F485947

General Info

Members Datasets Scaffolds Average Seq Length
927 424 868 148

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10123717|Ga0157378_101237172
Length 160
Sequence MGAGIAETDLDDDSDFAESHEINVTPFIDVILVLLIIFMVAAPLSTVDLPIDLPTSTAIPQKKPDKPTYVSIKPDLAVAIGENPVKRVDLVSSLDAMADSNKDRFIFLRADRAVPYGELMSVLEILRAGGYSKIKLVALEGVPDATASPAAPANPERGQP

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
13 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
14 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
15 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
16 2791355199
17 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
18 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
19 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
20 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
21 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
22 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
23 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
24 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
25 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
26 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
27 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
28 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
29 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
30 2906610324
31 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
32 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
33 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
34 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
35 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
36 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
37 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
38 2922425934
39 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
40 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
41 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
42 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
43 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
44 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
45 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
46 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
47 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
48 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
49 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
66 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
79 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
80 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
81 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
88 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
222 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
223 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
229 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
230 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
253 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
299 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
373 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
381 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
385 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
386 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
387 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
388 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
389 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
390 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
391 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
392 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
395 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
396 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
399 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
400 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
401 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
402 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
403 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
404 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
405 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
406 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
407 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
408 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
414 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
415 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
416 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
417 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
418 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
419 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
420 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
421 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
422 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
423 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
424 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.72
Metatranscriptomes 0.22
Isolates 6.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 4.21
Rhizoplane 6.15
Rhizosphere 77.89
Stem 0
Stem Tuber 0
Unclassified 5.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1007436 3300000549 Bacteria 1347
2 JGI24740J21852_10159770 3300001979 Bacteria 559
3 JGI25406J46586_10000288 3300003203 Bacteria 22623
4 JGI25404J52841_10000065 3300003659 Bacteria 9238
5 JGI25404J52841_10003688 3300003659 Bacteria 3046
6 Ga0070658_10024846 3300005327 Bacteria 4805
7 Ga0070658_10171288 3300005327 Bacteria 1824
8 Ga0070676_10612375 3300005328 Bacteria 787
9 Ga0070683_101072321 3300005329 Bacteria 774
10 Ga0070690_100123939 3300005330 Bacteria 1737
11 Ga0070670_100048669 3300005331 Bacteria 3647
12 Ga0070670_100762239 3300005331 Bacteria 872
13 Ga0068869_100094348 3300005334 Bacteria 2256
14 Ga0068869_100962100 3300005334 Bacteria 742
15 Ga0070666_10370711 3300005335 Bacteria 1027
16 Ga0070680_100024742 3300005336 Bacteria 4799
17 Ga0070680_100310978 3300005336 Bacteria 1337
18 Ga0070680_100335246 3300005336 Bacteria 1285
19 Ga0070682_100307357 3300005337 Bacteria 1166
20 Ga0070682_100532842 3300005337 Bacteria 916
21 Ga0068868_100173474 3300005338 Bacteria 1786
22 Ga0068868_100307046 3300005338 Bacteria 1349
23 Ga0068868_101034850 3300005338 Bacteria 753
24 Ga0070660_101226708 3300005339 Bacteria 636
25 Ga0070689_100120995 3300005340 Bacteria 2091
26 Ga0070689_100531686 3300005340 Bacteria 1011
27 Ga0070687_100236636 3300005343 Bacteria 1127
28 Ga0070692_10141081 3300005345 Bacteria 1364
29 Ga0070668_100720672 3300005347 Bacteria 881
30 Ga0070675_100621497 3300005354 Bacteria 981
31 Ga0070671_100010357 3300005355 Bacteria 7480
32 Ga0070671_100058408 3300005355 Bacteria 3212
33 Ga0070674_100053701 3300005356 Bacteria 2783
34 Ga0070674_100521125 3300005356 Bacteria 993
35 Ga0070673_100596988 3300005364 Bacteria 1007
36 Ga0070673_100722654 3300005364 Bacteria 916
37 Ga0070673_101336152 3300005364 Bacteria 674
38 Ga0070688_100005941 3300005365 Bacteria 6468
39 Ga0070688_100779813 3300005365 Bacteria 746
40 Ga0070659_100059496 3300005366 Bacteria 3017
41 Ga0070667_100574908 3300005367 Bacteria 1037
42 Ga0070667_101844773 3300005367 Bacteria 569
43 Ga0070709_10032762 3300005434 Bacteria 3136
44 Ga0070709_11428067 3300005434 Bacteria 561
45 Ga0070714_100004035 3300005435 Bacteria 11037
46 Ga0070714_100575669 3300005435 Bacteria 1080
47 Ga0070714_102023696 3300005435 Bacteria 562
48 Ga0070713_100002369 3300005436 Bacteria 12291
49 Ga0070713_100044765 3300005436 Bacteria 3623
50 Ga0070713_100050453 3300005436 Bacteria 3437
51 Ga0070713_101303800 3300005436 Bacteria 704
52 Ga0070710_10000567 3300005437 Bacteria 17537
53 Ga0070711_100003229 3300005439 Bacteria 9465
54 Ga0070711_100117149 3300005439 Bacteria 1964
55 Ga0070711_100797184 3300005439 Bacteria 801
56 Ga0070711_101267762 3300005439 Bacteria 639
57 Ga0070700_100213896 3300005441 Bacteria 1362
58 Ga0070700_100549624 3300005441 Bacteria 897
59 Ga0070694_101376505 3300005444 Bacteria 595
60 Ga0070663_100034607 3300005455 Bacteria 3500
61 Ga0070663_100770942 3300005455 Bacteria 823
62 Ga0070663_101214682 3300005455 Bacteria 663
63 Ga0070678_100098322 3300005456 Bacteria 2262
64 Ga0070678_100281854 3300005456 Bacteria 1406
65 Ga0070662_100274675 3300005457 Bacteria 1362
66 Ga0070662_100744628 3300005457 Bacteria 831
67 Ga0070681_10158175 3300005458 Bacteria 2190
68 Ga0068867_101051230 3300005459 Bacteria 741
69 Ga0070685_10098612 3300005466 Bacteria 1780
70 Ga0070698_100708697 3300005471 Bacteria 949
71 Ga0070679_100062502 3300005530 Bacteria 3712
72 Ga0070684_100006295 3300005535 Bacteria 9170
73 Ga0070684_100124186 3300005535 Bacteria 2324
74 Ga0070684_100708302 3300005535 Bacteria 939
75 Ga0070672_100142688 3300005543 Bacteria 1977
76 Ga0070686_100069621 3300005544 Bacteria 2299
77 Ga0070665_100136724 3300005548 Bacteria 2454
78 Ga0070665_100346455 3300005548 Bacteria 1491
79 Ga0070665_100401630 3300005548 Bacteria 1378
80 Ga0068855_100043258 3300005563 Bacteria 5336
81 Ga0068855_100838550 3300005563 Bacteria 975
82 Ga0070664_101431136 3300005564 Bacteria 654
83 Ga0068857_101018036 3300005577 Bacteria 798
84 Ga0068854_100190036 3300005578 Bacteria 1608
85 Ga0068856_100000020 3300005614 Bacteria 146775
86 Ga0068856_100360813 3300005614 Bacteria 1472
87 Ga0068856_100716684 3300005614 Bacteria 1021
88 Ga0068856_100890985 3300005614 Bacteria 909
89 Ga0068852_100960162 3300005616 Bacteria 873
90 Ga0068852_101339245 3300005616 Bacteria 738
91 Ga0068852_101942547 3300005616 Bacteria 611
92 Ga0068864_100049091 3300005618 Bacteria 3630
93 Ga0068851_10001206 3300005834 Bacteria 11224
94 Ga0068863_100050091 3300005841 Bacteria 3961
95 Ga0068858_100585417 3300005842 Bacteria 1082
96 Ga0068858_100607961 3300005842 Bacteria 1061
97 Ga0068860_100000435 3300005843 Bacteria 52946
98 Ga0068860_100831490 3300005843 Bacteria 938
99 Ga0068862_100908500 3300005844 Bacteria 866
100 Ga0081455_10006778 3300005937 Bacteria 12220
101 Ga0081455_10013247 3300005937 Bacteria 8167
102 Ga0081455_10035346 3300005937 Bacteria 4468
103 Ga0081540_1001395 3300005983 Bacteria 20932
104 Ga0081540_1001807 3300005983 Bacteria 17952
105 Ga0081540_1061317 3300005983 Bacteria 1793
106 Ga0081540_1075269 3300005983 Bacteria 1543
107 Ga0081539_10000140 3300005985 Bacteria 166746
108 Ga0081539_10004350 3300005985 Bacteria 15796
109 Ga0081539_10122286 3300005985 Bacteria 1291
110 Ga0081539_10234681 3300005985 Bacteria 825
111 Ga0070717_10002140 3300006028 Bacteria 13847
112 Ga0070717_10005547 3300006028 Bacteria 9205
113 Ga0070717_10006180 3300006028 Bacteria 8790
114 Ga0070717_10022610 3300006028 Bacteria 4970
115 Ga0070717_10767129 3300006028 Bacteria 877
116 Ga0070717_11718690 3300006028 Bacteria 568
117 Ga0075365_10174618 3300006038 Bacteria 1500
118 Ga0075365_10179834 3300006038 Bacteria 1478
119 Ga0070715_10001480 3300006163 Bacteria 6839
120 Ga0070716_100075601 3300006173 Bacteria 1994
121 Ga0070716_100250221 3300006173 Bacteria 1207
122 Ga0070716_100296602 3300006173 Bacteria 1122
123 Ga0070712_100021818 3300006175 Bacteria 4212
124 Ga0070712_100062890 3300006175 Bacteria 2626
125 Ga0070712_101102789 3300006175 Bacteria 689
126 Ga0075367_10051329 3300006178 Bacteria 2437
127 Ga0075367_10155277 3300006178 Bacteria 1421
128 Ga0075367_10227816 3300006178 Bacteria 1167
129 Ga0097621_100242238 3300006237 Bacteria 1577
130 Ga0097621_100901153 3300006237 Bacteria 824
131 Ga0075370_10513060 3300006353 Bacteria 724
132 Ga0068871_100020724 3300006358 Bacteria 5041
133 Ga0068871_100042693 3300006358 Bacteria 3642
134 Ga0075431_101180052 3300006847 Bacteria 729
135 Ga0075433_10656056 3300006852 Bacteria 920
136 Ga0075434_100090377 3300006871 Bacteria 3064
137 Ga0099794_10057690 3300007265 Bacteria 1881
138 Ga0099794_10097175 3300007265 Bacteria 1467
139 Ga0099795_10042841 3300007788 Bacteria 1618
140 Ga0099795_10063731 3300007788 Bacteria 1375
141 Ga0099795_10066543 3300007788 Bacteria 1350
142 Ga0099795_10067946 3300007788 Bacteria 1338
143 Ga0105240_10126409 3300009093 Bacteria 3072
144 Ga0105240_10180873 3300009093 Bacteria 2488
145 Ga0105240_10532978 3300009093 Bacteria 1301
146 Ga0105240_11205827 3300009093 Bacteria 801
147 Ga0105245_10010375 3300009098 Bacteria 8114
148 Ga0105245_10175912 3300009098 Bacteria 2041
149 Ga0105247_10014178 3300009101 Bacteria 4782
150 Ga0105247_10043912 3300009101 Bacteria 2739
151 Ga0105247_10232537 3300009101 Bacteria 1252
152 Ga0105247_10445282 3300009101 Bacteria 932
153 Ga0105243_11078470 3300009148 Bacteria 810
154 Ga0105243_12815858 3300009148 Bacteria 527
155 Ga0105241_10289344 3300009174 Bacteria 1402
156 Ga0105242_10133265 3300009176 Bacteria 2148
157 Ga0105242_11411741 3300009176 Bacteria 724
158 Ga0105248_10398872 3300009177 Bacteria 1549
159 Ga0105237_10118949 3300009545 Bacteria 2636
160 Ga0105237_10990142 3300009545 Bacteria 848
161 Ga0105237_11625872 3300009545 Bacteria 653
162 Ga0105238_12384899 3300009551 Bacteria 564
163 Ga0105249_10669938 3300009553 Bacteria 1096
164 Ga0099796_10001079 3300010159 Bacteria 5207
165 Ga0099796_10018958 3300010159 Bacteria 2077
166 Ga0099796_10151382 3300010159 Bacteria 914
167 Ga0099796_10204827 3300010159 Bacteria 802
168 Ga0099796_10242542 3300010159 Bacteria 746
169 Ga0099796_10379952 3300010159 Bacteria 615
170 Ga0105239_10063610 3300010375 Bacteria 4051
171 Ga0105239_10154782 3300010375 Bacteria 2560
172 Ga0105246_10004587 3300011119 Bacteria 8412
173 Ga0105246_10286227 3300011119 Bacteria 1324
174 Ga0157371_10242204 3300013102 Bacteria 1298
175 Ga0157370_10012436 3300013104 Bacteria 8824
176 Ga0157370_10032211 3300013104 Bacteria 5120
177 Ga0157369_10018574 3300013105 Bacteria 7794
178 Ga0157374_10007971 3300013296 Bacteria 9048
179 Ga0157378_10123717 3300013297 Bacteria 2387
180 Ga0157378_10826258 3300013297 Bacteria 954
181 Ga0157378_11705483 3300013297 Bacteria 677
182 Ga0163162_10031396 3300013306 Bacteria 5269
183 Ga0163162_11485112 3300013306 Bacteria 772
184 Ga0157375_10333275 3300013308 Bacteria 1682
185 Ga0163163_10067632 3300014325 Bacteria 3552
186 Ga0163163_10263359 3300014325 Bacteria 1775
187 Ga0157380_10290249 3300014326 Bacteria 1501
188 Ga0157380_10949977 3300014326 Bacteria 889
189 Ga0157376_10021927 3300014969 Bacteria 4969
190 Ga0157376_10279547 3300014969 Bacteria 1571
191 Ga0157376_11241179 3300014969 Bacteria 774
192 Ga0163161_10146480 3300017792 Bacteria 1792
193 Ga0163161_10494548 3300017792 Bacteria 995
194 Ga0163161_11102398 3300017792 Bacteria 682
195 Ga0154015_1187678 3300020610 Bacteria 815
196 Ga0209025_1010552 3300025294 Bacteria 6248
197 Ga0207697_10097187 3300025315 Bacteria 1253
198 Ga0207656_10001137 3300025321 Bacteria 8748
199 Ga0207692_10076712 3300025898 Bacteria 1776
200 Ga0207710_10009231 3300025900 Bacteria 4147
201 Ga0207710_10117658 3300025900 Bacteria 1266
202 Ga0207710_10250505 3300025900 Bacteria 885
203 Ga0207699_10003128 3300025906 Bacteria 7862
204 Ga0207645_10444414 3300025907 Bacteria 875
205 Ga0207643_10078551 3300025908 Bacteria 1909
206 Ga0207643_10393508 3300025908 Bacteria 875
207 Ga0207707_10003603 3300025912 Bacteria 13734
208 Ga0207707_10098146 3300025912 Bacteria 2561
209 Ga0207707_10294711 3300025912 Bacteria 1403
210 Ga0207695_10015120 3300025913 Bacteria 9105
211 Ga0207695_10213100 3300025913 Bacteria 1841
212 Ga0207695_10471501 3300025913 Bacteria 1138
213 Ga0207671_10116267 3300025914 Bacteria 2040
214 Ga0207671_10126850 3300025914 Bacteria 1956
215 Ga0207693_10000581 3300025915 Bacteria 32715
216 Ga0207693_10029129 3300025915 Bacteria 4363
217 Ga0207693_10102044 3300025915 Bacteria 2250
218 Ga0207693_10604283 3300025915 Bacteria 854
219 Ga0207663_10000084 3300025916 Bacteria 44454
220 Ga0207663_10108215 3300025916 Bacteria 1882
221 Ga0207663_10147085 3300025916 Bacteria 1648
222 Ga0207663_10227370 3300025916 Bacteria 1361
223 Ga0207660_10086010 3300025917 Bacteria 2320
224 Ga0207660_10683102 3300025917 Bacteria 837
225 Ga0207660_10699397 3300025917 Bacteria 827
226 Ga0207662_10223347 3300025918 Bacteria 1227
227 Ga0207649_10106432 3300025920 Bacteria 1866
228 Ga0207652_10001857 3300025921 Bacteria 18344
229 Ga0207652_10156454 3300025921 Bacteria 2042
230 Ga0207652_11098652 3300025921 Bacteria 696
231 Ga0207681_10978683 3300025923 Bacteria 709
232 Ga0207694_10008673 3300025924 Bacteria 7674
233 Ga0207659_10352321 3300025926 Bacteria 1222
234 Ga0207659_10550473 3300025926 Bacteria 981
235 Ga0207687_10091887 3300025927 Bacteria 2215
236 Ga0207687_10809404 3300025927 Bacteria 799
237 Ga0207700_10002410 3300025928 Bacteria 10739
238 Ga0207700_10062075 3300025928 Bacteria 2837
239 Ga0207700_10340756 3300025928 Bacteria 1303
240 Ga0207700_10542432 3300025928 Bacteria 1032
241 Ga0207664_10013665 3300025929 Bacteria 5836
242 Ga0207664_10129229 3300025929 Bacteria 2125
243 Ga0207664_10909507 3300025929 Bacteria 790
244 Ga0207644_10011377 3300025931 Bacteria 5886
245 Ga0207644_10018588 3300025931 Bacteria 4706
246 Ga0207644_10186533 3300025931 Bacteria 1629
247 Ga0207690_10084985 3300025932 Bacteria 2220
248 Ga0207690_10659082 3300025932 Bacteria 858
249 Ga0207709_11389037 3300025935 Bacteria 581
250 Ga0207670_10008541 3300025936 Bacteria 5788
251 Ga0207670_10118053 3300025936 Bacteria 1923
252 Ga0207665_10001451 3300025939 Bacteria 15944
253 Ga0207665_10127819 3300025939 Bacteria 1801
254 Ga0207665_10139383 3300025939 Bacteria 1728
255 Ga0207665_10155006 3300025939 Bacteria 1643
256 Ga0207665_10264410 3300025939 Bacteria 1275
257 Ga0207665_10419551 3300025939 Bacteria 1022
258 Ga0207691_10536738 3300025940 Bacteria 992
259 Ga0207711_10465755 3300025941 Bacteria 1177
260 Ga0207689_10118168 3300025942 Bacteria 2180
261 Ga0207661_10001574 3300025944 Bacteria 15528
262 Ga0207661_10960747 3300025944 Bacteria 787
263 Ga0207661_11025876 3300025944 Bacteria 760
264 Ga0207679_10089987 3300025945 Bacteria 2371
265 Ga0207667_10011919 3300025949 Bacteria 10067
266 Ga0207667_10169869 3300025949 Bacteria 2241
267 Ga0207667_10334657 3300025949 Bacteria 1545
268 Ga0207651_10015475 3300025960 Bacteria 4434
269 Ga0207651_10122348 3300025960 Bacteria 1976
270 Ga0207651_10167591 3300025960 Bacteria 1729
271 Ga0207651_10251949 3300025960 Bacteria 1445
272 Ga0207651_10881743 3300025960 Bacteria 796
273 Ga0207712_11022993 3300025961 Bacteria 734
274 Ga0207668_11122512 3300025972 Bacteria 705
275 Ga0207640_11417366 3300025981 Bacteria 623
276 Ga0207658_10697348 3300025986 Bacteria 917
277 Ga0207677_10105095 3300026023 Bacteria 2089
278 Ga0207678_10085203 3300026067 Bacteria 2702
279 Ga0207678_10101390 3300026067 Bacteria 2458
280 Ga0207678_10202766 3300026067 Bacteria 1696
281 Ga0207678_10915314 3300026067 Bacteria 776
282 Ga0207708_10615165 3300026075 Bacteria 921
283 Ga0207708_10857560 3300026075 Bacteria 784
284 Ga0207702_10000126 3300026078 Bacteria 90550
285 Ga0207702_10198787 3300026078 Bacteria 1857
286 Ga0207641_10039952 3300026088 Bacteria 3925
287 Ga0207641_11428799 3300026088 Bacteria 693
288 Ga0207648_10675345 3300026089 Bacteria 956
289 Ga0207676_10195304 3300026095 Bacteria 1784
290 Ga0207674_10085956 3300026116 Bacteria 3139
291 Ga0207674_10256881 3300026116 Bacteria 1694
292 Ga0207683_10048423 3300026121 Bacteria 3722
293 Ga0207683_10283213 3300026121 Bacteria 1515
294 Ga0207698_10474898 3300026142 Bacteria 1212
295 Ga0207698_10705681 3300026142 Bacteria 1004
296 Ga0209588_1111659 3300027671 Bacteria 878
297 Ga0268266_10026648 3300028379 Bacteria 4918
298 Ga0268266_10389371 3300028379 Bacteria 1316
299 Ga0268266_10629846 3300028379 Bacteria 1031
300 Ga0268264_10000093 3300028381 Bacteria 232057
301 Ga0268264_10178480 3300028381 Bacteria 1927
302 Ga0268264_10738702 3300028381 Bacteria 980
303 Ga0268264_10927801 3300028381 Bacteria 875
304 Ga0307511_10113901 3300030521 Bacteria 1707
305 Ga0307511_10132200 3300030521 Bacteria 1499
306 Ga0265330_10034624 3300031235 Bacteria 2255
307 Ga0265330_10036768 3300031235 Bacteria 2181
308 Ga0265332_10000319 3300031238 Bacteria 36874
309 Ga0265332_10005559 3300031238 Bacteria 5803
310 Ga0265332_10033171 3300031238 Bacteria 2248
311 Ga0265328_10156074 3300031239 Bacteria 859
312 Ga0265325_10008748 3300031241 Bacteria 5954
313 Ga0265325_10275592 3300031241 Bacteria 755
314 Ga0265329_10006074 3300031242 Bacteria 4823
315 Ga0265340_10006774 3300031247 Bacteria 6270
316 Ga0265340_10014937 3300031247 Bacteria 4043
317 Ga0265339_10000354 3300031249 Bacteria 36474
318 Ga0265339_10026639 3300031249 Bacteria 3309
319 Ga0265339_10475542 3300031249 Bacteria 578
320 Ga0265331_10041214 3300031250 Bacteria 2244
321 Ga0265316_10059968 3300031344 Bacteria 2958
322 Ga0265316_10194170 3300031344 Bacteria 1507
323 Ga0265316_10885612 3300031344 Bacteria 624
324 Ga0307509_10250115 3300031507 Bacteria 1557
325 Ga0307509_10300125 3300031507 Bacteria 1355
326 Ga0307509_10418353 3300031507 Bacteria 1041
327 Ga0265313_10029007 3300031595 Bacteria 2868
328 Ga0265313_10197542 3300031595 Bacteria 838
329 Ga0307508_10198560 3300031616 Bacteria 1607
330 Ga0265314_10005412 3300031711 Bacteria 11534
331 Ga0265314_10131439 3300031711 Bacteria 1561
332 Ga0265342_10000050 3300031712 Bacteria 124639
333 Ga0265342_10065394 3300031712 Bacteria 2131
334 Ga0265342_10118566 3300031712 Bacteria 1492
335 Ga0265342_10119550 3300031712 Bacteria 1485
336 Ga0265342_10249906 3300031712 Bacteria 947
337 Ga0307516_10001650 3300031730 Bacteria 30691
338 Ga0307516_10161420 3300031730 Bacteria 1991
339 Ga0307516_10183185 3300031730 Bacteria 1826
340 Ga0307516_10409092 3300031730 Bacteria 1015
341 Ga0307516_10501785 3300031730 Bacteria 868
342 Ga0307516_10805017 3300031730 Bacteria 601
343 Ga0307413_10104304 3300031824 Bacteria 1882
344 Ga0307412_10687597 3300031911 Bacteria 877
345 Ga0307412_10822095 3300031911 Bacteria 808
346 Ga0307409_101303873 3300031995 Bacteria 751
347 Ga0307409_101877434 3300031995 Bacteria 628
348 Ga0307416_100896327 3300032002 Bacteria 987
349 Ga0307415_100221837 3300032126 Bacteria 1516
350 Ga0307507_10016040 3300033179 Bacteria 8756
351 Ga0307510_10080137 3300033180 Bacteria 3177
352 Ga0307510_10287945 3300033180 Bacteria 1110
353 Ga0373926_0024022 3300035083 Bacteria 2120
354 Ga0373934_0004350 3300035086 Bacteria 5233
355 Ga0373934_0031073 3300035086 Bacteria 2090
356 Ga0373934_0073779 3300035086 Bacteria 1366
357 Ga0373944_0033628 3300035089 Bacteria 1554
358 Ga0373923_0014524 3300035111 Bacteria 2959
359 Ga0373923_0161892 3300035111 Bacteria 1021
360 Ga0373923_0196408 3300035111 Bacteria 931
361 Ga0373936_0001544 3300035113 Bacteria 8389
362 Ga0373936_0016127 3300035113 Bacteria 2871
363 Ga0373936_0045600 3300035113 Bacteria 1766
364 Ga0373936_0458551 3300035113 Bacteria 590
365 Ga0373945_0002222 3300035116 Bacteria 6067
366 Ga0373945_0012571 3300035116 Bacteria 2814
367 Ga0373953_0000812 3300035117 Bacteria 8708
368 Ga0373953_0004109 3300035117 Bacteria 4614
369 Ga0373953_0010843 3300035117 Bacteria 3183
370 Ga0373954_0001004 3300035118 Bacteria 11147
371 Ga0373954_0003114 3300035118 Bacteria 7002
372 Ga0373954_0079917 3300035118 Bacteria 1561
373 Ga0373956_0012101 3300035119 Bacteria 3569
374 Ga0373956_0028583 3300035119 Bacteria 2427
375 Ga0373956_0037651 3300035119 Bacteria 2138
376 Ga0373956_0047415 3300035119 Bacteria 1922
377 Ga0373956_0478997 3300035119 Bacteria 594
378 Ga0373956_0528114 3300035119 Bacteria 563
379 Ga0373957_0001219 3300035120 Bacteria 6866
380 Ga0373957_0018766 3300035120 Bacteria 2426
381 Ga0373957_0281374 3300035120 Bacteria 703
382 Ga0373957_0312919 3300035120 Bacteria 667
383 Ga0373943_0022807 3300035170 Bacteria 2905
384 Ga0373943_0113038 3300035170 Bacteria 1434
385 Ga0373946_0001948 3300035171 Bacteria 7225
386 Ga0373946_0302535 3300035171 Bacteria 791
387 Ga0373955_0000039 3300035172 Bacteria 51994
388 Ga0373955_0010487 3300035172 Bacteria 4378
389 Ga0373955_0021151 3300035172 Bacteria 3279
390 Ga0373961_0094618 3300035241 Bacteria 959
391 Ga0373924_0004875 3300035410 Bacteria 4715
392 Ga0373924_0030479 3300035410 Bacteria 2163
393 Ga0373924_0138135 3300035410 Bacteria 1062
394 Ga0373924_0185259 3300035410 Bacteria 916
395 Ga0373931_0083407 3300035691 Bacteria 1768
396 Ga0373931_0101039 3300035691 Bacteria 1622
397 Ga0373935_0000079 3300035692 Bacteria 41989
398 Ga0373935_0000382 3300035692 Bacteria 22745
399 Ga0373935_0008213 3300035692 Bacteria 6252
400 Ga0373935_0032024 3300035692 Bacteria 3266
401 Ga0373935_0068458 3300035692 Bacteria 2284
402 Ga0373927_0006278 3300035695 Bacteria 8111
403 Ga0373927_0017668 3300035695 Bacteria 4692
404 Ga0373927_0025913 3300035695 Bacteria 3832
405 Ga0373927_0052978 3300035695 Bacteria 2624
406 Ga0373933_0000110 3300035724 Bacteria 52519
407 Ga0373933_0004722 3300035724 Bacteria 7451
408 Ga0373933_0010172 3300035724 Bacteria 5152
409 Ga0373933_0012105 3300035724 Bacteria 4763
410 Ga0373933_0200978 3300035724 Bacteria 1275
411 Ga0373933_0267619 3300035724 Bacteria 1102
412 Ga0373947_0003920 3300035725 Bacteria 8750
413 Ga0373947_0199408 3300035725 Bacteria 1309
414 Ga0373947_0597485 3300035725 Bacteria 752
415 Ga0373937_0000223 3300036401 Bacteria 54957
416 Ga0373937_0016193 3300036401 Bacteria 6615
417 Ga0373937_0142202 3300036401 Bacteria 2245
418 Ga0373937_0386491 3300036401 Bacteria 1327
419 Ga0373937_0598382 3300036401 Bacteria 1047
420 Ga0372808_012212 3300036459 Bacteria 1218
421 Ga0373925_0000002 3300037068 Bacteria 368879
422 Ga0373925_0013463 3300037068 Bacteria 5920
423 Ga0373925_0017659 3300037068 Bacteria 5177
424 Ga0373925_0027177 3300037068 Bacteria 4190
425 Ga0373925_0070716 3300037068 Bacteria 2638
426 Ga0373925_1224651 3300037068 Bacteria 617
427 Ga0395898_0046725 3300037466 Bacteria 4252
428 Ga0395898_0338844 3300037466 Bacteria 1434
429 Ga0436365_0800516 3300039437 Bacteria 792
430 Ga0436365_0926888 3300039437 Bacteria 1578
431 Ga0436360_0670966 3300039438 Bacteria 1626
432 Ga0436361_1216747 3300039447 Bacteria 884
433 Ga0436363_0529468 3300039450 Bacteria 953
434 Ga0436363_0538725 3300039450 Bacteria 660
435 Ga0436362_0818857 3300039453 Bacteria 696
436 Ga0451795_0272602 3300041456 Bacteria 757
437 Ga0451800_0560181 3300041459 Bacteria 1418
438 Ga0451807_2567829 3300041486 Bacteria 1392
439 Ga0451837_0149782 3300041494 Bacteria 590
440 Ga0466972_0021424 3300044658 Bacteria 3221
441 Ga0466968_0056962 3300044735 Bacteria 1679
442 Ga0466968_0404050 3300044735 Bacteria 670
443 Ga0466960_0036712 3300044901 Bacteria 2296
444 Ga0466959_0567829 3300045049 Bacteria 764
445 Ga0466967_0415822 3300045976 Bacteria 1310
446 Ga0466967_0433695 3300045976 Bacteria 1282
447 Ga0495592_0000475 3300046454 Bacteria 29441
448 Ga0495592_0006852 3300046454 Bacteria 8508
449 Ga0495592_0009482 3300046454 Bacteria 7319
450 Ga0495592_0043882 3300046454 Bacteria 3343
451 Ga0495592_0341506 3300046454 Bacteria 962
452 Ga0495603_0000191 3300046455 Bacteria 32052
453 Ga0495603_0009824 3300046455 Bacteria 5790
454 Ga0495603_0101732 3300046455 Bacteria 1677
455 Ga0495590_0135595 3300046457 Bacteria 887
456 Ga0495629_0000500 3300046459 Bacteria 32861
457 Ga0495629_0001281 3300046459 Bacteria 19758
458 Ga0495629_0007003 3300046459 Bacteria 8306
459 Ga0495629_0255098 3300046459 Bacteria 1206
460 Ga0495629_0402677 3300046459 Bacteria 930
461 Ga0495641_0001436 3300046461 Bacteria 20225
462 Ga0495641_0044832 3300046461 Bacteria 2038
463 Ga0495641_0362520 3300046461 Bacteria 656
464 Ga0495651_0005638 3300046462 Bacteria 9539
465 Ga0495651_0010558 3300046462 Bacteria 7099
466 Ga0495651_0129083 3300046462 Bacteria 1847
467 Ga0495653_0000006 3300046463 Bacteria 363285
468 Ga0495653_0003914 3300046463 Bacteria 12039
469 Ga0495580_0010080 3300046472 Bacteria 7381
470 Ga0495580_0085589 3300046472 Bacteria 2195
471 Ga0495582_0000251 3300046473 Bacteria 29816
472 Ga0495582_0121260 3300046473 Bacteria 1473
473 Ga0495639_0000077 3300046475 Bacteria 46394
474 Ga0495662_0000826 3300046476 Bacteria 15060
475 Ga0495662_0001775 3300046476 Bacteria 10789
476 Ga0495664_0000002 3300046477 Bacteria 625183
477 Ga0495664_0005360 3300046477 Bacteria 7035
478 Ga0495664_0245197 3300046477 Bacteria 1084
479 Ga0495664_0328231 3300046477 Bacteria 922
480 Ga0495584_0117094 3300046491 Bacteria 1349
481 Ga0495594_0000648 3300046499 Bacteria 17955
482 Ga0495606_0001179 3300046507 Bacteria 36884
483 Ga0495608_0000009 3300046511 Bacteria 266614
484 Ga0495608_0002194 3300046511 Bacteria 14100
485 Ga0495608_0002352 3300046511 Bacteria 13621
486 Ga0495608_0541959 3300046511 Bacteria 702
487 Ga0495616_0295645 3300046513 Bacteria 685
488 Ga0495618_0000005 3300046514 Bacteria 230421
489 Ga0495618_0056355 3300046514 Bacteria 2488
490 Ga0495618_0072979 3300046514 Bacteria 2184
491 Ga0495628_0000002 3300046516 Bacteria 589399
492 Ga0495628_0009404 3300046516 Bacteria 8342
493 Ga0495628_0030315 3300046516 Bacteria 4380
494 Ga0495630_0000240 3300046517 Bacteria 43911
495 Ga0495630_0032298 3300046517 Bacteria 3900
496 Ga0495630_0143217 3300046517 Bacteria 1817
497 Ga0495648_0006022 3300046524 Bacteria 9959
498 Ga0495666_0025194 3300046526 Bacteria 2938
499 Ga0495666_0237580 3300046526 Bacteria 832
500 Ga0495652_0000004 3300046529 Bacteria 588877
501 Ga0495652_0001117 3300046529 Bacteria 30393
502 Ga0495652_0003535 3300046529 Bacteria 15358
503 Ga0495652_0030569 3300046529 Bacteria 4722
504 Ga0495652_0061438 3300046529 Bacteria 3171
505 Ga0495665_0016458 3300046531 Bacteria 3985
506 Ga0495665_0130344 3300046531 Bacteria 1316
507 Ga0495665_0299869 3300046531 Bacteria 823
508 Ga0495640_0000005 3300046533 Bacteria 318271
509 Ga0495640_0003320 3300046533 Bacteria 12954
510 Ga0495640_0008340 3300046533 Bacteria 8125
511 Ga0495640_0013662 3300046533 Bacteria 6171
512 Ga0495640_0018138 3300046533 Bacteria 5229
513 Ga0495586_0034576 3300046535 Bacteria 2715
514 Ga0495586_0268095 3300046535 Bacteria 976
515 Ga0495586_0275461 3300046535 Bacteria 962
516 Ga0495587_0000007 3300046536 Bacteria 290788
517 Ga0495587_0048810 3300046536 Bacteria 2506
518 Ga0495645_0000003 3300046543 Bacteria 570133
519 Ga0495645_0022506 3300046543 Bacteria 4560
520 Ga0495645_0252854 3300046543 Bacteria 1170
521 Ga0495622_0020648 3300046557 Bacteria 3067
522 Ga0495667_0000002 3300046559 Bacteria 437535
523 Ga0495667_0001890 3300046559 Bacteria 13905
524 Ga0495667_0007037 3300046559 Bacteria 7634
525 Ga0495667_0020775 3300046559 Bacteria 4430
526 Ga0495667_0449706 3300046559 Bacteria 809
527 Ga0495656_0052411 3300046615 Bacteria 1750
528 Ga0495634_0000129 3300046642 Bacteria 65082
529 Ga0495634_0000440 3300046642 Bacteria 41444
530 Ga0495634_0006578 3300046642 Bacteria 8814
531 Ga0495634_0039133 3300046642 Bacteria 3230
532 Ga0495635_0000020 3300046663 Bacteria 189698
533 Ga0495635_0000425 3300046663 Bacteria 26748
534 Ga0495635_0018106 3300046663 Bacteria 4919
535 Ga0495635_0086616 3300046663 Bacteria 2143
536 Ga0495588_0001638 3300046674 Bacteria 9590
537 Ga0495588_0409162 3300046674 Bacteria 712
538 Ga0495657_0000240 3300046675 Bacteria 49927
539 Ga0495657_0014186 3300046675 Bacteria 5856
540 Ga0495657_0014528 3300046675 Bacteria 5777
541 Ga0495657_0023164 3300046675 Bacteria 4440
542 Ga0495599_0000001 3300046678 Bacteria 537563
543 Ga0495599_0004705 3300046678 Bacteria 8102
544 Ga0495599_0025144 3300046678 Bacteria 3726
545 Ga0495599_0040272 3300046678 Bacteria 2934
546 Ga0495623_0000001 3300046679 Bacteria 313861
547 Ga0495623_0052608 3300046679 Bacteria 2572
548 Ga0495623_0108149 3300046679 Bacteria 1688
549 Ga0495646_0000013 3300046680 Bacteria 159700
550 Ga0495646_0005175 3300046680 Bacteria 8224
551 Ga0495646_0005468 3300046680 Bacteria 8028
552 Ga0495646_0166781 3300046680 Bacteria 1216
553 Ga0495646_0233902 3300046680 Bacteria 989
554 Ga0495647_0003601 3300046681 Bacteria 4968
555 Ga0495647_0112912 3300046681 Bacteria 1136
556 Ga0495658_0002435 3300046683 Bacteria 9368
557 Ga0495658_0107561 3300046683 Bacteria 1673
558 Ga0495658_0497733 3300046683 Bacteria 779
559 Ga0495613_0010577 3300046689 Bacteria 6844
560 Ga0495613_0080447 3300046689 Bacteria 2368
561 Ga0495613_0265426 3300046689 Bacteria 1195
562 Ga0495624_0000818 3300046690 Bacteria 24567
563 Ga0495600_0000041 3300046809 Bacteria 75747
564 Ga0495600_0032884 3300046809 Bacteria 3365
565 Ga0495600_0034137 3300046809 Bacteria 3302
566 Ga0495600_0205380 3300046809 Bacteria 1264
567 Ga0495600_0587577 3300046809 Bacteria 678
568 Ga0495581_0020734 3300047315 Bacteria 3810
569 Ga0495581_0044348 3300047315 Bacteria 2572
570 Ga0495581_0191251 3300047315 Bacteria 1197
571 Ga0495604_0000005 3300047317 Bacteria 424516
572 Ga0495604_0017963 3300047317 Bacteria 5659
573 Ga0495604_0047819 3300047317 Bacteria 3330
574 Ga0495604_0406191 3300047317 Bacteria 896
575 Ga0495674_0000003 3300047319 Bacteria 562126
576 Ga0495674_0001342 3300047319 Bacteria 23999
577 Ga0495674_0050291 3300047319 Bacteria 3678
578 Ga0495674_0233939 3300047319 Bacteria 1516
579 Ga0495674_0463858 3300047319 Bacteria 1016
580 Ga0495676_0066921 3300047321 Bacteria 2781
581 Ga0495676_0202401 3300047321 Bacteria 1379
582 Ga0495680_0000002 3300047322 Bacteria 197533
583 Ga0495680_0002310 3300047322 Bacteria 19589
584 Ga0495680_0013256 3300047322 Bacteria 7202
585 Ga0495680_0157954 3300047322 Bacteria 1648
586 Ga0495675_0000383 3300047444 Bacteria 30552
587 Ga0495675_0120178 3300047444 Bacteria 1636
588 Ga0495675_0283899 3300047444 Bacteria 986
589 Ga0495684_0000020 3300047471 Bacteria 148507
590 Ga0495684_0003601 3300047471 Bacteria 12078
591 Ga0495684_0055791 3300047471 Bacteria 3013
592 Ga0495684_0464766 3300047471 Bacteria 876
593 Ga0495593_0000192 3300047673 Bacteria 32140
594 Ga0495593_0002191 3300047673 Bacteria 11688
595 Ga0495593_0004378 3300047673 Bacteria 8399
596 Ga0495593_0090816 3300047673 Bacteria 1573
597 Ga0495602_0000027 3300048088 Bacteria 145010
598 Ga0495602_0001747 3300048088 Bacteria 21667
599 Ga0495602_0148139 3300048088 Bacteria 1848
600 Ga0495602_0359047 3300048088 Bacteria 1049
601 Ga0495614_0143135 3300048089 Bacteria 1063
602 Ga0496100_0005558 3300048903 Bacteria 6803
603 Ga0496100_0062256 3300048903 Bacteria 2462
604 Ga0496100_0079263 3300048903 Bacteria 2213
605 Ga0496100_0913220 3300048903 Bacteria 690
606 Ga0496100_1659527 3300048903 Bacteria 505
607 Ga0496101_0006237 3300048904 Bacteria 7667
608 Ga0496101_0111706 3300048904 Bacteria 2058
609 Ga0496101_0183028 3300048904 Bacteria 1614
610 Ga0496101_0786063 3300048904 Bacteria 751
611 Ga0496101_1268995 3300048904 Bacteria 576
612 Ga0496102_0002444 3300048905 Bacteria 15846
613 Ga0496102_0130392 3300048905 Bacteria 2353
614 Ga0496103_0077882 3300048906 Bacteria 2082
615 Ga0496104_0004215 3300048907 Bacteria 12487
616 Ga0496104_0135359 3300048907 Bacteria 2367
617 Ga0496104_0328582 3300048907 Bacteria 1442
618 Ga0496104_0666798 3300048907 Bacteria 949
619 Ga0496105_0008253 3300048908 Bacteria 8098
620 Ga0496106_0000645 3300048909 Bacteria 24977
621 Ga0496106_0045251 3300048909 Bacteria 3306
622 Ga0496107_0006772 3300048910 Bacteria 7887
623 Ga0496107_0047582 3300048910 Bacteria 3088
624 Ga0496107_0063699 3300048910 Bacteria 2672
625 Ga0496107_0321313 3300048910 Bacteria 1152
626 Ga0496107_0493880 3300048910 Bacteria 908
627 Ga0496108_0000515 3300048911 Bacteria 30277
628 Ga0496108_0008972 3300048911 Bacteria 8106
629 Ga0496108_0286731 3300048911 Bacteria 1433
630 Ga0496108_1652776 3300048911 Bacteria 529
631 Ga0496109_0002891 3300048912 Bacteria 14365
632 Ga0496109_0031689 3300048912 Bacteria 4747
633 Ga0496109_0236351 3300048912 Bacteria 1719
634 Ga0496110_0006362 3300048913 Bacteria 9335
635 Ga0496110_0064722 3300048913 Bacteria 3232
636 Ga0496110_0071115 3300048913 Bacteria 3084
637 Ga0496110_0353814 3300048913 Bacteria 1338
638 Ga0496111_0039295 3300048914 Bacteria 3392
639 Ga0496112_0000004 3300048915 Bacteria 553294
640 Ga0496112_0009417 3300048915 Bacteria 8799
641 Ga0496112_0010399 3300048915 Bacteria 8437
642 Ga0496112_0017028 3300048915 Bacteria 6823
643 Ga0496112_0382543 3300048915 Bacteria 1348
644 Ga0496112_1386347 3300048915 Bacteria 618
645 Ga0496113_0122408 3300048916 Bacteria 2035
646 Ga0496113_0713298 3300048916 Bacteria 800
647 Ga0496114_0015589 3300048917 Bacteria 6111
648 Ga0496114_0097491 3300048917 Bacteria 2504
649 Ga0496114_0693953 3300048917 Bacteria 893
650 Ga0496114_0717352 3300048917 Bacteria 876
651 Ga0496115_0004586 3300048918 Bacteria 10008
652 Ga0496115_0079056 3300048918 Bacteria 2677
653 Ga0496115_0412543 3300048918 Bacteria 1095
654 Ga0496115_0883551 3300048918 Bacteria 690
655 Ga0496117_0010119 3300048920 Bacteria 8659
656 Ga0496118_0007230 3300048921 Bacteria 11848
657 Ga0496119_0183634 3300048922 Bacteria 1095
658 Ga0496120_0120517 3300048923 Bacteria 1357
659 Ga0496121_0001276 3300048924 Bacteria 43353
660 Ga0496121_0209113 3300048924 Bacteria 1384
661 Ga0496124_0001454 3300048927 Bacteria 34934
662 Ga0496125_0042211 3300048928 Bacteria 3888
663 Ga0496126_0027808 3300048929 Bacteria 5395
664 Ga0496126_0030336 3300048929 Bacteria 5124
665 Ga0496126_0196151 3300048929 Bacteria 1707
666 Ga0496126_0283942 3300048929 Bacteria 1370
667 Ga0501031_0013431 3300049568 Bacteria 5340
668 Ga0501031_0020234 3300049568 Bacteria 4338
669 Ga0501031_0398278 3300049568 Bacteria 890
670 Ga0501032_0000068 3300049569 Bacteria 89292
671 Ga0501032_0000619 3300049569 Bacteria 28816
672 Ga0501032_0021467 3300049569 Bacteria 4487
673 Ga0501032_0067268 3300049569 Bacteria 2393
674 Ga0501032_0366129 3300049569 Bacteria 928
675 Ga0501033_0000108 3300049570 Bacteria 79903
676 Ga0501033_0000274 3300049570 Bacteria 49649
677 Ga0501033_0000523 3300049570 Bacteria 35975
678 Ga0501033_0007813 3300049570 Bacteria 8287
679 Ga0501034_0000100 3300049571 Bacteria 159536
680 Ga0501034_0000790 3300049571 Bacteria 47085
681 Ga0501034_0119962 3300049571 Bacteria 2616
682 Ga0501034_0204299 3300049571 Bacteria 1932
683 Ga0501036_0000203 3300049572 Bacteria 39418
684 Ga0501036_0000228 3300049572 Bacteria 37800
685 Ga0501036_0306245 3300049572 Bacteria 1328
686 Ga0501037_0000109 3300049573 Bacteria 77490
687 Ga0501037_0002072 3300049573 Bacteria 14545
688 Ga0501037_0026542 3300049573 Bacteria 4281
689 Ga0501037_0029153 3300049573 Bacteria 4077
690 Ga0501037_0029275 3300049573 Bacteria 4068
691 Ga0501037_0292989 3300049573 Bacteria 1131
692 Ga0501038_0000028 3300049574 Bacteria 144481
693 Ga0501038_0002060 3300049574 Bacteria 18617
694 Ga0501038_0010248 3300049574 Bacteria 8577
695 Ga0501038_0027293 3300049574 Bacteria 5081
696 Ga0501038_0030228 3300049574 Bacteria 4795
697 Ga0501038_0609104 3300049574 Bacteria 825
698 Ga0501039_0000005 3300049575 Bacteria 295471
699 Ga0501039_0001334 3300049575 Bacteria 18048
700 Ga0501039_0035260 3300049575 Bacteria 3860
701 Ga0501039_0046990 3300049575 Bacteria 3335
702 Ga0501039_0299379 3300049575 Bacteria 1264
703 Ga0501040_0055226 3300049576 Bacteria 2723
704 Ga0501041_0027198 3300049577 Bacteria 3446
705 Ga0501042_0019889 3300049578 Bacteria 4668
706 Ga0501042_0067661 3300049578 Bacteria 2554
707 Ga0501042_0082553 3300049578 Bacteria 2304
708 Ga0501042_0134965 3300049578 Bacteria 1779
709 Ga0501042_0210193 3300049578 Bacteria 1403
710 Ga0501042_1254755 3300049578 Bacteria 540
711 Ga0501043_0000085 3300049579 Bacteria 83544
712 Ga0501043_0000122 3300049579 Bacteria 71952
713 Ga0501043_0005228 3300049579 Bacteria 10504
714 Ga0501043_0034754 3300049579 Bacteria 3964
715 Ga0501043_0321070 3300049579 Bacteria 1180
716 Ga0501046_0000032 3300049580 Bacteria 180265
717 Ga0501046_0000426 3300049580 Bacteria 42186
718 Ga0501046_0048182 3300049580 Bacteria 3375
719 Ga0501047_0000221 3300049581 Bacteria 68563
720 Ga0501047_0000543 3300049581 Bacteria 40726
721 Ga0501047_0131111 3300049581 Bacteria 2387
722 Ga0501047_0136998 3300049581 Bacteria 2328
723 Ga0501047_0425278 3300049581 Bacteria 1159
724 Ga0501048_0000621 3300049582 Bacteria 25292
725 Ga0501048_0010200 3300049582 Bacteria 7024
726 Ga0501048_0117599 3300049582 Bacteria 1878
727 Ga0501048_0348836 3300049582 Bacteria 1055
728 Ga0501048_1075839 3300049582 Bacteria 578
729 Ga0501067_0008392 3300049583 Bacteria 5734
730 Ga0501067_0012822 3300049583 Bacteria 4642
731 Ga0501067_0033173 3300049583 Bacteria 2865
732 Ga0501067_0338194 3300049583 Bacteria 839
733 Ga0501068_0001789 3300049584 Bacteria 11428
734 Ga0501068_0043563 3300049584 Bacteria 2700
735 Ga0501068_0084939 3300049584 Bacteria 1947
736 Ga0501068_0294300 3300049584 Bacteria 1038
737 Ga0501069_0020617 3300049585 Bacteria 3572
738 Ga0501069_0032959 3300049585 Bacteria 2851
739 Ga0501070_0000152 3300049586 Bacteria 63679
740 Ga0501070_0001287 3300049586 Bacteria 22514
741 Ga0501070_0240752 3300049586 Bacteria 1481
742 Ga0501071_0059427 3300049587 Bacteria 2766
743 Ga0501071_0103123 3300049587 Bacteria 2104
744 Ga0501071_0190696 3300049587 Bacteria 1537
745 Ga0501071_1136029 3300049587 Bacteria 603
746 Ga0501072_0012969 3300049588 Bacteria 6378
747 Ga0501072_0094544 3300049588 Bacteria 2375
748 Ga0501073_0000290 3300049589 Bacteria 33072
749 Ga0501073_0053449 3300049589 Bacteria 2827
750 Ga0501073_0089627 3300049589 Bacteria 2138
751 Ga0501073_0207098 3300049589 Bacteria 1355
752 Ga0501074_0000094 3300049590 Bacteria 42565
753 Ga0501074_0011814 3300049590 Bacteria 6347
754 Ga0501074_0030336 3300049590 Bacteria 3917
755 Ga0501074_0490107 3300049590 Bacteria 871
756 Ga0501075_0337392 3300049591 Bacteria 1149
757 Ga0501075_0446227 3300049591 Bacteria 987
758 Ga0501076_0098914 3300049592 Bacteria 2350
759 Ga0501076_0153496 3300049592 Bacteria 1874
760 Ga0501076_0260971 3300049592 Bacteria 1418
761 Ga0501077_0019240 3300049593 Bacteria 4318
762 Ga0501079_0018183 3300049741 Bacteria 5369
763 Ga0501079_0043737 3300049741 Bacteria 3457
764 Ga0501079_0082251 3300049741 Bacteria 2490
765 Ga0501079_0101678 3300049741 Bacteria 2229
766 Ga0501080_0000104 3300049742 Bacteria 57865
767 Ga0501080_0045469 3300049742 Bacteria 4087
768 Ga0501080_0057105 3300049742 Bacteria 3634
769 Ga0501080_0111172 3300049742 Bacteria 2539
770 Ga0501081_0073183 3300049743 Bacteria 2390
771 Ga0501083_0000087 3300049744 Bacteria 62691
772 Ga0501083_0019454 3300049744 Bacteria 4730
773 Ga0501083_0211890 3300049744 Bacteria 1263
774 Ga0501035_0000016 3300049822 Bacteria 243412
775 Ga0501035_0000223 3300049822 Bacteria 67732
776 Ga0501035_0091957 3300049822 Bacteria 2669
777 Ga0501035_0109979 3300049822 Bacteria 2415
778 Ga0501035_0247338 3300049822 Bacteria 1515
779 Ga0501035_0412736 3300049822 Bacteria 1122
780 Ga0501044_0000657 3300049823 Bacteria 41841
781 Ga0501044_0000970 3300049823 Bacteria 34530
782 Ga0501044_0016829 3300049823 Bacteria 7845
783 Ga0501044_0041827 3300049823 Bacteria 4770
784 Ga0501044_0153070 3300049823 Bacteria 2287
785 Ga0501044_0381989 3300049823 Bacteria 1323
786 Ga0501045_0012225 3300049824 Bacteria 6046
787 Ga0501045_0068761 3300049824 Bacteria 2602
788 Ga0501045_0129276 3300049824 Bacteria 1877
789 nmdc:mga03n38_295254_c1 3300050490 Bacteria 869
790 nmdc:mga0yw44_755199_c1 3300050492 Bacteria 661
791 nmdc:mga06z11_466386_c1 3300050494 Bacteria 764
792 nmdc:mga0n895_132806_c1 3300050512 Bacteria 2515
793 nmdc:mga0rr50_550992_c1 3300050513 Bacteria 982
794 nmdc:mga08x19_647743_c1 3300050514 Bacteria 749
795 nmdc:mga0sz30_97539_c1 3300050516 Bacteria 1282
796 Ga0495601_0000010 3300053077 Bacteria 266222
797 Ga0495601_0018417 3300053077 Bacteria 4250
798 Ga0495601_0061457 3300053077 Bacteria 2385
799 Ga0495601_0093334 3300053077 Bacteria 1939
800 Ga0495601_0136024 3300053077 Bacteria 1602
801 Ga0495601_0144509 3300053077 Bacteria 1552
802 Ga0495612_0000002 3300053078 Bacteria 310466
803 Ga0495612_0002483 3300053078 Bacteria 7600
804 Ga0495612_0025001 3300053078 Bacteria 2398
805 Ga0495612_0109813 3300053078 Bacteria 1179
806 Ga0500635_0004243 3300053080 Bacteria 3678
807 Ga0500635_0012371 3300053080 Bacteria 2449
808 Ga0495655_0020575 3300053083 Bacteria 1483
809 Ga0495655_0169437 3300053083 Bacteria 698
810 Ga0495595_0000110 3300053084 Bacteria 37533
811 Ga0495595_0001562 3300053084 Bacteria 8936
812 Ga0495595_0002197 3300053084 Bacteria 7581
813 Ga0495595_0122410 3300053084 Bacteria 1268
814 Ga0495595_0426778 3300053084 Bacteria 673
815 Ga0495619_0000002 3300053085 Bacteria 530226
816 Ga0495619_0028951 3300053085 Bacteria 3575
817 Ga0495619_0143547 3300053085 Bacteria 1645
818 Ga0495619_0167393 3300053085 Bacteria 1519
819 Ga0500647_0156423 3300053091 Bacteria 1060
820 Ga0500566_0000006 3300053094 Bacteria 153632
821 Ga0500566_0006230 3300053094 Bacteria 7089
822 Ga0500566_0153126 3300053094 Bacteria 1210
823 Ga0500566_0306904 3300053094 Bacteria 744
824 Ga0500640_000847 3300053095 Bacteria 8454
825 Ga0500641_0007939 3300053096 Bacteria 3784
826 Ga0500648_052854 3300053097 Bacteria 2304
827 Ga0500648_066618 3300053097 Bacteria 2039
828 Ga0500554_021852 3300053102 Bacteria 1780
829 Ga0500558_192725 3300053106 Bacteria 717
830 Ga0500572_000674 3300053111 Bacteria 11241
831 Ga0500591_106953 3300053115 Bacteria 1182
832 Ga0500595_000152 3300053119 Bacteria 45452
833 Ga0500595_028536 3300053119 Bacteria 1902
834 Ga0500608_078816 3300053122 Bacteria 1557
835 Ga0500608_306052 3300053122 Bacteria 587
836 Ga0500614_182106 3300053123 Bacteria 643
837 Ga0500628_111595 3300053129 Bacteria 734
838 Ga0500559_0002479 3300053136 Bacteria 9523
839 Ga0500559_0012860 3300053136 Bacteria 3551
840 Ga0500559_0036407 3300053136 Bacteria 2129
841 Ga0500559_0272142 3300053136 Bacteria 797
842 Ga0500559_0359400 3300053136 Bacteria 680
843 Ga0500585_129378 3300053144 Bacteria 895
844 Ga0500590_086891 3300053148 Bacteria 1525
845 Ga0500590_087739 3300053148 Bacteria 1516
846 Ga0500603_000582 3300053150 Bacteria 9153
847 Ga0500603_007518 3300053150 Bacteria 2395
848 Ga0500630_000571 3300053159 Bacteria 16714
849 Ga0500638_000086 3300053162 Bacteria 16892
850 Ga0500638_012783 3300053162 Bacteria 3774
851 Ga0500639_000016 3300053163 Bacteria 118099
852 Ga0500639_182966 3300053163 Bacteria 923
853 Ga0500636_0041402 3300053177 Bacteria 2724
854 Ga0500636_0116929 3300053177 Bacteria 1500
855 Ga0500637_0005306 3300053178 Bacteria 6228
856 Ga0500637_0009759 3300053178 Bacteria 4900
857 Ga0500637_0111738 3300053178 Bacteria 1584
858 Ga0500637_0134233 3300053178 Bacteria 1434
859 Ga0500657_197405 3300053728 Bacteria 673
860 Ga0500645_023416 3300053730 Bacteria 1892
861 Ga0500596_005726 3300053735 Bacteria 2156
862 Ga0501084_0008032 3300054114 Bacteria 8689
863 Ga0501084_0445126 3300054114 Bacteria 1095
864 Ga0501084_0943383 3300054114 Bacteria 725
865 Ga0500661_000398 3300055283 Bacteria 8059
866 Ga0501082_0235365 3300060353 Bacteria 1594
867 Ga0466962_0069129 3300061719 Bacteria 1687
868 Ga0530510_0119136 3300061734 Bacteria 1937

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_550992_c1 nmdc:mga0rr50_550992_c1_611_967 113
2 3300006173 Ga0070716_100075601 Ga0070716_1000756013 121
3 3300017792 Ga0163161_10146480 Ga0163161_101464803 121
4 3300025939 Ga0207665_10139383 Ga0207665_101393832 121
5 3300046455 Ga0495603_0101732 Ga0495603_0101732_868_1341 121
6 3300046513 Ga0495616_0295645 Ga0495616_0295645_66_539 121
7 3300048904 Ga0496101_0111706 Ga0496101_0111706_156_629 121
8 3300035119 Ga0373956_0528114 Ga0373956_0528114_70_543 123
9 3300036401 Ga0373937_0598382 Ga0373937_0598382_114_587 123
10 3300048903 Ga0496100_0913220 Ga0496100_0913220_92_571 123
11 3300048904 Ga0496101_1268995 Ga0496101_1268995_65_544 123
12 3300025907 Ga0207645_10444414 Ga0207645_104444142 128
13 3300046461 Ga0495641_0044832 Ga0495641_0044832_870_1334 128
14 3300046472 Ga0495580_0085589 Ga0495580_0085589_1629_2093 128
15 3300005336 Ga0070680_100310978 Ga0070680_1003109782 129
16 3300005458 Ga0070681_10158175 Ga0070681_101581753 129
17 3300025912 Ga0207707_10098146 Ga0207707_100981462 129
18 3300025917 Ga0207660_10699397 Ga0207660_106993972 129
19 3300025944 Ga0207661_11025876 Ga0207661_110258761 129
20 3300039437 Ga0436365_0926888 Ga0436365_0926888_946_1410 129
21 3300039450 Ga0436363_0538725 Ga0436363_0538725_127_591 129
22 3300041494 Ga0451837_0149782 Ga0451837_0149782_73_543 129
23 3300009545 Ga0105237_11625872 Ga0105237_116258722 130
24 3300031730 Ga0307516_10161420 Ga0307516_101614202 130
25 3300039453 Ga0436362_0818857 Ga0436362_0818857_72_509 130
26 3300046477 Ga0495664_0245197 Ga0495664_0245197_121_594 130
27 3300046543 Ga0495645_0252854 Ga0495645_0252854_441_914 130
28 3300047319 Ga0495674_0233939 Ga0495674_0233939_837_1310 130
29 3300053077 Ga0495601_0144509 Ga0495601_0144509_440_913 130
30 3300053078 Ga0495612_0025001 Ga0495612_0025001_1384_1857 130
31 3300005327 Ga0070658_10171288 Ga0070658_101712883 131
32 3300005335 Ga0070666_10370711 Ga0070666_103707111 131
33 3300005356 Ga0070674_100521125 Ga0070674_1005211252 131
34 3300005985 Ga0081539_10122286 Ga0081539_101222862 131
35 3300006038 Ga0075365_10179834 Ga0075365_101798342 131
36 3300006178 Ga0075367_10227816 Ga0075367_102278161 131
37 3300006353 Ga0075370_10513060 Ga0075370_105130602 131
38 3300013308 Ga0157375_10333275 Ga0157375_103332751 131
39 3300025915 Ga0207693_10604283 Ga0207693_106042831 131
40 3300025931 Ga0207644_10186533 Ga0207644_101865333 131
41 3300026121 Ga0207683_10048423 Ga0207683_100484233 131
42 3300050490 nmdc:mga03n38_295254_c1 nmdc:mga03n38_295254_c1_375_845 131
43 3300050516 nmdc:mga0sz30_97539_c1 nmdc:mga0sz30_97539_c1_756_1226 131
44 3300003659 JGI25404J52841_10003688 JGI25404J52841_100036882 132
45 3300005367 Ga0070667_101844773 Ga0070667_1018447731 132
46 3300005548 Ga0070665_100401630 Ga0070665_1004016302 132
47 3300005841 Ga0068863_100050091 Ga0068863_1000500914 132
48 3300005983 Ga0081540_1001395 Ga0081540_100139513 132
49 3300009545 Ga0105237_10118949 Ga0105237_101189492 132
50 3300025914 Ga0207671_10116267 Ga0207671_101162672 132
51 3300026088 Ga0207641_10039952 Ga0207641_100399523 132
52 3300028379 Ga0268266_10629846 Ga0268266_106298461 132
53 3300031730 Ga0307516_10409092 Ga0307516_104090922 132
54 3300053097 Ga0500648_052854 Ga0500648_052854_1157_1630 132
55 3300053136 Ga0500559_0012860 Ga0500559_0012860_28_501 132
56 3300053177 Ga0500636_0041402 Ga0500636_0041402_1462_1935 132
57 3300001979 JGI24740J21852_10159770 JGI24740J21852_101597701 133
58 3300005334 Ga0068869_100094348 Ga0068869_1000943483 133
59 3300005337 Ga0070682_100307357 Ga0070682_1003073572 133
60 3300005338 Ga0068868_100173474 Ga0068868_1001734743 133
61 3300005455 Ga0070663_100034607 Ga0070663_1000346073 133
62 3300005457 Ga0070662_100744628 Ga0070662_1007446281 133
63 3300005535 Ga0070684_100124186 Ga0070684_1001241862 133
64 3300005618 Ga0068864_100049091 Ga0068864_1000490913 133
65 3300005842 Ga0068858_100585417 Ga0068858_1005854172 133
66 3300006028 Ga0070717_11718690 Ga0070717_117186901 133
67 3300006038 Ga0075365_10174618 Ga0075365_101746182 133
68 3300006175 Ga0070712_100062890 Ga0070712_1000628902 133
69 3300006178 Ga0075367_10155277 Ga0075367_101552772 133
70 3300006358 Ga0068871_100020724 Ga0068871_1000207244 133
71 3300009098 Ga0105245_10010375 Ga0105245_100103756 133
72 3300009101 Ga0105247_10445282 Ga0105247_104452822 133
73 3300009176 Ga0105242_10133265 Ga0105242_101332653 133
74 3300009551 Ga0105238_12384899 Ga0105238_123848991 133
75 3300010375 Ga0105239_10063610 Ga0105239_100636102 133
76 3300011119 Ga0105246_10004587 Ga0105246_100045873 133
77 3300013296 Ga0157374_10007971 Ga0157374_100079713 133
78 3300013306 Ga0163162_10031396 Ga0163162_100313963 133
79 3300014325 Ga0163163_10067632 Ga0163163_100676322 133
80 3300014969 Ga0157376_10021927 Ga0157376_100219273 133
81 3300017792 Ga0163161_11102398 Ga0163161_111023982 133
82 3300025315 Ga0207697_10097187 Ga0207697_100971872 133
83 3300025915 Ga0207693_10029129 Ga0207693_100291292 133
84 3300025927 Ga0207687_10091887 Ga0207687_100918873 133
85 3300025928 Ga0207700_10542432 Ga0207700_105424322 133
86 3300025942 Ga0207689_10118168 Ga0207689_101181683 133
87 3300025945 Ga0207679_10089987 Ga0207679_100899873 133
88 3300025960 Ga0207651_10167591 Ga0207651_101675913 133
89 3300026023 Ga0207677_10105095 Ga0207677_101050952 133
90 3300026067 Ga0207678_10085203 Ga0207678_100852032 133
91 3300026095 Ga0207676_10195304 Ga0207676_101953043 133
92 3300028379 Ga0268266_10026648 Ga0268266_100266483 133
93 3300037068 Ga0373925_1224651 Ga0373925_1224651_87_554 133
94 3300048903 Ga0496100_0005558 Ga0496100_0005558_4167_4634 133
95 3300048904 Ga0496101_0006237 Ga0496101_0006237_1859_2326 133
96 3300048905 Ga0496102_0002444 Ga0496102_0002444_1955_2422 133
97 3300048906 Ga0496103_0077882 Ga0496103_0077882_363_830 133
98 3300048907 Ga0496104_0004215 Ga0496104_0004215_3944_4411 133
99 3300048908 Ga0496105_0008253 Ga0496105_0008253_2710_3177 133
100 3300048910 Ga0496107_0006772 Ga0496107_0006772_7104_7571 133
101 3300048911 Ga0496108_0008972 Ga0496108_0008972_3660_4127 133
102 3300048912 Ga0496109_0031689 Ga0496109_0031689_1247_1714 133
103 3300048913 Ga0496110_0006362 Ga0496110_0006362_1218_1685 133
104 3300048914 Ga0496111_0039295 Ga0496111_0039295_910_1377 133
105 3300048915 Ga0496112_0009417 Ga0496112_0009417_4072_4539 133
106 3300048917 Ga0496114_0015589 Ga0496114_0015589_1516_1983 133
107 3300048918 Ga0496115_0004586 Ga0496115_0004586_3306_3773 133
108 3300005329 Ga0070683_101072321 Ga0070683_1010723211 134
109 3300005330 Ga0070690_100123939 Ga0070690_1001239391 134
110 3300005334 Ga0068869_100962100 Ga0068869_1009621002 134
111 3300005340 Ga0070689_100531686 Ga0070689_1005316862 134
112 3300005343 Ga0070687_100236636 Ga0070687_1002366362 134
113 3300005345 Ga0070692_10141081 Ga0070692_101410812 134
114 3300005355 Ga0070671_100058408 Ga0070671_1000584083 134
115 3300005356 Ga0070674_100053701 Ga0070674_1000537011 134
116 3300005365 Ga0070688_100005941 Ga0070688_1000059415 134
117 3300005441 Ga0070700_100213896 Ga0070700_1002138962 134
118 3300005441 Ga0070700_100549624 Ga0070700_1005496241 134
119 3300005456 Ga0070678_100098322 Ga0070678_1000983222 134
120 3300005457 Ga0070662_100274675 Ga0070662_1002746752 134
121 3300005466 Ga0070685_10098612 Ga0070685_100986122 134
122 3300005543 Ga0070672_100142688 Ga0070672_1001426882 134
123 3300005544 Ga0070686_100069621 Ga0070686_1000696212 134
124 3300005564 Ga0070664_101431136 Ga0070664_1014311362 134
125 3300005616 Ga0068852_101942547 Ga0068852_1019425472 134
126 3300005842 Ga0068858_100607961 Ga0068858_1006079612 134
127 3300006173 Ga0070716_100250221 Ga0070716_1002502211 134
128 3300006237 Ga0097621_100901153 Ga0097621_1009011532 134
129 3300006358 Ga0068871_100042693 Ga0068871_1000426933 134
130 3300006871 Ga0075434_100090377 Ga0075434_1000903771 134
131 3300009553 Ga0105249_10669938 Ga0105249_106699382 134
132 3300010159 Ga0099796_10204827 Ga0099796_102048272 134
133 3300013297 Ga0157378_11705483 Ga0157378_117054832 134
134 3300014325 Ga0163163_10263359 Ga0163163_102633592 134
135 3300025908 Ga0207643_10078551 Ga0207643_100785512 134
136 3300025918 Ga0207662_10223347 Ga0207662_102233472 134
137 3300025926 Ga0207659_10352321 Ga0207659_103523212 134
138 3300025931 Ga0207644_10018588 Ga0207644_100185884 134
139 3300025936 Ga0207670_10008541 Ga0207670_100085413 134
140 3300025939 Ga0207665_10155006 Ga0207665_101550062 134
141 3300025944 Ga0207661_10960747 Ga0207661_109607472 134
142 3300025960 Ga0207651_10122348 Ga0207651_101223481 134
143 3300025961 Ga0207712_11022993 Ga0207712_110229932 134
144 3300026075 Ga0207708_10615165 Ga0207708_106151652 134
145 3300026075 Ga0207708_10857560 Ga0207708_108575601 134
146 3300028381 Ga0268264_10178480 Ga0268264_101784802 134
147 3300031995 Ga0307409_101303873 Ga0307409_1013038731 134
148 3300035241 Ga0373961_0094618 Ga0373961_0094618_123_548 134
149 3300035691 Ga0373931_0083407 Ga0373931_0083407_81_506 134
150 3300039438 Ga0436360_0670966 Ga0436360_0670966_411_857 134
151 3300048903 Ga0496100_1659527 Ga0496100_1659527_16_462 134
152 3300050512 nmdc:mga0n895_132806_c1 nmdc:mga0n895_132806_c1_127_573 134
153 3300053084 Ga0495595_0426778 Ga0495595_0426778_175_600 134
154 3300005338 Ga0068868_100307046 Ga0068868_1003070462 135
155 3300005354 Ga0070675_100621497 Ga0070675_1006214972 135
156 3300005364 Ga0070673_100722654 Ga0070673_1007226542 135
157 3300013297 Ga0157378_10826258 Ga0157378_108262581 135
158 3300025908 Ga0207643_10393508 Ga0207643_103935081 135
159 3300025926 Ga0207659_10550473 Ga0207659_105504732 135
160 3300025960 Ga0207651_10881743 Ga0207651_108817432 135
161 3300039450 Ga0436363_0529468 Ga0436363_0529468_234_680 135
162 3300046511 Ga0495608_0541959 Ga0495608_0541959_33_509 135
163 3300053730 Ga0500645_023416 Ga0500645_023416_363_836 135
164 3300005843 Ga0068860_100000435 Ga0068860_10000043550 137
165 3300005843 Ga0068860_100831490 Ga0068860_1008314902 137
166 3300005844 Ga0068862_100908500 Ga0068862_1009085001 137
167 3300006237 Ga0097621_100242238 Ga0097621_1002422382 137
168 3300011119 Ga0105246_10286227 Ga0105246_102862272 137
169 3300028381 Ga0268264_10000093 Ga0268264_10000093205 137
170 3300028381 Ga0268264_10738702 Ga0268264_107387022 137
171 3300031507 Ga0307509_10250115 Ga0307509_102501152 137
172 3300031911 Ga0307412_10822095 Ga0307412_108220952 137
173 3300046533 Ga0495640_0013662 Ga0495640_0013662_641_1123 137
174 3300005985 Ga0081539_10004350 Ga0081539_1000435010 138
175 3300006847 Ga0075431_101180052 Ga0075431_1011800521 138
176 3300045976 Ga0466967_0433695 Ga0466967_0433695_183_623 138
177 3300005331 Ga0070670_100762239 Ga0070670_1007622392 139
178 3300006175 Ga0070712_101102789 Ga0070712_1011027892 139
179 3300009148 Ga0105243_12815858 Ga0105243_128158581 139
180 3300039437 Ga0436365_0800516 Ga0436365_0800516_133_558 139
181 3300046809 Ga0495600_0587577 Ga0495600_0587577_142_612 139
182 3300053077 Ga0495601_0061457 Ga0495601_0061457_1453_1923 139
183 3300053122 Ga0500608_306052 Ga0500608_306052_89_559 139
184 3300005347 Ga0070668_100720672 Ga0070668_1007206722 140
185 3300005937 Ga0081455_10013247 Ga0081455_100132474 140
186 3300009093 Ga0105240_10126409 Ga0105240_101264092 140
187 3300025913 Ga0207695_10471501 Ga0207695_104715012 140
188 3300025972 Ga0207668_11122512 Ga0207668_111225122 140
189 3300048903 Ga0496100_0079263 Ga0496100_0079263_1002_1472 140
190 3300048904 Ga0496101_0183028 Ga0496101_0183028_911_1381 140
191 3300048907 Ga0496104_0135359 Ga0496104_0135359_995_1465 140
192 3300048909 Ga0496106_0045251 Ga0496106_0045251_1072_1542 140
193 3300048910 Ga0496107_0063699 Ga0496107_0063699_826_1296 140
194 3300048911 Ga0496108_0286731 Ga0496108_0286731_845_1315 140
195 3300048917 Ga0496114_0097491 Ga0496114_0097491_833_1303 140
196 3300049568 Ga0501031_0020234 Ga0501031_0020234_363_833 140
197 3300049569 Ga0501032_0021467 Ga0501032_0021467_3483_3953 140
198 3300049570 Ga0501033_0000523 Ga0501033_0000523_35143_35613 140
199 3300049571 Ga0501034_0204299 Ga0501034_0204299_1151_1621 140
200 3300049572 Ga0501036_0306245 Ga0501036_0306245_548_1018 140
201 3300049573 Ga0501037_0029153 Ga0501037_0029153_2742_3212 140
202 3300049573 Ga0501037_0029275 Ga0501037_0029275_1150_1620 140
203 3300049574 Ga0501038_0609104 Ga0501038_0609104_18_488 140
204 3300049575 Ga0501039_0035260 Ga0501039_0035260_2250_2720 140
205 3300049577 Ga0501041_0027198 Ga0501041_0027198_2164_2634 140
206 3300049578 Ga0501042_0210193 Ga0501042_0210193_129_599 140
207 3300049578 Ga0501042_1254755 Ga0501042_1254755_24_494 140
208 3300049579 Ga0501043_0005228 Ga0501043_0005228_5614_6084 140
209 3300049580 Ga0501046_0048182 Ga0501046_0048182_1744_2214 140
210 3300049581 Ga0501047_0136998 Ga0501047_0136998_992_1462 140
211 3300049582 Ga0501048_0117599 Ga0501048_0117599_668_1138 140
212 3300049583 Ga0501067_0338194 Ga0501067_0338194_164_634 140
213 3300049584 Ga0501068_0043563 Ga0501068_0043563_1086_1556 140
214 3300049586 Ga0501070_0240752 Ga0501070_0240752_470_940 140
215 3300049587 Ga0501071_0103123 Ga0501071_0103123_1174_1644 140
216 3300049589 Ga0501073_0053449 Ga0501073_0053449_1358_1828 140
217 3300049590 Ga0501074_0490107 Ga0501074_0490107_115_585 140
218 3300049591 Ga0501075_0337392 Ga0501075_0337392_343_813 140
219 3300049592 Ga0501076_0153496 Ga0501076_0153496_834_1304 140
220 3300049593 Ga0501077_0019240 Ga0501077_0019240_1449_1919 140
221 3300049741 Ga0501079_0101678 Ga0501079_0101678_818_1288 140
222 3300049742 Ga0501080_0045469 Ga0501080_0045469_1391_1861 140
223 3300049743 Ga0501081_0073183 Ga0501081_0073183_1380_1850 140
224 3300049744 Ga0501083_0211890 Ga0501083_0211890_399_869 140
225 3300049822 Ga0501035_0109979 Ga0501035_0109979_805_1275 140
226 3300049822 Ga0501035_0247338 Ga0501035_0247338_681_1151 140
227 3300049823 Ga0501044_0016829 Ga0501044_0016829_2830_3300 140
228 3300049823 Ga0501044_0381989 Ga0501044_0381989_343_813 140
229 3300053077 Ga0495601_0093334 Ga0495601_0093334_876_1349 140
230 3300053097 Ga0500648_066618 Ga0500648_066618_670_1143 140
231 3300053106 Ga0500558_192725 Ga0500558_192725_11_484 140
232 3300053136 Ga0500559_0359400 Ga0500559_0359400_152_625 140
233 3300053735 Ga0500596_005726 Ga0500596_005726_1557_2030 140
234 3300005444 Ga0070694_101376505 Ga0070694_1013765051 141
235 3300025929 Ga0207664_10909507 Ga0207664_109095072 141
236 3300035119 Ga0373956_0047415 Ga0373956_0047415_885_1352 141
237 3300035692 Ga0373935_0068458 Ga0373935_0068458_687_1154 141
238 3300035695 Ga0373927_0052978 Ga0373927_0052978_1133_1600 141
239 3300035724 Ga0373933_0004722 Ga0373933_0004722_2410_2877 141
240 3300046454 Ga0495592_0006852 Ga0495592_0006852_1367_1834 141
241 3300046511 Ga0495608_0002194 Ga0495608_0002194_588_1055 141
242 3300046529 Ga0495652_0001117 Ga0495652_0001117_13951_14418 141
243 3300046543 Ga0495645_0022506 Ga0495645_0022506_83_550 141
244 3300046559 Ga0495667_0001890 Ga0495667_0001890_942_1409 141
245 3300046675 Ga0495657_0014186 Ga0495657_0014186_775_1242 141
246 3300046678 Ga0495599_0004705 Ga0495599_0004705_4590_5057 141
247 3300047322 Ga0495680_0002310 Ga0495680_0002310_3159_3626 141
248 3300048088 Ga0495602_0001747 Ga0495602_0001747_14483_14950 141
249 3300048905 Ga0496102_0130392 Ga0496102_0130392_1275_1739 141
250 3300048907 Ga0496104_0666798 Ga0496104_0666798_179_643 141
251 3300048910 Ga0496107_0493880 Ga0496107_0493880_317_781 141
252 3300048915 Ga0496112_0382543 Ga0496112_0382543_228_692 141
253 3300048917 Ga0496114_0693953 Ga0496114_0693953_324_788 141
254 3300049568 Ga0501031_0398278 Ga0501031_0398278_303_779 141
255 3300049569 Ga0501032_0000068 Ga0501032_0000068_87963_88439 141
256 3300049569 Ga0501032_0067268 Ga0501032_0067268_1741_2217 141
257 3300049570 Ga0501033_0000274 Ga0501033_0000274_2478_2954 141
258 3300049570 Ga0501033_0007813 Ga0501033_0007813_2382_2858 141
259 3300049571 Ga0501034_0000790 Ga0501034_0000790_46252_46728 141
260 3300049571 Ga0501034_0119962 Ga0501034_0119962_1358_1834 141
261 3300049572 Ga0501036_0000203 Ga0501036_0000203_1078_1554 141
262 3300049573 Ga0501037_0000109 Ga0501037_0000109_2333_2809 141
263 3300049573 Ga0501037_0026542 Ga0501037_0026542_684_1160 141
264 3300049573 Ga0501037_0292989 Ga0501037_0292989_459_935 141
265 3300049574 Ga0501038_0000028 Ga0501038_0000028_138102_138578 141
266 3300049574 Ga0501038_0002060 Ga0501038_0002060_8019_8495 141
267 3300049574 Ga0501038_0027293 Ga0501038_0027293_564_1040 141
268 3300049574 Ga0501038_0030228 Ga0501038_0030228_969_1445 141
269 3300049575 Ga0501039_0000005 Ga0501039_0000005_289815_290291 141
270 3300049575 Ga0501039_0046990 Ga0501039_0046990_1891_2367 141
271 3300049575 Ga0501039_0299379 Ga0501039_0299379_733_1209 141
272 3300049576 Ga0501040_0055226 Ga0501040_0055226_1822_2298 141
273 3300049578 Ga0501042_0019889 Ga0501042_0019889_684_1160 141
274 3300049578 Ga0501042_0082553 Ga0501042_0082553_979_1455 141
275 3300049579 Ga0501043_0000122 Ga0501043_0000122_8348_8824 141
276 3300049579 Ga0501043_0034754 Ga0501043_0034754_2952_3428 141
277 3300049579 Ga0501043_0321070 Ga0501043_0321070_131_613 141
278 3300049580 Ga0501046_0000032 Ga0501046_0000032_4733_5209 141
279 3300049581 Ga0501047_0000543 Ga0501047_0000543_2509_2985 141
280 3300049581 Ga0501047_0131111 Ga0501047_0131111_282_758 141
281 3300049581 Ga0501047_0425278 Ga0501047_0425278_91_567 141
282 3300049582 Ga0501048_0010200 Ga0501048_0010200_425_901 141
283 3300049582 Ga0501048_0348836 Ga0501048_0348836_154_630 141
284 3300049583 Ga0501067_0012822 Ga0501067_0012822_4118_4594 141
285 3300049583 Ga0501067_0033173 Ga0501067_0033173_561_1037 141
286 3300049584 Ga0501068_0084939 Ga0501068_0084939_766_1242 141
287 3300049584 Ga0501068_0294300 Ga0501068_0294300_34_510 141
288 3300049585 Ga0501069_0020617 Ga0501069_0020617_2551_3027 141
289 3300049586 Ga0501070_0000152 Ga0501070_0000152_1421_1897 141
290 3300049587 Ga0501071_0190696 Ga0501071_0190696_996_1472 141
291 3300049587 Ga0501071_1136029 Ga0501071_1136029_83_559 141
292 3300049588 Ga0501072_0094544 Ga0501072_0094544_1316_1792 141
293 3300049589 Ga0501073_0089627 Ga0501073_0089627_467_943 141
294 3300049589 Ga0501073_0207098 Ga0501073_0207098_684_1160 141
295 3300049590 Ga0501074_0011814 Ga0501074_0011814_2437_2913 141
296 3300049590 Ga0501074_0030336 Ga0501074_0030336_596_1072 141
297 3300049741 Ga0501079_0043737 Ga0501079_0043737_2780_3256 141
298 3300049741 Ga0501079_0082251 Ga0501079_0082251_761_1237 141
299 3300049742 Ga0501080_0000104 Ga0501080_0000104_10087_10563 141
300 3300049742 Ga0501080_0111172 Ga0501080_0111172_1868_2344 141
301 3300049744 Ga0501083_0019454 Ga0501083_0019454_2432_2908 141
302 3300049822 Ga0501035_0000016 Ga0501035_0000016_231798_232274 141
303 3300049822 Ga0501035_0091957 Ga0501035_0091957_684_1160 141
304 3300049823 Ga0501044_0000657 Ga0501044_0000657_5422_5898 141
305 3300049823 Ga0501044_0041827 Ga0501044_0041827_3528_4004 141
306 3300049823 Ga0501044_0153070 Ga0501044_0153070_1763_2239 141
307 3300049824 Ga0501045_0012225 Ga0501045_0012225_3658_4134 141
308 3300049824 Ga0501045_0129276 Ga0501045_0129276_467_943 141
309 3300053078 Ga0495612_0002483 Ga0495612_0002483_5892_6359 141
310 3300053084 Ga0495595_0001562 Ga0495595_0001562_7136_7603 141
311 3300054114 Ga0501084_0445126 Ga0501084_0445126_495_971 141
312 3300054114 Ga0501084_0943383 Ga0501084_0943383_176_652 141
313 3300061734 Ga0530510_0119136 Ga0530510_0119136_1149_1625 141
314 3300003659 JGI25404J52841_10000065 JGI25404J52841_100000653 142
315 3300005937 Ga0081455_10035346 Ga0081455_100353463 142
316 3300005983 Ga0081540_1001807 Ga0081540_100180710 142
317 3300006852 Ga0075433_10656056 Ga0075433_106560562 142
318 3300009093 Ga0105240_10532978 Ga0105240_105329781 142
319 3300005434 Ga0070709_11428067 Ga0070709_114280671 143
320 3300006178 Ga0075367_10051329 Ga0075367_100513293 143
321 3300046680 Ga0495646_0166781 Ga0495646_0166781_113_550 143
322 3300050494 nmdc:mga06z11_466386_c1 nmdc:mga06z11_466386_c1_228_716 143
323 3300005436 Ga0070713_100050453 Ga0070713_1000504533 144
324 3300005439 Ga0070711_100797184 Ga0070711_1007971841 144
325 3300006028 Ga0070717_10767129 Ga0070717_107671292 144
326 3300025915 Ga0207693_10102044 Ga0207693_101020443 144
327 3300025916 Ga0207663_10227370 Ga0207663_102273702 144
328 3300025928 Ga0207700_10340756 Ga0207700_103407562 144
329 3300025939 Ga0207665_10127819 Ga0207665_101278192 144
330 3300026088 Ga0207641_11428799 Ga0207641_114287992 144
331 3300035083 Ga0373926_0024022 Ga0373926_0024022_1510_1947 144
332 3300035086 Ga0373934_0031073 Ga0373934_0031073_539_976 144
333 3300035089 Ga0373944_0033628 Ga0373944_0033628_200_637 144
334 3300035111 Ga0373923_0014524 Ga0373923_0014524_1174_1611 144
335 3300035113 Ga0373936_0001544 Ga0373936_0001544_2872_3309 144
336 3300035116 Ga0373945_0002222 Ga0373945_0002222_1664_2101 144
337 3300035117 Ga0373953_0004109 Ga0373953_0004109_2822_3259 144
338 3300035118 Ga0373954_0003114 Ga0373954_0003114_2504_2941 144
339 3300035119 Ga0373956_0028583 Ga0373956_0028583_929_1366 144
340 3300035120 Ga0373957_0018766 Ga0373957_0018766_187_624 144
341 3300035170 Ga0373943_0022807 Ga0373943_0022807_348_785 144
342 3300035171 Ga0373946_0001948 Ga0373946_0001948_2060_2497 144
343 3300035172 Ga0373955_0000039 Ga0373955_0000039_15859_16296 144
344 3300035410 Ga0373924_0004875 Ga0373924_0004875_596_1033 144
345 3300035692 Ga0373935_0000079 Ga0373935_0000079_34635_35072 144
346 3300035695 Ga0373927_0017668 Ga0373927_0017668_2527_2964 144
347 3300035724 Ga0373933_0010172 Ga0373933_0010172_3447_3884 144
348 3300035725 Ga0373947_0003920 Ga0373947_0003920_3659_4096 144
349 3300036401 Ga0373937_0000223 Ga0373937_0000223_9389_9826 144
350 3300037068 Ga0373925_0000002 Ga0373925_0000002_339800_340237 144
351 3300046454 Ga0495592_0000475 Ga0495592_0000475_22713_23150 144
352 3300046459 Ga0495629_0007003 Ga0495629_0007003_6139_6576 144
353 3300046461 Ga0495641_0362520 Ga0495641_0362520_63_500 144
354 3300046462 Ga0495651_0005638 Ga0495651_0005638_7686_8123 144
355 3300046463 Ga0495653_0000006 Ga0495653_0000006_339948_340385 144
356 3300046473 Ga0495582_0121260 Ga0495582_0121260_667_1104 144
357 3300046476 Ga0495662_0001775 Ga0495662_0001775_8709_9146 144
358 3300046477 Ga0495664_0000002 Ga0495664_0000002_375582_376019 144
359 3300046511 Ga0495608_0000009 Ga0495608_0000009_104416_104853 144
360 3300046514 Ga0495618_0000005 Ga0495618_0000005_152941_153378 144
361 3300046516 Ga0495628_0000002 Ga0495628_0000002_339967_340404 144
362 3300046517 Ga0495630_0000240 Ga0495630_0000240_31585_32022 144
363 3300046529 Ga0495652_0000004 Ga0495652_0000004_248479_248916 144
364 3300046531 Ga0495665_0130344 Ga0495665_0130344_292_729 144
365 3300046533 Ga0495640_0000005 Ga0495640_0000005_104431_104868 144
366 3300046535 Ga0495586_0034576 Ga0495586_0034576_180_617 144
367 3300046536 Ga0495587_0000007 Ga0495587_0000007_213374_213811 144
368 3300046543 Ga0495645_0000003 Ga0495645_0000003_321218_321655 144
369 3300046559 Ga0495667_0000002 Ga0495667_0000002_97319_97756 144
370 3300046615 Ga0495656_0052411 Ga0495656_0052411_128_598 144
371 3300046642 Ga0495634_0000129 Ga0495634_0000129_6234_6671 144
372 3300046663 Ga0495635_0000020 Ga0495635_0000020_149340_149777 144
373 3300046675 Ga0495657_0000240 Ga0495657_0000240_5177_5614 144
374 3300046678 Ga0495599_0000001 Ga0495599_0000001_478645_479082 144
375 3300046679 Ga0495623_0000001 Ga0495623_0000001_247590_248027 144
376 3300046680 Ga0495646_0000013 Ga0495646_0000013_98223_98660 144
377 3300046683 Ga0495658_0497733 Ga0495658_0497733_38_475 144
378 3300046689 Ga0495613_0080447 Ga0495613_0080447_1693_2130 144
379 3300046809 Ga0495600_0000041 Ga0495600_0000041_57212_57649 144
380 3300047315 Ga0495581_0044348 Ga0495581_0044348_544_981 144
381 3300047317 Ga0495604_0000005 Ga0495604_0000005_365611_366048 144
382 3300047319 Ga0495674_0000003 Ga0495674_0000003_221722_222159 144
383 3300047321 Ga0495676_0202401 Ga0495676_0202401_395_832 144
384 3300047322 Ga0495680_0000002 Ga0495680_0000002_143034_143471 144
385 3300047444 Ga0495675_0000383 Ga0495675_0000383_27747_28184 144
386 3300047471 Ga0495684_0000020 Ga0495684_0000020_89627_90064 144
387 3300047673 Ga0495593_0004378 Ga0495593_0004378_1713_2150 144
388 3300048088 Ga0495602_0000027 Ga0495602_0000027_67527_67964 144
389 3300048089 Ga0495614_0143135 Ga0495614_0143135_410_847 144
390 3300053077 Ga0495601_0000010 Ga0495601_0000010_248433_248870 144
391 3300053078 Ga0495612_0000002 Ga0495612_0000002_251563_252000 144
392 3300053084 Ga0495595_0000110 Ga0495595_0000110_19872_20309 144
393 3300053085 Ga0495619_0000002 Ga0495619_0000002_339970_340407 144
394 iso_pu_bacteria 2513237141 2513890192 144
395 3300025900 Ga0207710_10250505 Ga0207710_102505052 145
396 3300025941 Ga0207711_10465755 Ga0207711_104657552 145
397 3300035086 Ga0373934_0004350 Ga0373934_0004350_4266_4733 145
398 3300035111 Ga0373923_0196408 Ga0373923_0196408_73_540 145
399 3300035117 Ga0373953_0000812 Ga0373953_0000812_7745_8212 145
400 3300035118 Ga0373954_0001004 Ga0373954_0001004_5063_5530 145
401 3300035119 Ga0373956_0037651 Ga0373956_0037651_452_919 145
402 3300035120 Ga0373957_0001219 Ga0373957_0001219_2408_2875 145
403 3300035120 Ga0373957_0281374 Ga0373957_0281374_71_538 145
404 3300035172 Ga0373955_0010487 Ga0373955_0010487_2563_3030 145
405 3300035410 Ga0373924_0185259 Ga0373924_0185259_256_723 145
406 3300035724 Ga0373933_0267619 Ga0373933_0267619_367_834 145
407 3300036401 Ga0373937_0016193 Ga0373937_0016193_5535_6002 145
408 3300046454 Ga0495592_0009482 Ga0495592_0009482_1339_1806 145
409 3300046459 Ga0495629_0001281 Ga0495629_0001281_16351_16818 145
410 3300046462 Ga0495651_0010558 Ga0495651_0010558_6020_6487 145
411 3300046463 Ga0495653_0003914 Ga0495653_0003914_1356_1823 145
412 3300046511 Ga0495608_0002352 Ga0495608_0002352_1377_1844 145
413 3300046514 Ga0495618_0056355 Ga0495618_0056355_283_750 145
414 3300046516 Ga0495628_0009404 Ga0495628_0009404_2308_2775 145
415 3300046529 Ga0495652_0003535 Ga0495652_0003535_7465_7932 145
416 3300046533 Ga0495640_0008340 Ga0495640_0008340_7256_7723 145
417 3300046559 Ga0495667_0020775 Ga0495667_0020775_1339_1806 145
418 3300046642 Ga0495634_0006578 Ga0495634_0006578_7824_8291 145
419 3300046663 Ga0495635_0018106 Ga0495635_0018106_1504_1971 145
420 3300046675 Ga0495657_0023164 Ga0495657_0023164_2756_3223 145
421 3300046678 Ga0495599_0025144 Ga0495599_0025144_2827_3294 145
422 3300046679 Ga0495623_0052608 Ga0495623_0052608_639_1106 145
423 3300046680 Ga0495646_0005468 Ga0495646_0005468_2624_3091 145
424 3300046809 Ga0495600_0034137 Ga0495600_0034137_339_806 145
425 3300047319 Ga0495674_0050291 Ga0495674_0050291_3028_3495 145
426 3300047322 Ga0495680_0013256 Ga0495680_0013256_5796_6263 145
427 3300047444 Ga0495675_0120178 Ga0495675_0120178_668_1135 145
428 3300047471 Ga0495684_0003601 Ga0495684_0003601_357_824 145
429 3300047673 Ga0495593_0002191 Ga0495593_0002191_9756_10223 145
430 3300048088 Ga0495602_0148139 Ga0495602_0148139_714_1181 145
431 3300053084 Ga0495595_0002197 Ga0495595_0002197_1201_1668 145
432 3300053085 Ga0495619_0028951 Ga0495619_0028951_2681_3148 145
433 iso_pu_bacteria 2922425934 2922430613 145
434 3300005328 Ga0070676_10612375 Ga0070676_106123751 146
435 3300005331 Ga0070670_100048669 Ga0070670_1000486694 146
436 3300005338 Ga0068868_101034850 Ga0068868_1010348502 146
437 3300005340 Ga0070689_100120995 Ga0070689_1001209952 146
438 3300005355 Ga0070671_100010357 Ga0070671_1000103574 146
439 3300005367 Ga0070667_100574908 Ga0070667_1005749082 146
440 3300005456 Ga0070678_100281854 Ga0070678_1002818542 146
441 3300005614 Ga0068856_100360813 Ga0068856_1003608132 146
442 3300006028 Ga0070717_10022610 Ga0070717_100226104 146
443 3300007788 Ga0099795_10063731 Ga0099795_100637312 146
444 3300009176 Ga0105242_11411741 Ga0105242_114117411 146
445 3300009177 Ga0105248_10398872 Ga0105248_103988722 146
446 3300014969 Ga0157376_11241179 Ga0157376_112411792 146
447 3300025916 Ga0207663_10147085 Ga0207663_101470852 146
448 3300025931 Ga0207644_10011377 Ga0207644_100113775 146
449 3300025936 Ga0207670_10118053 Ga0207670_101180532 146
450 3300025960 Ga0207651_10015475 Ga0207651_100154753 146
451 3300025986 Ga0207658_10697348 Ga0207658_106973482 146
452 3300026078 Ga0207702_10198787 Ga0207702_101987872 146
453 3300026121 Ga0207683_10283213 Ga0207683_102832132 146
454 3300037466 Ga0395898_0046725 Ga0395898_0046725_900_1343 146
455 3300048903 Ga0496100_0062256 Ga0496100_0062256_1678_2142 146
456 3300048912 Ga0496109_0236351 Ga0496109_0236351_806_1270 146
457 3300048913 Ga0496110_0353814 Ga0496110_0353814_434_898 146
458 3300048915 Ga0496112_0017028 Ga0496112_0017028_2759_3223 146
459 3300048915 Ga0496112_1386347 Ga0496112_1386347_108_596 146
460 3300048918 Ga0496115_0883551 Ga0496115_0883551_60_524 146
461 3300053085 Ga0495619_0167393 Ga0495619_0167393_731_1207 146
462 iso_pu_bacteria 2904690495 2904694849 146
463 iso_pu_bacteria 2908756301 2908760009 146
464 3300005535 Ga0070684_100708302 Ga0070684_1007083021 147
465 3300005563 Ga0068855_100838550 Ga0068855_1008385501 147
466 3300020610 Ga0154015_1187678 Ga0154015_11876782 147
467 3300025921 Ga0207652_11098652 Ga0207652_110986522 147
468 3300025949 Ga0207667_10334657 Ga0207667_103346572 147
469 3300026067 Ga0207678_10101390 Ga0207678_101013902 147
470 3300041456 Ga0451795_0272602 Ga0451795_0272602_233_703 147
471 3300041486 Ga0451807_2567829 Ga0451807_2567829_744_1214 147
472 3300044658 Ga0466972_0021424 Ga0466972_0021424_923_1384 147
473 3300044735 Ga0466968_0056962 Ga0466968_0056962_395_856 147
474 3300044735 Ga0466968_0404050 Ga0466968_0404050_61_522 147
475 3300044901 Ga0466960_0036712 Ga0466960_0036712_1086_1547 147
476 3300045049 Ga0466959_0567829 Ga0466959_0567829_219_680 147
477 iso_pu_bacteria 2513237096 2513657098 147
478 iso_pu_bacteria 2513237137 2513855540 147
479 iso_pu_bacteria 2513237145 2513918838 147
480 iso_pu_bacteria 2517572143 2517892085 147
481 iso_pu_bacteria 2524023228 2524534169 147
482 iso_pu_bacteria 2667528175 2671121877 147
483 iso_pu_bacteria 2791355197 2793068830 147
484 iso_pu_bacteria 2885374607 2885381723 147
485 iso_pu_bacteria 2906610324 2906617215 147
486 iso_pu_bacteria 2906635258 2906643395 147
487 iso_pu_bacteria 2906660503 2906662474 147
488 iso_pu_bacteria 2908739725 2908742365 147
489 iso_pu_bacteria 2935630451 2935631222 147
490 iso_pu_bacteria 2941507105 2941509963 147
491 iso_pu_bacteria 2941515067 2941518950 147
492 iso_pu_bacteria 2941523033 2941525362 147
493 iso_pu_bacteria 3005474847 3005480524 147
494 iso_pu_bacteria 8019555841 8019556235 147
495 iso_pu_bacteria 8019565922 8019569074 147
496 iso_pu_bacteria 8056689827 8056694258 147
497 3300005364 Ga0070673_101336152 Ga0070673_1013361522 148
498 3300006028 Ga0070717_10006180 Ga0070717_100061807 148
499 3300031238 Ga0265332_10005559 Ga0265332_100055595 148
500 3300031712 Ga0265342_10119550 Ga0265342_101195502 148
501 3300036459 Ga0372808_012212 Ga0372808_012212_587_1045 148
502 3300039447 Ga0436361_1216747 Ga0436361_1216747_170_616 148
503 3300053129 Ga0500628_111595 Ga0500628_111595_139_591 148
504 iso_pu_bacteria 2824704595 2824714258 148
505 iso_pu_bacteria 2824753945 2824754274 148
506 iso_pu_bacteria 2824763712 2824767773 148
507 iso_pu_bacteria 2888419890 2888424821 148
508 iso_pu_bacteria 2904711408 2904714997 148
509 iso_pu_bacteria 2932794094 2932798069 148
510 iso_pu_bacteria 2932801729 2932807075 148
511 iso_pu_bacteria 2935883170 2935886797 148
512 iso_pu_bacteria 3005710791 3005715197 148
513 iso_pu_bacteria 8006933436 8006940252 148
514 iso_pu_bacteria 8006973647 8006980030 148
515 3300025294 Ga0209025_1010552 Ga0209025_10105522 149
516 iso_pu_bacteria 2513237098 2513674393 149
517 iso_pu_bacteria 2517093001 2517102750 149
518 iso_pu_bacteria 2524023210 2524470463 149
519 iso_pu_bacteria 2885383462 2885390824 149
520 iso_pu_bacteria 2903768456 2903773783 149
521 iso_pu_bacteria 2935959822 2935960704 149
522 iso_pu_bacteria 8056681323 8056688304 149
523 3300005336 Ga0070680_100335246 Ga0070680_1003352462 150
524 3300035724 Ga0373933_0000110 Ga0373933_0000110_1032_1484 150
525 3300048917 Ga0496114_0717352 Ga0496114_0717352_23_475 150
526 3300061719 Ga0466962_0069129 Ga0466962_0069129_1025_1483 150
527 iso_pu_bacteria 2728368998 2728753297 150
528 iso_pu_bacteria 2888388044 2888393526 150
529 3300005339 Ga0070660_101226708 Ga0070660_1012267081 151
530 3300005434 Ga0070709_10032762 Ga0070709_100327622 151
531 3300005435 Ga0070714_100004035 Ga0070714_1000040355 151
532 3300005436 Ga0070713_100002369 Ga0070713_1000023698 151
533 3300005437 Ga0070710_10000567 Ga0070710_100005674 151
534 3300005439 Ga0070711_100003229 Ga0070711_1000032292 151
535 3300006028 Ga0070717_10002140 Ga0070717_1000214012 151
536 3300006163 Ga0070715_10001480 Ga0070715_100014806 151
537 3300006173 Ga0070716_100296602 Ga0070716_1002966022 151
538 3300006175 Ga0070712_100021818 Ga0070712_1000218184 151
539 3300025898 Ga0207692_10076712 Ga0207692_100767122 151
540 3300025906 Ga0207699_10003128 Ga0207699_100031287 151
541 3300025915 Ga0207693_10000581 Ga0207693_1000058118 151
542 3300025916 Ga0207663_10000084 Ga0207663_1000008411 151
543 3300025928 Ga0207700_10062075 Ga0207700_100620752 151
544 3300025929 Ga0207664_10013665 Ga0207664_100136653 151
545 3300025939 Ga0207665_10001451 Ga0207665_1000145112 151
546 3300035725 Ga0373947_0199408 Ga0373947_0199408_30_488 151
547 3300045976 Ga0466967_0415822 Ga0466967_0415822_531_992 151
548 3300046524 Ga0495648_0006022 Ga0495648_0006022_6870_7325 151
549 iso_pu_bacteria 2513237101 2513692880 151
550 iso_pu_bacteria 2513237104 2513718464 151
551 iso_pu_bacteria 2721755755 2723844752 151
552 iso_pu_bacteria 2791355199 2793079904 151
553 iso_pu_bacteria 2874604998 2874605527 151
554 iso_pu_bacteria 2876808645 2876813046 151
555 iso_pu_bacteria 2879110137 2879115840 151
556 iso_pu_bacteria 2922361189 2922365657 151
557 iso_pu_bacteria 2922386360 2922391270 151
558 iso_pu_bacteria 8006964411 8006967005 151
559 iso_pu_bacteria 8006984368 8006987957 151
560 iso_pu_bacteria 8006994254 8006995689 151
561 iso_pu_bacteria 8056673599 8056677677 151
562 3300005548 Ga0070665_100346455 Ga0070665_1003464552 152
563 3300005614 Ga0068856_100716684 Ga0068856_1007166842 152
564 3300005983 Ga0081540_1061317 Ga0081540_10613173 152
565 3300005983 Ga0081540_1075269 Ga0081540_10752692 152
566 3300009098 Ga0105245_10175912 Ga0105245_101759122 152
567 3300025932 Ga0207690_10659082 Ga0207690_106590822 152
568 3300031235 Ga0265330_10036768 Ga0265330_100367682 152
569 3300037466 Ga0395898_0338844 Ga0395898_0338844_682_1143 152
570 3300049569 Ga0501032_0366129 Ga0501032_0366129_189_647 152
571 3300049578 Ga0501042_0067661 Ga0501042_0067661_1286_1744 152
572 3300049582 Ga0501048_1075839 Ga0501048_1075839_85_543 152
573 3300049592 Ga0501076_0098914 Ga0501076_0098914_85_543 152
574 3300049822 Ga0501035_0412736 Ga0501035_0412736_196_654 152
575 3300053094 Ga0500566_0000006 Ga0500566_0000006_89564_90022 152
576 3300053095 Ga0500640_000847 Ga0500640_000847_1512_1970 152
577 3300053111 Ga0500572_000674 Ga0500572_000674_3751_4209 152
578 3300053115 Ga0500591_106953 Ga0500591_106953_615_1073 152
579 3300053122 Ga0500608_078816 Ga0500608_078816_902_1360 152
580 3300053136 Ga0500559_0002479 Ga0500559_0002479_2058_2516 152
581 3300053144 Ga0500585_129378 Ga0500585_129378_287_745 152
582 3300053148 Ga0500590_086891 Ga0500590_086891_703_1161 152
583 3300053150 Ga0500603_000582 Ga0500603_000582_3222_3680 152
584 3300053159 Ga0500630_000571 Ga0500630_000571_6655_7113 152
585 3300053162 Ga0500638_012783 Ga0500638_012783_1528_1986 152
586 3300053163 Ga0500639_000016 Ga0500639_000016_73154_73612 152
587 3300060353 Ga0501082_0235365 Ga0501082_0235365_595_1053 152
588 iso_pu_bacteria 2906626472 2906633626 152
589 iso_pu_bacteria 8016583857 8016593181 152
590 3300005535 Ga0070684_100006295 Ga0070684_1000062959 153
591 3300005937 Ga0081455_10006778 Ga0081455_100067789 153
592 3300005985 Ga0081539_10234681 Ga0081539_102346812 153
593 3300025927 Ga0207687_10809404 Ga0207687_108094041 153
594 3300025944 Ga0207661_10001574 Ga0207661_1000157412 153
595 3300031730 Ga0307516_10501785 Ga0307516_105017851 153
596 3300035692 Ga0373935_0008213 Ga0373935_0008213_1720_2187 153
597 3300035725 Ga0373947_0597485 Ga0373947_0597485_152_619 153
598 3300037068 Ga0373925_0013463 Ga0373925_0013463_4817_5284 153
599 3300046457 Ga0495590_0135595 Ga0495590_0135595_396_857 153
600 3300046683 Ga0495658_0107561 Ga0495658_0107561_988_1455 153
601 3300046689 Ga0495613_0265426 Ga0495613_0265426_142_609 153
602 3300047673 Ga0495593_0090816 Ga0495593_0090816_1094_1561 153
603 3300048904 Ga0496101_0786063 Ga0496101_0786063_237_704 153
604 3300050514 nmdc:mga08x19_647743_c1 nmdc:mga08x19_647743_c1_71_538 153
605 3300005365 Ga0070688_100779813 Ga0070688_1007798132 154
606 3300005435 Ga0070714_100575669 Ga0070714_1005756692 154
607 3300005459 Ga0068867_101051230 Ga0068867_1010512302 154
608 3300009101 Ga0105247_10014178 Ga0105247_100141785 154
609 3300009148 Ga0105243_11078470 Ga0105243_110784702 154
610 3300013306 Ga0163162_11485112 Ga0163162_114851122 154
611 3300014326 Ga0157380_10949977 Ga0157380_109499772 154
612 3300014969 Ga0157376_10279547 Ga0157376_102795472 154
613 3300017792 Ga0163161_10494548 Ga0163161_104945482 154
614 3300025900 Ga0207710_10009231 Ga0207710_100092313 154
615 3300025923 Ga0207681_10978683 Ga0207681_109786832 154
616 3300025935 Ga0207709_11389037 Ga0207709_113890371 154
617 3300026089 Ga0207648_10675345 Ga0207648_106753451 154
618 3300026116 Ga0207674_10256881 Ga0207674_102568812 154
619 3300028381 Ga0268264_10927801 Ga0268264_109278012 154
620 3300030521 Ga0307511_10132200 Ga0307511_101322002 154
621 3300031616 Ga0307508_10198560 Ga0307508_101985602 154
622 3300031824 Ga0307413_10104304 Ga0307413_101043043 154
623 3300031995 Ga0307409_101877434 Ga0307409_1018774341 154
624 3300041459 Ga0451800_0560181 Ga0451800_0560181_564_1034 154
625 3300048923 Ga0496120_0120517 Ga0496120_0120517_577_1047 154
626 3300048929 Ga0496126_0196151 Ga0496126_0196151_717_1187 154
627 3300050492 nmdc:mga0yw44_755199_c1 nmdc:mga0yw44_755199_c1_68_535 154
628 3300053083 Ga0495655_0020575 Ga0495655_0020575_346_810 154
629 3300053136 Ga0500559_0272142 Ga0500559_0272142_220_690 154
630 3300005336 Ga0070680_100024742 Ga0070680_1000247424 155
631 3300005364 Ga0070673_100596988 Ga0070673_1005969882 155
632 3300005439 Ga0070711_100117149 Ga0070711_1001171493 155
633 3300005455 Ga0070663_101214682 Ga0070663_1012146821 155
634 3300005530 Ga0070679_100062502 Ga0070679_1000625022 155
635 3300005548 Ga0070665_100136724 Ga0070665_1001367242 155
636 3300005563 Ga0068855_100043258 Ga0068855_1000432582 155
637 3300005577 Ga0068857_101018036 Ga0068857_1010180362 155
638 3300005614 Ga0068856_100000020 Ga0068856_10000002087 155
639 3300005614 Ga0068856_100890985 Ga0068856_1008909852 155
640 3300005616 Ga0068852_100960162 Ga0068852_1009601622 155
641 3300007265 Ga0099794_10097175 Ga0099794_100971752 155
642 3300009093 Ga0105240_10180873 Ga0105240_101808732 155
643 3300009101 Ga0105247_10043912 Ga0105247_100439123 155
644 3300009174 Ga0105241_10289344 Ga0105241_102893442 155
645 3300010159 Ga0099796_10151382 Ga0099796_101513822 155
646 3300010375 Ga0105239_10154782 Ga0105239_101547823 155
647 3300013102 Ga0157371_10242204 Ga0157371_102422042 155
648 3300013104 Ga0157370_10012436 Ga0157370_100124367 155
649 3300014326 Ga0157380_10290249 Ga0157380_102902492 155
650 3300025900 Ga0207710_10117658 Ga0207710_101176582 155
651 3300025912 Ga0207707_10294711 Ga0207707_102947111 155
652 3300025913 Ga0207695_10213100 Ga0207695_102131002 155
653 3300025916 Ga0207663_10108215 Ga0207663_101082152 155
654 3300025917 Ga0207660_10683102 Ga0207660_106831022 155
655 3300025921 Ga0207652_10156454 Ga0207652_101564542 155
656 3300025949 Ga0207667_10169869 Ga0207667_101698692 155
657 3300025960 Ga0207651_10251949 Ga0207651_102519492 155
658 3300025981 Ga0207640_11417366 Ga0207640_114173661 155
659 3300026067 Ga0207678_10202766 Ga0207678_102027662 155
660 3300026078 Ga0207702_10000126 Ga0207702_1000012661 155
661 3300026142 Ga0207698_10474898 Ga0207698_104748982 155
662 3300026142 Ga0207698_10705681 Ga0207698_107056812 155
663 3300028379 Ga0268266_10389371 Ga0268266_103893712 155
664 3300030521 Ga0307511_10113901 Ga0307511_101139012 155
665 3300031235 Ga0265330_10034624 Ga0265330_100346242 155
666 3300031238 Ga0265332_10000319 Ga0265332_1000031914 155
667 3300031238 Ga0265332_10033171 Ga0265332_100331711 155
668 3300031239 Ga0265328_10156074 Ga0265328_101560741 155
669 3300031241 Ga0265325_10008748 Ga0265325_100087482 155
670 3300031241 Ga0265325_10275592 Ga0265325_102755922 155
671 3300031242 Ga0265329_10006074 Ga0265329_100060745 155
672 3300031247 Ga0265340_10006774 Ga0265340_100067745 155
673 3300031247 Ga0265340_10014937 Ga0265340_100149372 155
674 3300031249 Ga0265339_10000354 Ga0265339_100003544 155
675 3300031249 Ga0265339_10026639 Ga0265339_100266392 155
676 3300031250 Ga0265331_10041214 Ga0265331_100412142 155
677 3300031344 Ga0265316_10059968 Ga0265316_100599682 155
678 3300031344 Ga0265316_10194170 Ga0265316_101941702 155
679 3300031344 Ga0265316_10885612 Ga0265316_108856122 155
680 3300031507 Ga0307509_10418353 Ga0307509_104183532 155
681 3300031595 Ga0265313_10029007 Ga0265313_100290074 155
682 3300031595 Ga0265313_10197542 Ga0265313_101975422 155
683 3300031711 Ga0265314_10131439 Ga0265314_101314391 155
684 3300031712 Ga0265342_10000050 Ga0265342_1000005091 155
685 3300031712 Ga0265342_10065394 Ga0265342_100653941 155
686 3300031730 Ga0307516_10001650 Ga0307516_100016509 155
687 3300031730 Ga0307516_10183185 Ga0307516_101831852 155
688 3300033179 Ga0307507_10016040 Ga0307507_1001604010 155
689 3300033180 Ga0307510_10287945 Ga0307510_102879452 155
690 3300035086 Ga0373934_0073779 Ga0373934_0073779_672_1145 155
691 3300035111 Ga0373923_0161892 Ga0373923_0161892_392_865 155
692 3300035113 Ga0373936_0016127 Ga0373936_0016127_254_721 155
693 3300035113 Ga0373936_0458551 Ga0373936_0458551_61_534 155
694 3300035116 Ga0373945_0012571 Ga0373945_0012571_174_644 155
695 3300035117 Ga0373953_0010843 Ga0373953_0010843_2451_2924 155
696 3300035118 Ga0373954_0079917 Ga0373954_0079917_871_1344 155
697 3300035119 Ga0373956_0012101 Ga0373956_0012101_593_1066 155
698 3300035119 Ga0373956_0478997 Ga0373956_0478997_86_553 155
699 3300035120 Ga0373957_0312919 Ga0373957_0312919_188_655 155
700 3300035171 Ga0373946_0302535 Ga0373946_0302535_248_721 155
701 3300035172 Ga0373955_0021151 Ga0373955_0021151_288_761 155
702 3300035410 Ga0373924_0138135 Ga0373924_0138135_214_687 155
703 3300035692 Ga0373935_0032024 Ga0373935_0032024_16_489 155
704 3300035695 Ga0373927_0006278 Ga0373927_0006278_5939_6412 155
705 3300035724 Ga0373933_0012105 Ga0373933_0012105_2100_2573 155
706 3300036401 Ga0373937_0386491 Ga0373937_0386491_573_1040 155
707 3300037068 Ga0373925_0027177 Ga0373925_0027177_2310_2783 155
708 3300046454 Ga0495592_0341506 Ga0495592_0341506_260_733 155
709 3300046459 Ga0495629_0255098 Ga0495629_0255098_233_706 155
710 3300046459 Ga0495629_0402677 Ga0495629_0402677_57_530 155
711 3300046462 Ga0495651_0129083 Ga0495651_0129083_636_1109 155
712 3300046477 Ga0495664_0328231 Ga0495664_0328231_288_761 155
713 3300046516 Ga0495628_0030315 Ga0495628_0030315_3079_3552 155
714 3300046517 Ga0495630_0143217 Ga0495630_0143217_334_807 155
715 3300046529 Ga0495652_0061438 Ga0495652_0061438_311_784 155
716 3300046533 Ga0495640_0018138 Ga0495640_0018138_771_1244 155
717 3300046535 Ga0495586_0275461 Ga0495586_0275461_17_490 155
718 3300046536 Ga0495587_0048810 Ga0495587_0048810_207_680 155
719 3300046559 Ga0495667_0007037 Ga0495667_0007037_3310_3783 155
720 3300046642 Ga0495634_0039133 Ga0495634_0039133_334_807 155
721 3300046663 Ga0495635_0086616 Ga0495635_0086616_443_916 155
722 3300046674 Ga0495588_0409162 Ga0495588_0409162_137_604 155
723 3300046675 Ga0495657_0014528 Ga0495657_0014528_4562_5035 155
724 3300046678 Ga0495599_0040272 Ga0495599_0040272_248_721 155
725 3300046679 Ga0495623_0108149 Ga0495623_0108149_1156_1629 155
726 3300046680 Ga0495646_0233902 Ga0495646_0233902_248_721 155
727 3300046681 Ga0495647_0112912 Ga0495647_0112912_515_988 155
728 3300046809 Ga0495600_0032884 Ga0495600_0032884_610_1083 155
729 3300047317 Ga0495604_0017963 Ga0495604_0017963_3646_4119 155
730 3300047317 Ga0495604_0047819 Ga0495604_0047819_2819_3286 155
731 3300047319 Ga0495674_0463858 Ga0495674_0463858_116_589 155
732 3300047322 Ga0495680_0157954 Ga0495680_0157954_145_618 155
733 3300047444 Ga0495675_0283899 Ga0495675_0283899_266_739 155
734 3300047471 Ga0495684_0464766 Ga0495684_0464766_197_670 155
735 3300048088 Ga0495602_0359047 Ga0495602_0359047_230_703 155
736 3300048907 Ga0496104_0328582 Ga0496104_0328582_106_573 155
737 3300048909 Ga0496106_0000645 Ga0496106_0000645_11338_11811 155
738 3300048910 Ga0496107_0047582 Ga0496107_0047582_174_641 155
739 3300048910 Ga0496107_0321313 Ga0496107_0321313_311_784 155
740 3300048911 Ga0496108_0000515 Ga0496108_0000515_5864_6331 155
741 3300048912 Ga0496109_0002891 Ga0496109_0002891_12954_13421 155
742 3300048913 Ga0496110_0064722 Ga0496110_0064722_654_1121 155
743 3300048916 Ga0496113_0122408 Ga0496113_0122408_1057_1524 155
744 3300048918 Ga0496115_0079056 Ga0496115_0079056_2013_2480 155
745 3300048920 Ga0496117_0010119 Ga0496117_0010119_7102_7575 155
746 3300048921 Ga0496118_0007230 Ga0496118_0007230_8306_8779 155
747 3300048922 Ga0496119_0183634 Ga0496119_0183634_312_785 155
748 3300048924 Ga0496121_0001276 Ga0496121_0001276_13629_14102 155
749 3300048927 Ga0496124_0001454 Ga0496124_0001454_24575_25048 155
750 3300048928 Ga0496125_0042211 Ga0496125_0042211_1383_1856 155
751 3300048929 Ga0496126_0027808 Ga0496126_0027808_1266_1739 155
752 3300049568 Ga0501031_0013431 Ga0501031_0013431_3516_3986 155
753 3300049569 Ga0501032_0000619 Ga0501032_0000619_5763_6233 155
754 3300049570 Ga0501033_0000108 Ga0501033_0000108_18063_18533 155
755 3300049571 Ga0501034_0000100 Ga0501034_0000100_115130_115600 155
756 3300049572 Ga0501036_0000228 Ga0501036_0000228_7944_8414 155
757 3300049573 Ga0501037_0002072 Ga0501037_0002072_13711_14181 155
758 3300049574 Ga0501038_0010248 Ga0501038_0010248_2345_2815 155
759 3300049575 Ga0501039_0001334 Ga0501039_0001334_2823_3293 155
760 3300049578 Ga0501042_0134965 Ga0501042_0134965_485_955 155
761 3300049579 Ga0501043_0000085 Ga0501043_0000085_60736_61206 155
762 3300049580 Ga0501046_0000426 Ga0501046_0000426_8485_8955 155
763 3300049581 Ga0501047_0000221 Ga0501047_0000221_48876_49346 155
764 3300049582 Ga0501048_0000621 Ga0501048_0000621_7704_8174 155
765 3300049583 Ga0501067_0008392 Ga0501067_0008392_4251_4721 155
766 3300049584 Ga0501068_0001789 Ga0501068_0001789_803_1273 155
767 3300049585 Ga0501069_0032959 Ga0501069_0032959_2006_2476 155
768 3300049586 Ga0501070_0001287 Ga0501070_0001287_5485_5955 155
769 3300049587 Ga0501071_0059427 Ga0501071_0059427_895_1365 155
770 3300049588 Ga0501072_0012969 Ga0501072_0012969_4248_4718 155
771 3300049589 Ga0501073_0000290 Ga0501073_0000290_8272_8742 155
772 3300049590 Ga0501074_0000094 Ga0501074_0000094_21917_22387 155
773 3300049591 Ga0501075_0446227 Ga0501075_0446227_196_663 155
774 3300049592 Ga0501076_0260971 Ga0501076_0260971_165_635 155
775 3300049741 Ga0501079_0018183 Ga0501079_0018183_1294_1764 155
776 3300049742 Ga0501080_0057105 Ga0501080_0057105_2463_2933 155
777 3300049744 Ga0501083_0000087 Ga0501083_0000087_54117_54587 155
778 3300049822 Ga0501035_0000223 Ga0501035_0000223_54666_55136 155
779 3300049823 Ga0501044_0000970 Ga0501044_0000970_9944_10414 155
780 3300049824 Ga0501045_0068761 Ga0501045_0068761_1300_1770 155
781 3300053077 Ga0495601_0018417 Ga0495601_0018417_207_680 155
782 3300053078 Ga0495612_0109813 Ga0495612_0109813_316_789 155
783 3300053094 Ga0500566_0006230 Ga0500566_0006230_303_770 155
784 3300053094 Ga0500566_0306904 Ga0500566_0306904_64_537 155
785 3300053096 Ga0500641_0007939 Ga0500641_0007939_545_1012 155
786 3300053119 Ga0500595_000152 Ga0500595_000152_7403_7870 155
787 3300053119 Ga0500595_028536 Ga0500595_028536_641_1114 155
788 3300053136 Ga0500559_0036407 Ga0500559_0036407_170_637 155
789 3300053148 Ga0500590_087739 Ga0500590_087739_643_1116 155
790 3300053150 Ga0500603_007518 Ga0500603_007518_1369_1836 155
791 3300053162 Ga0500638_000086 Ga0500638_000086_3982_4449 155
792 3300053177 Ga0500636_0116929 Ga0500636_0116929_404_871 155
793 3300053178 Ga0500637_0009759 Ga0500637_0009759_3947_4414 155
794 3300053178 Ga0500637_0111738 Ga0500637_0111738_948_1421 155
795 3300053728 Ga0500657_197405 Ga0500657_197405_52_525 155
796 3300054114 Ga0501084_0008032 Ga0501084_0008032_2329_2799 155
797 3300055283 Ga0500661_000398 Ga0500661_000398_4064_4531 155
798 3300005435 Ga0070714_102023696 Ga0070714_1020236961 156
799 3300005436 Ga0070713_100044765 Ga0070713_1000447653 156
800 3300005578 Ga0068854_100190036 Ga0068854_1001900362 156
801 3300006028 Ga0070717_10005547 Ga0070717_100055476 156
802 3300009101 Ga0105247_10232537 Ga0105247_102325372 156
803 3300025928 Ga0207700_10002410 Ga0207700_100024109 156
804 3300025929 Ga0207664_10129229 Ga0207664_101292292 156
805 3300025939 Ga0207665_10264410 Ga0207665_102644102 156
806 3300031249 Ga0265339_10475542 Ga0265339_104755421 156
807 3300031711 Ga0265314_10005412 Ga0265314_100054126 156
808 3300031712 Ga0265342_10118566 Ga0265342_101185662 156
809 3300048929 Ga0496126_0030336 Ga0496126_0030336_418_888 156
810 3300000549 LJQas_1007436 LJQas_10074362 157
811 3300003203 JGI25406J46586_10000288 JGI25406J46586_1000028811 157
812 3300005327 Ga0070658_10024846 Ga0070658_100248461 157
813 3300005337 Ga0070682_100532842 Ga0070682_1005328422 157
814 3300005366 Ga0070659_100059496 Ga0070659_1000594961 157
815 3300005436 Ga0070713_101303800 Ga0070713_1013038002 157
816 3300005439 Ga0070711_101267762 Ga0070711_1012677621 157
817 3300005455 Ga0070663_100770942 Ga0070663_1007709422 157
818 3300005471 Ga0070698_100708697 Ga0070698_1007086971 157
819 3300005616 Ga0068852_101339245 Ga0068852_1013392452 157
820 3300005834 Ga0068851_10001206 Ga0068851_100012068 157
821 3300005985 Ga0081539_10000140 Ga0081539_1000014010 157
822 3300007265 Ga0099794_10057690 Ga0099794_100576903 157
823 3300007788 Ga0099795_10042841 Ga0099795_100428412 157
824 3300007788 Ga0099795_10066543 Ga0099795_100665432 157
825 3300007788 Ga0099795_10067946 Ga0099795_100679462 157
826 3300009093 Ga0105240_11205827 Ga0105240_112058272 157
827 3300009545 Ga0105237_10990142 Ga0105237_109901422 157
828 3300010159 Ga0099796_10001079 Ga0099796_100010794 157
829 3300010159 Ga0099796_10018958 Ga0099796_100189583 157
830 3300010159 Ga0099796_10242542 Ga0099796_102425421 157
831 3300010159 Ga0099796_10379952 Ga0099796_103799521 157
832 3300013104 Ga0157370_10032211 Ga0157370_100322116 157
833 3300013105 Ga0157369_10018574 Ga0157369_100185742 157
834 3300013297 Ga0157378_10123717 Ga0157378_101237172 157
835 3300025321 Ga0207656_10001137 Ga0207656_100011372 157
836 3300025912 Ga0207707_10003603 Ga0207707_1000360313 157
837 3300025913 Ga0207695_10015120 Ga0207695_100151209 157
838 3300025914 Ga0207671_10126850 Ga0207671_101268503 157
839 3300025917 Ga0207660_10086010 Ga0207660_100860102 157
840 3300025920 Ga0207649_10106432 Ga0207649_101064322 157
841 3300025921 Ga0207652_10001857 Ga0207652_100018578 157
842 3300025924 Ga0207694_10008673 Ga0207694_100086737 157
843 3300025932 Ga0207690_10084985 Ga0207690_100849851 157
844 3300025939 Ga0207665_10419551 Ga0207665_104195512 157
845 3300025940 Ga0207691_10536738 Ga0207691_105367382 157
846 3300025949 Ga0207667_10011919 Ga0207667_1001191910 157
847 3300026067 Ga0207678_10915314 Ga0207678_109153142 157
848 3300026116 Ga0207674_10085956 Ga0207674_100859563 157
849 3300027671 Ga0209588_1111659 Ga0209588_11116592 157
850 3300031507 Ga0307509_10300125 Ga0307509_103001252 157
851 3300031712 Ga0265342_10249906 Ga0265342_102499062 157
852 3300031730 Ga0307516_10805017 Ga0307516_108050172 157
853 3300031911 Ga0307412_10687597 Ga0307412_106875971 157
854 3300032002 Ga0307416_100896327 Ga0307416_1008963272 157
855 3300032126 Ga0307415_100221837 Ga0307415_1002218372 157
856 3300033180 Ga0307510_10080137 Ga0307510_100801372 157
857 3300035113 Ga0373936_0045600 Ga0373936_0045600_98_571 157
858 3300035170 Ga0373943_0113038 Ga0373943_0113038_97_570 157
859 3300035410 Ga0373924_0030479 Ga0373924_0030479_288_761 157
860 3300035691 Ga0373931_0101039 Ga0373931_0101039_829_1302 157
861 3300035692 Ga0373935_0000382 Ga0373935_0000382_1312_1785 157
862 3300035695 Ga0373927_0025913 Ga0373927_0025913_1169_1642 157
863 3300035724 Ga0373933_0200978 Ga0373933_0200978_102_575 157
864 3300036401 Ga0373937_0142202 Ga0373937_0142202_868_1341 157
865 3300037068 Ga0373925_0017659 Ga0373925_0017659_2719_3192 157
866 3300037068 Ga0373925_0070716 Ga0373925_0070716_1667_2140 157
867 3300046454 Ga0495592_0043882 Ga0495592_0043882_2657_3130 157
868 3300046455 Ga0495603_0000191 Ga0495603_0000191_18674_19147 157
869 3300046455 Ga0495603_0009824 Ga0495603_0009824_5258_5731 157
870 3300046459 Ga0495629_0000500 Ga0495629_0000500_14387_14860 157
871 3300046461 Ga0495641_0001436 Ga0495641_0001436_5849_6322 157
872 3300046472 Ga0495580_0010080 Ga0495580_0010080_3410_3883 157
873 3300046473 Ga0495582_0000251 Ga0495582_0000251_15336_15809 157
874 3300046475 Ga0495639_0000077 Ga0495639_0000077_18951_19424 157
875 3300046476 Ga0495662_0000826 Ga0495662_0000826_10122_10595 157
876 3300046477 Ga0495664_0005360 Ga0495664_0005360_2773_3246 157
877 3300046491 Ga0495584_0117094 Ga0495584_0117094_206_679 157
878 3300046499 Ga0495594_0000648 Ga0495594_0000648_14068_14541 157
879 3300046507 Ga0495606_0001179 Ga0495606_0001179_35300_35773 157
880 3300046514 Ga0495618_0072979 Ga0495618_0072979_1351_1824 157
881 3300046517 Ga0495630_0032298 Ga0495630_0032298_2541_3014 157
882 3300046526 Ga0495666_0025194 Ga0495666_0025194_1245_1718 157
883 3300046526 Ga0495666_0237580 Ga0495666_0237580_279_752 157
884 3300046529 Ga0495652_0030569 Ga0495652_0030569_1978_2451 157
885 3300046531 Ga0495665_0016458 Ga0495665_0016458_504_977 157
886 3300046531 Ga0495665_0299869 Ga0495665_0299869_56_529 157
887 3300046533 Ga0495640_0003320 Ga0495640_0003320_686_1159 157
888 3300046535 Ga0495586_0268095 Ga0495586_0268095_430_903 157
889 3300046557 Ga0495622_0020648 Ga0495622_0020648_1939_2412 157
890 3300046559 Ga0495667_0449706 Ga0495667_0449706_188_661 157
891 3300046642 Ga0495634_0000440 Ga0495634_0000440_39060_39533 157
892 3300046663 Ga0495635_0000425 Ga0495635_0000425_18178_18651 157
893 3300046674 Ga0495588_0001638 Ga0495588_0001638_7780_8253 157
894 3300046680 Ga0495646_0005175 Ga0495646_0005175_16_489 157
895 3300046681 Ga0495647_0003601 Ga0495647_0003601_3313_3786 157
896 3300046683 Ga0495658_0002435 Ga0495658_0002435_7553_8026 157
897 3300046689 Ga0495613_0010577 Ga0495613_0010577_1187_1660 157
898 3300046690 Ga0495624_0000818 Ga0495624_0000818_5643_6116 157
899 3300046809 Ga0495600_0205380 Ga0495600_0205380_223_696 157
900 3300047315 Ga0495581_0020734 Ga0495581_0020734_339_812 157
901 3300047315 Ga0495581_0191251 Ga0495581_0191251_379_852 157
902 3300047317 Ga0495604_0406191 Ga0495604_0406191_84_557 157
903 3300047319 Ga0495674_0001342 Ga0495674_0001342_13022_13495 157
904 3300047321 Ga0495676_0066921 Ga0495676_0066921_1812_2285 157
905 3300047471 Ga0495684_0055791 Ga0495684_0055791_214_687 157
906 3300047673 Ga0495593_0000192 Ga0495593_0000192_12766_13239 157
907 3300048911 Ga0496108_1652776 Ga0496108_1652776_41_514 157
908 3300048913 Ga0496110_0071115 Ga0496110_0071115_1808_2281 157
909 3300048915 Ga0496112_0000004 Ga0496112_0000004_331183_331656 157
910 3300048915 Ga0496112_0010399 Ga0496112_0010399_140_613 157
911 3300048916 Ga0496113_0713298 Ga0496113_0713298_80_553 157
912 3300048918 Ga0496115_0412543 Ga0496115_0412543_498_971 157
913 3300048924 Ga0496121_0209113 Ga0496121_0209113_471_944 157
914 3300048929 Ga0496126_0283942 Ga0496126_0283942_485_958 157
915 3300053077 Ga0495601_0136024 Ga0495601_0136024_344_817 157
916 3300053080 Ga0500635_0004243 Ga0500635_0004243_1523_1996 157
917 3300053080 Ga0500635_0012371 Ga0500635_0012371_828_1301 157
918 3300053083 Ga0495655_0169437 Ga0495655_0169437_28_501 157
919 3300053084 Ga0495595_0122410 Ga0495595_0122410_508_981 157
920 3300053085 Ga0495619_0143547 Ga0495619_0143547_323_796 157
921 3300053091 Ga0500647_0156423 Ga0500647_0156423_10_483 157
922 3300053094 Ga0500566_0153126 Ga0500566_0153126_271_744 157
923 3300053102 Ga0500554_021852 Ga0500554_021852_737_1210 157
924 3300053123 Ga0500614_182106 Ga0500614_182106_66_539 157
925 3300053163 Ga0500639_182966 Ga0500639_182966_410_883 157
926 3300053178 Ga0500637_0005306 Ga0500637_0005306_5045_5518 157
927 3300053178 Ga0500637_0134233 Ga0500637_0134233_324_797 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

17

141

0.97

Feature Viewer

pLDDT pTM Quality
64.15 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map