300005343 | Ga0070687_100236636 | Ga0070687_1002366362 | 134 |
| 113 | 3300005345 | Ga0070692_10141081 | Ga0070692_101410812 | 134 |
| 114 | 3300005355 | Ga0070671_100058408 | Ga0070671_1000584083 | 134 |
| 115 | 3300005356 | Ga0070674_100053701 | Ga0070674_1000537011 | 134 |
| 116 | 3300005365 | Ga0070688_100005941 | Ga0070688_1000059415 | 134 |
| 117 | 3300005441 | Ga0070700_100213896 | Ga0070700_1002138962 | 134 |
| 118 | 3300005441 | Ga0070700_100549624 | Ga0070700_1005496241 | 134 |
| 119 | 3300005456 | Ga0070678_100098322 | Ga0070678_1000983222 | 134 |
| 120 | 3300005457 | Ga0070662_100274675 | Ga0070662_1002746752 | 134 |
| 121 | 3300005466 | Ga0070685_10098612 | Ga0070685_100986122 | 134 |
| 122 | 3300005543 | Ga0070672_100142688 | Ga0070672_1001426882 | 134 |
| 123 | 3300005544 | Ga0070686_100069621 | Ga0070686_1000696212 | 134 |
| 124 | 3300005564 | Ga0070664_101431136 | Ga0070664_1014311362 | 134 |
| 125 | 3300005616 | Ga0068852_101942547 | Ga0068852_1019425472 | 134 |
| 126 | 3300005842 | Ga0068858_100607961 | Ga0068858_1006079612 | 134 |
| 127 | 3300006173 | Ga0070716_100250221 | Ga0070716_1002502211 | 134 |
| 128 | 3300006237 | Ga0097621_100901153 | Ga0097621_1009011532 | 134 |
| 129 | 3300006358 | Ga0068871_100042693 | Ga0068871_1000426933 | 134 |
| 130 | 3300006871 | Ga0075434_100090377 | Ga0075434_1000903771 | 134 |
| 131 | 3300009553 | Ga0105249_10669938 | Ga0105249_106699382 | 134 |
| 132 | 3300010159 | Ga0099796_10204827 | Ga0099796_102048272 | 134 |
| 133 | 3300013297 | Ga0157378_11705483 | Ga0157378_117054832 | 134 |
| 134 | 3300014325 | Ga0163163_10263359 | Ga0163163_102633592 | 134 |
| 135 | 3300025908 | Ga0207643_10078551 | Ga0207643_100785512 | 134 |
| 136 | 3300025918 | Ga0207662_10223347 | Ga0207662_102233472 | 134 |
| 137 | 3300025926 | Ga0207659_10352321 | Ga0207659_103523212 | 134 |
| 138 | 3300025931 | Ga0207644_10018588 | Ga0207644_100185884 | 134 |
| 139 | 3300025936 | Ga0207670_10008541 | Ga0207670_100085413 | 134 |
| 140 | 3300025939 | Ga0207665_10155006 | Ga0207665_101550062 | 134 |
| 141 | 3300025944 | Ga0207661_10960747 | Ga0207661_109607472 | 134 |
| 142 | 3300025960 | Ga0207651_10122348 | Ga0207651_101223481 | 134 |
| 143 | 3300025961 | Ga0207712_11022993 | Ga0207712_110229932 | 134 |
| 144 | 3300026075 | Ga0207708_10615165 | Ga0207708_106151652 | 134 |
| 145 | 3300026075 | Ga0207708_10857560 | Ga0207708_108575601 | 134 |
| 146 | 3300028381 | Ga0268264_10178480 | Ga0268264_101784802 | 134 |
| 147 | 3300031995 | Ga0307409_101303873 | Ga0307409_1013038731 | 134 |
| 148 | 3300035241 | Ga0373961_0094618 | Ga0373961_0094618_123_548 | 134 |
| 149 | 3300035691 | Ga0373931_0083407 | Ga0373931_0083407_81_506 | 134 |
| 150 | 3300039438 | Ga0436360_0670966 | Ga0436360_0670966_411_857 | 134 |
| 151 | 3300048903 | Ga0496100_1659527 | Ga0496100_1659527_16_462 | 134 |
| 152 | 3300050512 | nmdc:mga0n895_132806_c1 | nmdc:mga0n895_132806_c1_127_573 | 134 |
| 153 | 3300053084 | Ga0495595_0426778 | Ga0495595_0426778_175_600 | 134 |
| 154 | 3300005338 | Ga0068868_100307046 | Ga0068868_1003070462 | 135 |
| 155 | 3300005354 | Ga0070675_100621497 | Ga0070675_1006214972 | 135 |
| 156 | 3300005364 | Ga0070673_100722654 | Ga0070673_1007226542 | 135 |
| 157 | 3300013297 | Ga0157378_10826258 | Ga0157378_108262581 | 135 |
| 158 | 3300025908 | Ga0207643_10393508 | Ga0207643_103935081 | 135 |
| 159 | 3300025926 | Ga0207659_10550473 | Ga0207659_105504732 | 135 |
| 160 | 3300025960 | Ga0207651_10881743 | Ga0207651_108817432 | 135 |
| 161 | 3300039450 | Ga0436363_0529468 | Ga0436363_0529468_234_680 | 135 |
| 162 | 3300046511 | Ga0495608_0541959 | Ga0495608_0541959_33_509 | 135 |
| 163 | 3300053730 | Ga0500645_023416 | Ga0500645_023416_363_836 | 135 |
| 164 | 3300005843 | Ga0068860_100000435 | Ga0068860_10000043550 | 137 |
| 165 | 3300005843 | Ga0068860_100831490 | Ga0068860_1008314902 | 137 |
| 166 | 3300005844 | Ga0068862_100908500 | Ga0068862_1009085001 | 137 |
| 167 | 3300006237 | Ga0097621_100242238 | Ga0097621_1002422382 | 137 |
| 168 | 3300011119 | Ga0105246_10286227 | Ga0105246_102862272 | 137 |
| 169 | 3300028381 | Ga0268264_10000093 | Ga0268264_10000093205 | 137 |
| 170 | 3300028381 | Ga0268264_10738702 | Ga0268264_107387022 | 137 |
| 171 | 3300031507 | Ga0307509_10250115 | Ga0307509_102501152 | 137 |
| 172 | 3300031911 | Ga0307412_10822095 | Ga0307412_108220952 | 137 |
| 173 | 3300046533 | Ga0495640_0013662 | Ga0495640_0013662_641_1123 | 137 |
| 174 | 3300005985 | Ga0081539_10004350 | Ga0081539_1000435010 | 138 |
| 175 | 3300006847 | Ga0075431_101180052 | Ga0075431_1011800521 | 138 |
| 176 | 3300045976 | Ga0466967_0433695 | Ga0466967_0433695_183_623 | 138 |
| 177 | 3300005331 | Ga0070670_100762239 | Ga0070670_1007622392 | 139 |
| 178 | 3300006175 | Ga0070712_101102789 | Ga0070712_1011027892 | 139 |
| 179 | 3300009148 | Ga0105243_12815858 | Ga0105243_128158581 | 139 |
| 180 | 3300039437 | Ga0436365_0800516 | Ga0436365_0800516_133_558 | 139 |
| 181 | 3300046809 | Ga0495600_0587577 | Ga0495600_0587577_142_612 | 139 |
| 182 | 3300053077 | Ga0495601_0061457 | Ga0495601_0061457_1453_1923 | 139 |
| 183 | 3300053122 | Ga0500608_306052 | Ga0500608_306052_89_559 | 139 |
| 184 | 3300005347 | Ga0070668_100720672 | Ga0070668_1007206722 | 140 |
| 185 | 3300005937 | Ga0081455_10013247 | Ga0081455_100132474 | 140 |
| 186 | 3300009093 | Ga0105240_10126409 | Ga0105240_101264092 | 140 |
| 187 | 3300025913 | Ga0207695_10471501 | Ga0207695_104715012 | 140 |
| 188 | 3300025972 | Ga0207668_11122512 | Ga0207668_111225122 | 140 |
| 189 | 3300048903 | Ga0496100_0079263 | Ga0496100_0079263_1002_1472 | 140 |
| 190 | 3300048904 | Ga0496101_0183028 | Ga0496101_0183028_911_1381 | 140 |
| 191 | 3300048907 | Ga0496104_0135359 | Ga0496104_0135359_995_1465 | 140 |
| 192 | 3300048909 | Ga0496106_0045251 | Ga0496106_0045251_1072_1542 | 140 |
| 193 | 3300048910 | Ga0496107_0063699 | Ga0496107_0063699_826_1296 | 140 |
| 194 | 3300048911 | Ga0496108_0286731 | Ga0496108_0286731_845_1315 | 140 |
| 195 | 3300048917 | Ga0496114_0097491 | Ga0496114_0097491_833_1303 | 140 |
| 196 | 3300049568 | Ga0501031_0020234 | Ga0501031_0020234_363_833 | 140 |
| 197 | 3300049569 | Ga0501032_0021467 | Ga0501032_0021467_3483_3953 | 140 |
| 198 | 3300049570 | Ga0501033_0000523 | Ga0501033_0000523_35143_35613 | 140 |
| 199 | 3300049571 | Ga0501034_0204299 | Ga0501034_0204299_1151_1621 | 140 |
| 200 | 3300049572 | Ga0501036_0306245 | Ga0501036_0306245_548_1018 | 140 |
| 201 | 3300049573 | Ga0501037_0029153 | Ga0501037_0029153_2742_3212 | 140 |
| 202 | 3300049573 | Ga0501037_0029275 | Ga0501037_0029275_1150_1620 | 140 |
| 203 | 3300049574 | Ga0501038_0609104 | Ga0501038_0609104_18_488 | 140 |
| 204 | 3300049575 | Ga0501039_0035260 | Ga0501039_0035260_2250_2720 | 140 |
| 205 | 3300049577 | Ga0501041_0027198 | Ga0501041_0027198_2164_2634 | 140 |
| 206 | 3300049578 | Ga0501042_0210193 | Ga0501042_0210193_129_599 | 140 |
| 207 | 3300049578 | Ga0501042_1254755 | Ga0501042_1254755_24_494 | 140 |
| 208 | 3300049579 | Ga0501043_0005228 | Ga0501043_0005228_5614_6084 | 140 |
| 209 | 3300049580 | Ga0501046_0048182 | Ga0501046_0048182_1744_2214 | 140 |
| 210 | 3300049581 | Ga0501047_0136998 | Ga0501047_0136998_992_1462 | 140 |
| 211 | 3300049582 | Ga0501048_0117599 | Ga0501048_0117599_668_1138 | 140 |
| 212 | 3300049583 | Ga0501067_0338194 | Ga0501067_0338194_164_634 | 140 |
| 213 | 3300049584 | Ga0501068_0043563 | Ga0501068_0043563_1086_1556 | 140 |
| 214 | 3300049586 | Ga0501070_0240752 | Ga0501070_0240752_470_940 | 140 |
| 215 | 3300049587 | Ga0501071_0103123 | Ga0501071_0103123_1174_1644 | 140 |
| 216 | 3300049589 | Ga0501073_0053449 | Ga0501073_0053449_1358_1828 | 140 |
| 217 | 3300049590 | Ga0501074_0490107 | Ga0501074_0490107_115_585 | 140 |
| 218 | 3300049591 | Ga0501075_0337392 | Ga0501075_0337392_343_813 | 140 |
| 219 | 3300049592 | Ga0501076_0153496 | Ga0501076_0153496_834_1304 | 140 |
| 220 | 3300049593 | Ga0501077_0019240 | Ga0501077_0019240_1449_1919 | 140 |
| 221 | 3300049741 | Ga0501079_0101678 | Ga0501079_0101678_818_1288 | 140 |
| 222 | 3300049742 | Ga0501080_0045469 | Ga0501080_0045469_1391_1861 | 140 |
| 223 | 3300049743 | Ga0501081_0073183 | Ga0501081_0073183_1380_1850 | 140 |
| 224 | 3300049744 | Ga0501083_0211890 | Ga0501083_0211890_399_869 | 140 |
| 225 | 3300049822 | Ga0501035_0109979 | Ga0501035_0109979_805_1275 | 140 |
| 226 | 3300049822 | Ga0501035_0247338 | Ga0501035_0247338_681_1151 | 140 |
| 227 | 3300049823 | Ga0501044_0016829 | Ga0501044_0016829_2830_3300 | 140 |
| 228 | 3300049823 | Ga0501044_0381989 | Ga0501044_0381989_343_813 | 140 |
| 229 | 3300053077 | Ga0495601_0093334 | Ga0495601_0093334_876_1349 | 140 |
| 230 | 3300053097 | Ga0500648_066618 | Ga0500648_066618_670_1143 | 140 |
| 231 | 3300053106 | Ga0500558_192725 | Ga0500558_192725_11_484 | 140 |
| 232 | 3300053136 | Ga0500559_0359400 | Ga0500559_0359400_152_625 | 140 |
| 233 | 3300053735 | Ga0500596_005726 | Ga0500596_005726_1557_2030 | 140 |
| 234 | 3300005444 | Ga0070694_101376505 | Ga0070694_1013765051 | 141 |
| 235 | 3300025929 | Ga0207664_10909507 | Ga0207664_109095072 | 141 |
| 236 | 3300035119 | Ga0373956_0047415 | Ga0373956_0047415_885_1352 | 141 |
| 237 | 3300035692 | Ga0373935_0068458 | Ga0373935_0068458_687_1154 | 141 |
| 238 | 3300035695 | Ga0373927_0052978 | Ga0373927_0052978_1133_1600 | 141 |
| 239 | 3300035724 | Ga0373933_0004722 | Ga0373933_0004722_2410_2877 | 141 |
| 240 | 3300046454 | Ga0495592_0006852 | Ga0495592_0006852_1367_1834 | 141 |
| 241 | 3300046511 | Ga0495608_0002194 | Ga0495608_0002194_588_1055 | 141 |
| 242 | 3300046529 | Ga0495652_0001117 | Ga0495652_0001117_13951_14418 | 141 |
| 243 | 3300046543 | Ga0495645_0022506 | Ga0495645_0022506_83_550 | 141 |
| 244 | 3300046559 | Ga0495667_0001890 | Ga0495667_0001890_942_1409 | 141 |
| 245 | 3300046675 | Ga0495657_0014186 | Ga0495657_0014186_775_1242 | 141 |
| 246 | 3300046678 | Ga0495599_0004705 | Ga0495599_0004705_4590_5057 | 141 |
| 247 | 3300047322 | Ga0495680_0002310 | Ga0495680_0002310_3159_3626 | 141 |
| 248 | 3300048088 | Ga0495602_0001747 | Ga0495602_0001747_14483_14950 | 141 |
| 249 | 3300048905 | Ga0496102_0130392 | Ga0496102_0130392_1275_1739 | 141 |
| 250 | 3300048907 | Ga0496104_0666798 | Ga0496104_0666798_179_643 | 141 |
| 251 | 3300048910 | Ga0496107_0493880 | Ga0496107_0493880_317_781 | 141 |
| 252 | 3300048915 | Ga0496112_0382543 | Ga0496112_0382543_228_692 | 141 |
| 253 | 3300048917 | Ga0496114_0693953 | Ga0496114_0693953_324_788 | 141 |
| 254 | 3300049568 | Ga0501031_0398278 | Ga0501031_0398278_303_779 | 141 |
| 255 | 3300049569 | Ga0501032_0000068 | Ga0501032_0000068_87963_88439 | 141 |
| 256 | 3300049569 | Ga0501032_0067268 | Ga0501032_0067268_1741_2217 | 141 |
| 257 | 3300049570 | Ga0501033_0000274 | Ga0501033_0000274_2478_2954 | 141 |
| 258 | 3300049570 | Ga0501033_0007813 | Ga0501033_0007813_2382_2858 | 141 |
| 259 | 3300049571 | Ga0501034_0000790 | Ga0501034_0000790_46252_46728 | 141 |
| 260 | 3300049571 | Ga0501034_0119962 | Ga0501034_0119962_1358_1834 | 141 |
| 261 | 3300049572 | Ga0501036_0000203 | Ga0501036_0000203_1078_1554 | 141 |
| 262 | 3300049573 | Ga0501037_0000109 | Ga0501037_0000109_2333_2809 | 141 |
| 263 | 3300049573 | Ga0501037_0026542 | Ga0501037_0026542_684_1160 | 141 |
| 264 | 3300049573 | Ga0501037_0292989 | Ga0501037_0292989_459_935 | 141 |
| 265 | 3300049574 | Ga0501038_0000028 | Ga0501038_0000028_138102_138578 | 141 |
| 266 | 3300049574 | Ga0501038_0002060 | Ga0501038_0002060_8019_8495 | 141 |
| 267 | 3300049574 | Ga0501038_0027293 | Ga0501038_0027293_564_1040 | 141 |
| 268 | 3300049574 | Ga0501038_0030228 | Ga0501038_0030228_969_1445 | 141 |
| 269 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_289815_290291 | 141 |
| 270 | 3300049575 | Ga0501039_0046990 | Ga0501039_0046990_1891_2367 | 141 |
| 271 | 3300049575 | Ga0501039_0299379 | Ga0501039_0299379_733_1209 | 141 |
| 272 | 3300049576 | Ga0501040_0055226 | Ga0501040_0055226_1822_2298 | 141 |
| 273 | 3300049578 | Ga0501042_0019889 | Ga0501042_0019889_684_1160 | 141 |
| 274 | 3300049578 | Ga0501042_0082553 | Ga0501042_0082553_979_1455 | 141 |
| 275 | 3300049579 | Ga0501043_0000122 | Ga0501043_0000122_8348_8824 | 141 |
| 276 | 3300049579 | Ga0501043_0034754 | Ga0501043_0034754_2952_3428 | 141 |
| 277 | 3300049579 | Ga0501043_0321070 | Ga0501043_0321070_131_613 | 141 |
| 278 | 3300049580 | Ga0501046_0000032 | Ga0501046_0000032_4733_5209 | 141 |
| 279 | 3300049581 | Ga0501047_0000543 | Ga0501047_0000543_2509_2985 | 141 |
| 280 | 3300049581 | Ga0501047_0131111 | Ga0501047_0131111_282_758 | 141 |
| 281 | 3300049581 | Ga0501047_0425278 | Ga0501047_0425278_91_567 | 141 |
| 282 | 3300049582 | Ga0501048_0010200 | Ga0501048_0010200_425_901 | 141 |
| 283 | 3300049582 | Ga0501048_0348836 | Ga0501048_0348836_154_630 | 141 |
| 284 | 3300049583 | Ga0501067_0012822 | Ga0501067_0012822_4118_4594 | 141 |
| 285 | 3300049583 | Ga0501067_0033173 | Ga0501067_0033173_561_1037 | 141 |
| 286 | 3300049584 | Ga0501068_0084939 | Ga0501068_0084939_766_1242 | 141 |
| 287 | 3300049584 | Ga0501068_0294300 | Ga0501068_0294300_34_510 | 141 |
| 288 | 3300049585 | Ga0501069_0020617 | Ga0501069_0020617_2551_3027 | 141 |
| 289 | 3300049586 | Ga0501070_0000152 | Ga0501070_0000152_1421_1897 | 141 |
| 290 | 3300049587 | Ga0501071_0190696 | Ga0501071_0190696_996_1472 | 141 |
| 291 | 3300049587 | Ga0501071_1136029 | Ga0501071_1136029_83_559 | 141 |
| 292 | 3300049588 | Ga0501072_0094544 | Ga0501072_0094544_1316_1792 | 141 |
| 293 | 3300049589 | Ga0501073_0089627 | Ga0501073_0089627_467_943 | 141 |
| 294 | 3300049589 | Ga0501073_0207098 | Ga0501073_0207098_684_1160 | 141 |
| 295 | 3300049590 | Ga0501074_0011814 | Ga0501074_0011814_2437_2913 | 141 |
| 296 | 3300049590 | Ga0501074_0030336 | Ga0501074_0030336_596_1072 | 141 |
| 297 | 3300049741 | Ga0501079_0043737 | Ga0501079_0043737_2780_3256 | 141 |
| 298 | 3300049741 | Ga0501079_0082251 | Ga0501079_0082251_761_1237 | 141 |
| 299 | 3300049742 | Ga0501080_0000104 | Ga0501080_0000104_10087_10563 | 141 |
| 300 | 3300049742 | Ga0501080_0111172 | Ga0501080_0111172_1868_2344 | 141 |
| 301 | 3300049744 | Ga0501083_0019454 | Ga0501083_0019454_2432_2908 | 141 |
| 302 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_231798_232274 | 141 |
| 303 | 3300049822 | Ga0501035_0091957 | Ga0501035_0091957_684_1160 | 141 |
| 304 | 3300049823 | Ga0501044_0000657 | Ga0501044_0000657_5422_5898 | 141 |
| 305 | 3300049823 | Ga0501044_0041827 | Ga0501044_0041827_3528_4004 | 141 |
| 306 | 3300049823 | Ga0501044_0153070 | Ga0501044_0153070_1763_2239 | 141 |
| 307 | 3300049824 | Ga0501045_0012225 | Ga0501045_0012225_3658_4134 | 141 |
| 308 | 3300049824 | Ga0501045_0129276 | Ga0501045_0129276_467_943 | 141 |
| 309 | 3300053078 | Ga0495612_0002483 | Ga0495612_0002483_5892_6359 | 141 |
| 310 | 3300053084 | Ga0495595_0001562 | Ga0495595_0001562_7136_7603 | 141 |
| 311 | 3300054114 | Ga0501084_0445126 | Ga0501084_0445126_495_971 | 141 |
| 312 | 3300054114 | Ga0501084_0943383 | Ga0501084_0943383_176_652 | 141 |
| 313 | 3300061734 | Ga0530510_0119136 | Ga0530510_0119136_1149_1625 | 141 |
| 314 | 3300003659 | JGI25404J52841_10000065 | JGI25404J52841_100000653 | 142 |
| 315 | 3300005937 | Ga0081455_10035346 | Ga0081455_100353463 | 142 |
| 316 | 3300005983 | Ga0081540_1001807 | Ga0081540_100180710 | 142 |
| 317 | 3300006852 | Ga0075433_10656056 | Ga0075433_106560562 | 142 |
| 318 | 3300009093 | Ga0105240_10532978 | Ga0105240_105329781 | 142 |
| 319 | 3300005434 | Ga0070709_11428067 | Ga0070709_114280671 | 143 |
| 320 | 3300006178 | Ga0075367_10051329 | Ga0075367_100513293 | 143 |
| 321 | 3300046680 | Ga0495646_0166781 | Ga0495646_0166781_113_550 | 143 |
| 322 | 3300050494 | nmdc:mga06z11_466386_c1 | nmdc:mga06z11_466386_c1_228_716 | 143 |
| 323 | 3300005436 | Ga0070713_100050453 | Ga0070713_1000504533 | 144 |
| 324 | 3300005439 | Ga0070711_100797184 | Ga0070711_1007971841 | 144 |
| 325 | 3300006028 | Ga0070717_10767129 | Ga0070717_107671292 | 144 |
| 326 | 3300025915 | Ga0207693_10102044 | Ga0207693_101020443 | 144 |
| 327 | 3300025916 | Ga0207663_10227370 | Ga0207663_102273702 | 144 |
| 328 | 3300025928 | Ga0207700_10340756 | Ga0207700_103407562 | 144 |
| 329 | 3300025939 | Ga0207665_10127819 | Ga0207665_101278192 | 144 |
| 330 | 3300026088 | Ga0207641_11428799 | Ga0207641_114287992 | 144 |
| 331 | 3300035083 | Ga0373926_0024022 | Ga0373926_0024022_1510_1947 | 144 |
| 332 | 3300035086 | Ga0373934_0031073 | Ga0373934_0031073_539_976 | 144 |
| 333 | 3300035089 | Ga0373944_0033628 | Ga0373944_0033628_200_637 | 144 |
| 334 | 3300035111 | Ga0373923_0014524 | Ga0373923_0014524_1174_1611 | 144 |
| 335 | 3300035113 | Ga0373936_0001544 | Ga0373936_0001544_2872_3309 | 144 |
| 336 | 3300035116 | Ga0373945_0002222 | Ga0373945_0002222_1664_2101 | 144 |
| 337 | 3300035117 | Ga0373953_0004109 | Ga0373953_0004109_2822_3259 | 144 |
| 338 | 3300035118 | Ga0373954_0003114 | Ga0373954_0003114_2504_2941 | 144 |
| 339 | 3300035119 | Ga0373956_0028583 | Ga0373956_0028583_929_1366 | 144 |
| 340 | 3300035120 | Ga0373957_0018766 | Ga0373957_0018766_187_624 | 144 |
| 341 | 3300035170 | Ga0373943_0022807 | Ga0373943_0022807_348_785 | 144 |
| 342 | 3300035171 | Ga0373946_0001948 | Ga0373946_0001948_2060_2497 | 144 |
| 343 | 3300035172 | Ga0373955_0000039 | Ga0373955_0000039_15859_16296 | 144 |
| 344 | 3300035410 | Ga0373924_0004875 | Ga0373924_0004875_596_1033 | 144 |
| 345 | 3300035692 | Ga0373935_0000079 | Ga0373935_0000079_34635_35072 | 144 |
| 346 | 3300035695 | Ga0373927_0017668 | Ga0373927_0017668_2527_2964 | 144 |
| 347 | 3300035724 | Ga0373933_0010172 | Ga0373933_0010172_3447_3884 | 144 |
| 348 | 3300035725 | Ga0373947_0003920 | Ga0373947_0003920_3659_4096 | 144 |
| 349 | 3300036401 | Ga0373937_0000223 | Ga0373937_0000223_9389_9826 | 144 |
| 350 | 3300037068 | Ga0373925_0000002 | Ga0373925_0000002_339800_340237 | 144 |
| 351 | 3300046454 | Ga0495592_0000475 | Ga0495592_0000475_22713_23150 | 144 |
| 352 | 3300046459 | Ga0495629_0007003 | Ga0495629_0007003_6139_6576 | 144 |
| 353 | 3300046461 | Ga0495641_0362520 | Ga0495641_0362520_63_500 | 144 |
| 354 | 3300046462 | Ga0495651_0005638 | Ga0495651_0005638_7686_8123 | 144 |
| 355 | 3300046463 | Ga0495653_0000006 | Ga0495653_0000006_339948_340385 | 144 |
| 356 | 3300046473 | Ga0495582_0121260 | Ga0495582_0121260_667_1104 | 144 |
| 357 | 3300046476 | Ga0495662_0001775 | Ga0495662_0001775_8709_9146 | 144 |
| 358 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_375582_376019 | 144 |
| 359 | 3300046511 | Ga0495608_0000009 | Ga0495608_0000009_104416_104853 | 144 |
| 360 | 3300046514 | Ga0495618_0000005 | Ga0495618_0000005_152941_153378 | 144 |
| 361 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_339967_340404 | 144 |
| 362 | 3300046517 | Ga0495630_0000240 | Ga0495630_0000240_31585_32022 | 144 |
| 363 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_248479_248916 | 144 |
| 364 | 3300046531 | Ga0495665_0130344 | Ga0495665_0130344_292_729 | 144 |
| 365 | 3300046533 | Ga0495640_0000005 | Ga0495640_0000005_104431_104868 | 144 |
| 366 | 3300046535 | Ga0495586_0034576 | Ga0495586_0034576_180_617 | 144 |
| 367 | 3300046536 | Ga0495587_0000007 | Ga0495587_0000007_213374_213811 | 144 |
| 368 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_321218_321655 | 144 |
| 369 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_97319_97756 | 144 |
| 370 | 3300046615 | Ga0495656_0052411 | Ga0495656_0052411_128_598 | 144 |
| 371 | 3300046642 | Ga0495634_0000129 | Ga0495634_0000129_6234_6671 | 144 |
| 372 | 3300046663 | Ga0495635_0000020 | Ga0495635_0000020_149340_149777 | 144 |
| 373 | 3300046675 | Ga0495657_0000240 | Ga0495657_0000240_5177_5614 | 144 |
| 374 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_478645_479082 | 144 |
| 375 | 3300046679 | Ga0495623_0000001 | Ga0495623_0000001_247590_248027 | 144 |
| 376 | 3300046680 | Ga0495646_0000013 | Ga0495646_0000013_98223_98660 | 144 |
| 377 | 3300046683 | Ga0495658_0497733 | Ga0495658_0497733_38_475 | 144 |
| 378 | 3300046689 | Ga0495613_0080447 | Ga0495613_0080447_1693_2130 | 144 |
| 379 | 3300046809 | Ga0495600_0000041 | Ga0495600_0000041_57212_57649 | 144 |
| 380 | 3300047315 | Ga0495581_0044348 | Ga0495581_0044348_544_981 | 144 |
| 381 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_365611_366048 | 144 |
| 382 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_221722_222159 | 144 |
| 383 | 3300047321 | Ga0495676_0202401 | Ga0495676_0202401_395_832 | 144 |
| 384 | 3300047322 | Ga0495680_0000002 | Ga0495680_0000002_143034_143471 | 144 |
| 385 | 3300047444 | Ga0495675_0000383 | Ga0495675_0000383_27747_28184 | 144 |
| 386 | 3300047471 | Ga0495684_0000020 | Ga0495684_0000020_89627_90064 | 144 |
| 387 | 3300047673 | Ga0495593_0004378 | Ga0495593_0004378_1713_2150 | 144 |
| 388 | 3300048088 | Ga0495602_0000027 | Ga0495602_0000027_67527_67964 | 144 |
| 389 | 3300048089 | Ga0495614_0143135 | Ga0495614_0143135_410_847 | 144 |
| 390 | 3300053077 | Ga0495601_0000010 | Ga0495601_0000010_248433_248870 | 144 |
| 391 | 3300053078 | Ga0495612_0000002 | Ga0495612_0000002_251563_252000 | 144 |
| 392 | 3300053084 | Ga0495595_0000110 | Ga0495595_0000110_19872_20309 | 144 |
| 393 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_339970_340407 | 144 |
| 394 | iso_pu_bacteria | 2513237141 | 2513890192 | 144 |
| 395 | 3300025900 | Ga0207710_10250505 | Ga0207710_102505052 | 145 |
| 396 | 3300025941 | Ga0207711_10465755 | Ga0207711_104657552 | 145 |
| 397 | 3300035086 | Ga0373934_0004350 | Ga0373934_0004350_4266_4733 | 145 |
| 398 | 3300035111 | Ga0373923_0196408 | Ga0373923_0196408_73_540 | 145 |
| 399 | 3300035117 | Ga0373953_0000812 | Ga0373953_0000812_7745_8212 | 145 |
| 400 | 3300035118 | Ga0373954_0001004 | Ga0373954_0001004_5063_5530 | 145 |
| 401 | 3300035119 | Ga0373956_0037651 | Ga0373956_0037651_452_919 | 145 |
| 402 | 3300035120 | Ga0373957_0001219 | Ga0373957_0001219_2408_2875 | 145 |
| 403 | 3300035120 | Ga0373957_0281374 | Ga0373957_0281374_71_538 | 145 |
| 404 | 3300035172 | Ga0373955_0010487 | Ga0373955_0010487_2563_3030 | 145 |
| 405 | 3300035410 | Ga0373924_0185259 | Ga0373924_0185259_256_723 | 145 |
| 406 | 3300035724 | Ga0373933_0267619 | Ga0373933_0267619_367_834 | 145 |
| 407 | 3300036401 | Ga0373937_0016193 | Ga0373937_0016193_5535_6002 | 145 |
| 408 | 3300046454 | Ga0495592_0009482 | Ga0495592_0009482_1339_1806 | 145 |
| 409 | 3300046459 | Ga0495629_0001281 | Ga0495629_0001281_16351_16818 | 145 |
| 410 | 3300046462 | Ga0495651_0010558 | Ga0495651_0010558_6020_6487 | 145 |
| 411 | 3300046463 | Ga0495653_0003914 | Ga0495653_0003914_1356_1823 | 145 |
| 412 | 3300046511 | Ga0495608_0002352 | Ga0495608_0002352_1377_1844 | 145 |
| 413 | 3300046514 | Ga0495618_0056355 | Ga0495618_0056355_283_750 | 145 |
| 414 | 3300046516 | Ga0495628_0009404 | Ga0495628_0009404_2308_2775 | 145 |
| 415 | 3300046529 | Ga0495652_0003535 | Ga0495652_0003535_7465_7932 | 145 |
| 416 | 3300046533 | Ga0495640_0008340 | Ga0495640_0008340_7256_7723 | 145 |
| 417 | 3300046559 | Ga0495667_0020775 | Ga0495667_0020775_1339_1806 | 145 |
| 418 | 3300046642 | Ga0495634_0006578 | Ga0495634_0006578_7824_8291 | 145 |
| 419 | 3300046663 | Ga0495635_0018106 | Ga0495635_0018106_1504_1971 | 145 |
| 420 | 3300046675 | Ga0495657_0023164 | Ga0495657_0023164_2756_3223 | 145 |
| 421 | 3300046678 | Ga0495599_0025144 | Ga0495599_0025144_2827_3294 | 145 |
| 422 | 3300046679 | Ga0495623_0052608 | Ga0495623_0052608_639_1106 | 145 |
| 423 | 3300046680 | Ga0495646_0005468 | Ga0495646_0005468_2624_3091 | 145 |
| 424 | 3300046809 | Ga0495600_0034137 | Ga0495600_0034137_339_806 | 145 |
| 425 | 3300047319 | Ga0495674_0050291 | Ga0495674_0050291_3028_3495 | 145 |
| 426 | 3300047322 | Ga0495680_0013256 | Ga0495680_0013256_5796_6263 | 145 |
| 427 | 3300047444 | Ga0495675_0120178 | Ga0495675_0120178_668_1135 | 145 |
| 428 | 3300047471 | Ga0495684_0003601 | Ga0495684_0003601_357_824 | 145 |
| 429 | 3300047673 | Ga0495593_0002191 | Ga0495593_0002191_9756_10223 | 145 |
| 430 | 3300048088 | Ga0495602_0148139 | Ga0495602_0148139_714_1181 | 145 |
| 431 | 3300053084 | Ga0495595_0002197 | Ga0495595_0002197_1201_1668 | 145 |
| 432 | 3300053085 | Ga0495619_0028951 | Ga0495619_0028951_2681_3148 | 145 |
| 433 | iso_pu_bacteria | 2922425934 | 2922430613 | 145 |
| 434 | 3300005328 | Ga0070676_10612375 | Ga0070676_106123751 | 146 |
| 435 | 3300005331 | Ga0070670_100048669 | Ga0070670_1000486694 | 146 |
| 436 | 3300005338 | Ga0068868_101034850 | Ga0068868_1010348502 | 146 |
| 437 | 3300005340 | Ga0070689_100120995 | Ga0070689_1001209952 | 146 |
| 438 | 3300005355 | Ga0070671_100010357 | Ga0070671_1000103574 | 146 |
| 439 | 3300005367 | Ga0070667_100574908 | Ga0070667_1005749082 | 146 |
| 440 | 3300005456 | Ga0070678_100281854 | Ga0070678_1002818542 | 146 |
| 441 | 3300005614 | Ga0068856_100360813 | Ga0068856_1003608132 | 146 |
| 442 | 3300006028 | Ga0070717_10022610 | Ga0070717_100226104 | 146 |
| 443 | 3300007788 | Ga0099795_10063731 | Ga0099795_100637312 | 146 |
| 444 | 3300009176 | Ga0105242_11411741 | Ga0105242_114117411 | 146 |
| 445 | 3300009177 | Ga0105248_10398872 | Ga0105248_103988722 | 146 |
| 446 | 3300014969 | Ga0157376_11241179 | Ga0157376_112411792 | 146 |
| 447 | 3300025916 | Ga0207663_10147085 | Ga0207663_101470852 | 146 |
| 448 | 3300025931 | Ga0207644_10011377 | Ga0207644_100113775 | 146 |
| 449 | 3300025936 | Ga0207670_10118053 | Ga0207670_101180532 | 146 |
| 450 | 3300025960 | Ga0207651_10015475 | Ga0207651_100154753 | 146 |
| 451 | 3300025986 | Ga0207658_10697348 | Ga0207658_106973482 | 146 |
| 452 | 3300026078 | Ga0207702_10198787 | Ga0207702_101987872 | 146 |
| 453 | 3300026121 | Ga0207683_10283213 | Ga0207683_102832132 | 146 |
| 454 | 3300037466 | Ga0395898_0046725 | Ga0395898_0046725_900_1343 | 146 |
| 455 | 3300048903 | Ga0496100_0062256 | Ga0496100_0062256_1678_2142 | 146 |
| 456 | 3300048912 | Ga0496109_0236351 | Ga0496109_0236351_806_1270 | 146 |
| 457 | 3300048913 | Ga0496110_0353814 | Ga0496110_0353814_434_898 | 146 |
| 458 | 3300048915 | Ga0496112_0017028 | Ga0496112_0017028_2759_3223 | 146 |
| 459 | 3300048915 | Ga0496112_1386347 | Ga0496112_1386347_108_596 | 146 |
| 460 | 3300048918 | Ga0496115_0883551 | Ga0496115_0883551_60_524 | 146 |
| 461 | 3300053085 | Ga0495619_0167393 | Ga0495619_0167393_731_1207 | 146 |
| 462 | iso_pu_bacteria | 2904690495 | 2904694849 | 146 |
| 463 | iso_pu_bacteria | 2908756301 | 2908760009 | 146 |
| 464 | 3300005535 | Ga0070684_100708302 | Ga0070684_1007083021 | 147 |
| 465 | 3300005563 | Ga0068855_100838550 | Ga0068855_1008385501 | 147 |
| 466 | 3300020610 | Ga0154015_1187678 | Ga0154015_11876782 | 147 |
| 467 | 3300025921 | Ga0207652_11098652 | Ga0207652_110986522 | 147 |
| 468 | 3300025949 | Ga0207667_10334657 | Ga0207667_103346572 | 147 |
| 469 | 3300026067 | Ga0207678_10101390 | Ga0207678_101013902 | 147 |
| 470 | 3300041456 | Ga0451795_0272602 | Ga0451795_0272602_233_703 | 147 |
| 471 | 3300041486 | Ga0451807_2567829 | Ga0451807_2567829_744_1214 | 147 |
| 472 | 3300044658 | Ga0466972_0021424 | Ga0466972_0021424_923_1384 | 147 |
| 473 | 3300044735 | Ga0466968_0056962 | Ga0466968_0056962_395_856 | 147 |
| 474 | 3300044735 | Ga0466968_0404050 | Ga0466968_0404050_61_522 | 147 |
| 475 | 3300044901 | Ga0466960_0036712 | Ga0466960_0036712_1086_1547 | 147 |
| 476 | 3300045049 | Ga0466959_0567829 | Ga0466959_0567829_219_680 | 147 |
| 477 | iso_pu_bacteria | 2513237096 | 2513657098 | 147 |
| 478 | iso_pu_bacteria | 2513237137 | 2513855540 | 147 |
| 479 | iso_pu_bacteria | 2513237145 | 2513918838 | 147 |
| 480 | iso_pu_bacteria | 2517572143 | 2517892085 | 147 |
| 481 | iso_pu_bacteria | 2524023228 | 2524534169 | 147 |
| 482 | iso_pu_bacteria | 2667528175 | 2671121877 | 147 |
| 483 | iso_pu_bacteria | 2791355197 | 2793068830 | 147 |
| 484 | iso_pu_bacteria | 2885374607 | 2885381723 | 147 |
| 485 | iso_pu_bacteria | 2906610324 | 2906617215 | 147 |
| 486 | iso_pu_bacteria | 2906635258 | 2906643395 | 147 |
| 487 | iso_pu_bacteria | 2906660503 | 2906662474 | 147 |
| 488 | iso_pu_bacteria | 2908739725 | 2908742365 | 147 |
| 489 | iso_pu_bacteria | 2935630451 | 2935631222 | 147 |
| 490 | iso_pu_bacteria | 2941507105 | 2941509963 | 147 |
| 491 | iso_pu_bacteria | 2941515067 | 2941518950 | 147 |
| 492 | iso_pu_bacteria | 2941523033 | 2941525362 | 147 |
| 493 | iso_pu_bacteria | 3005474847 | 3005480524 | 147 |
| 494 | iso_pu_bacteria | 8019555841 | 8019556235 | 147 |
| 495 | iso_pu_bacteria | 8019565922 | 8019569074 | 147 |
| 496 | iso_pu_bacteria | 8056689827 | 8056694258 | 147 |
| 497 | 3300005364 | Ga0070673_101336152 | Ga0070673_1013361522 | 148 |
| 498 | 3300006028 | Ga0070717_10006180 | Ga0070717_100061807 | 148 |
| 499 | 3300031238 | Ga0265332_10005559 | Ga0265332_100055595 | 148 |
| 500 | 3300031712 | Ga0265342_10119550 | Ga0265342_101195502 | 148 |
| 501 | 3300036459 | Ga0372808_012212 | Ga0372808_012212_587_1045 | 148 |
| 502 | 3300039447 | Ga0436361_1216747 | Ga0436361_1216747_170_616 | 148 |
| 503 | 3300053129 | Ga0500628_111595 | Ga0500628_111595_139_591 | 148 |
| 504 | iso_pu_bacteria | 2824704595 | 2824714258 | 148 |
| 505 | iso_pu_bacteria | 2824753945 | 2824754274 | 148 |
| 506 | iso_pu_bacteria | 2824763712 | 2824767773 | 148 |
| 507 | iso_pu_bacteria | 2888419890 | 2888424821 | 148 |
| 508 | iso_pu_bacteria | 2904711408 | 2904714997 | 148 |
| 509 | iso_pu_bacteria | 2932794094 | 2932798069 | 148 |
| 510 | iso_pu_bacteria | 2932801729 | 2932807075 | 148 |
| 511 | iso_pu_bacteria | 2935883170 | 2935886797 | 148 |
| 512 | iso_pu_bacteria | 3005710791 | 3005715197 | 148 |
| 513 | iso_pu_bacteria | 8006933436 | 8006940252 | 148 |
| 514 | iso_pu_bacteria | 8006973647 | 8006980030 | 148 |
| 515 | 3300025294 | Ga0209025_1010552 | Ga0209025_10105522 | 149 |
| 516 | iso_pu_bacteria | 2513237098 | 2513674393 | 149 |
| 517 | iso_pu_bacteria | 2517093001 | 2517102750 | 149 |
| 518 | iso_pu_bacteria | 2524023210 | 2524470463 | 149 |
| 519 | iso_pu_bacteria | 2885383462 | 2885390824 | 149 |
| 520 | iso_pu_bacteria | 2903768456 | 2903773783 | 149 |
| 521 | iso_pu_bacteria | 2935959822 | 2935960704 | 149 |
| 522 | iso_pu_bacteria | 8056681323 | 8056688304 | 149 |
| 523 | 3300005336 | Ga0070680_100335246 | Ga0070680_1003352462 | 150 |
| 524 | 3300035724 | Ga0373933_0000110 | Ga0373933_0000110_1032_1484 | 150 |
| 525 | 3300048917 | Ga0496114_0717352 | Ga0496114_0717352_23_475 | 150 |
| 526 | 3300061719 | Ga0466962_0069129 | Ga0466962_0069129_1025_1483 | 150 |
| 527 | iso_pu_bacteria | 2728368998 | 2728753297 | 150 |
| 528 | iso_pu_bacteria | 2888388044 | 2888393526 | 150 |
| 529 | 3300005339 | Ga0070660_101226708 | Ga0070660_1012267081 | 151 |
| 530 | 3300005434 | Ga0070709_10032762 | Ga0070709_100327622 | 151 |
| 531 | 3300005435 | Ga0070714_100004035 | Ga0070714_1000040355 | 151 |
| 532 | 3300005436 | Ga0070713_100002369 | Ga0070713_1000023698 | 151 |
| 533 | 3300005437 | Ga0070710_10000567 | Ga0070710_100005674 | 151 |
| 534 | 3300005439 | Ga0070711_100003229 | Ga0070711_1000032292 | 151 |
| 535 | 3300006028 | Ga0070717_10002140 | Ga0070717_1000214012 | 151 |
| 536 | 3300006163 | Ga0070715_10001480 | Ga0070715_100014806 | 151 |
| 537 | 3300006173 | Ga0070716_100296602 | Ga0070716_1002966022 | 151 |
| 538 | 3300006175 | Ga0070712_100021818 | Ga0070712_1000218184 | 151 |
| 539 | 3300025898 | Ga0207692_10076712 | Ga0207692_100767122 | 151 |
| 540 | 3300025906 | Ga0207699_10003128 | Ga0207699_100031287 | 151 |
| 541 | 3300025915 | Ga0207693_10000581 | Ga0207693_1000058118 | 151 |
| 542 | 3300025916 | Ga0207663_10000084 | Ga0207663_1000008411 | 151 |
| 543 | 3300025928 | Ga0207700_10062075 | Ga0207700_100620752 | 151 |
| 544 | 3300025929 | Ga0207664_10013665 | Ga0207664_100136653 | 151 |
| 545 | 3300025939 | Ga0207665_10001451 | Ga0207665_1000145112 | 151 |
| 546 | 3300035725 | Ga0373947_0199408 | Ga0373947_0199408_30_488 | 151 |
| 547 | 3300045976 | Ga0466967_0415822 | Ga0466967_0415822_531_992 | 151 |
| 548 | 3300046524 | Ga0495648_0006022 | Ga0495648_0006022_6870_7325 | 151 |
| 549 | iso_pu_bacteria | 2513237101 | 2513692880 | 151 |
| 550 | iso_pu_bacteria | 2513237104 | 2513718464 | 151 |
| 551 | iso_pu_bacteria | 2721755755 | 2723844752 | 151 |
| 552 | iso_pu_bacteria | 2791355199 | 2793079904 | 151 |
| 553 | iso_pu_bacteria | 2874604998 | 2874605527 | 151 |
| 554 | iso_pu_bacteria | 2876808645 | 2876813046 | 151 |
| 555 | iso_pu_bacteria | 2879110137 | 2879115840 | 151 |
| 556 | iso_pu_bacteria | 2922361189 | 2922365657 | 151 |
| 557 | iso_pu_bacteria | 2922386360 | 2922391270 | 151 |
| 558 | iso_pu_bacteria | 8006964411 | 8006967005 | 151 |
| 559 | iso_pu_bacteria | 8006984368 | 8006987957 | 151 |
| 560 | iso_pu_bacteria | 8006994254 | 8006995689 | 151 |
| 561 | iso_pu_bacteria | 8056673599 | 8056677677 | 151 |
| 562 | 3300005548 | Ga0070665_100346455 | Ga0070665_1003464552 | 152 |
| 563 | 3300005614 | Ga0068856_100716684 | Ga0068856_1007166842 | 152 |
| 564 | 3300005983 | Ga0081540_1061317 | Ga0081540_10613173 | 152 |
| 565 | 3300005983 | Ga0081540_1075269 | Ga0081540_10752692 | 152 |
| 566 | 3300009098 | Ga0105245_10175912 | Ga0105245_101759122 | 152 |
| 567 | 3300025932 | Ga0207690_10659082 | Ga0207690_106590822 | 152 |
| 568 | 3300031235 | Ga0265330_10036768 | Ga0265330_100367682 | 152 |
| 569 | 3300037466 | Ga0395898_0338844 | Ga0395898_0338844_682_1143 | 152 |
| 570 | 3300049569 | Ga0501032_0366129 | Ga0501032_0366129_189_647 | 152 |
| 571 | 3300049578 | Ga0501042_0067661 | Ga0501042_0067661_1286_1744 | 152 |
| 572 | 3300049582 | Ga0501048_1075839 | Ga0501048_1075839_85_543 | 152 |
| 573 | 3300049592 | Ga0501076_0098914 | Ga0501076_0098914_85_543 | 152 |
| 574 | 3300049822 | Ga0501035_0412736 | Ga0501035_0412736_196_654 | 152 |
| 575 | 3300053094 | Ga0500566_0000006 | Ga0500566_0000006_89564_90022 | 152 |
| 576 | 3300053095 | Ga0500640_000847 | Ga0500640_000847_1512_1970 | 152 |
| 577 | 3300053111 | Ga0500572_000674 | Ga0500572_000674_3751_4209 | 152 |
| 578 | 3300053115 | Ga0500591_106953 | Ga0500591_106953_615_1073 | 152 |
| 579 | 3300053122 | Ga0500608_078816 | Ga0500608_078816_902_1360 | 152 |
| 580 | 3300053136 | Ga0500559_0002479 | Ga0500559_0002479_2058_2516 | 152 |
| 581 | 3300053144 | Ga0500585_129378 | Ga0500585_129378_287_745 | 152 |
| 582 | 3300053148 | Ga0500590_086891 | Ga0500590_086891_703_1161 | 152 |
| 583 | 3300053150 | Ga0500603_000582 | Ga0500603_000582_3222_3680 | 152 |
| 584 | 3300053159 | Ga0500630_000571 | Ga0500630_000571_6655_7113 | 152 |
| 585 | 3300053162 | Ga0500638_012783 | Ga0500638_012783_1528_1986 | 152 |
| 586 | 3300053163 | Ga0500639_000016 | Ga0500639_000016_73154_73612 | 152 |
| 587 | 3300060353 | Ga0501082_0235365 | Ga0501082_0235365_595_1053 | 152 |
| 588 | iso_pu_bacteria | 2906626472 | 2906633626 | 152 |
| 589 | iso_pu_bacteria | 8016583857 | 8016593181 | 152 |
| 590 | 3300005535 | Ga0070684_100006295 | Ga0070684_1000062959 | 153 |
| 591 | 3300005937 | Ga0081455_10006778 | Ga0081455_100067789 | 153 |
| 592 | 3300005985 | Ga0081539_10234681 | Ga0081539_102346812 | 153 |
| 593 | 3300025927 | Ga0207687_10809404 | Ga0207687_108094041 | 153 |
| 594 | 3300025944 | Ga0207661_10001574 | Ga0207661_1000157412 | 153 |
| 595 | 3300031730 | Ga0307516_10501785 | Ga0307516_105017851 | 153 |
| 596 | 3300035692 | Ga0373935_0008213 | Ga0373935_0008213_1720_2187 | 153 |
| 597 | 3300035725 | Ga0373947_0597485 | Ga0373947_0597485_152_619 | 153 |
| 598 | 3300037068 | Ga0373925_0013463 | Ga0373925_0013463_4817_5284 | 153 |
| 599 | 3300046457 | Ga0495590_0135595 | Ga0495590_0135595_396_857 | 153 |
| 600 | 3300046683 | Ga0495658_0107561 | Ga0495658_0107561_988_1455 | 153 |
| 601 | 3300046689 | Ga0495613_0265426 | Ga0495613_0265426_142_609 | 153 |
| 602 | 3300047673 | Ga0495593_0090816 | Ga0495593_0090816_1094_1561 | 153 |
| 603 | 3300048904 | Ga0496101_0786063 | Ga0496101_0786063_237_704 | 153 |
| 604 | 3300050514 | nmdc:mga08x19_647743_c1 | nmdc:mga08x19_647743_c1_71_538 | 153 |
| 605 | 3300005365 | Ga0070688_100779813 | Ga0070688_1007798132 | 154 |
| 606 | 3300005435 | Ga0070714_100575669 | Ga0070714_1005756692 | 154 |
| 607 | 3300005459 | Ga0068867_101051230 | Ga0068867_1010512302 | 154 |
| 608 | 3300009101 | Ga0105247_10014178 | Ga0105247_100141785 | 154 |
| 609 | 3300009148 | Ga0105243_11078470 | Ga0105243_110784702 | 154 |
| 610 | 3300013306 | Ga0163162_11485112 | Ga0163162_114851122 | 154 |
| 611 | 3300014326 | Ga0157380_10949977 | Ga0157380_109499772 | 154 |
| 612 | 3300014969 | Ga0157376_10279547 | Ga0157376_102795472 | 154 |
| 613 | 3300017792 | Ga0163161_10494548 | Ga0163161_104945482 | 154 |
| 614 | 3300025900 | Ga0207710_10009231 | Ga0207710_100092313 | 154 |
| 615 | 3300025923 | Ga0207681_10978683 | Ga0207681_109786832 | 154 |
| 616 | 3300025935 | Ga0207709_11389037 | Ga0207709_113890371 | 154 |
| 617 | 3300026089 | Ga0207648_10675345 | Ga0207648_106753451 | 154 |
| 618 | 3300026116 | Ga0207674_10256881 | Ga0207674_102568812 | 154 |
| 619 | 3300028381 | Ga0268264_10927801 | Ga0268264_109278012 | 154 |
| 620 | 3300030521 | Ga0307511_10132200 | Ga0307511_101322002 | 154 |
| 621 | 3300031616 | Ga0307508_10198560 | Ga0307508_101985602 | 154 |
| 622 | 3300031824 | Ga0307413_10104304 | Ga0307413_101043043 | 154 |
| 623 | 3300031995 | Ga0307409_101877434 | Ga0307409_1018774341 | 154 |
| 624 | 3300041459 | Ga0451800_0560181 | Ga0451800_0560181_564_1034 | 154 |
| 625 | 3300048923 | Ga0496120_0120517 | Ga0496120_0120517_577_1047 | 154 |
| 626 | 3300048929 | Ga0496126_0196151 | Ga0496126_0196151_717_1187 | 154 |
| 627 | 3300050492 | nmdc:mga0yw44_755199_c1 | nmdc:mga0yw44_755199_c1_68_535 | 154 |
| 628 | 3300053083 | Ga0495655_0020575 | Ga0495655_0020575_346_810 | 154 |
| 629 | 3300053136 | Ga0500559_0272142 | Ga0500559_0272142_220_690 | 154 |
| 630 | 3300005336 | Ga0070680_100024742 | Ga0070680_1000247424 | 155 |
| 631 | 3300005364 | Ga0070673_100596988 | Ga0070673_1005969882 | 155 |
| 632 | 3300005439 | Ga0070711_100117149 | Ga0070711_1001171493 | 155 |
| 633 | 3300005455 | Ga0070663_101214682 | Ga0070663_1012146821 | 155 |
| 634 | 3300005530 | Ga0070679_100062502 | Ga0070679_1000625022 | 155 |
| 635 | 3300005548 | Ga0070665_100136724 | Ga0070665_1001367242 | 155 |
| 636 | 3300005563 | Ga0068855_100043258 | Ga0068855_1000432582 | 155 |
| 637 | 3300005577 | Ga0068857_101018036 | Ga0068857_1010180362 | 155 |
| 638 | 3300005614 | Ga0068856_100000020 | Ga0068856_10000002087 | 155 |
| 639 | 3300005614 | Ga0068856_100890985 | Ga0068856_1008909852 | 155 |
| 640 | 3300005616 | Ga0068852_100960162 | Ga0068852_1009601622 | 155 |
| 641 | 3300007265 | Ga0099794_10097175 | Ga0099794_100971752 | 155 |
| 642 | 3300009093 | Ga0105240_10180873 | Ga0105240_101808732 | 155 |
| 643 | 3300009101 | Ga0105247_10043912 | Ga0105247_100439123 | 155 |
| 644 | 3300009174 | Ga0105241_10289344 | Ga0105241_102893442 | 155 |
| 645 | 3300010159 | Ga0099796_10151382 | Ga0099796_101513822 | 155 |
| 646 | 3300010375 | Ga0105239_10154782 | Ga0105239_101547823 | 155 |
| 647 | 3300013102 | Ga0157371_10242204 | Ga0157371_102422042 | 155 |
| 648 | 3300013104 | Ga0157370_10012436 | Ga0157370_100124367 | 155 |
| 649 | 3300014326 | Ga0157380_10290249 | Ga0157380_102902492 | 155 |
| 650 | 3300025900 | Ga0207710_10117658 | Ga0207710_101176582 | 155 |
| 651 | 3300025912 | Ga0207707_10294711 | Ga0207707_102947111 | 155 |
| 652 | 3300025913 | Ga0207695_10213100 | Ga0207695_102131002 | 155 |
| 653 | 3300025916 | Ga0207663_10108215 | Ga0207663_101082152 | 155 |
| 654 | 3300025917 | Ga0207660_10683102 | Ga0207660_106831022 | 155 |
| 655 | 3300025921 | Ga0207652_10156454 | Ga0207652_101564542 | 155 |
| 656 | 3300025949 | Ga0207667_10169869 | Ga0207667_101698692 | 155 |
| 657 | 3300025960 | Ga0207651_10251949 | Ga0207651_102519492 | 155 |
| 658 | 3300025981 | Ga0207640_11417366 | Ga0207640_114173661 | 155 |
| 659 | 3300026067 | Ga0207678_10202766 | Ga0207678_102027662 | 155 |
| 660 | 3300026078 | Ga0207702_10000126 | Ga0207702_1000012661 | 155 |
| 661 | 3300026142 | Ga0207698_10474898 | Ga0207698_104748982 | 155 |
| 662 | 3300026142 | Ga0207698_10705681 | Ga0207698_107056812 | 155 |
| 663 | 3300028379 | Ga0268266_10389371 | Ga0268266_103893712 | 155 |
| 664 | 3300030521 | Ga0307511_10113901 | Ga0307511_101139012 | 155 |
| 665 | 3300031235 | Ga0265330_10034624 | Ga0265330_100346242 | 155 |
| 666 | 3300031238 | Ga0265332_10000319 | Ga0265332_1000031914 | 155 |
| 667 | 3300031238 | Ga0265332_10033171 | Ga0265332_100331711 | 155 |
| 668 | 3300031239 | Ga0265328_10156074 | Ga0265328_101560741 | 155 |
| 669 | 3300031241 | Ga0265325_10008748 | Ga0265325_100087482 | 155 |
| 670 | 3300031241 | Ga0265325_10275592 | Ga0265325_102755922 | 155 |
| 671 | 3300031242 | Ga0265329_10006074 | Ga0265329_100060745 | 155 |
| 672 | 3300031247 | Ga0265340_10006774 | Ga0265340_100067745 | 155 |
| 673 | 3300031247 | Ga0265340_10014937 | Ga0265340_100149372 | 155 |
| 674 | 3300031249 | Ga0265339_10000354 | Ga0265339_100003544 | 155 |
| 675 | 3300031249 | Ga0265339_10026639 | Ga0265339_100266392 | 155 |
| 676 | 3300031250 | Ga0265331_10041214 | Ga0265331_100412142 | 155 |
| 677 | 3300031344 | Ga0265316_10059968 | Ga0265316_100599682 | 155 |
| 678 | 3300031344 | Ga0265316_10194170 | Ga0265316_101941702 | 155 |
| 679 | 3300031344 | Ga0265316_10885612 | Ga0265316_108856122 | 155 |
| 680 | 3300031507 | Ga0307509_10418353 | Ga0307509_104183532 | 155 |
| 681 | 3300031595 | Ga0265313_10029007 | Ga0265313_100290074 | 155 |
| 682 | 3300031595 | Ga0265313_10197542 | Ga0265313_101975422 | 155 |
| 683 | 3300031711 | Ga0265314_10131439 | Ga0265314_101314391 | 155 |
| 684 | 3300031712 | Ga0265342_10000050 | Ga0265342_1000005091 | 155 |
| 685 | 3300031712 | Ga0265342_10065394 | Ga0265342_100653941 | 155 |
| 686 | 3300031730 | Ga0307516_10001650 | Ga0307516_100016509 | 155 |
| 687 | 3300031730 | Ga0307516_10183185 | Ga0307516_101831852 | 155 |
| 688 | 3300033179 | Ga0307507_10016040 | Ga0307507_1001604010 | 155 |
| 689 | 3300033180 | Ga0307510_10287945 | Ga0307510_102879452 | 155 |
| 690 | 3300035086 | Ga0373934_0073779 | Ga0373934_0073779_672_1145 | 155 |
| 691 | 3300035111 | Ga0373923_0161892 | Ga0373923_0161892_392_865 | 155 |
| 692 | 3300035113 | Ga0373936_0016127 | Ga0373936_0016127_254_721 | 155 |
| 693 | 3300035113 | Ga0373936_0458551 | Ga0373936_0458551_61_534 | 155 |
| 694 | 3300035116 | Ga0373945_0012571 | Ga0373945_0012571_174_644 | 155 |
| 695 | 3300035117 | Ga0373953_0010843 | Ga0373953_0010843_2451_2924 | 155 |
| 696 | 3300035118 | Ga0373954_0079917 | Ga0373954_0079917_871_1344 | 155 |
| 697 | 3300035119 | Ga0373956_0012101 | Ga0373956_0012101_593_1066 | 155 |
| 698 | 3300035119 | Ga0373956_0478997 | Ga0373956_0478997_86_553 | 155 |
| 699 | 3300035120 | Ga0373957_0312919 | Ga0373957_0312919_188_655 | 155 |
| 700 | 3300035171 | Ga0373946_0302535 | Ga0373946_0302535_248_721 | 155 |
| 701 | 3300035172 | Ga0373955_0021151 | Ga0373955_0021151_288_761 | 155 |
| 702 | 3300035410 | Ga0373924_0138135 | Ga0373924_0138135_214_687 | 155 |
| 703 | 3300035692 | Ga0373935_0032024 | Ga0373935_0032024_16_489 | 155 |
| 704 | 3300035695 | Ga0373927_0006278 | Ga0373927_0006278_5939_6412 | 155 |
| 705 | 3300035724 | Ga0373933_0012105 | Ga0373933_0012105_2100_2573 | 155 |
| 706 | 3300036401 | Ga0373937_0386491 | Ga0373937_0386491_573_1040 | 155 |
| 707 | 3300037068 | Ga0373925_0027177 | Ga0373925_0027177_2310_2783 | 155 |
| 708 | 3300046454 | Ga0495592_0341506 | Ga0495592_0341506_260_733 | 155 |
| 709 | 3300046459 | Ga0495629_0255098 | Ga0495629_0255098_233_706 | 155 |
| 710 | 3300046459 | Ga0495629_0402677 | Ga0495629_0402677_57_530 | 155 |
| 711 | 3300046462 | Ga0495651_0129083 | Ga0495651_0129083_636_1109 | 155 |
| 712 | 3300046477 | Ga0495664_0328231 | Ga0495664_0328231_288_761 | 155 |
| 713 | 3300046516 | Ga0495628_0030315 | Ga0495628_0030315_3079_3552 | 155 |
| 714 | 3300046517 | Ga0495630_0143217 | Ga0495630_0143217_334_807 | 155 |
| 715 | 3300046529 | Ga0495652_0061438 | Ga0495652_0061438_311_784 | 155 |
| 716 | 3300046533 | Ga0495640_0018138 | Ga0495640_0018138_771_1244 | 155 |
| 717 | 3300046535 | Ga0495586_0275461 | Ga0495586_0275461_17_490 | 155 |
| 718 | 3300046536 | Ga0495587_0048810 | Ga0495587_0048810_207_680 | 155 |
| 719 | 3300046559 | Ga0495667_0007037 | Ga0495667_0007037_3310_3783 | 155 |
| 720 | 3300046642 | Ga0495634_0039133 | Ga0495634_0039133_334_807 | 155 |
| 721 | 3300046663 | Ga0495635_0086616 | Ga0495635_0086616_443_916 | 155 |
| 722 | 3300046674 | Ga0495588_0409162 | Ga0495588_0409162_137_604 | 155 |
| 723 | 3300046675 | Ga0495657_0014528 | Ga0495657_0014528_4562_5035 | 155 |
| 724 | 3300046678 | Ga0495599_0040272 | Ga0495599_0040272_248_721 | 155 |
| 725 | 3300046679 | Ga0495623_0108149 | Ga0495623_0108149_1156_1629 | 155 |
| 726 | 3300046680 | Ga0495646_0233902 | Ga0495646_0233902_248_721 | 155 |
| 727 | 3300046681 | Ga0495647_0112912 | Ga0495647_0112912_515_988 | 155 |
| 728 | 3300046809 | Ga0495600_0032884 | Ga0495600_0032884_610_1083 | 155 |
| 729 | 3300047317 | Ga0495604_0017963 | Ga0495604_0017963_3646_4119 | 155 |
| 730 | 3300047317 | Ga0495604_0047819 | Ga0495604_0047819_2819_3286 | 155 |
| 731 | 3300047319 | Ga0495674_0463858 | Ga0495674_0463858_116_589 | 155 |
| 732 | 3300047322 | Ga0495680_0157954 | Ga0495680_0157954_145_618 | 155 |
| 733 | 3300047444 | Ga0495675_0283899 | Ga0495675_0283899_266_739 | 155 |
| 734 | 3300047471 | Ga0495684_0464766 | Ga0495684_0464766_197_670 | 155 |
| 735 | 3300048088 | Ga0495602_0359047 | Ga0495602_0359047_230_703 | 155 |
| 736 | 3300048907 | Ga0496104_0328582 | Ga0496104_0328582_106_573 | 155 |
| 737 | 3300048909 | Ga0496106_0000645 | Ga0496106_0000645_11338_11811 | 155 |
| 738 | 3300048910 | Ga0496107_0047582 | Ga0496107_0047582_174_641 | 155 |
| 739 | 3300048910 | Ga0496107_0321313 | Ga0496107_0321313_311_784 | 155 |
| 740 | 3300048911 | Ga0496108_0000515 | Ga0496108_0000515_5864_6331 | 155 |
| 741 | 3300048912 | Ga0496109_0002891 | Ga0496109_0002891_12954_13421 | 155 |
| 742 | 3300048913 | Ga0496110_0064722 | Ga0496110_0064722_654_1121 | 155 |
| 743 | 3300048916 | Ga0496113_0122408 | Ga0496113_0122408_1057_1524 | 155 |
| 744 | 3300048918 | Ga0496115_0079056 | Ga0496115_0079056_2013_2480 | 155 |
| 745 | 3300048920 | Ga0496117_0010119 | Ga0496117_0010119_7102_7575 | 155 |
| 746 | 3300048921 | Ga0496118_0007230 | Ga0496118_0007230_8306_8779 | 155 |
| 747 | 3300048922 | Ga0496119_0183634 | Ga0496119_0183634_312_785 | 155 |
| 748 | 3300048924 | Ga0496121_0001276 | Ga0496121_0001276_13629_14102 | 155 |
| 749 | 3300048927 | Ga0496124_0001454 | Ga0496124_0001454_24575_25048 | 155 |
| 750 | 3300048928 | Ga0496125_0042211 | Ga0496125_0042211_1383_1856 | 155 |
| 751 | 3300048929 | Ga0496126_0027808 | Ga0496126_0027808_1266_1739 | 155 |
| 752 | 3300049568 | Ga0501031_0013431 | Ga0501031_0013431_3516_3986 | 155 |
| 753 | 3300049569 | Ga0501032_0000619 | Ga0501032_0000619_5763_6233 | 155 |
| 754 | 3300049570 | Ga0501033_0000108 | Ga0501033_0000108_18063_18533 | 155 |
| 755 | 3300049571 | Ga0501034_0000100 | Ga0501034_0000100_115130_115600 | 155 |
| 756 | 3300049572 | Ga0501036_0000228 | Ga0501036_0000228_7944_8414 | 155 |
| 757 | 3300049573 | Ga0501037_0002072 | Ga0501037_0002072_13711_14181 | 155 |
| 758 | 3300049574 | Ga0501038_0010248 | Ga0501038_0010248_2345_2815 | 155 |
| 759 | 3300049575 | Ga0501039_0001334 | Ga0501039_0001334_2823_3293 | 155 |
| 760 | 3300049578 | Ga0501042_0134965 | Ga0501042_0134965_485_955 | 155 |
| 761 | 3300049579 | Ga0501043_0000085 | Ga0501043_0000085_60736_61206 | 155 |
| 762 | 3300049580 | Ga0501046_0000426 | Ga0501046_0000426_8485_8955 | 155 |
| 763 | 3300049581 | Ga0501047_0000221 | Ga0501047_0000221_48876_49346 | 155 |
| 764 | 3300049582 | Ga0501048_0000621 | Ga0501048_0000621_7704_8174 | 155 |
| 765 | 3300049583 | Ga0501067_0008392 | Ga0501067_0008392_4251_4721 | 155 |
| 766 | 3300049584 | Ga0501068_0001789 | Ga0501068_0001789_803_1273 | 155 |
| 767 | 3300049585 | Ga0501069_0032959 | Ga0501069_0032959_2006_2476 | 155 |
| 768 | 3300049586 | Ga0501070_0001287 | Ga0501070_0001287_5485_5955 | 155 |
| 769 | 3300049587 | Ga0501071_0059427 | Ga0501071_0059427_895_1365 | 155 |
| 770 | 3300049588 | Ga0501072_0012969 | Ga0501072_0012969_4248_4718 | 155 |
| 771 | 3300049589 | Ga0501073_0000290 | Ga0501073_0000290_8272_8742 | 155 |
| 772 | 3300049590 | Ga0501074_0000094 | Ga0501074_0000094_21917_22387 | 155 |
| 773 | 3300049591 | Ga0501075_0446227 | Ga0501075_0446227_196_663 | 155 |
| 774 | 3300049592 | Ga0501076_0260971 | Ga0501076_0260971_165_635 | 155 |
| 775 | 3300049741 | Ga0501079_0018183 | Ga0501079_0018183_1294_1764 | 155 |
| 776 | 3300049742 | Ga0501080_0057105 | Ga0501080_0057105_2463_2933 | 155 |
| 777 | 3300049744 | Ga0501083_0000087 | Ga0501083_0000087_54117_54587 | 155 |
| 778 | 3300049822 | Ga0501035_0000223 | Ga0501035_0000223_54666_55136 | 155 |
| 779 | 3300049823 | Ga0501044_0000970 | Ga0501044_0000970_9944_10414 | 155 |
| 780 | 3300049824 | Ga0501045_0068761 | Ga0501045_0068761_1300_1770 | 155 |
| 781 | 3300053077 | Ga0495601_0018417 | Ga0495601_0018417_207_680 | 155 |
| 782 | 3300053078 | Ga0495612_0109813 | Ga0495612_0109813_316_789 | 155 |
| 783 | 3300053094 | Ga0500566_0006230 | Ga0500566_0006230_303_770 | 155 |
| 784 | 3300053094 | Ga0500566_0306904 | Ga0500566_0306904_64_537 | 155 |
| 785 | 3300053096 | Ga0500641_0007939 | Ga0500641_0007939_545_1012 | 155 |
| 786 | 3300053119 | Ga0500595_000152 | Ga0500595_000152_7403_7870 | 155 |
| 787 | 3300053119 | Ga0500595_028536 | Ga0500595_028536_641_1114 | 155 |
| 788 | 3300053136 | Ga0500559_0036407 | Ga0500559_0036407_170_637 | 155 |
| 789 | 3300053148 | Ga0500590_087739 | Ga0500590_087739_643_1116 | 155 |
| 790 | 3300053150 | Ga0500603_007518 | Ga0500603_007518_1369_1836 | 155 |
| 791 | 3300053162 | Ga0500638_000086 | Ga0500638_000086_3982_4449 | 155 |
| 792 | 3300053177 | Ga0500636_0116929 | Ga0500636_0116929_404_871 | 155 |
| 793 | 3300053178 | Ga0500637_0009759 | Ga0500637_0009759_3947_4414 | 155 |
| 794 | 3300053178 | Ga0500637_0111738 | Ga0500637_0111738_948_1421 | 155 |
| 795 | 3300053728 | Ga0500657_197405 | Ga0500657_197405_52_525 | 155 |
| 796 | 3300054114 | Ga0501084_0008032 | Ga0501084_0008032_2329_2799 | 155 |
| 797 | 3300055283 | Ga0500661_000398 | Ga0500661_000398_4064_4531 | 155 |
| 798 | 3300005435 | Ga0070714_102023696 | Ga0070714_1020236961 | 156 |
| 799 | 3300005436 | Ga0070713_100044765 | Ga0070713_1000447653 | 156 |
| 800 | 3300005578 | Ga0068854_100190036 | Ga0068854_1001900362 | 156 |
| 801 | 3300006028 | Ga0070717_10005547 | Ga0070717_100055476 | 156 |
| 802 | 3300009101 | Ga0105247_10232537 | Ga0105247_102325372 | 156 |
| 803 | 3300025928 | Ga0207700_10002410 | Ga0207700_100024109 | 156 |
| 804 | 3300025929 | Ga0207664_10129229 | Ga0207664_101292292 | 156 |
| 805 | 3300025939 | Ga0207665_10264410 | Ga0207665_102644102 | 156 |
| 806 | 3300031249 | Ga0265339_10475542 | Ga0265339_104755421 | 156 |
| 807 | 3300031711 | Ga0265314_10005412 | Ga0265314_100054126 | 156 |
| 808 | 3300031712 | Ga0265342_10118566 | Ga0265342_101185662 | 156 |
| 809 | 3300048929 | Ga0496126_0030336 | Ga0496126_0030336_418_888 | 156 |
| 810 | 3300000549 | LJQas_1007436 | LJQas_10074362 | 157 |
| 811 | 3300003203 | JGI25406J46586_10000288 | JGI25406J46586_1000028811 | 157 |
| 812 | 3300005327 | Ga0070658_10024846 | Ga0070658_100248461 | 157 |
| 813 | 3300005337 | Ga0070682_100532842 | Ga0070682_1005328422 | 157 |
| 814 | 3300005366 | Ga0070659_100059496 | Ga0070659_1000594961 | 157 |
| 815 | 3300005436 | Ga0070713_101303800 | Ga0070713_1013038002 | 157 |
| 816 | 3300005439 | Ga0070711_101267762 | Ga0070711_1012677621 | 157 |
| 817 | 3300005455 | Ga0070663_100770942 | Ga0070663_1007709422 | 157 |
| 818 | 3300005471 | Ga0070698_100708697 | Ga0070698_1007086971 | 157 |
| 819 | 3300005616 | Ga0068852_101339245 | Ga0068852_1013392452 | 157 |
| 820 | 3300005834 | Ga0068851_10001206 | Ga0068851_100012068 | 157 |
| 821 | 3300005985 | Ga0081539_10000140 | Ga0081539_1000014010 | 157 |
| 822 | 3300007265 | Ga0099794_10057690 | Ga0099794_100576903 | 157 |
| 823 | 3300007788 | Ga0099795_10042841 | Ga0099795_100428412 | 157 |
| 824 | 3300007788 | Ga0099795_10066543 | Ga0099795_100665432 | 157 |
| 825 | 3300007788 | Ga0099795_10067946 | Ga0099795_100679462 | 157 |
| 826 | 3300009093 | Ga0105240_11205827 | Ga0105240_112058272 | 157 |
| 827 | 3300009545 | Ga0105237_10990142 | Ga0105237_109901422 | 157 |
| 828 | 3300010159 | Ga0099796_10001079 | Ga0099796_100010794 | 157 |
| 829 | 3300010159 | Ga0099796_10018958 | Ga0099796_100189583 | 157 |
| 830 | 3300010159 | Ga0099796_10242542 | Ga0099796_102425421 | 157 |
| 831 | 3300010159 | Ga0099796_10379952 | Ga0099796_103799521 | 157 |
| 832 | 3300013104 | Ga0157370_10032211 | Ga0157370_100322116 | 157 |
| 833 | 3300013105 | Ga0157369_10018574 | Ga0157369_100185742 | 157 |
| 834 | 3300013297 | Ga0157378_10123717 | Ga0157378_101237172 | 157 |
| 835 | 3300025321 | Ga0207656_10001137 | Ga0207656_100011372 | 157 |
| 836 | 3300025912 | Ga0207707_10003603 | Ga0207707_1000360313 | 157 |
| 837 | 3300025913 | Ga0207695_10015120 | Ga0207695_100151209 | 157 |
| 838 | 3300025914 | Ga0207671_10126850 | Ga0207671_101268503 | 157 |
| 839 | 3300025917 | Ga0207660_10086010 | Ga0207660_100860102 | 157 |
| 840 | 3300025920 | Ga0207649_10106432 | Ga0207649_101064322 | 157 |
| 841 | 3300025921 | Ga0207652_10001857 | Ga0207652_100018578 | 157 |
| 842 | 3300025924 | Ga0207694_10008673 | Ga0207694_100086737 | 157 |
| 843 | 3300025932 | Ga0207690_10084985 | Ga0207690_100849851 | 157 |
| 844 | 3300025939 | Ga0207665_10419551 | Ga0207665_104195512 | 157 |
| 845 | 3300025940 | Ga0207691_10536738 | Ga0207691_105367382 | 157 |
| 846 | 3300025949 | Ga0207667_10011919 | Ga0207667_1001191910 | 157 |
| 847 | 3300026067 | Ga0207678_10915314 | Ga0207678_109153142 | 157 |
| 848 | 3300026116 | Ga0207674_10085956 | Ga0207674_100859563 | 157 |
| 849 | 3300027671 | Ga0209588_1111659 | Ga0209588_11116592 | 157 |
| 850 | 3300031507 | Ga0307509_10300125 | Ga0307509_103001252 | 157 |
| 851 | 3300031712 | Ga0265342_10249906 | Ga0265342_102499062 | 157 |
| 852 | 3300031730 | Ga0307516_10805017 | Ga0307516_108050172 | 157 |
| 853 | 3300031911 | Ga0307412_10687597 | Ga0307412_106875971 | 157 |
| 854 | 3300032002 | Ga0307416_100896327 | Ga0307416_1008963272 | 157 |
| 855 | 3300032126 | Ga0307415_100221837 | Ga0307415_1002218372 | 157 |
| 856 | 3300033180 | Ga0307510_10080137 | Ga0307510_100801372 | 157 |
| 857 | 3300035113 | Ga0373936_0045600 | Ga0373936_0045600_98_571 | 157 |
| 858 | 3300035170 | Ga0373943_0113038 | Ga0373943_0113038_97_570 | 157 |
| 859 | 3300035410 | Ga0373924_0030479 | Ga0373924_0030479_288_761 | 157 |
| 860 | 3300035691 | Ga0373931_0101039 | Ga0373931_0101039_829_1302 | 157 |
| 861 | 3300035692 | Ga0373935_0000382 | Ga0373935_0000382_1312_1785 | 157 |
| 862 | 3300035695 | Ga0373927_0025913 | Ga0373927_0025913_1169_1642 | 157 |
| 863 | 3300035724 | Ga0373933_0200978 | Ga0373933_0200978_102_575 | 157 |
| 864 | 3300036401 | Ga0373937_0142202 | Ga0373937_0142202_868_1341 | 157 |
| 865 | 3300037068 | Ga0373925_0017659 | Ga0373925_0017659_2719_3192 | 157 |
| 866 | 3300037068 | Ga0373925_0070716 | Ga0373925_0070716_1667_2140 | 157 |
| 867 | 3300046454 | Ga0495592_0043882 | Ga0495592_0043882_2657_3130 | 157 |
| 868 | 3300046455 | Ga0495603_0000191 | Ga0495603_0000191_18674_19147 | 157 |
| 869 | 3300046455 | Ga0495603_0009824 | Ga0495603_0009824_5258_5731 | 157 |
| 870 | 3300046459 | Ga0495629_0000500 | Ga0495629_0000500_14387_14860 | 157 |
| 871 | 3300046461 | Ga0495641_0001436 | Ga0495641_0001436_5849_6322 | 157 |
| 872 | 3300046472 | Ga0495580_0010080 | Ga0495580_0010080_3410_3883 | 157 |
| 873 | 3300046473 | Ga0495582_0000251 | Ga0495582_0000251_15336_15809 | 157 |
| 874 | 3300046475 | Ga0495639_0000077 | Ga0495639_0000077_18951_19424 | 157 |
| 875 | 3300046476 | Ga0495662_0000826 | Ga0495662_0000826_10122_10595 | 157 |
| 876 | 3300046477 | Ga0495664_0005360 | Ga0495664_0005360_2773_3246 | 157 |
| 877 | 3300046491 | Ga0495584_0117094 | Ga0495584_0117094_206_679 | 157 |
| 878 | 3300046499 | Ga0495594_0000648 | Ga0495594_0000648_14068_14541 | 157 |
| 879 | 3300046507 | Ga0495606_0001179 | Ga0495606_0001179_35300_35773 | 157 |
| 880 | 3300046514 | Ga0495618_0072979 | Ga0495618_0072979_1351_1824 | 157 |
| 881 | 3300046517 | Ga0495630_0032298 | Ga0495630_0032298_2541_3014 | 157 |
| 882 | 3300046526 | Ga0495666_0025194 | Ga0495666_0025194_1245_1718 | 157 |
| 883 | 3300046526 | Ga0495666_0237580 | Ga0495666_0237580_279_752 | 157 |
| 884 | 3300046529 | Ga0495652_0030569 | Ga0495652_0030569_1978_2451 | 157 |
| 885 | 3300046531 | Ga0495665_0016458 | Ga0495665_0016458_504_977 | 157 |
| 886 | 3300046531 | Ga0495665_0299869 | Ga0495665_0299869_56_529 | 157 |
| 887 | 3300046533 | Ga0495640_0003320 | Ga0495640_0003320_686_1159 | 157 |
| 888 | 3300046535 | Ga0495586_0268095 | Ga0495586_0268095_430_903 | 157 |
| 889 | 3300046557 | Ga0495622_0020648 | Ga0495622_0020648_1939_2412 | 157 |
| 890 | 3300046559 | Ga0495667_0449706 | Ga0495667_0449706_188_661 | 157 |
| 891 | 3300046642 | Ga0495634_0000440 | Ga0495634_0000440_39060_39533 | 157 |
| 892 | 3300046663 | Ga0495635_0000425 | Ga0495635_0000425_18178_18651 | 157 |
| 893 | 3300046674 | Ga0495588_0001638 | Ga0495588_0001638_7780_8253 | 157 |
| 894 | 3300046680 | Ga0495646_0005175 | Ga0495646_0005175_16_489 | 157 |
| 895 | 3300046681 | Ga0495647_0003601 | Ga0495647_0003601_3313_3786 | 157 |
| 896 | 3300046683 | Ga0495658_0002435 | Ga0495658_0002435_7553_8026 | 157 |
| 897 | 3300046689 | Ga0495613_0010577 | Ga0495613_0010577_1187_1660 | 157 |
| 898 | 3300046690 | Ga0495624_0000818 | Ga0495624_0000818_5643_6116 | 157 |
| 899 | 3300046809 | Ga0495600_0205380 | Ga0495600_0205380_223_696 | 157 |
| 900 | 3300047315 | Ga0495581_0020734 | Ga0495581_0020734_339_812 | 157 |
| 901 | 3300047315 | Ga0495581_0191251 | Ga0495581_0191251_379_852 | 157 |
| 902 | 3300047317 | Ga0495604_0406191 | Ga0495604_0406191_84_557 | 157 |
| 903 | 3300047319 | Ga0495674_0001342 | Ga0495674_0001342_13022_13495 | 157 |
| 904 | 3300047321 | Ga0495676_0066921 | Ga0495676_0066921_1812_2285 | 157 |
| 905 | 3300047471 | Ga0495684_0055791 | Ga0495684_0055791_214_687 | 157 |
| 906 | 3300047673 | Ga0495593_0000192 | Ga0495593_0000192_12766_13239 | 157 |
| 907 | 3300048911 | Ga0496108_1652776 | Ga0496108_1652776_41_514 | 157 |
| 908 | 3300048913 | Ga0496110_0071115 | Ga0496110_0071115_1808_2281 | 157 |
| 909 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_331183_331656 | 157 |
| 910 | 3300048915 | Ga0496112_0010399 | Ga0496112_0010399_140_613 | 157 |
| 911 | 3300048916 | Ga0496113_0713298 | Ga0496113_0713298_80_553 | 157 |
| 912 | 3300048918 | Ga0496115_0412543 | Ga0496115_0412543_498_971 | 157 |
| 913 | 3300048924 | Ga0496121_0209113 | Ga0496121_0209113_471_944 | 157 |
| 914 | 3300048929 | Ga0496126_0283942 | Ga0496126_0283942_485_958 | 157 |
| 915 | 3300053077 | Ga0495601_0136024 | Ga0495601_0136024_344_817 | 157 |
| 916 | 3300053080 | Ga0500635_0004243 | Ga0500635_0004243_1523_1996 | 157 |
| 917 | 3300053080 | Ga0500635_0012371 | Ga0500635_0012371_828_1301 | 157 |
| 918 | 3300053083 | Ga0495655_0169437 | Ga0495655_0169437_28_501 | 157 |
| 919 | 3300053084 | Ga0495595_0122410 | Ga0495595_0122410_508_981 | 157 |
| 920 | 3300053085 | Ga0495619_0143547 | Ga0495619_0143547_323_796 | 157 |
| 921 | 3300053091 | Ga0500647_0156423 | Ga0500647_0156423_10_483 | 157 |
| 922 | 3300053094 | Ga0500566_0153126 | Ga0500566_0153126_271_744 | 157 |
| 923 | 3300053102 | Ga0500554_021852 | Ga0500554_021852_737_1210 | 157 |
| 924 | 3300053123 | Ga0500614_182106 | Ga0500614_182106_66_539 | 157 |
| 925 | 3300053163 | Ga0500639_182966 | Ga0500639_182966_410_883 | 157 |
| 926 | 3300053178 | Ga0500637_0005306 | Ga0500637_0005306_5045_5518 | 157 |
| 927 | 3300053178 | Ga0500637_0134233 | Ga0500637_0134233_324_797 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar