F485946
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 927 | 335 | 908 | 357 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10153558|Ga0157374_101535582 |
| Length | 417 |
| Sequence | VILKQPNKMNEHHYIVIMAGGIGSRFWPMSRQDYPKQFLDILNTGQTLIQGTFERFAHFVPVENIYVVTSNEYMDIVKEQLPGLPAENVLGEPSRKNTAPCIAYISFKLQQKDPKASLIVAPADHIIKDQKAFTKVCLEALSFVNKHNAFITLGITPLQPNTGYGYIQREQHSVSDNVYKVKTFTEKPNLELAKTFLASGDFLWNAGIFIWQVKNVIKAFEKYLPEMYDVFVAEKDAFNTPEERKALEHIYPLCTNISIDFGIMEKAENVYVIPSSFGWSDLGTWNSAYENLEKDSRENAIAGENVMIVDAEKCIVHASDKKLLVLQGLKDFIIVDTEDVLLICKKDKEQDIKDYVAEVKKSMGDDYLECECGNVEMWECENSQQAVISNGRSEKSNRITSDKTATYYRCRRIDSNE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 7 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 8 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 9 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 10 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 11 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 12 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 13 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 14 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 15 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 16 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 17 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 18 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 19 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 20 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 21 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 24 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 25 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 30 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 31 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 222 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 224 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 225 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 226 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 227 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 228 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 229 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 230 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 231 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 232 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 233 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 243 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 289 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 291 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 296 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 297 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 298 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 299 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 317 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 320 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 321 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 322 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 323 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 325 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 326 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 327 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 328 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 330 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 334 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.73 |
| Metatranscriptomes | 0.11 |
| Isolates | 2.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.58 |
| Nodule | 0 |
| Rhizoplane | 0.22 |
| Rhizosphere | 87.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1538117 | 2162886007 | Bacteria | 1196 |
| 2 | JGI24740J21852_10002379 | 3300001979 | Bacteria | 8555 |
| 3 | JGI24739J22299_10000062 | 3300001989 | Bacteria | 29944 |
| 4 | JGI24744J21845_10003674 | 3300002077 | Bacteria | 3161 |
| 5 | JGI25154J39366_1000023 | 3300002738 | Bacteria | 219569 |
| 6 | JGI25154J39366_1007774 | 3300002738 | Bacteria | 1434 |
| 7 | JGI25159J45721_1009609 | 3300002987 | Bacteria | 2538 |
| 8 | JGI25153J46596_10002509 | 3300003215 | Bacteria | 10537 |
| 9 | JGI25153J46596_10023575 | 3300003215 | Bacteria | 2239 |
| 10 | rootH1_10013813 | 3300003316 | Bacteria | 11218 |
| 11 | rootH1_10013813 | 3300003323 | Bacteria | 1368 |
| 12 | rootH1_10166897 | 3300003316 | Bacteria | 1381 |
| 13 | rootH2_10007005 | 3300003320 | Bacteria | 1761 |
| 14 | rootH2_10017798 | 3300003320 | Bacteria | 14280 |
| 15 | rootH2_10039673 | 3300003320 | Bacteria | 11437 |
| 16 | rootH2_10092694 | 3300003320 | Bacteria | 2548 |
| 17 | rootH2_10135544 | 3300003320 | Bacteria | 6928 |
| 18 | rootL2_10023331 | 3300003322 | Bacteria | 2597 |
| 19 | rootL2_10027551 | 3300003322 | Bacteria | 8632 |
| 20 | rootL2_10038898 | 3300003322 | Bacteria | 4134 |
| 21 | rootL2_10062550 | 3300003322 | Bacteria | 3641 |
| 22 | rootL2_10075820 | 3300003322 | Bacteria | 3561 |
| 23 | rootL2_10082800 | 3300003322 | Bacteria | 3650 |
| 24 | rootH1_10044529 | 3300003323 | Bacteria | 12446 |
| 25 | rootH1_10175021 | 3300003323 | Bacteria | 3205 |
| 26 | JGI25160J50197_1001239 | 3300003354 | Bacteria | 12966 |
| 27 | JGI25160J50197_1003881 | 3300003354 | Bacteria | 6553 |
| 28 | Ga0055528_1001011 | 3300003790 | Bacteria | 18675 |
| 29 | Ga0055530_10000880 | 3300003791 | Bacteria | 24686 |
| 30 | Ga0055531_10000054 | 3300003794 | Bacteria | 123684 |
| 31 | Ga0055531_10013120 | 3300003794 | Bacteria | 3845 |
| 32 | Ga0065165_1000027 | 3300005262 | Bacteria | 228507 |
| 33 | Ga0065165_1007410 | 3300005262 | Bacteria | 5401 |
| 34 | Ga0065704_10088342 | 3300005289 | Bacteria | 2947 |
| 35 | Ga0065704_10094599 | 3300005289 | Bacteria | 2535 |
| 36 | Ga0065704_10101212 | 3300005289 | Unclassified | 2240 |
| 37 | Ga0065712_10080579 | 3300005290 | Bacteria | 3089 |
| 38 | Ga0065715_10127934 | 3300005293 | Bacteria | 2073 |
| 39 | Ga0070658_10051009 | 3300005327 | Bacteria | 3353 |
| 40 | Ga0070658_10063181 | 3300005327 | Bacteria | 3018 |
| 41 | Ga0070676_10010918 | 3300005328 | Bacteria | 4934 |
| 42 | Ga0070676_10083899 | 3300005328 | Bacteria | 1939 |
| 43 | Ga0070676_10145117 | 3300005328 | Bacteria | 1514 |
| 44 | Ga0070683_100011019 | 3300005329 | Bacteria | 7792 |
| 45 | Ga0070683_100167963 | 3300005329 | Bacteria | 2082 |
| 46 | Ga0070683_100208234 | 3300005329 | Bacteria | 1857 |
| 47 | Ga0070670_100026886 | 3300005331 | Bacteria | 4949 |
| 48 | Ga0070670_100082020 | 3300005331 | Bacteria | 2771 |
| 49 | Ga0070670_100100801 | 3300005331 | Unclassified | 2486 |
| 50 | Ga0070670_100304256 | 3300005331 | Bacteria | 1395 |
| 51 | Ga0068869_100004838 | 3300005334 | Bacteria | 8409 |
| 52 | Ga0068869_100009710 | 3300005334 | Bacteria | 6249 |
| 53 | Ga0068869_100017987 | 3300005334 | Bacteria | 4803 |
| 54 | Ga0068869_100089615 | 3300005334 | Bacteria | 2310 |
| 55 | Ga0068869_100244713 | 3300005334 | Bacteria | 1430 |
| 56 | Ga0070666_10000112 | 3300005335 | Bacteria | 55997 |
| 57 | Ga0070666_10015901 | 3300005335 | Bacteria | 4806 |
| 58 | Ga0070666_10057022 | 3300005335 | Bacteria | 2639 |
| 59 | Ga0070680_100024630 | 3300005336 | Unclassified | 4810 |
| 60 | Ga0070680_100039686 | 3300005336 | Bacteria | 3809 |
| 61 | Ga0070682_100036209 | 3300005337 | Unclassified | 3016 |
| 62 | Ga0070682_100081306 | 3300005337 | Bacteria | 2097 |
| 63 | Ga0068868_100001123 | 3300005338 | Bacteria | 18309 |
| 64 | Ga0068868_100008985 | 3300005338 | Bacteria | 7171 |
| 65 | Ga0068868_100030169 | 3300005338 | Bacteria | 4158 |
| 66 | Ga0068868_100045803 | 3300005338 | Bacteria | 3423 |
| 67 | Ga0070660_100000435 | 3300005339 | Bacteria | 27665 |
| 68 | Ga0070660_100006706 | 3300005339 | Bacteria | 7988 |
| 69 | Ga0070660_100007671 | 3300005339 | Bacteria | 7520 |
| 70 | Ga0070660_100028232 | 3300005339 | Bacteria | 4196 |
| 71 | Ga0070660_100086771 | 3300005339 | Bacteria | 2463 |
| 72 | Ga0070660_100222396 | 3300005339 | Unclassified | 1535 |
| 73 | Ga0070689_100054995 | 3300005340 | Bacteria | 3082 |
| 74 | Ga0070689_100098025 | 3300005340 | Unclassified | 2318 |
| 75 | Ga0070689_100123580 | 3300005340 | Bacteria | 2069 |
| 76 | Ga0070691_10018185 | 3300005341 | Bacteria | 3239 |
| 77 | Ga0070687_100049691 | 3300005343 | Bacteria | 2162 |
| 78 | Ga0070661_100046932 | 3300005344 | Bacteria | 3160 |
| 79 | Ga0070668_100063236 | 3300005347 | Bacteria | 2868 |
| 80 | Ga0070668_100294488 | 3300005347 | Bacteria | 1359 |
| 81 | Ga0070669_100006429 | 3300005353 | Bacteria | 8458 |
| 82 | Ga0070669_100014257 | 3300005353 | Bacteria | 5656 |
| 83 | Ga0070669_100038623 | 3300005353 | Bacteria | 3466 |
| 84 | Ga0070669_100042143 | 3300005353 | Bacteria | 3321 |
| 85 | Ga0070669_100228034 | 3300005353 | Unclassified | 1475 |
| 86 | Ga0070675_100096056 | 3300005354 | Bacteria | 2489 |
| 87 | Ga0070675_100117262 | 3300005354 | Bacteria | 2259 |
| 88 | Ga0070675_100226650 | 3300005354 | Unclassified | 1629 |
| 89 | Ga0070675_100321286 | 3300005354 | Bacteria | 1367 |
| 90 | Ga0070671_100079539 | 3300005355 | Bacteria | 2740 |
| 91 | Ga0070671_100092367 | 3300005355 | Bacteria | 2535 |
| 92 | Ga0070674_100034018 | 3300005356 | Bacteria | 3399 |
| 93 | Ga0070674_100077838 | 3300005356 | Bacteria | 2362 |
| 94 | Ga0070673_100022084 | 3300005364 | Bacteria | 4627 |
| 95 | Ga0070673_100032786 | 3300005364 | Bacteria | 3916 |
| 96 | Ga0070673_100102983 | 3300005364 | Bacteria | 2354 |
| 97 | Ga0070673_100112954 | 3300005364 | Bacteria | 2255 |
| 98 | Ga0070673_100118290 | 3300005364 | Bacteria | 2206 |
| 99 | Ga0070673_100420777 | 3300005364 | Unclassified | 1198 |
| 100 | Ga0070659_100007146 | 3300005366 | Bacteria | 8102 |
| 101 | Ga0070659_100008871 | 3300005366 | Bacteria | 7367 |
| 102 | Ga0070659_100126170 | 3300005366 | Bacteria | 2076 |
| 103 | Ga0070667_100008519 | 3300005367 | Bacteria | 8501 |
| 104 | Ga0070667_100017599 | 3300005367 | Bacteria | 5921 |
| 105 | Ga0070667_100050896 | 3300005367 | Bacteria | 3491 |
| 106 | Ga0070667_100059753 | 3300005367 | Bacteria | 3225 |
| 107 | Ga0070667_100114046 | 3300005367 | Bacteria | 2346 |
| 108 | Ga0070667_100157773 | 3300005367 | Bacteria | 1997 |
| 109 | Ga0070667_100413693 | 3300005367 | Unclassified | 1229 |
| 110 | Ga0070663_100096476 | 3300005455 | Bacteria | 2199 |
| 111 | Ga0070663_100290238 | 3300005455 | Bacteria | 1306 |
| 112 | Ga0070678_100011344 | 3300005456 | Bacteria | 5491 |
| 113 | Ga0070678_100081222 | 3300005456 | Bacteria | 2457 |
| 114 | Ga0070662_100046050 | 3300005457 | Bacteria | 3133 |
| 115 | Ga0070662_100127996 | 3300005457 | Bacteria | 1954 |
| 116 | Ga0070662_100139466 | 3300005457 | Bacteria | 1877 |
| 117 | Ga0070681_10012536 | 3300005458 | Bacteria | 8413 |
| 118 | Ga0070681_10037752 | 3300005458 | Bacteria | 4845 |
| 119 | Ga0068867_100018835 | 3300005459 | Bacteria | 4911 |
| 120 | Ga0068867_100039779 | 3300005459 | Bacteria | 3430 |
| 121 | Ga0068867_100076839 | 3300005459 | Bacteria | 2508 |
| 122 | Ga0068867_100098355 | 3300005459 | Bacteria | 2231 |
| 123 | Ga0068867_100284436 | 3300005459 | Bacteria | 1357 |
| 124 | Ga0070685_10005017 | 3300005466 | Bacteria | 6705 |
| 125 | Ga0070685_10236915 | 3300005466 | Bacteria | 1203 |
| 126 | Ga0070698_100000282 | 3300005471 | Bacteria | 51827 |
| 127 | Ga0070698_100002541 | 3300005471 | Bacteria | 20094 |
| 128 | Ga0070698_100006847 | 3300005471 | Bacteria | 12348 |
| 129 | Ga0070698_100151107 | 3300005471 | Bacteria | 2270 |
| 130 | Ga0070679_100000908 | 3300005530 | Bacteria | 25669 |
| 131 | Ga0070679_100002354 | 3300005530 | Bacteria | 17120 |
| 132 | Ga0070679_100023183 | 3300005530 | Bacteria | 6075 |
| 133 | Ga0070679_100094063 | 3300005530 | Bacteria | 2984 |
| 134 | Ga0070679_100132523 | 3300005530 | Bacteria | 2473 |
| 135 | Ga0070679_100221834 | 3300005530 | Bacteria | 1851 |
| 136 | Ga0070684_100008818 | 3300005535 | Bacteria | 7905 |
| 137 | Ga0070684_100023317 | 3300005535 | Bacteria | 5174 |
| 138 | Ga0070684_100140304 | 3300005535 | Bacteria | 2185 |
| 139 | Ga0068853_100001871 | 3300005539 | Bacteria | 15486 |
| 140 | Ga0068853_100003897 | 3300005539 | Bacteria | 11438 |
| 141 | Ga0068853_100004597 | 3300005539 | Bacteria | 10710 |
| 142 | Ga0068853_100009821 | 3300005539 | Bacteria | 7723 |
| 143 | Ga0068853_100015375 | 3300005539 | Bacteria | 6288 |
| 144 | Ga0068853_100029290 | 3300005539 | Bacteria | 4639 |
| 145 | Ga0068853_100041203 | 3300005539 | Bacteria | 3943 |
| 146 | Ga0068853_100078345 | 3300005539 | Bacteria | 2888 |
| 147 | Ga0068853_100087689 | 3300005539 | Bacteria | 2731 |
| 148 | Ga0068853_100150799 | 3300005539 | Bacteria | 2093 |
| 149 | Ga0068853_100170414 | 3300005539 | Bacteria | 1969 |
| 150 | Ga0068853_100247288 | 3300005539 | Unclassified | 1636 |
| 151 | Ga0070672_100008190 | 3300005543 | Bacteria | 7143 |
| 152 | Ga0070672_100079570 | 3300005543 | Bacteria | 2624 |
| 153 | Ga0070672_100119585 | 3300005543 | Bacteria | 2155 |
| 154 | Ga0070672_100210328 | 3300005543 | Bacteria | 1629 |
| 155 | Ga0070686_100001004 | 3300005544 | Bacteria | 16245 |
| 156 | Ga0070686_100015742 | 3300005544 | Bacteria | 4388 |
| 157 | Ga0070686_100072943 | 3300005544 | Bacteria | 2252 |
| 158 | Ga0070693_100205551 | 3300005547 | Bacteria | 1282 |
| 159 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 160 | Ga0070665_100012136 | 3300005548 | Bacteria | 8689 |
| 161 | Ga0068855_100000081 | 3300005563 | Bacteria | 115707 |
| 162 | Ga0068855_100002548 | 3300005563 | Bacteria | 22452 |
| 163 | Ga0068855_100013609 | 3300005563 | Bacteria | 9810 |
| 164 | Ga0068855_100023253 | 3300005563 | Bacteria | 7424 |
| 165 | Ga0068855_100024021 | 3300005563 | Bacteria | 7298 |
| 166 | Ga0068855_100059131 | 3300005563 | Bacteria | 4486 |
| 167 | Ga0068855_100062546 | 3300005563 | Unclassified | 4345 |
| 168 | Ga0068855_100107987 | 3300005563 | Bacteria | 3197 |
| 169 | Ga0068855_100198910 | 3300005563 | Bacteria | 2257 |
| 170 | Ga0070664_100008601 | 3300005564 | Bacteria | 8259 |
| 171 | Ga0070664_100027903 | 3300005564 | Bacteria | 4695 |
| 172 | Ga0070664_100218228 | 3300005564 | Unclassified | 1706 |
| 173 | Ga0070664_100226085 | 3300005564 | Unclassified | 1676 |
| 174 | Ga0068857_100002654 | 3300005577 | Bacteria | 14675 |
| 175 | Ga0068857_100038718 | 3300005577 | Bacteria | 4222 |
| 176 | Ga0068857_100098455 | 3300005577 | Bacteria | 2623 |
| 177 | Ga0068857_100174035 | 3300005577 | Bacteria | 1957 |
| 178 | Ga0068854_100026545 | 3300005578 | Bacteria | 3982 |
| 179 | Ga0068854_100046669 | 3300005578 | Bacteria | 3085 |
| 180 | Ga0068854_100087630 | 3300005578 | Bacteria | 2310 |
| 181 | Ga0068854_100094419 | 3300005578 | Bacteria | 2231 |
| 182 | Ga0068854_100124907 | 3300005578 | Bacteria | 1958 |
| 183 | Ga0068856_100024646 | 3300005614 | Bacteria | 5857 |
| 184 | Ga0068856_100032149 | 3300005614 | Bacteria | 5137 |
| 185 | Ga0068856_100054252 | 3300005614 | Bacteria | 3953 |
| 186 | Ga0068856_100099043 | 3300005614 | Bacteria | 2906 |
| 187 | Ga0068856_100178106 | 3300005614 | Unclassified | 2138 |
| 188 | Ga0068852_100000900 | 3300005616 | Bacteria | 19686 |
| 189 | Ga0068852_100003313 | 3300005616 | Bacteria | 11246 |
| 190 | Ga0068852_100005128 | 3300005616 | Bacteria | 9334 |
| 191 | Ga0068852_100020548 | 3300005616 | Bacteria | 5252 |
| 192 | Ga0068852_100038926 | 3300005616 | Bacteria | 4000 |
| 193 | Ga0068852_100043565 | 3300005616 | Bacteria | 3807 |
| 194 | Ga0068852_100075342 | 3300005616 | Bacteria | 2976 |
| 195 | Ga0068852_100090210 | 3300005616 | Bacteria | 2741 |
| 196 | Ga0068852_100148892 | 3300005616 | Bacteria | 2175 |
| 197 | Ga0068852_100156709 | 3300005616 | Bacteria | 2122 |
| 198 | Ga0068852_100160219 | 3300005616 | Bacteria | 2100 |
| 199 | Ga0068852_100229781 | 3300005616 | Bacteria | 1768 |
| 200 | Ga0068852_100236699 | 3300005616 | Unclassified | 1743 |
| 201 | Ga0068852_100486253 | 3300005616 | Bacteria | 1227 |
| 202 | Ga0068859_100000018 | 3300005617 | Bacteria | 248813 |
| 203 | Ga0068859_100000289 | 3300005617 | Bacteria | 49979 |
| 204 | Ga0068859_100017809 | 3300005617 | Bacteria | 7141 |
| 205 | Ga0068859_100086698 | 3300005617 | Bacteria | 3178 |
| 206 | Ga0068859_100123833 | 3300005617 | Bacteria | 2653 |
| 207 | Ga0068859_100226485 | 3300005617 | Bacteria | 1958 |
| 208 | Ga0068859_100292465 | 3300005617 | Bacteria | 1722 |
| 209 | Ga0068864_100002226 | 3300005618 | Bacteria | 16023 |
| 210 | Ga0068864_100002659 | 3300005618 | Bacteria | 14761 |
| 211 | Ga0068864_100026453 | 3300005618 | Bacteria | 4893 |
| 212 | Ga0068864_100043128 | 3300005618 | Bacteria | 3862 |
| 213 | Ga0068864_100088090 | 3300005618 | Bacteria | 2734 |
| 214 | Ga0068864_100173896 | 3300005618 | Bacteria | 1965 |
| 215 | Ga0068866_10014018 | 3300005718 | Bacteria | 3530 |
| 216 | Ga0068866_10060672 | 3300005718 | Bacteria | 1962 |
| 217 | Ga0068861_100001502 | 3300005719 | Bacteria | 14807 |
| 218 | Ga0068861_100049553 | 3300005719 | Bacteria | 3181 |
| 219 | Ga0068861_100146876 | 3300005719 | Bacteria | 1930 |
| 220 | Ga0068851_10008435 | 3300005834 | Bacteria | 4762 |
| 221 | Ga0068851_10041605 | 3300005834 | Bacteria | 2311 |
| 222 | Ga0068851_10049634 | 3300005834 | Bacteria | 2129 |
| 223 | Ga0068870_10002263 | 3300005840 | Bacteria | 7992 |
| 224 | Ga0068870_10048875 | 3300005840 | Bacteria | 2229 |
| 225 | Ga0068863_100004036 | 3300005841 | Bacteria | 14494 |
| 226 | Ga0068863_100005189 | 3300005841 | Bacteria | 12849 |
| 227 | Ga0068863_100026959 | 3300005841 | Bacteria | 5479 |
| 228 | Ga0068863_100105425 | 3300005841 | Bacteria | 2682 |
| 229 | Ga0068858_100013296 | 3300005842 | Bacteria | 7761 |
| 230 | Ga0068860_100000024 | 3300005843 | Bacteria | 271902 |
| 231 | Ga0068860_100001161 | 3300005843 | Bacteria | 28804 |
| 232 | Ga0068860_100004223 | 3300005843 | Bacteria | 14727 |
| 233 | Ga0068860_100008699 | 3300005843 | Bacteria | 10113 |
| 234 | Ga0068860_100010496 | 3300005843 | Bacteria | 9156 |
| 235 | Ga0068860_100032753 | 3300005843 | Bacteria | 4993 |
| 236 | Ga0068860_100066223 | 3300005843 | Bacteria | 3431 |
| 237 | Ga0068860_100097121 | 3300005843 | Unclassified | 2808 |
| 238 | Ga0068860_100148099 | 3300005843 | Bacteria | 2260 |
| 239 | Ga0068860_100253286 | 3300005843 | Bacteria | 1715 |
| 240 | Ga0068860_100301772 | 3300005843 | Bacteria | 1569 |
| 241 | Ga0068862_100011939 | 3300005844 | Bacteria | 7176 |
| 242 | Ga0068862_100025468 | 3300005844 | Bacteria | 4967 |
| 243 | Ga0068862_100027366 | 3300005844 | Bacteria | 4799 |
| 244 | Ga0068862_100199458 | 3300005844 | Unclassified | 1804 |
| 245 | Ga0081540_1020265 | 3300005983 | Bacteria | 4008 |
| 246 | Ga0081539_10000402 | 3300005985 | Bacteria | 92866 |
| 247 | Ga0075366_10002904 | 3300006195 | Bacteria | 8904 |
| 248 | Ga0075366_10008292 | 3300006195 | Bacteria | 5772 |
| 249 | Ga0097621_100005119 | 3300006237 | Bacteria | 9211 |
| 250 | Ga0097621_100015237 | 3300006237 | Bacteria | 5779 |
| 251 | Ga0097621_100086635 | 3300006237 | Unclassified | 2614 |
| 252 | Ga0097621_100224467 | 3300006237 | Bacteria | 1638 |
| 253 | Ga0097621_100377478 | 3300006237 | Bacteria | 1266 |
| 254 | Ga0068871_100003481 | 3300006358 | Bacteria | 10814 |
| 255 | Ga0068871_100029501 | 3300006358 | Bacteria | 4309 |
| 256 | Ga0068871_100044243 | 3300006358 | Bacteria | 3579 |
| 257 | Ga0068871_100100034 | 3300006358 | Bacteria | 2428 |
| 258 | Ga0068871_100298801 | 3300006358 | Bacteria | 1413 |
| 259 | Ga0068871_100305082 | 3300006358 | Bacteria | 1398 |
| 260 | Ga0075428_100093975 | 3300006844 | Bacteria | 3269 |
| 261 | Ga0075428_100152663 | 3300006844 | Bacteria | 2509 |
| 262 | Ga0075430_100001793 | 3300006846 | Bacteria | 17561 |
| 263 | Ga0075431_100055523 | 3300006847 | Bacteria | 4085 |
| 264 | Ga0075434_100118073 | 3300006871 | Bacteria | 2666 |
| 265 | Ga0075429_100000136 | 3300006880 | Bacteria | 44169 |
| 266 | Ga0068865_100014717 | 3300006881 | Bacteria | 4977 |
| 267 | Ga0068865_100052116 | 3300006881 | Bacteria | 2835 |
| 268 | Ga0097620_100000018 | 3300006931 | Bacteria | 248813 |
| 269 | Ga0097620_100000289 | 3300006931 | Bacteria | 49979 |
| 270 | Ga0097620_100017809 | 3300006931 | Bacteria | 7141 |
| 271 | Ga0097620_100086694 | 3300006931 | Bacteria | 3178 |
| 272 | Ga0097620_100123837 | 3300006931 | Bacteria | 2653 |
| 273 | Ga0097620_100226484 | 3300006931 | Bacteria | 1958 |
| 274 | Ga0097620_100292450 | 3300006931 | Bacteria | 1722 |
| 275 | Ga0105240_10000106 | 3300009093 | Bacteria | 171825 |
| 276 | Ga0105240_10000606 | 3300009093 | Bacteria | 66467 |
| 277 | Ga0105240_10002298 | 3300009093 | Bacteria | 30947 |
| 278 | Ga0105240_10003660 | 3300009093 | Bacteria | 23789 |
| 279 | Ga0105240_10006503 | 3300009093 | Bacteria | 17166 |
| 280 | Ga0105240_10019918 | 3300009093 | Bacteria | 8960 |
| 281 | Ga0105240_10055153 | 3300009093 | Bacteria | 4977 |
| 282 | Ga0105240_10067774 | 3300009093 | Bacteria | 4423 |
| 283 | Ga0105240_10085981 | 3300009093 | Bacteria | 3852 |
| 284 | Ga0105240_10091296 | 3300009093 | Bacteria | 3721 |
| 285 | Ga0105240_10368623 | 3300009093 | Bacteria | 1624 |
| 286 | Ga0111539_10033061 | 3300009094 | Bacteria | 6280 |
| 287 | Ga0111539_10033256 | 3300009094 | Bacteria | 6262 |
| 288 | Ga0111539_10176061 | 3300009094 | Bacteria | 2499 |
| 289 | Ga0111539_10279378 | 3300009094 | Bacteria | 1943 |
| 290 | Ga0111539_10463430 | 3300009094 | Bacteria | 1476 |
| 291 | Ga0105245_10052931 | 3300009098 | Bacteria | 3642 |
| 292 | Ga0105245_10159481 | 3300009098 | Bacteria | 2139 |
| 293 | Ga0105247_10001391 | 3300009101 | Bacteria | 17555 |
| 294 | Ga0105247_10042996 | 3300009101 | Bacteria | 2768 |
| 295 | Ga0105247_10165010 | 3300009101 | Bacteria | 1469 |
| 296 | Ga0114129_10004956 | 3300009147 | Bacteria | 18775 |
| 297 | Ga0114129_10007484 | 3300009147 | Bacteria | 15553 |
| 298 | Ga0114129_10039792 | 3300009147 | Bacteria | 6631 |
| 299 | Ga0105243_10461794 | 3300009148 | Bacteria | 1194 |
| 300 | Ga0105241_10000590 | 3300009174 | Bacteria | 27344 |
| 301 | Ga0105241_10001966 | 3300009174 | Bacteria | 15555 |
| 302 | Ga0105241_10004142 | 3300009174 | Bacteria | 10702 |
| 303 | Ga0105241_10013483 | 3300009174 | Bacteria | 5990 |
| 304 | Ga0105241_10019697 | 3300009174 | Bacteria | 4979 |
| 305 | Ga0105242_10002943 | 3300009176 | Bacteria | 13315 |
| 306 | Ga0105242_10140077 | 3300009176 | Bacteria | 2098 |
| 307 | Ga0105242_10246472 | 3300009176 | Bacteria | 1608 |
| 308 | Ga0105237_10001093 | 3300009545 | Bacteria | 36314 |
| 309 | Ga0105237_10003013 | 3300009545 | Bacteria | 20323 |
| 310 | Ga0105237_10003222 | 3300009545 | Bacteria | 19554 |
| 311 | Ga0105237_10003412 | 3300009545 | Bacteria | 18886 |
| 312 | Ga0105237_10014210 | 3300009545 | Bacteria | 8336 |
| 313 | Ga0105237_10015959 | 3300009545 | Bacteria | 7809 |
| 314 | Ga0105237_10016066 | 3300009545 | Bacteria | 7784 |
| 315 | Ga0105237_10190612 | 3300009545 | Bacteria | 2050 |
| 316 | Ga0105237_10233270 | 3300009545 | Bacteria | 1841 |
| 317 | Ga0105237_10244455 | 3300009545 | Bacteria | 1796 |
| 318 | Ga0105238_10002205 | 3300009551 | Bacteria | 19643 |
| 319 | Ga0105238_10080747 | 3300009551 | Bacteria | 3241 |
| 320 | Ga0105249_10000635 | 3300009553 | Bacteria | 32011 |
| 321 | Ga0105249_10001404 | 3300009553 | Bacteria | 21086 |
| 322 | Ga0105249_10012962 | 3300009553 | Bacteria | 7357 |
| 323 | Ga0105249_10044696 | 3300009553 | Bacteria | 4027 |
| 324 | Ga0105249_10048465 | 3300009553 | Bacteria | 3873 |
| 325 | Ga0105249_10298373 | 3300009553 | Bacteria | 1615 |
| 326 | Ga0105249_10315997 | 3300009553 | Bacteria | 1572 |
| 327 | Ga0105249_10339620 | 3300009553 | Bacteria | 1518 |
| 328 | Ga0105249_10567068 | 3300009553 | Bacteria | 1187 |
| 329 | Ga0105239_10000404 | 3300010375 | Bacteria | 63332 |
| 330 | Ga0105239_10006093 | 3300010375 | Bacteria | 14040 |
| 331 | Ga0105239_10006097 | 3300010375 | Bacteria | 14036 |
| 332 | Ga0105239_10006227 | 3300010375 | Bacteria | 13883 |
| 333 | Ga0105239_10015063 | 3300010375 | Bacteria | 8572 |
| 334 | Ga0105239_10017847 | 3300010375 | Bacteria | 7848 |
| 335 | Ga0105239_10225431 | 3300010375 | Bacteria | 2102 |
| 336 | Ga0105239_10239255 | 3300010375 | Bacteria | 2037 |
| 337 | Ga0105239_10677477 | 3300010375 | Bacteria | 1178 |
| 338 | Ga0157373_10002753 | 3300013100 | Bacteria | 13315 |
| 339 | Ga0157373_10012587 | 3300013100 | Bacteria | 6219 |
| 340 | Ga0157373_10013999 | 3300013100 | Bacteria | 5880 |
| 341 | Ga0157373_10044393 | 3300013100 | Bacteria | 3173 |
| 342 | Ga0157373_10048356 | 3300013100 | Unclassified | 3033 |
| 343 | Ga0157373_10076302 | 3300013100 | Bacteria | 2365 |
| 344 | Ga0157371_10000518 | 3300013102 | Bacteria | 46197 |
| 345 | Ga0157371_10000668 | 3300013102 | Bacteria | 40664 |
| 346 | Ga0157371_10002698 | 3300013102 | Bacteria | 16766 |
| 347 | Ga0157371_10002845 | 3300013102 | Bacteria | 16172 |
| 348 | Ga0157371_10012494 | 3300013102 | Bacteria | 6489 |
| 349 | Ga0157371_10012758 | 3300013102 | Bacteria | 6406 |
| 350 | Ga0157371_10022192 | 3300013102 | Bacteria | 4654 |
| 351 | Ga0157371_10036915 | 3300013102 | Bacteria | 3500 |
| 352 | Ga0157371_10056930 | 3300013102 | Bacteria | 2772 |
| 353 | Ga0157371_10168127 | 3300013102 | Bacteria | 1566 |
| 354 | Ga0157370_10000408 | 3300013104 | Bacteria | 54355 |
| 355 | Ga0157370_10001339 | 3300013104 | Bacteria | 30595 |
| 356 | Ga0157370_10016291 | 3300013104 | Bacteria | 7532 |
| 357 | Ga0157370_10055556 | 3300013104 | Bacteria | 3771 |
| 358 | Ga0157370_10087246 | 3300013104 | Bacteria | 2931 |
| 359 | Ga0157370_10141669 | 3300013104 | Bacteria | 2240 |
| 360 | Ga0157370_10169686 | 3300013104 | Unclassified | 2029 |
| 361 | Ga0157370_10356359 | 3300013104 | Unclassified | 1348 |
| 362 | Ga0157369_10004046 | 3300013105 | Bacteria | 17375 |
| 363 | Ga0157369_10027741 | 3300013105 | Bacteria | 6272 |
| 364 | Ga0157369_10049589 | 3300013105 | Bacteria | 4551 |
| 365 | Ga0157369_10052340 | 3300013105 | Bacteria | 4418 |
| 366 | Ga0157369_10082517 | 3300013105 | Bacteria | 3439 |
| 367 | Ga0157369_10131361 | 3300013105 | Bacteria | 2653 |
| 368 | Ga0157369_10137179 | 3300013105 | Bacteria | 2589 |
| 369 | Ga0157369_10163681 | 3300013105 | Bacteria | 2347 |
| 370 | Ga0157369_10263946 | 3300013105 | Bacteria | 1795 |
| 371 | Ga0157369_10353582 | 3300013105 | Unclassified | 1526 |
| 372 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 373 | Ga0157374_10001866 | 3300013296 | Bacteria | 17736 |
| 374 | Ga0157374_10062246 | 3300013296 | Bacteria | 3497 |
| 375 | Ga0157374_10091760 | 3300013296 | Bacteria | 2897 |
| 376 | Ga0157374_10153558 | 3300013296 | Bacteria | 2240 |
| 377 | Ga0157374_10262288 | 3300013296 | Bacteria | 1702 |
| 378 | Ga0157378_10001243 | 3300013297 | Bacteria | 23019 |
| 379 | Ga0157378_10006230 | 3300013297 | Bacteria | 10445 |
| 380 | Ga0157378_10006792 | 3300013297 | Bacteria | 9981 |
| 381 | Ga0157378_10015554 | 3300013297 | Bacteria | 6664 |
| 382 | Ga0157378_10018115 | 3300013297 | Bacteria | 6184 |
| 383 | Ga0157378_10032011 | 3300013297 | Bacteria | 4645 |
| 384 | Ga0157378_10075180 | 3300013297 | Bacteria | 3041 |
| 385 | Ga0157378_10158144 | 3300013297 | Bacteria | 2117 |
| 386 | Ga0157378_10198855 | 3300013297 | Bacteria | 1895 |
| 387 | Ga0163162_10000888 | 3300013306 | Bacteria | 27841 |
| 388 | Ga0163162_10001107 | 3300013306 | Bacteria | 24993 |
| 389 | Ga0163162_10002571 | 3300013306 | Bacteria | 17169 |
| 390 | Ga0163162_10002830 | 3300013306 | Bacteria | 16503 |
| 391 | Ga0163162_10023096 | 3300013306 | Bacteria | 6135 |
| 392 | Ga0163162_10031725 | 3300013306 | Bacteria | 5242 |
| 393 | Ga0163162_10077356 | 3300013306 | Bacteria | 3390 |
| 394 | Ga0163162_10077963 | 3300013306 | Bacteria | 3378 |
| 395 | Ga0163162_10292251 | 3300013306 | Bacteria | 1761 |
| 396 | Ga0163162_10450680 | 3300013306 | Bacteria | 1419 |
| 397 | Ga0157372_10000171 | 3300013307 | Bacteria | 71956 |
| 398 | Ga0157372_10001188 | 3300013307 | Bacteria | 28174 |
| 399 | Ga0157372_10002627 | 3300013307 | Bacteria | 19456 |
| 400 | Ga0157372_10011662 | 3300013307 | Bacteria | 9356 |
| 401 | Ga0157372_10013407 | 3300013307 | Bacteria | 8753 |
| 402 | Ga0157372_10018986 | 3300013307 | Bacteria | 7399 |
| 403 | Ga0157372_10026460 | 3300013307 | Bacteria | 6312 |
| 404 | Ga0157372_10029218 | 3300013307 | Bacteria | 6018 |
| 405 | Ga0157372_10034639 | 3300013307 | Bacteria | 5553 |
| 406 | Ga0157372_10052938 | 3300013307 | Bacteria | 4522 |
| 407 | Ga0157372_10061464 | 3300013307 | Bacteria | 4207 |
| 408 | Ga0157372_10078140 | 3300013307 | Bacteria | 3739 |
| 409 | Ga0157372_10098783 | 3300013307 | Bacteria | 3330 |
| 410 | Ga0157372_10203342 | 3300013307 | Unclassified | 2295 |
| 411 | Ga0157372_10406214 | 3300013307 | Bacteria | 1587 |
| 412 | Ga0157372_10469987 | 3300013307 | Bacteria | 1466 |
| 413 | Ga0157372_10646583 | 3300013307 | Bacteria | 1232 |
| 414 | Ga0157375_10033658 | 3300013308 | Bacteria | 4872 |
| 415 | Ga0157375_10057621 | 3300013308 | Unclassified | 3841 |
| 416 | Ga0157375_10137864 | 3300013308 | Bacteria | 2565 |
| 417 | Ga0157375_10202173 | 3300013308 | Unclassified | 2143 |
| 418 | Ga0157375_10319002 | 3300013308 | Unclassified | 1718 |
| 419 | Ga0157375_10356905 | 3300013308 | Bacteria | 1628 |
| 420 | Ga0157375_10648474 | 3300013308 | Bacteria | 1212 |
| 421 | Ga0163163_10000432 | 3300014325 | Bacteria | 38603 |
| 422 | Ga0163163_10014374 | 3300014325 | Bacteria | 7277 |
| 423 | Ga0163163_10107022 | 3300014325 | Bacteria | 2823 |
| 424 | Ga0163163_10128193 | 3300014325 | Bacteria | 2576 |
| 425 | Ga0163163_10253183 | 3300014325 | Bacteria | 1812 |
| 426 | Ga0163163_10277075 | 3300014325 | Bacteria | 1729 |
| 427 | Ga0157380_10146948 | 3300014326 | Bacteria | 2033 |
| 428 | Ga0157380_10147135 | 3300014326 | Bacteria | 2031 |
| 429 | Ga0157380_10455292 | 3300014326 | Bacteria | 1230 |
| 430 | Ga0157379_10168865 | 3300014968 | Bacteria | 1975 |
| 431 | Ga0157376_10000341 | 3300014969 | Bacteria | 31058 |
| 432 | Ga0157376_10002166 | 3300014969 | Bacteria | 13231 |
| 433 | Ga0157376_10060857 | 3300014969 | Bacteria | 3173 |
| 434 | Ga0157376_10095786 | 3300014969 | Bacteria | 2582 |
| 435 | Ga0157376_10113044 | 3300014969 | Bacteria | 2394 |
| 436 | Ga0157376_10115471 | 3300014969 | Bacteria | 2370 |
| 437 | Ga0157376_10150201 | 3300014969 | Bacteria | 2100 |
| 438 | Ga0182005_1000097 | 3300015265 | Bacteria | 66720 |
| 439 | Ga0163161_10210996 | 3300017792 | Unclassified | 1500 |
| 440 | Ga0213876_10001574 | 3300021384 | Bacteria | 14029 |
| 441 | Ga0213876_10066116 | 3300021384 | Bacteria | 1908 |
| 442 | Ga0209436_100324 | 3300025208 | Bacteria | 21828 |
| 443 | Ga0209258_100302 | 3300025242 | Bacteria | 79794 |
| 444 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 445 | Ga0209646_1001349 | 3300025246 | Bacteria | 6775 |
| 446 | Ga0209026_1000095 | 3300025250 | Bacteria | 164309 |
| 447 | Ga0209148_1000131 | 3300025254 | Bacteria | 174079 |
| 448 | Ga0209129_1008612 | 3300025258 | Bacteria | 2814 |
| 449 | Ga0209673_1000203 | 3300025273 | Bacteria | 119623 |
| 450 | Ga0209130_1001297 | 3300025284 | Bacteria | 17208 |
| 451 | Ga0209675_1026138 | 3300025291 | Bacteria | 1458 |
| 452 | Ga0209564_1022859 | 3300025295 | Bacteria | 2192 |
| 453 | Ga0209564_1022867 | 3300025295 | Bacteria | 2192 |
| 454 | Ga0209758_1004975 | 3300025297 | Bacteria | 10628 |
| 455 | Ga0209050_1000888 | 3300025298 | Bacteria | 39848 |
| 456 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 457 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 458 | Ga0207426_1000313 | 3300025302 | Bacteria | 94934 |
| 459 | Ga0207426_1000806 | 3300025302 | Bacteria | 33910 |
| 460 | Ga0209257_1000070 | 3300025304 | Bacteria | 336454 |
| 461 | Ga0209257_1002474 | 3300025304 | Bacteria | 18274 |
| 462 | Ga0207656_10024838 | 3300025321 | Bacteria | 2428 |
| 463 | Ga0207656_10062548 | 3300025321 | Unclassified | 1636 |
| 464 | Ga0207642_10019137 | 3300025899 | Bacteria | 2645 |
| 465 | Ga0207710_10000673 | 3300025900 | Bacteria | 19242 |
| 466 | Ga0207710_10004125 | 3300025900 | Bacteria | 6380 |
| 467 | Ga0207688_10002217 | 3300025901 | Bacteria | 10462 |
| 468 | Ga0207688_10011466 | 3300025901 | Bacteria | 4826 |
| 469 | Ga0207680_10000193 | 3300025903 | Bacteria | 29312 |
| 470 | Ga0207680_10036735 | 3300025903 | Bacteria | 2823 |
| 471 | Ga0207647_10000210 | 3300025904 | Bacteria | 47384 |
| 472 | Ga0207647_10006574 | 3300025904 | Bacteria | 8445 |
| 473 | Ga0207647_10044652 | 3300025904 | Bacteria | 2767 |
| 474 | Ga0207647_10045343 | 3300025904 | Bacteria | 2744 |
| 475 | Ga0207647_10128473 | 3300025904 | Bacteria | 1490 |
| 476 | Ga0207645_10002084 | 3300025907 | Bacteria | 16005 |
| 477 | Ga0207645_10012266 | 3300025907 | Bacteria | 5821 |
| 478 | Ga0207645_10022290 | 3300025907 | Bacteria | 4122 |
| 479 | Ga0207645_10040712 | 3300025907 | Bacteria | 2976 |
| 480 | Ga0207645_10070775 | 3300025907 | Bacteria | 2232 |
| 481 | Ga0207643_10005282 | 3300025908 | Bacteria | 6909 |
| 482 | Ga0207705_10056135 | 3300025909 | Bacteria | 2839 |
| 483 | Ga0207705_10084572 | 3300025909 | Unclassified | 2316 |
| 484 | Ga0207654_10001980 | 3300025911 | Bacteria | 10581 |
| 485 | Ga0207654_10017862 | 3300025911 | Bacteria | 3716 |
| 486 | Ga0207707_10007370 | 3300025912 | Bacteria | 9582 |
| 487 | Ga0207707_10013675 | 3300025912 | Bacteria | 7079 |
| 488 | Ga0207707_10096103 | 3300025912 | Unclassified | 2589 |
| 489 | Ga0207707_10126301 | 3300025912 | Bacteria | 2237 |
| 490 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 491 | Ga0207695_10000685 | 3300025913 | Bacteria | 66448 |
| 492 | Ga0207695_10000917 | 3300025913 | Bacteria | 52754 |
| 493 | Ga0207695_10001873 | 3300025913 | Bacteria | 32931 |
| 494 | Ga0207695_10008256 | 3300025913 | Bacteria | 13070 |
| 495 | Ga0207695_10028845 | 3300025913 | Bacteria | 6143 |
| 496 | Ga0207695_10038240 | 3300025913 | Bacteria | 5169 |
| 497 | Ga0207695_10088165 | 3300025913 | Bacteria | 3124 |
| 498 | Ga0207695_10118885 | 3300025913 | Bacteria | 2613 |
| 499 | Ga0207671_10000637 | 3300025914 | Bacteria | 45954 |
| 500 | Ga0207671_10001799 | 3300025914 | Bacteria | 23966 |
| 501 | Ga0207671_10002779 | 3300025914 | Bacteria | 18262 |
| 502 | Ga0207671_10004496 | 3300025914 | Bacteria | 13275 |
| 503 | Ga0207671_10007714 | 3300025914 | Bacteria | 9281 |
| 504 | Ga0207671_10008078 | 3300025914 | Bacteria | 8989 |
| 505 | Ga0207671_10011235 | 3300025914 | Bacteria | 7305 |
| 506 | Ga0207671_10051595 | 3300025914 | Bacteria | 3048 |
| 507 | Ga0207671_10053268 | 3300025914 | Bacteria | 2998 |
| 508 | Ga0207671_10256304 | 3300025914 | Bacteria | 1376 |
| 509 | Ga0207660_10035163 | 3300025917 | Bacteria | 3476 |
| 510 | Ga0207660_10115889 | 3300025917 | Unclassified | 2023 |
| 511 | Ga0207657_10003743 | 3300025919 | Bacteria | 16162 |
| 512 | Ga0207657_10004066 | 3300025919 | Bacteria | 15521 |
| 513 | Ga0207657_10013683 | 3300025919 | Bacteria | 7947 |
| 514 | Ga0207657_10014890 | 3300025919 | Bacteria | 7566 |
| 515 | Ga0207657_10050054 | 3300025919 | Bacteria | 3637 |
| 516 | Ga0207657_10094958 | 3300025919 | Bacteria | 2482 |
| 517 | Ga0207652_10000098 | 3300025921 | Bacteria | 94858 |
| 518 | Ga0207652_10000771 | 3300025921 | Bacteria | 30684 |
| 519 | Ga0207652_10007027 | 3300025921 | Bacteria | 9072 |
| 520 | Ga0207652_10052600 | 3300025921 | Bacteria | 3496 |
| 521 | Ga0207652_10070241 | 3300025921 | Bacteria | 3041 |
| 522 | Ga0207652_10075289 | 3300025921 | Bacteria | 2941 |
| 523 | Ga0207652_10138414 | 3300025921 | Unclassified | 2175 |
| 524 | Ga0207652_10207612 | 3300025921 | Bacteria | 1763 |
| 525 | Ga0207681_10010977 | 3300025923 | Bacteria | 5563 |
| 526 | Ga0207681_10020930 | 3300025923 | Bacteria | 4151 |
| 527 | Ga0207681_10034340 | 3300025923 | Bacteria | 3334 |
| 528 | Ga0207681_10034444 | 3300025923 | Bacteria | 3330 |
| 529 | Ga0207681_10046936 | 3300025923 | Bacteria | 2907 |
| 530 | Ga0207694_10004594 | 3300025924 | Bacteria | 10748 |
| 531 | Ga0207694_10259943 | 3300025924 | Bacteria | 1422 |
| 532 | Ga0207650_10001513 | 3300025925 | Bacteria | 16609 |
| 533 | Ga0207650_10047461 | 3300025925 | Bacteria | 3165 |
| 534 | Ga0207650_10154590 | 3300025925 | Bacteria | 1813 |
| 535 | Ga0207650_10169646 | 3300025925 | Bacteria | 1734 |
| 536 | Ga0207659_10023695 | 3300025926 | Bacteria | 4101 |
| 537 | Ga0207659_10268367 | 3300025926 | Bacteria | 1391 |
| 538 | Ga0207644_10318802 | 3300025931 | Bacteria | 1256 |
| 539 | Ga0207690_10010426 | 3300025932 | Bacteria | 5522 |
| 540 | Ga0207690_10088374 | 3300025932 | Bacteria | 2183 |
| 541 | Ga0207706_10017700 | 3300025933 | Bacteria | 6420 |
| 542 | Ga0207706_10029724 | 3300025933 | Bacteria | 4877 |
| 543 | Ga0207686_10000709 | 3300025934 | Bacteria | 20683 |
| 544 | Ga0207686_10127732 | 3300025934 | Bacteria | 1740 |
| 545 | Ga0207670_10039676 | 3300025936 | Bacteria | 3085 |
| 546 | Ga0207669_10018579 | 3300025937 | Bacteria | 3598 |
| 547 | Ga0207669_10054671 | 3300025937 | Bacteria | 2413 |
| 548 | Ga0207669_10057781 | 3300025937 | Bacteria | 2364 |
| 549 | Ga0207704_10006232 | 3300025938 | Bacteria | 5547 |
| 550 | Ga0207704_10009596 | 3300025938 | Bacteria | 4677 |
| 551 | Ga0207704_10084718 | 3300025938 | Bacteria | 2061 |
| 552 | Ga0207691_10030097 | 3300025940 | Bacteria | 5075 |
| 553 | Ga0207691_10045472 | 3300025940 | Bacteria | 4035 |
| 554 | Ga0207691_10080271 | 3300025940 | Bacteria | 2934 |
| 555 | Ga0207691_10080607 | 3300025940 | Bacteria | 2927 |
| 556 | Ga0207689_10003649 | 3300025942 | Bacteria | 14045 |
| 557 | Ga0207689_10007268 | 3300025942 | Bacteria | 9723 |
| 558 | Ga0207689_10008486 | 3300025942 | Bacteria | 8952 |
| 559 | Ga0207689_10031074 | 3300025942 | Bacteria | 4448 |
| 560 | Ga0207689_10058060 | 3300025942 | Bacteria | 3183 |
| 561 | Ga0207689_10149580 | 3300025942 | Unclassified | 1925 |
| 562 | Ga0207679_10008949 | 3300025945 | Bacteria | 6396 |
| 563 | Ga0207679_10039923 | 3300025945 | Bacteria | 3356 |
| 564 | Ga0207679_10077262 | 3300025945 | Bacteria | 2532 |
| 565 | Ga0207679_10141067 | 3300025945 | Unclassified | 1948 |
| 566 | Ga0207667_10000172 | 3300025949 | Bacteria | 95455 |
| 567 | Ga0207667_10000630 | 3300025949 | Bacteria | 45583 |
| 568 | Ga0207667_10001836 | 3300025949 | Bacteria | 26673 |
| 569 | Ga0207667_10008374 | 3300025949 | Bacteria | 12289 |
| 570 | Ga0207667_10031326 | 3300025949 | Bacteria | 5742 |
| 571 | Ga0207667_10055066 | 3300025949 | Bacteria | 4182 |
| 572 | Ga0207667_10138798 | 3300025949 | Bacteria | 2503 |
| 573 | Ga0207667_10230902 | 3300025949 | Bacteria | 1895 |
| 574 | Ga0207651_10009901 | 3300025960 | Bacteria | 5248 |
| 575 | Ga0207651_10017040 | 3300025960 | Bacteria | 4279 |
| 576 | Ga0207651_10020151 | 3300025960 | Bacteria | 4018 |
| 577 | Ga0207651_10207041 | 3300025960 | Bacteria | 1576 |
| 578 | Ga0207712_10001470 | 3300025961 | Bacteria | 16071 |
| 579 | Ga0207712_10002610 | 3300025961 | Bacteria | 11559 |
| 580 | Ga0207712_10002895 | 3300025961 | Bacteria | 10971 |
| 581 | Ga0207712_10007405 | 3300025961 | Bacteria | 6931 |
| 582 | Ga0207712_10017162 | 3300025961 | Bacteria | 4697 |
| 583 | Ga0207712_10239308 | 3300025961 | Unclassified | 1461 |
| 584 | Ga0207668_10116964 | 3300025972 | Unclassified | 2011 |
| 585 | Ga0207640_10070822 | 3300025981 | Bacteria | 2347 |
| 586 | Ga0207640_10089746 | 3300025981 | Bacteria | 2125 |
| 587 | Ga0207658_10004993 | 3300025986 | Bacteria | 9143 |
| 588 | Ga0207658_10026815 | 3300025986 | Bacteria | 4044 |
| 589 | Ga0207658_10031720 | 3300025986 | Bacteria | 3755 |
| 590 | Ga0207658_10123177 | 3300025986 | Bacteria | 2071 |
| 591 | Ga0207677_10000816 | 3300026023 | Bacteria | 17807 |
| 592 | Ga0207677_10004544 | 3300026023 | Bacteria | 7462 |
| 593 | Ga0207703_10015149 | 3300026035 | Bacteria | 6018 |
| 594 | Ga0207639_10002886 | 3300026041 | Bacteria | 11551 |
| 595 | Ga0207639_10018447 | 3300026041 | Bacteria | 4958 |
| 596 | Ga0207639_10049666 | 3300026041 | Bacteria | 3182 |
| 597 | Ga0207639_10052285 | 3300026041 | Bacteria | 3112 |
| 598 | Ga0207639_10055557 | 3300026041 | Bacteria | 3031 |
| 599 | Ga0207639_10074264 | 3300026041 | Unclassified | 2669 |
| 600 | Ga0207639_10136311 | 3300026041 | Bacteria | 2039 |
| 601 | Ga0207639_10226103 | 3300026041 | Bacteria | 1619 |
| 602 | Ga0207678_10033889 | 3300026067 | Unclassified | 4448 |
| 603 | Ga0207708_10020703 | 3300026075 | Bacteria | 4961 |
| 604 | Ga0207702_10082483 | 3300026078 | Bacteria | 2796 |
| 605 | Ga0207702_10085938 | 3300026078 | Unclassified | 2742 |
| 606 | Ga0207702_10318199 | 3300026078 | Bacteria | 1481 |
| 607 | Ga0207702_10396376 | 3300026078 | Bacteria | 1330 |
| 608 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 609 | Ga0207641_10128901 | 3300026088 | Bacteria | 2269 |
| 610 | Ga0207641_10167509 | 3300026088 | Bacteria | 2002 |
| 611 | Ga0207641_10204148 | 3300026088 | Bacteria | 1824 |
| 612 | Ga0207648_10000384 | 3300026089 | Bacteria | 48937 |
| 613 | Ga0207648_10010983 | 3300026089 | Bacteria | 8553 |
| 614 | Ga0207648_10013448 | 3300026089 | Bacteria | 7615 |
| 615 | Ga0207648_10039543 | 3300026089 | Bacteria | 4147 |
| 616 | Ga0207648_10280134 | 3300026089 | Bacteria | 1491 |
| 617 | Ga0207648_10331629 | 3300026089 | Bacteria | 1369 |
| 618 | Ga0207676_10005777 | 3300026095 | Bacteria | 8750 |
| 619 | Ga0207676_10008363 | 3300026095 | Bacteria | 7355 |
| 620 | Ga0207676_10010736 | 3300026095 | Bacteria | 6530 |
| 621 | Ga0207676_10025572 | 3300026095 | Bacteria | 4381 |
| 622 | Ga0207676_10043389 | 3300026095 | Bacteria | 3462 |
| 623 | Ga0207676_10076021 | 3300026095 | Bacteria | 2712 |
| 624 | Ga0207674_10004626 | 3300026116 | Bacteria | 16516 |
| 625 | Ga0207674_10033161 | 3300026116 | Bacteria | 5407 |
| 626 | Ga0207674_10043007 | 3300026116 | Bacteria | 4660 |
| 627 | Ga0207674_10080599 | 3300026116 | Bacteria | 3258 |
| 628 | Ga0207674_10131836 | 3300026116 | Unclassified | 2462 |
| 629 | Ga0207674_10152040 | 3300026116 | Bacteria | 2271 |
| 630 | Ga0207674_10170701 | 3300026116 | Bacteria | 2128 |
| 631 | Ga0207674_10483231 | 3300026116 | Bacteria | 1197 |
| 632 | Ga0207675_100009007 | 3300026118 | Bacteria | 9365 |
| 633 | Ga0207675_100012296 | 3300026118 | Bacteria | 7996 |
| 634 | Ga0207675_100064596 | 3300026118 | Bacteria | 3421 |
| 635 | Ga0207675_100155488 | 3300026118 | Bacteria | 2179 |
| 636 | Ga0207675_100266074 | 3300026118 | Unclassified | 1663 |
| 637 | Ga0207675_100270750 | 3300026118 | Bacteria | 1648 |
| 638 | Ga0207683_10007595 | 3300026121 | Bacteria | 9286 |
| 639 | Ga0207683_10109372 | 3300026121 | Bacteria | 2474 |
| 640 | Ga0207698_10009978 | 3300026142 | Bacteria | 6078 |
| 641 | Ga0207698_10018321 | 3300026142 | Bacteria | 4769 |
| 642 | Ga0207698_10037614 | 3300026142 | Bacteria | 3566 |
| 643 | Ga0207698_10051120 | 3300026142 | Bacteria | 3158 |
| 644 | Ga0207698_10073059 | 3300026142 | Bacteria | 2729 |
| 645 | Ga0207698_10080910 | 3300026142 | Bacteria | 2619 |
| 646 | Ga0207698_10102320 | 3300026142 | Bacteria | 2377 |
| 647 | Ga0207698_10160932 | 3300026142 | Unclassified | 1963 |
| 648 | Ga0207698_10242148 | 3300026142 | Bacteria | 1645 |
| 649 | Ga0207698_10297218 | 3300026142 | Unclassified | 1501 |
| 650 | Ga0207698_10370944 | 3300026142 | Unclassified | 1358 |
| 651 | Ga0207698_10439612 | 3300026142 | Bacteria | 1256 |
| 652 | Ga0207698_10494465 | 3300026142 | Bacteria | 1189 |
| 653 | Ga0207698_10511397 | 3300026142 | Bacteria | 1170 |
| 654 | Ga0207428_10047103 | 3300027907 | Bacteria | 3463 |
| 655 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 656 | Ga0268266_10128363 | 3300028379 | Unclassified | 2265 |
| 657 | Ga0268265_10009060 | 3300028380 | Bacteria | 6731 |
| 658 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 659 | Ga0268264_10001761 | 3300028381 | Bacteria | 19835 |
| 660 | Ga0268264_10006760 | 3300028381 | Bacteria | 9638 |
| 661 | Ga0268264_10009685 | 3300028381 | Bacteria | 7982 |
| 662 | Ga0268264_10010034 | 3300028381 | Bacteria | 7841 |
| 663 | Ga0268264_10028275 | 3300028381 | Bacteria | 4585 |
| 664 | Ga0268264_10037291 | 3300028381 | Bacteria | 4007 |
| 665 | Ga0268264_10075394 | 3300028381 | Bacteria | 2868 |
| 666 | Ga0268264_10086516 | 3300028381 | Bacteria | 2693 |
| 667 | Ga0268264_10276301 | 3300028381 | Bacteria | 1571 |
| 668 | Ga0268264_10363318 | 3300028381 | Bacteria | 1381 |
| 669 | Ga0307517_10004393 | 3300028786 | Bacteria | 21657 |
| 670 | Ga0307517_10137171 | 3300028786 | Bacteria | 1735 |
| 671 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 672 | Ga0307515_10000031 | 3300028794 | Bacteria | 358648 |
| 673 | Ga0307511_10000002 | 3300030521 | Bacteria | 199923 |
| 674 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 675 | Ga0265327_10001248 | 3300031251 | Bacteria | 33913 |
| 676 | Ga0265327_10075405 | 3300031251 | Bacteria | 1677 |
| 677 | Ga0265313_10092838 | 3300031595 | Bacteria | 1351 |
| 678 | Ga0307516_10000159 | 3300031730 | Bacteria | 84553 |
| 679 | Ga0307516_10189430 | 3300031730 | Bacteria | 1784 |
| 680 | Ga0307414_10046302 | 3300032004 | Bacteria | 2985 |
| 681 | Ga0307414_10222252 | 3300032004 | Unclassified | 1551 |
| 682 | Ga0316583_10005637 | 3300032133 | Bacteria | 4501 |
| 683 | Ga0307510_10004925 | 3300033180 | Bacteria | 15802 |
| 684 | Ga0373943_0010590 | 3300035170 | Bacteria | 4136 |
| 685 | Ga0373955_0025009 | 3300035172 | Bacteria | 3061 |
| 686 | Ga0373935_0056690 | 3300035692 | Unclassified | 2499 |
| 687 | Ga0373927_0103964 | 3300035695 | Bacteria | 1849 |
| 688 | Ga0373933_0036103 | 3300035724 | Bacteria | 2891 |
| 689 | Ga0373937_0142441 | 3300036401 | Unclassified | 2243 |
| 690 | Ga0316582_0072857 | 3300036647 | Bacteria | 2228 |
| 691 | Ga0395899_0002500 | 3300037312 | Bacteria | 14918 |
| 692 | Ga0395899_0044855 | 3300037312 | Bacteria | 3293 |
| 693 | Ga0395899_0071908 | 3300037312 | Bacteria | 2531 |
| 694 | Ga0395899_0146615 | 3300037312 | Bacteria | 1675 |
| 695 | Ga0395900_0006705 | 3300037418 | Bacteria | 11964 |
| 696 | Ga0395900_0016665 | 3300037418 | Bacteria | 7494 |
| 697 | Ga0395900_0041142 | 3300037418 | Bacteria | 4765 |
| 698 | Ga0395900_0169824 | 3300037418 | Bacteria | 2221 |
| 699 | Ga0395900_0226618 | 3300037418 | Bacteria | 1881 |
| 700 | Ga0395900_0325488 | 3300037418 | Bacteria | 1516 |
| 701 | Ga0395898_0001101 | 3300037466 | Bacteria | 41709 |
| 702 | Ga0395898_0010318 | 3300037466 | Bacteria | 9772 |
| 703 | Ga0395898_0059676 | 3300037466 | Bacteria | 3710 |
| 704 | Ga0395898_0091791 | 3300037466 | Unclassified | 2921 |
| 705 | Ga0395905_0000340 | 3300037471 | Bacteria | 66412 |
| 706 | Ga0395905_0003668 | 3300037471 | Bacteria | 16282 |
| 707 | Ga0395905_0021187 | 3300037471 | Bacteria | 6152 |
| 708 | Ga0395905_0095804 | 3300037471 | Bacteria | 2786 |
| 709 | Ga0395901_0022528 | 3300038443 | Bacteria | 6457 |
| 710 | Ga0395901_0022924 | 3300038443 | Bacteria | 6400 |
| 711 | Ga0395901_0063597 | 3300038443 | Bacteria | 3840 |
| 712 | Ga0395901_0341982 | 3300038443 | Bacteria | 1546 |
| 713 | Ga0436365_0565109 | 3300039437 | Bacteria | 6714 |
| 714 | Ga0436365_0850637 | 3300039437 | Bacteria | 2704 |
| 715 | Ga0436365_1118032 | 3300039437 | Bacteria | 1503 |
| 716 | Ga0436365_1249677 | 3300039437 | Bacteria | 17339 |
| 717 | Ga0436365_1261027 | 3300039437 | Bacteria | 1957 |
| 718 | Ga0439436_0002706 | 3300041404 | Bacteria | 5349 |
| 719 | Ga0439439_0034645 | 3300041406 | Bacteria | 1295 |
| 720 | Ga0451795_0780786 | 3300041456 | Bacteria | 1292 |
| 721 | Ga0451795_0781871 | 3300041456 | Bacteria | 1586 |
| 722 | Ga0451852_31448 | 3300041508 | Unclassified | 1567 |
| 723 | Ga0439431_0002553 | 3300041997 | Bacteria | 4018 |
| 724 | Ga0439433_0012360 | 3300041999 | Bacteria | 1871 |
| 725 | Ga0439445_0007815 | 3300042004 | Bacteria | 2491 |
| 726 | Ga0439448_0040628 | 3300042005 | Bacteria | 1503 |
| 727 | Ga0439449_0002729 | 3300042007 | Bacteria | 6868 |
| 728 | Ga0439449_0007774 | 3300042007 | Bacteria | 4071 |
| 729 | Ga0439457_002111 | 3300042014 | Bacteria | 5781 |
| 730 | Ga0439462_0004635 | 3300042015 | Bacteria | 3362 |
| 731 | Ga0450923_000505 | 3300042125 | Bacteria | 4323 |
| 732 | Ga0450897_000793 | 3300042128 | Bacteria | 1917 |
| 733 | Ga0450898_001475 | 3300042134 | Bacteria | 3109 |
| 734 | Ga0451577_0006113 | 3300042876 | Bacteria | 12094 |
| 735 | Ga0451577_0119657 | 3300042876 | Bacteria | 2359 |
| 736 | Ga0451577_0150514 | 3300042876 | Bacteria | 2094 |
| 737 | Ga0451577_0352884 | 3300042876 | Bacteria | 1334 |
| 738 | Ga0466969_0000127 | 3300044656 | Bacteria | 41196 |
| 739 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 740 | Ga0466972_0000080 | 3300044658 | Bacteria | 89226 |
| 741 | Ga0466972_0020001 | 3300044658 | Bacteria | 3346 |
| 742 | Ga0466972_0032921 | 3300044658 | Bacteria | 2543 |
| 743 | Ga0466972_0046660 | 3300044658 | Bacteria | 2097 |
| 744 | Ga0453683_0138195 | 3300044673 | Unclassified | 1537 |
| 745 | Ga0466965_0148639 | 3300044683 | Bacteria | 1224 |
| 746 | Ga0466966_0000120 | 3300044684 | Bacteria | 49271 |
| 747 | Ga0453684_0002335 | 3300044712 | Bacteria | 46440 |
| 748 | Ga0453684_0021550 | 3300044712 | Bacteria | 9621 |
| 749 | Ga0453684_0026631 | 3300044712 | Bacteria | 8337 |
| 750 | Ga0453684_0108162 | 3300044712 | Bacteria | 3384 |
| 751 | Ga0453684_0147752 | 3300044712 | Bacteria | 2797 |
| 752 | Ga0453684_0153958 | 3300044712 | Bacteria | 2728 |
| 753 | Ga0453684_0231776 | 3300044712 | Bacteria | 2131 |
| 754 | Ga0453684_0532170 | 3300044712 | Bacteria | 1297 |
| 755 | Ga0466971_0015332 | 3300044719 | Bacteria | 3372 |
| 756 | Ga0466968_0087464 | 3300044735 | Bacteria | 1376 |
| 757 | Ga0466970_0003312 | 3300044765 | Bacteria | 7829 |
| 758 | Ga0466957_0000380 | 3300044842 | Bacteria | 21740 |
| 759 | Ga0466957_0022142 | 3300044842 | Bacteria | 3747 |
| 760 | Ga0466957_0082602 | 3300044842 | Bacteria | 2003 |
| 761 | Ga0466959_0000014 | 3300045049 | Bacteria | 150962 |
| 762 | Ga0466959_0032834 | 3300045049 | Bacteria | 3842 |
| 763 | Ga0466959_0034324 | 3300045049 | Bacteria | 3752 |
| 764 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 765 | Ga0451576_0295748 | 3300045051 | Bacteria | 1693 |
| 766 | Ga0451576_0299422 | 3300045051 | Bacteria | 1682 |
| 767 | Ga0466958_0013285 | 3300045836 | Bacteria | 4685 |
| 768 | Ga0495627_032001 | 3300046453 | Bacteria | 1657 |
| 769 | Ga0495638_0036074 | 3300046460 | Bacteria | 3151 |
| 770 | Ga0495638_0048927 | 3300046460 | Bacteria | 2645 |
| 771 | Ga0495638_0084937 | 3300046460 | Bacteria | 1915 |
| 772 | Ga0495653_0064121 | 3300046463 | Bacteria | 2769 |
| 773 | Ga0495650_0031064 | 3300046471 | Bacteria | 2409 |
| 774 | Ga0495580_0174334 | 3300046472 | Unclassified | 1486 |
| 775 | Ga0495606_0005804 | 3300046507 | Bacteria | 11654 |
| 776 | Ga0495618_0096219 | 3300046514 | Unclassified | 1894 |
| 777 | Ga0495628_0027888 | 3300046516 | Bacteria | 4591 |
| 778 | Ga0495643_0037388 | 3300046522 | Bacteria | 2663 |
| 779 | Ga0495645_0128073 | 3300046543 | Bacteria | 1782 |
| 780 | Ga0495633_0000125 | 3300046558 | Bacteria | 104459 |
| 781 | Ga0495668_0000082 | 3300046616 | Bacteria | 154982 |
| 782 | Ga0495634_0009802 | 3300046642 | Bacteria | 7051 |
| 783 | Ga0495625_0081734 | 3300046660 | Bacteria | 2248 |
| 784 | Ga0495670_0066473 | 3300046691 | Unclassified | 1819 |
| 785 | Ga0495649_0033106 | 3300046694 | Bacteria | 2845 |
| 786 | Ga0495672_0021009 | 3300047320 | Unclassified | 4265 |
| 787 | Ga0495672_0043145 | 3300047320 | Bacteria | 2714 |
| 788 | Ga0495687_000261 | 3300047443 | Bacteria | 71090 |
| 789 | Ga0495684_0142488 | 3300047471 | Bacteria | 1797 |
| 790 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 791 | Ga0495686_0007643 | 3300047472 | Bacteria | 8070 |
| 792 | Ga0495686_0056486 | 3300047472 | Bacteria | 2452 |
| 793 | Ga0496121_0000081 | 3300048924 | Bacteria | 229506 |
| 794 | Ga0496126_0042525 | 3300048929 | Bacteria | 4196 |
| 795 | Ga0501298_002627 | 3300049521 | Bacteria | 2735 |
| 796 | Ga0501032_0001909 | 3300049569 | Bacteria | 16464 |
| 797 | Ga0501033_0225055 | 3300049570 | Bacteria | 1334 |
| 798 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 799 | Ga0501034_0007421 | 3300049571 | Bacteria | 11669 |
| 800 | Ga0501034_0011664 | 3300049571 | Bacteria | 9096 |
| 801 | Ga0501034_0024828 | 3300049571 | Bacteria | 6098 |
| 802 | Ga0501034_0032084 | 3300049571 | Bacteria | 5336 |
| 803 | Ga0501034_0054317 | 3300049571 | Bacteria | 4033 |
| 804 | Ga0501034_0074752 | 3300049571 | Bacteria | 3396 |
| 805 | Ga0501034_0123271 | 3300049571 | Bacteria | 2577 |
| 806 | Ga0501036_0034595 | 3300049572 | Bacteria | 4274 |
| 807 | Ga0501037_0018719 | 3300049573 | Bacteria | 5103 |
| 808 | Ga0501037_0031925 | 3300049573 | Bacteria | 3888 |
| 809 | Ga0501038_0030627 | 3300049574 | Bacteria | 4758 |
| 810 | Ga0501039_0084825 | 3300049575 | Bacteria | 2467 |
| 811 | Ga0501039_0166752 | 3300049575 | Bacteria | 1731 |
| 812 | Ga0501043_0003893 | 3300049579 | Bacteria | 12252 |
| 813 | Ga0501043_0068367 | 3300049579 | Unclassified | 2789 |
| 814 | Ga0501043_0087841 | 3300049579 | Bacteria | 2443 |
| 815 | Ga0501043_0152891 | 3300049579 | Bacteria | 1805 |
| 816 | Ga0501046_0045392 | 3300049580 | Bacteria | 3492 |
| 817 | Ga0501046_0056453 | 3300049580 | Bacteria | 3082 |
| 818 | Ga0501047_0006704 | 3300049581 | Bacteria | 10826 |
| 819 | Ga0501047_0006977 | 3300049581 | Bacteria | 10603 |
| 820 | Ga0501047_0013596 | 3300049581 | Bacteria | 7720 |
| 821 | Ga0501047_0082793 | 3300049581 | Bacteria | 3084 |
| 822 | Ga0501047_0404324 | 3300049581 | Bacteria | 1198 |
| 823 | Ga0501048_0006258 | 3300049582 | Bacteria | 9053 |
| 824 | Ga0501067_0036099 | 3300049583 | Bacteria | 2745 |
| 825 | Ga0501067_0150962 | 3300049583 | Bacteria | 1294 |
| 826 | Ga0501068_0027869 | 3300049584 | Bacteria | 3338 |
| 827 | Ga0501069_0074172 | 3300049585 | Unclassified | 1909 |
| 828 | Ga0501070_0082958 | 3300049586 | Bacteria | 2653 |
| 829 | Ga0501070_0148251 | 3300049586 | Bacteria | 1936 |
| 830 | Ga0501070_0195039 | 3300049586 | Bacteria | 1663 |
| 831 | Ga0501073_0006651 | 3300049589 | Bacteria | 8610 |
| 832 | Ga0501073_0031419 | 3300049589 | Bacteria | 3789 |
| 833 | Ga0501074_0002599 | 3300049590 | Bacteria | 12616 |
| 834 | Ga0501201_000165 | 3300049651 | Bacteria | 5738 |
| 835 | Ga0501202_006692 | 3300049652 | Bacteria | 2069 |
| 836 | Ga0501217_006558 | 3300049661 | Bacteria | 2477 |
| 837 | Ga0501223_001832 | 3300049663 | Bacteria | 4805 |
| 838 | Ga0501224_001013 | 3300049664 | Bacteria | 3640 |
| 839 | Ga0501233_005424 | 3300049668 | Bacteria | 2366 |
| 840 | Ga0501235_001196 | 3300049669 | Bacteria | 5453 |
| 841 | Ga0501257_009245 | 3300049686 | Bacteria | 2223 |
| 842 | Ga0501257_023514 | 3300049686 | Bacteria | 1462 |
| 843 | Ga0501261_004740 | 3300049690 | Bacteria | 1694 |
| 844 | Ga0501219_000133 | 3300049703 | Bacteria | 13105 |
| 845 | Ga0501221_002892 | 3300049704 | Bacteria | 2829 |
| 846 | Ga0501225_0005194 | 3300049705 | Bacteria | 3833 |
| 847 | Ga0501080_0030856 | 3300049742 | Bacteria | 4994 |
| 848 | Ga0501080_0231967 | 3300049742 | Bacteria | 1687 |
| 849 | Ga0501083_0015427 | 3300049744 | Bacteria | 5350 |
| 850 | Ga0501083_0050834 | 3300049744 | Bacteria | 2788 |
| 851 | Ga0501241_003764 | 3300049758 | Bacteria | 2858 |
| 852 | Ga0501275_004810 | 3300049772 | Bacteria | 1279 |
| 853 | Ga0501035_0002433 | 3300049822 | Bacteria | 18202 |
| 854 | Ga0501035_0007289 | 3300049822 | Bacteria | 10349 |
| 855 | Ga0501035_0101410 | 3300049822 | Bacteria | 2526 |
| 856 | Ga0501035_0114099 | 3300049822 | Bacteria | 2366 |
| 857 | Ga0501044_0013650 | 3300049823 | Bacteria | 8779 |
| 858 | Ga0501044_0016689 | 3300049823 | Bacteria | 7884 |
| 859 | Ga0501044_0021227 | 3300049823 | Bacteria | 6932 |
| 860 | Ga0501044_0021518 | 3300049823 | Bacteria | 6878 |
| 861 | Ga0501044_0100055 | 3300049823 | Bacteria | 2918 |
| 862 | Ga0501044_0208382 | 3300049823 | Bacteria | 1910 |
| 863 | Ga0501044_0294316 | 3300049823 | Bacteria | 1554 |
| 864 | Ga0501284_00007 | 3300050005 | Bacteria | 147956 |
| 865 | nmdc:mga0k408_40938_c1 | 3300050493 | Bacteria | 2667 |
| 866 | nmdc:mga0k408_7554_c1 | 3300050493 | Bacteria | 5806 |
| 867 | nmdc:mga07m45_63327_c1 | 3300050496 | Bacteria | 2097 |
| 868 | nmdc:mga05p37_23584_c1 | 3300050507 | Bacteria | 7467 |
| 869 | nmdc:mga05p37_525609_c1 | 3300050507 | Bacteria | 1352 |
| 870 | nmdc:mga05p37_827_c1 | 3300050507 | Bacteria | 34726 |
| 871 | nmdc:mga09592_3608_c1 | 3300050508 | Bacteria | 12484 |
| 872 | nmdc:mga09592_5573_c1 | 3300050508 | Bacteria | 10252 |
| 873 | nmdc:mga09592_97382_c1 | 3300050508 | Bacteria | 2518 |
| 874 | nmdc:mga0qj67_145895_c1 | 3300050509 | Bacteria | 1919 |
| 875 | nmdc:mga06r32_14340_c1 | 3300050510 | Bacteria | 7191 |
| 876 | nmdc:mga06r32_48896_c1 | 3300050510 | Bacteria | 4044 |
| 877 | nmdc:mga08y16_77511_c1 | 3300050511 | Bacteria | 3465 |
| 878 | nmdc:mga0n895_83806_c1 | 3300050512 | Bacteria | 3180 |
| 879 | Ga0500644_0000026 | 3300053088 | Bacteria | 93328 |
| 880 | Ga0500644_0002655 | 3300053088 | Bacteria | 4465 |
| 881 | Ga0500644_0022480 | 3300053088 | Bacteria | 1902 |
| 882 | Ga0500646_0001794 | 3300053090 | Bacteria | 5655 |
| 883 | Ga0500583_0000001 | 3300053092 | Bacteria | 241642 |
| 884 | Ga0500583_0001510 | 3300053092 | Bacteria | 6700 |
| 885 | Ga0500583_0002299 | 3300053092 | Bacteria | 5712 |
| 886 | Ga0500583_0042259 | 3300053092 | Bacteria | 2076 |
| 887 | Ga0500651_0044135 | 3300053093 | Bacteria | 2808 |
| 888 | Ga0500562_000018 | 3300053108 | Bacteria | 126890 |
| 889 | Ga0500569_000047 | 3300053109 | Bacteria | 22066 |
| 890 | Ga0500607_046686 | 3300053121 | Bacteria | 2321 |
| 891 | Ga0500652_033644 | 3300053131 | Bacteria | 2026 |
| 892 | Ga0500658_0003491 | 3300053134 | Bacteria | 5931 |
| 893 | Ga0500559_0002568 | 3300053136 | Bacteria | 9306 |
| 894 | Ga0500568_0000142 | 3300053139 | Bacteria | 64049 |
| 895 | Ga0500568_0003595 | 3300053139 | Bacteria | 8563 |
| 896 | Ga0500577_0006329 | 3300053142 | Bacteria | 3257 |
| 897 | Ga0500577_0045393 | 3300053142 | Bacteria | 1624 |
| 898 | Ga0500589_014113 | 3300053147 | Bacteria | 3536 |
| 899 | Ga0500616_0002235 | 3300053153 | Bacteria | 16549 |
| 900 | Ga0500622_0000114 | 3300053156 | Bacteria | 83162 |
| 901 | Ga0500622_0000692 | 3300053156 | Bacteria | 29667 |
| 902 | Ga0500622_0005506 | 3300053156 | Bacteria | 7585 |
| 903 | Ga0500622_0025494 | 3300053156 | Bacteria | 3124 |
| 904 | Ga0500636_0030666 | 3300053177 | Bacteria | 3182 |
| 905 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 906 | Ga0501084_0059210 | 3300054114 | Bacteria | 3205 |
| 907 | Ga0500661_006998 | 3300055283 | Bacteria | 2093 |
| 908 | Ga0501082_0225538 | 3300060353 | Bacteria | 1630 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100024630 | Ga0070680_1000246302 | 324 |
| 2 | 3300005339 | Ga0070660_100086771 | Ga0070660_1000867712 | 324 |
| 3 | 3300005563 | Ga0068855_100062546 | Ga0068855_1000625463 | 324 |
| 4 | 3300025919 | Ga0207657_10094958 | Ga0207657_100949582 | 324 |
| 5 | 3300025949 | Ga0207667_10000630 | Ga0207667_1000063038 | 324 |
| 6 | 3300044658 | Ga0466972_0046660 | Ga0466972_0046660_1008_2063 | 324 |
| 7 | 3300005336 | Ga0070680_100039686 | Ga0070680_1000396862 | 328 |
| 8 | 3300013307 | Ga0157372_10018986 | Ga0157372_100189865 | 328 |
| 9 | 3300025904 | Ga0207647_10045343 | Ga0207647_100453432 | 328 |
| 10 | 3300025921 | Ga0207652_10138414 | Ga0207652_101384142 | 328 |
| 11 | 3300026116 | Ga0207674_10043007 | Ga0207674_100430074 | 328 |
| 12 | 3300049571 | Ga0501034_0054317 | Ga0501034_0054317_2679_3767 | 328 |
| 13 | 3300049822 | Ga0501035_0114099 | Ga0501035_0114099_455_1543 | 328 |
| 14 | 3300005339 | Ga0070660_100000435 | Ga0070660_10000043512 | 329 |
| 15 | 3300013102 | Ga0157371_10002845 | Ga0157371_100028451 | 329 |
| 16 | 3300013307 | Ga0157372_10078140 | Ga0157372_100781403 | 329 |
| 17 | 3300025919 | Ga0207657_10004066 | Ga0207657_100040661 | 329 |
| 18 | 3300005339 | Ga0070660_100028232 | Ga0070660_1000282323 | 330 |
| 19 | 3300005366 | Ga0070659_100008871 | Ga0070659_1000088715 | 330 |
| 20 | 3300005457 | Ga0070662_100127996 | Ga0070662_1001279962 | 330 |
| 21 | 3300005530 | Ga0070679_100094063 | Ga0070679_1000940633 | 330 |
| 22 | 3300005539 | Ga0068853_100087689 | Ga0068853_1000876893 | 330 |
| 23 | 3300005563 | Ga0068855_100024021 | Ga0068855_1000240215 | 330 |
| 24 | 3300013100 | Ga0157373_10076302 | Ga0157373_100763022 | 330 |
| 25 | 3300013102 | Ga0157371_10036915 | Ga0157371_100369152 | 330 |
| 26 | 3300013307 | Ga0157372_10029218 | Ga0157372_100292182 | 330 |
| 27 | 3300025912 | Ga0207707_10126301 | Ga0207707_101263012 | 330 |
| 28 | 3300025919 | Ga0207657_10014890 | Ga0207657_100148902 | 330 |
| 29 | 3300025921 | Ga0207652_10007027 | Ga0207652_100070274 | 330 |
| 30 | 3300025932 | Ga0207690_10010426 | Ga0207690_100104264 | 330 |
| 31 | 3300025949 | Ga0207667_10055066 | Ga0207667_100550662 | 330 |
| 32 | 3300026041 | Ga0207639_10074264 | Ga0207639_100742643 | 330 |
| 33 | 3300026116 | Ga0207674_10152040 | Ga0207674_101520402 | 330 |
| 34 | 3300037418 | Ga0395900_0169824 | Ga0395900_0169824_263_1351 | 330 |
| 35 | 3300041456 | Ga0451795_0781871 | Ga0451795_0781871_98_1270 | 330 |
| 36 | 3300053121 | Ga0500607_046686 | Ga0500607_046686_1041_2096 | 330 |
| 37 | 3300005577 | Ga0068857_100174035 | Ga0068857_1001740352 | 331 |
| 38 | 3300026095 | Ga0207676_10043389 | Ga0207676_100433893 | 331 |
| 39 | 3300049571 | Ga0501034_0074752 | Ga0501034_0074752_1940_3028 | 331 |
| 40 | 3300049586 | Ga0501070_0148251 | Ga0501070_0148251_640_1728 | 331 |
| 41 | 3300013307 | Ga0157372_10001188 | Ga0157372_100011885 | 332 |
| 42 | 3300005843 | Ga0068860_100301772 | Ga0068860_1003017722 | 333 |
| 43 | 3300005844 | Ga0068862_100025468 | Ga0068862_1000254682 | 333 |
| 44 | 3300014326 | Ga0157380_10455292 | Ga0157380_104552921 | 333 |
| 45 | 3300025907 | Ga0207645_10022290 | Ga0207645_100222901 | 333 |
| 46 | 3300025942 | Ga0207689_10007268 | Ga0207689_100072684 | 333 |
| 47 | 3300042876 | Ga0451577_0150514 | Ga0451577_0150514_530_1552 | 333 |
| 48 | 3300042876 | Ga0451577_0352884 | Ga0451577_0352884_34_1083 | 333 |
| 49 | 3300044712 | Ga0453684_0002335 | Ga0453684_0002335_8729_9784 | 333 |
| 50 | 3300044712 | Ga0453684_0231776 | Ga0453684_0231776_527_1549 | 333 |
| 51 | 3300045051 | Ga0451576_0299422 | Ga0451576_0299422_60_1082 | 333 |
| 52 | 3300046691 | Ga0495670_0066473 | Ga0495670_0066473_775_1797 | 333 |
| 53 | 3300041508 | Ga0451852_31448 | Ga0451852_31448_136_1194 | 334 |
| 54 | 3300042005 | Ga0439448_0040628 | Ga0439448_0040628_399_1454 | 335 |
| 55 | 3300045051 | Ga0451576_0000002 | Ga0451576_0000002_868246_869307 | 335 |
| 56 | 3300045049 | Ga0466959_0032834 | Ga0466959_0032834_1656_2747 | 336 |
| 57 | 3300041456 | Ga0451795_0780786 | Ga0451795_0780786_226_1269 | 337 |
| 58 | 3300005563 | Ga0068855_100013609 | Ga0068855_1000136093 | 338 |
| 59 | 3300009545 | Ga0105237_10003013 | Ga0105237_1000301312 | 338 |
| 60 | 3300010375 | Ga0105239_10000404 | Ga0105239_1000040448 | 338 |
| 61 | 3300025914 | Ga0207671_10011235 | Ga0207671_100112354 | 338 |
| 62 | 3300025949 | Ga0207667_10138798 | Ga0207667_101387983 | 338 |
| 63 | 3300005341 | Ga0070691_10018185 | Ga0070691_100181853 | 339 |
| 64 | 3300046453 | Ga0495627_032001 | Ga0495627_032001_140_1195 | 339 |
| 65 | 3300046558 | Ga0495633_0000125 | Ga0495633_0000125_65770_66825 | 339 |
| 66 | 3300049686 | Ga0501257_023514 | Ga0501257_023514_391_1446 | 339 |
| 67 | 3300053093 | Ga0500651_0044135 | Ga0500651_0044135_277_1332 | 339 |
| 68 | 3300005455 | Ga0070663_100096476 | Ga0070663_1000964762 | 340 |
| 69 | 3300005458 | Ga0070681_10012536 | Ga0070681_100125363 | 340 |
| 70 | 3300013105 | Ga0157369_10049589 | Ga0157369_100495895 | 340 |
| 71 | 3300025909 | Ga0207705_10084572 | Ga0207705_100845722 | 340 |
| 72 | 3300025912 | Ga0207707_10096103 | Ga0207707_100961032 | 340 |
| 73 | 3300025917 | Ga0207660_10115889 | Ga0207660_101158892 | 340 |
| 74 | 3300025921 | Ga0207652_10000771 | Ga0207652_1000077124 | 340 |
| 75 | 3300026067 | Ga0207678_10033889 | Ga0207678_100338892 | 340 |
| 76 | 3300037312 | Ga0395899_0044855 | Ga0395899_0044855_67_1149 | 340 |
| 77 | 3300037466 | Ga0395898_0010318 | Ga0395898_0010318_5297_6379 | 340 |
| 78 | 3300038443 | Ga0395901_0022528 | Ga0395901_0022528_5331_6413 | 340 |
| 79 | iso_pu_bacteria | 2738541278 | 2738725418 | 340 |
| 80 | iso_pu_bacteria | 2929239360 | 2929240123 | 340 |
| 81 | 3300003320 | rootH2_10017798 | rootH2_1001779810 | 341 |
| 82 | 3300005262 | Ga0065165_1007410 | Ga0065165_10074102 | 341 |
| 83 | 3300005618 | Ga0068864_100088090 | Ga0068864_1000880902 | 341 |
| 84 | 3300009553 | Ga0105249_10567068 | Ga0105249_105670681 | 341 |
| 85 | 3300013104 | Ga0157370_10000408 | Ga0157370_1000040824 | 341 |
| 86 | 3300013104 | Ga0157370_10356359 | Ga0157370_103563592 | 341 |
| 87 | 3300015265 | Ga0182005_1000097 | Ga0182005_100009740 | 341 |
| 88 | 3300053088 | Ga0500644_0000026 | Ga0500644_0000026_59571_60662 | 341 |
| 89 | 3300005353 | Ga0070669_100042143 | Ga0070669_1000421433 | 342 |
| 90 | 3300025242 | Ga0209258_100302 | Ga0209258_10030261 | 342 |
| 91 | 3300025254 | Ga0209148_1000131 | Ga0209148_100013120 | 342 |
| 92 | 3300025923 | Ga0207681_10020930 | Ga0207681_100209304 | 342 |
| 93 | 3300044842 | Ga0466957_0022142 | Ga0466957_0022142_1395_2486 | 342 |
| 94 | 3300046694 | Ga0495649_0033106 | Ga0495649_0033106_1234_2316 | 342 |
| 95 | 3300053092 | Ga0500583_0002299 | Ga0500583_0002299_2437_3528 | 342 |
| 96 | 3300053109 | Ga0500569_000047 | Ga0500569_000047_8579_9670 | 342 |
| 97 | 3300053134 | Ga0500658_0003491 | Ga0500658_0003491_3342_4433 | 342 |
| 98 | 3300053136 | Ga0500559_0002568 | Ga0500559_0002568_5515_6606 | 342 |
| 99 | 3300053142 | Ga0500577_0006329 | Ga0500577_0006329_959_2050 | 342 |
| 100 | 3300053153 | Ga0500616_0002235 | Ga0500616_0002235_10595_11686 | 342 |
| 101 | 3300005339 | Ga0070660_100222396 | Ga0070660_1002223961 | 343 |
| 102 | 3300005366 | Ga0070659_100007146 | Ga0070659_1000071464 | 343 |
| 103 | 3300005366 | Ga0070659_100126170 | Ga0070659_1001261702 | 343 |
| 104 | 3300005530 | Ga0070679_100002354 | Ga0070679_10000235411 | 343 |
| 105 | 3300005563 | Ga0068855_100002548 | Ga0068855_10000254823 | 343 |
| 106 | 3300005577 | Ga0068857_100098455 | Ga0068857_1000984552 | 343 |
| 107 | 3300013100 | Ga0157373_10013999 | Ga0157373_100139992 | 343 |
| 108 | 3300013100 | Ga0157373_10048356 | Ga0157373_100483562 | 343 |
| 109 | 3300013102 | Ga0157371_10000668 | Ga0157371_100006689 | 343 |
| 110 | 3300013104 | Ga0157370_10001339 | Ga0157370_1000133924 | 343 |
| 111 | 3300013104 | Ga0157370_10141669 | Ga0157370_101416692 | 343 |
| 112 | 3300025919 | Ga0207657_10050054 | Ga0207657_100500543 | 343 |
| 113 | 3300025921 | Ga0207652_10000098 | Ga0207652_1000009877 | 343 |
| 114 | 3300025949 | Ga0207667_10031326 | Ga0207667_100313262 | 343 |
| 115 | 3300026116 | Ga0207674_10033161 | Ga0207674_100331614 | 343 |
| 116 | 3300026142 | Ga0207698_10297218 | Ga0207698_102972182 | 343 |
| 117 | 3300037312 | Ga0395899_0002500 | Ga0395899_0002500_763_1845 | 343 |
| 118 | 3300037312 | Ga0395899_0071908 | Ga0395899_0071908_518_1600 | 343 |
| 119 | 3300037418 | Ga0395900_0006705 | Ga0395900_0006705_7246_8328 | 343 |
| 120 | 3300037418 | Ga0395900_0016665 | Ga0395900_0016665_2270_3352 | 343 |
| 121 | 3300037418 | Ga0395900_0041142 | Ga0395900_0041142_22_1104 | 343 |
| 122 | 3300037466 | Ga0395898_0001101 | Ga0395898_0001101_10982_12064 | 343 |
| 123 | 3300037466 | Ga0395898_0091791 | Ga0395898_0091791_964_2046 | 343 |
| 124 | 3300038443 | Ga0395901_0022924 | Ga0395901_0022924_3609_4691 | 343 |
| 125 | 3300002738 | JGI25154J39366_1007774 | JGI25154J39366_10077741 | 344 |
| 126 | 3300003316 | rootH1_10013813 | rootH1_100138136 | 344 |
| 127 | 3300003320 | rootH2_10039673 | rootH2_100396733 | 344 |
| 128 | 3300005289 | Ga0065704_10094599 | Ga0065704_100945992 | 344 |
| 129 | 3300005293 | Ga0065715_10127934 | Ga0065715_101279342 | 344 |
| 130 | 3300005329 | Ga0070683_100167963 | Ga0070683_1001679631 | 344 |
| 131 | 3300005335 | Ga0070666_10057022 | Ga0070666_100570221 | 344 |
| 132 | 3300005337 | Ga0070682_100036209 | Ga0070682_1000362092 | 344 |
| 133 | 3300005347 | Ga0070668_100294488 | Ga0070668_1002944882 | 344 |
| 134 | 3300005353 | Ga0070669_100228034 | Ga0070669_1002280342 | 344 |
| 135 | 3300005354 | Ga0070675_100321286 | Ga0070675_1003212862 | 344 |
| 136 | 3300005471 | Ga0070698_100002541 | Ga0070698_1000025415 | 344 |
| 137 | 3300005539 | Ga0068853_100003897 | Ga0068853_10000389713 | 344 |
| 138 | 3300005539 | Ga0068853_100009821 | Ga0068853_1000098212 | 344 |
| 139 | 3300005539 | Ga0068853_100041203 | Ga0068853_1000412033 | 344 |
| 140 | 3300005539 | Ga0068853_100078345 | Ga0068853_1000783453 | 344 |
| 141 | 3300005543 | Ga0070672_100079570 | Ga0070672_1000795702 | 344 |
| 142 | 3300005563 | Ga0068855_100000081 | Ga0068855_10000008155 | 344 |
| 143 | 3300005614 | Ga0068856_100054252 | Ga0068856_1000542523 | 344 |
| 144 | 3300005616 | Ga0068852_100075342 | Ga0068852_1000753422 | 344 |
| 145 | 3300005616 | Ga0068852_100090210 | Ga0068852_1000902102 | 344 |
| 146 | 3300005617 | Ga0068859_100000289 | Ga0068859_10000028929 | 344 |
| 147 | 3300005618 | Ga0068864_100173896 | Ga0068864_1001738962 | 344 |
| 148 | 3300005841 | Ga0068863_100105425 | Ga0068863_1001054253 | 344 |
| 149 | 3300005844 | Ga0068862_100011939 | Ga0068862_1000119393 | 344 |
| 150 | 3300006237 | Ga0097621_100377478 | Ga0097621_1003774782 | 344 |
| 151 | 3300006358 | Ga0068871_100100034 | Ga0068871_1001000341 | 344 |
| 152 | 3300006931 | Ga0097620_100000289 | Ga0097620_10000028922 | 344 |
| 153 | 3300009093 | Ga0105240_10067774 | Ga0105240_100677742 | 344 |
| 154 | 3300009093 | Ga0105240_10085981 | Ga0105240_100859814 | 344 |
| 155 | 3300009094 | Ga0111539_10033061 | Ga0111539_100330613 | 344 |
| 156 | 3300009094 | Ga0111539_10033256 | Ga0111539_100332565 | 344 |
| 157 | 3300009098 | Ga0105245_10159481 | Ga0105245_101594812 | 344 |
| 158 | 3300009147 | Ga0114129_10007484 | Ga0114129_1000748412 | 344 |
| 159 | 3300010375 | Ga0105239_10677477 | Ga0105239_106774771 | 344 |
| 160 | 3300013104 | Ga0157370_10169686 | Ga0157370_101696862 | 344 |
| 161 | 3300013297 | Ga0157378_10001243 | Ga0157378_1000124326 | 344 |
| 162 | 3300013307 | Ga0157372_10052938 | Ga0157372_100529382 | 344 |
| 163 | 3300014326 | Ga0157380_10147135 | Ga0157380_101471353 | 344 |
| 164 | 3300025246 | Ga0209646_1001349 | Ga0209646_10013497 | 344 |
| 165 | 3300025911 | Ga0207654_10017862 | Ga0207654_100178623 | 344 |
| 166 | 3300025913 | Ga0207695_10000087 | Ga0207695_10000087197 | 344 |
| 167 | 3300025925 | Ga0207650_10169646 | Ga0207650_101696461 | 344 |
| 168 | 3300025926 | Ga0207659_10268367 | Ga0207659_102683671 | 344 |
| 169 | 3300025949 | Ga0207667_10000172 | Ga0207667_1000017225 | 344 |
| 170 | 3300026041 | Ga0207639_10002886 | Ga0207639_100028869 | 344 |
| 171 | 3300026041 | Ga0207639_10052285 | Ga0207639_100522854 | 344 |
| 172 | 3300026041 | Ga0207639_10226103 | Ga0207639_102261032 | 344 |
| 173 | 3300026078 | Ga0207702_10396376 | Ga0207702_103963762 | 344 |
| 174 | 3300026088 | Ga0207641_10204148 | Ga0207641_102041482 | 344 |
| 175 | 3300026118 | Ga0207675_100270750 | Ga0207675_1002707502 | 344 |
| 176 | 3300026121 | Ga0207683_10109372 | Ga0207683_101093723 | 344 |
| 177 | 3300026142 | Ga0207698_10018321 | Ga0207698_100183213 | 344 |
| 178 | 3300026142 | Ga0207698_10080910 | Ga0207698_100809103 | 344 |
| 179 | 3300028381 | Ga0268264_10363318 | Ga0268264_103633182 | 344 |
| 180 | 3300030521 | Ga0307511_10000002 | Ga0307511_1000000221 | 344 |
| 181 | 3300031251 | Ga0265327_10000024 | Ga0265327_1000002492 | 344 |
| 182 | 3300031595 | Ga0265313_10092838 | Ga0265313_100928382 | 344 |
| 183 | 3300032004 | Ga0307414_10222252 | Ga0307414_102222522 | 344 |
| 184 | 3300035695 | Ga0373927_0103964 | Ga0373927_0103964_455_1510 | 344 |
| 185 | 3300041406 | Ga0439439_0034645 | Ga0439439_0034645_42_1097 | 344 |
| 186 | 3300042007 | Ga0439449_0002729 | Ga0439449_0002729_1289_2344 | 344 |
| 187 | 3300042128 | Ga0450897_000793 | Ga0450897_000793_749_1804 | 344 |
| 188 | 3300042876 | Ga0451577_0006113 | Ga0451577_0006113_1786_2841 | 344 |
| 189 | 3300044683 | Ga0466965_0148639 | Ga0466965_0148639_52_1107 | 344 |
| 190 | 3300044735 | Ga0466968_0087464 | Ga0466968_0087464_309_1364 | 344 |
| 191 | 3300046460 | Ga0495638_0048927 | Ga0495638_0048927_76_1131 | 344 |
| 192 | 3300046460 | Ga0495638_0084937 | Ga0495638_0084937_778_1833 | 344 |
| 193 | 3300046472 | Ga0495580_0174334 | Ga0495580_0174334_280_1335 | 344 |
| 194 | 3300046660 | Ga0495625_0081734 | Ga0495625_0081734_14_1069 | 344 |
| 195 | 3300047320 | Ga0495672_0043145 | Ga0495672_0043145_928_1983 | 344 |
| 196 | 3300047471 | Ga0495684_0142488 | Ga0495684_0142488_304_1359 | 344 |
| 197 | 3300047472 | Ga0495686_0056486 | Ga0495686_0056486_279_1334 | 344 |
| 198 | 3300049570 | Ga0501033_0225055 | Ga0501033_0225055_15_1070 | 344 |
| 199 | 3300049571 | Ga0501034_0007421 | Ga0501034_0007421_6716_7771 | 344 |
| 200 | 3300049573 | Ga0501037_0018719 | Ga0501037_0018719_820_1875 | 344 |
| 201 | 3300049579 | Ga0501043_0068367 | Ga0501043_0068367_1217_2272 | 344 |
| 202 | 3300049581 | Ga0501047_0013596 | Ga0501047_0013596_4952_6007 | 344 |
| 203 | 3300049581 | Ga0501047_0404324 | Ga0501047_0404324_38_1093 | 344 |
| 204 | 3300049652 | Ga0501202_006692 | Ga0501202_006692_430_1485 | 344 |
| 205 | 3300049822 | Ga0501035_0007289 | Ga0501035_0007289_4414_5469 | 344 |
| 206 | 3300049823 | Ga0501044_0013650 | Ga0501044_0013650_6205_7260 | 344 |
| 207 | 3300049823 | Ga0501044_0021518 | Ga0501044_0021518_5183_6238 | 344 |
| 208 | 3300049823 | Ga0501044_0208382 | Ga0501044_0208382_14_1069 | 344 |
| 209 | 3300050493 | nmdc:mga0k408_7554_c1 | nmdc:mga0k408_7554_c1_1281_2336 | 344 |
| 210 | 3300050507 | nmdc:mga05p37_23584_c1 | nmdc:mga05p37_23584_c1_3202_4257 | 344 |
| 211 | 3300050507 | nmdc:mga05p37_827_c1 | nmdc:mga05p37_827_c1_15684_16739 | 344 |
| 212 | 3300050508 | nmdc:mga09592_3608_c1 | nmdc:mga09592_3608_c1_11048_12103 | 344 |
| 213 | 3300050510 | nmdc:mga06r32_14340_c1 | nmdc:mga06r32_14340_c1_1767_2822 | 344 |
| 214 | 3300053092 | Ga0500583_0001510 | Ga0500583_0001510_880_1935 | 344 |
| 215 | 3300053139 | Ga0500568_0000142 | Ga0500568_0000142_18807_19862 | 344 |
| 216 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_107717_108772 | 344 |
| 217 | 3300005543 | Ga0070672_100210328 | Ga0070672_1002103282 | 345 |
| 218 | 3300013296 | Ga0157374_10000027 | Ga0157374_1000002727 | 345 |
| 219 | 3300013307 | Ga0157372_10000171 | Ga0157372_100001712 | 345 |
| 220 | 3300014969 | Ga0157376_10000341 | Ga0157376_1000034113 | 345 |
| 221 | 3300025904 | Ga0207647_10006574 | Ga0207647_100065748 | 345 |
| 222 | 3300049651 | Ga0501201_000165 | Ga0501201_000165_4389_5480 | 345 |
| 223 | 3300049664 | Ga0501224_001013 | Ga0501224_001013_1652_2743 | 345 |
| 224 | 3300049668 | Ga0501233_005424 | Ga0501233_005424_97_1188 | 345 |
| 225 | 3300049669 | Ga0501235_001196 | Ga0501235_001196_91_1182 | 345 |
| 226 | 3300049690 | Ga0501261_004740 | Ga0501261_004740_226_1317 | 345 |
| 227 | 3300009094 | Ga0111539_10279378 | Ga0111539_102793782 | 346 |
| 228 | 3300025932 | Ga0207690_10088374 | Ga0207690_100883742 | 346 |
| 229 | iso_pu_bacteria | 2971410472 | 2971412383 | 346 |
| 230 | 3300001979 | JGI24740J21852_10002379 | JGI24740J21852_100023794 | 347 |
| 231 | 3300002738 | JGI25154J39366_1000023 | JGI25154J39366_100002391 | 347 |
| 232 | 3300003320 | rootH2_10092694 | rootH2_100926943 | 347 |
| 233 | 3300005289 | Ga0065704_10088342 | Ga0065704_100883423 | 347 |
| 234 | 3300005983 | Ga0081540_1020265 | Ga0081540_10202654 | 347 |
| 235 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004507 | 347 |
| 236 | 3300025250 | Ga0209026_1000095 | Ga0209026_1000095115 | 347 |
| 237 | 3300032133 | Ga0316583_10005637 | Ga0316583_100056372 | 347 |
| 238 | 3300036647 | Ga0316582_0072857 | Ga0316582_0072857_111_1184 | 347 |
| 239 | 3300037471 | Ga0395905_0000340 | Ga0395905_0000340_45748_46839 | 347 |
| 240 | 3300006844 | Ga0075428_100152663 | Ga0075428_1001526632 | 348 |
| 241 | 3300049521 | Ga0501298_002627 | Ga0501298_002627_240_1331 | 348 |
| 242 | 3300049663 | Ga0501223_001832 | Ga0501223_001832_3105_4196 | 348 |
| 243 | 3300049704 | Ga0501221_002892 | Ga0501221_002892_1515_2606 | 348 |
| 244 | 3300049705 | Ga0501225_0005194 | Ga0501225_0005194_2554_3645 | 348 |
| 245 | 3300003215 | JGI25153J46596_10002509 | JGI25153J46596_100025099 | 349 |
| 246 | 3300003354 | JGI25160J50197_1003881 | JGI25160J50197_10038814 | 349 |
| 247 | 3300025258 | Ga0209129_1008612 | Ga0209129_10086123 | 349 |
| 248 | 3300025297 | Ga0209758_1004975 | Ga0209758_10049756 | 349 |
| 249 | 3300025302 | Ga0207426_1000313 | Ga0207426_100031338 | 349 |
| 250 | iso_pu_bacteria | 2818991444 | 2819585832 | 349 |
| 251 | iso_pu_bacteria | 2914759650 | 2914762894 | 349 |
| 252 | iso_pu_bacteria | 2929154850 | 2929159414 | 349 |
| 253 | 3300001989 | JGI24739J22299_10000062 | JGI24739J22299_100000626 | 350 |
| 254 | 3300003320 | rootH2_10007005 | rootH2_100070051 | 350 |
| 255 | 3300003354 | JGI25160J50197_1001239 | JGI25160J50197_10012398 | 350 |
| 256 | 3300003790 | Ga0055528_1001011 | Ga0055528_10010112 | 350 |
| 257 | 3300003791 | Ga0055530_10000880 | Ga0055530_1000088016 | 350 |
| 258 | 3300003794 | Ga0055531_10013120 | Ga0055531_100131204 | 350 |
| 259 | 3300005262 | Ga0065165_1000027 | Ga0065165_1000027124 | 350 |
| 260 | 3300025273 | Ga0209673_1000203 | Ga0209673_100020316 | 350 |
| 261 | 3300025291 | Ga0209675_1026138 | Ga0209675_10261382 | 350 |
| 262 | 3300025295 | Ga0209564_1022867 | Ga0209564_10228672 | 350 |
| 263 | 3300025298 | Ga0209050_1000888 | Ga0209050_100088814 | 350 |
| 264 | 3300025302 | Ga0207426_1000806 | Ga0207426_100080627 | 350 |
| 265 | 3300025304 | Ga0209257_1002474 | Ga0209257_10024748 | 350 |
| 266 | 3300044712 | Ga0453684_0021550 | Ga0453684_0021550_4188_5282 | 350 |
| 267 | 3300049581 | Ga0501047_0006704 | Ga0501047_0006704_6036_7127 | 350 |
| 268 | 3300003320 | rootH2_10135544 | rootH2_101355443 | 351 |
| 269 | 3300003323 | rootH1_10044529 | rootH1_100445295 | 351 |
| 270 | 3300005616 | Ga0068852_100148892 | Ga0068852_1001488922 | 351 |
| 271 | 3300013105 | Ga0157369_10137179 | Ga0157369_101371792 | 351 |
| 272 | 3300013307 | Ga0157372_10013407 | Ga0157372_100134073 | 351 |
| 273 | 3300025921 | Ga0207652_10052600 | Ga0207652_100526002 | 351 |
| 274 | 3300026116 | Ga0207674_10170701 | Ga0207674_101707012 | 351 |
| 275 | 3300026142 | Ga0207698_10051120 | Ga0207698_100511202 | 351 |
| 276 | 3300039437 | Ga0436365_1261027 | Ga0436365_1261027_704_1789 | 351 |
| 277 | 3300053131 | Ga0500652_033644 | Ga0500652_033644_383_1474 | 351 |
| 278 | 3300002987 | JGI25159J45721_1009609 | JGI25159J45721_10096092 | 352 |
| 279 | 3300003322 | rootL2_10023331 | rootL2_100233312 | 352 |
| 280 | 3300003322 | rootL2_10027551 | rootL2_100275515 | 352 |
| 281 | 3300003322 | rootL2_10082800 | rootL2_100828003 | 352 |
| 282 | 3300005328 | Ga0070676_10145117 | Ga0070676_101451171 | 352 |
| 283 | 3300005329 | Ga0070683_100011019 | Ga0070683_1000110198 | 352 |
| 284 | 3300005337 | Ga0070682_100081306 | Ga0070682_1000813062 | 352 |
| 285 | 3300005339 | Ga0070660_100007671 | Ga0070660_1000076716 | 352 |
| 286 | 3300005344 | Ga0070661_100046932 | Ga0070661_1000469322 | 352 |
| 287 | 3300005355 | Ga0070671_100079539 | Ga0070671_1000795393 | 352 |
| 288 | 3300005364 | Ga0070673_100032786 | Ga0070673_1000327862 | 352 |
| 289 | 3300005455 | Ga0070663_100290238 | Ga0070663_1002902381 | 352 |
| 290 | 3300005457 | Ga0070662_100139466 | Ga0070662_1001394662 | 352 |
| 291 | 3300005530 | Ga0070679_100221834 | Ga0070679_1002218341 | 352 |
| 292 | 3300005535 | Ga0070684_100008818 | Ga0070684_1000088183 | 352 |
| 293 | 3300005539 | Ga0068853_100004597 | Ga0068853_1000045975 | 352 |
| 294 | 3300005577 | Ga0068857_100038718 | Ga0068857_1000387182 | 352 |
| 295 | 3300005578 | Ga0068854_100026545 | Ga0068854_1000265452 | 352 |
| 296 | 3300005614 | Ga0068856_100032149 | Ga0068856_1000321495 | 352 |
| 297 | 3300005616 | Ga0068852_100020548 | Ga0068852_1000205483 | 352 |
| 298 | 3300005834 | Ga0068851_10041605 | Ga0068851_100416052 | 352 |
| 299 | 3300005985 | Ga0081539_10000402 | Ga0081539_1000040262 | 352 |
| 300 | 3300006237 | Ga0097621_100015237 | Ga0097621_1000152373 | 352 |
| 301 | 3300006358 | Ga0068871_100003481 | Ga0068871_10000348111 | 352 |
| 302 | 3300009148 | Ga0105243_10461794 | Ga0105243_104617941 | 352 |
| 303 | 3300013100 | Ga0157373_10012587 | Ga0157373_100125873 | 352 |
| 304 | 3300013102 | Ga0157371_10022192 | Ga0157371_100221923 | 352 |
| 305 | 3300013105 | Ga0157369_10027741 | Ga0157369_100277413 | 352 |
| 306 | 3300013296 | Ga0157374_10001866 | Ga0157374_100018668 | 352 |
| 307 | 3300013297 | Ga0157378_10006230 | Ga0157378_100062308 | 352 |
| 308 | 3300013307 | Ga0157372_10061464 | Ga0157372_100614641 | 352 |
| 309 | 3300013307 | Ga0157372_10469987 | Ga0157372_104699871 | 352 |
| 310 | 3300025208 | Ga0209436_100324 | Ga0209436_10032417 | 352 |
| 311 | 3300025284 | Ga0209130_1001297 | Ga0209130_100129714 | 352 |
| 312 | 3300025302 | Ga0207426_1000024 | Ga0207426_100002412 | 352 |
| 313 | 3300025904 | Ga0207647_10128473 | Ga0207647_101284732 | 352 |
| 314 | 3300025919 | Ga0207657_10003743 | Ga0207657_100037437 | 352 |
| 315 | 3300025921 | Ga0207652_10207612 | Ga0207652_102076121 | 352 |
| 316 | 3300025926 | Ga0207659_10023695 | Ga0207659_100236952 | 352 |
| 317 | 3300025933 | Ga0207706_10029724 | Ga0207706_100297242 | 352 |
| 318 | 3300025945 | Ga0207679_10008949 | Ga0207679_100089495 | 352 |
| 319 | 3300025981 | Ga0207640_10070822 | Ga0207640_100708222 | 352 |
| 320 | 3300026041 | Ga0207639_10049666 | Ga0207639_100496662 | 352 |
| 321 | 3300026116 | Ga0207674_10080599 | Ga0207674_100805993 | 352 |
| 322 | 3300038443 | Ga0395901_0341982 | Ga0395901_0341982_62_1141 | 352 |
| 323 | 3300044658 | Ga0466972_0020001 | Ga0466972_0020001_2130_3212 | 352 |
| 324 | 3300048929 | Ga0496126_0042525 | Ga0496126_0042525_517_1608 | 352 |
| 325 | 3300053156 | Ga0500622_0000692 | Ga0500622_0000692_26379_27470 | 352 |
| 326 | iso_pu_bacteria | 2818991442 | 2819574921 | 352 |
| 327 | iso_pu_bacteria | 2818991460 | 2819676869 | 352 |
| 328 | iso_pu_bacteria | 2821136567 | 2821141022 | 352 |
| 329 | iso_pu_bacteria | 2840677318 | 2840678820 | 352 |
| 330 | iso_pu_bacteria | 2883068021 | 2883069148 | 352 |
| 331 | iso_pu_bacteria | 2884791551 | 2884796723 | 352 |
| 332 | iso_pu_bacteria | 2896085136 | 2896086638 | 352 |
| 333 | iso_pu_bacteria | 2896109856 | 2896113057 | 352 |
| 334 | iso_pu_bacteria | 2904467357 | 2904471522 | 352 |
| 335 | iso_pu_bacteria | 2929177148 | 2929177759 | 352 |
| 336 | iso_pu_bacteria | 2945977869 | 2945980106 | 352 |
| 337 | iso_pu_bacteria | 2946013367 | 2946014032 | 352 |
| 338 | 3300002077 | JGI24744J21845_10003674 | JGI24744J21845_100036742 | 353 |
| 339 | 3300003215 | JGI25153J46596_10023575 | JGI25153J46596_100235752 | 353 |
| 340 | 3300003316 | rootH1_10166897 | rootH1_101668972 | 353 |
| 341 | 3300003322 | rootL2_10038898 | rootL2_100388983 | 353 |
| 342 | 3300003322 | rootL2_10062550 | rootL2_100625503 | 353 |
| 343 | 3300003322 | rootL2_10075820 | rootL2_100758203 | 353 |
| 344 | 3300003323 | rootH1_10175021 | rootH1_101750213 | 353 |
| 345 | 3300003794 | Ga0055531_10000054 | Ga0055531_1000005478 | 353 |
| 346 | 3300005327 | Ga0070658_10063181 | Ga0070658_100631813 | 353 |
| 347 | 3300005328 | Ga0070676_10010918 | Ga0070676_100109182 | 353 |
| 348 | 3300005328 | Ga0070676_10083899 | Ga0070676_100838991 | 353 |
| 349 | 3300005331 | Ga0070670_100026886 | Ga0070670_1000268862 | 353 |
| 350 | 3300005331 | Ga0070670_100082020 | Ga0070670_1000820202 | 353 |
| 351 | 3300005331 | Ga0070670_100304256 | Ga0070670_1003042561 | 353 |
| 352 | 3300005334 | Ga0068869_100004838 | Ga0068869_1000048389 | 353 |
| 353 | 3300005334 | Ga0068869_100009710 | Ga0068869_1000097105 | 353 |
| 354 | 3300005334 | Ga0068869_100017987 | Ga0068869_1000179872 | 353 |
| 355 | 3300005334 | Ga0068869_100089615 | Ga0068869_1000896152 | 353 |
| 356 | 3300005334 | Ga0068869_100244713 | Ga0068869_1002447132 | 353 |
| 357 | 3300005335 | Ga0070666_10000112 | Ga0070666_100001129 | 353 |
| 358 | 3300005335 | Ga0070666_10015901 | Ga0070666_100159014 | 353 |
| 359 | 3300005338 | Ga0068868_100001123 | Ga0068868_1000011233 | 353 |
| 360 | 3300005338 | Ga0068868_100008985 | Ga0068868_1000089854 | 353 |
| 361 | 3300005338 | Ga0068868_100030169 | Ga0068868_1000301692 | 353 |
| 362 | 3300005338 | Ga0068868_100045803 | Ga0068868_1000458033 | 353 |
| 363 | 3300005339 | Ga0070660_100006706 | Ga0070660_1000067062 | 353 |
| 364 | 3300005340 | Ga0070689_100098025 | Ga0070689_1000980252 | 353 |
| 365 | 3300005340 | Ga0070689_100123580 | Ga0070689_1001235802 | 353 |
| 366 | 3300005347 | Ga0070668_100063236 | Ga0070668_1000632362 | 353 |
| 367 | 3300005353 | Ga0070669_100006429 | Ga0070669_1000064296 | 353 |
| 368 | 3300005353 | Ga0070669_100014257 | Ga0070669_1000142576 | 353 |
| 369 | 3300005354 | Ga0070675_100226650 | Ga0070675_1002266502 | 353 |
| 370 | 3300005356 | Ga0070674_100034018 | Ga0070674_1000340182 | 353 |
| 371 | 3300005356 | Ga0070674_100077838 | Ga0070674_1000778382 | 353 |
| 372 | 3300005364 | Ga0070673_100022084 | Ga0070673_1000220845 | 353 |
| 373 | 3300005364 | Ga0070673_100112954 | Ga0070673_1001129542 | 353 |
| 374 | 3300005364 | Ga0070673_100420777 | Ga0070673_1004207771 | 353 |
| 375 | 3300005367 | Ga0070667_100008519 | Ga0070667_1000085199 | 353 |
| 376 | 3300005367 | Ga0070667_100017599 | Ga0070667_1000175992 | 353 |
| 377 | 3300005367 | Ga0070667_100050896 | Ga0070667_1000508961 | 353 |
| 378 | 3300005367 | Ga0070667_100059753 | Ga0070667_1000597532 | 353 |
| 379 | 3300005367 | Ga0070667_100114046 | Ga0070667_1001140462 | 353 |
| 380 | 3300005367 | Ga0070667_100157773 | Ga0070667_1001577731 | 353 |
| 381 | 3300005367 | Ga0070667_100413693 | Ga0070667_1004136931 | 353 |
| 382 | 3300005456 | Ga0070678_100011344 | Ga0070678_1000113442 | 353 |
| 383 | 3300005456 | Ga0070678_100081222 | Ga0070678_1000812222 | 353 |
| 384 | 3300005457 | Ga0070662_100046050 | Ga0070662_1000460502 | 353 |
| 385 | 3300005458 | Ga0070681_10037752 | Ga0070681_100377523 | 353 |
| 386 | 3300005459 | Ga0068867_100018835 | Ga0068867_1000188356 | 353 |
| 387 | 3300005459 | Ga0068867_100039779 | Ga0068867_1000397792 | 353 |
| 388 | 3300005459 | Ga0068867_100076839 | Ga0068867_1000768392 | 353 |
| 389 | 3300005459 | Ga0068867_100098355 | Ga0068867_1000983552 | 353 |
| 390 | 3300005459 | Ga0068867_100284436 | Ga0068867_1002844361 | 353 |
| 391 | 3300005466 | Ga0070685_10236915 | Ga0070685_102369151 | 353 |
| 392 | 3300005471 | Ga0070698_100151107 | Ga0070698_1001511072 | 353 |
| 393 | 3300005530 | Ga0070679_100000908 | Ga0070679_1000009082 | 353 |
| 394 | 3300005530 | Ga0070679_100023183 | Ga0070679_1000231836 | 353 |
| 395 | 3300005530 | Ga0070679_100132523 | Ga0070679_1001325231 | 353 |
| 396 | 3300005535 | Ga0070684_100023317 | Ga0070684_1000233172 | 353 |
| 397 | 3300005539 | Ga0068853_100001871 | Ga0068853_1000018716 | 353 |
| 398 | 3300005539 | Ga0068853_100015375 | Ga0068853_1000153752 | 353 |
| 399 | 3300005539 | Ga0068853_100029290 | Ga0068853_1000292902 | 353 |
| 400 | 3300005539 | Ga0068853_100150799 | Ga0068853_1001507992 | 353 |
| 401 | 3300005539 | Ga0068853_100170414 | Ga0068853_1001704141 | 353 |
| 402 | 3300005539 | Ga0068853_100247288 | Ga0068853_1002472882 | 353 |
| 403 | 3300005543 | Ga0070672_100008190 | Ga0070672_1000081906 | 353 |
| 404 | 3300005543 | Ga0070672_100119585 | Ga0070672_1001195852 | 353 |
| 405 | 3300005544 | Ga0070686_100001004 | Ga0070686_10000100418 | 353 |
| 406 | 3300005544 | Ga0070686_100015742 | Ga0070686_1000157423 | 353 |
| 407 | 3300005547 | Ga0070693_100205551 | Ga0070693_1002055511 | 353 |
| 408 | 3300005548 | Ga0070665_100000014 | Ga0070665_10000001429 | 353 |
| 409 | 3300005548 | Ga0070665_100012136 | Ga0070665_1000121368 | 353 |
| 410 | 3300005563 | Ga0068855_100023253 | Ga0068855_1000232533 | 353 |
| 411 | 3300005563 | Ga0068855_100059131 | Ga0068855_1000591314 | 353 |
| 412 | 3300005563 | Ga0068855_100107987 | Ga0068855_1001079872 | 353 |
| 413 | 3300005563 | Ga0068855_100198910 | Ga0068855_1001989102 | 353 |
| 414 | 3300005564 | Ga0070664_100027903 | Ga0070664_1000279033 | 353 |
| 415 | 3300005564 | Ga0070664_100226085 | Ga0070664_1002260852 | 353 |
| 416 | 3300005577 | Ga0068857_100002654 | Ga0068857_1000026548 | 353 |
| 417 | 3300005578 | Ga0068854_100046669 | Ga0068854_1000466692 | 353 |
| 418 | 3300005578 | Ga0068854_100087630 | Ga0068854_1000876303 | 353 |
| 419 | 3300005578 | Ga0068854_100094419 | Ga0068854_1000944193 | 353 |
| 420 | 3300005578 | Ga0068854_100124907 | Ga0068854_1001249072 | 353 |
| 421 | 3300005614 | Ga0068856_100024646 | Ga0068856_1000246463 | 353 |
| 422 | 3300005614 | Ga0068856_100099043 | Ga0068856_1000990433 | 353 |
| 423 | 3300005614 | Ga0068856_100178106 | Ga0068856_1001781062 | 353 |
| 424 | 3300005616 | Ga0068852_100000900 | Ga0068852_1000009002 | 353 |
| 425 | 3300005616 | Ga0068852_100005128 | Ga0068852_1000051284 | 353 |
| 426 | 3300005616 | Ga0068852_100043565 | Ga0068852_1000435653 | 353 |
| 427 | 3300005616 | Ga0068852_100156709 | Ga0068852_1001567091 | 353 |
| 428 | 3300005616 | Ga0068852_100229781 | Ga0068852_1002297812 | 353 |
| 429 | 3300005616 | Ga0068852_100236699 | Ga0068852_1002366992 | 353 |
| 430 | 3300005616 | Ga0068852_100486253 | Ga0068852_1004862531 | 353 |
| 431 | 3300005617 | Ga0068859_100000018 | Ga0068859_10000001857 | 353 |
| 432 | 3300005617 | Ga0068859_100086698 | Ga0068859_1000866982 | 353 |
| 433 | 3300005617 | Ga0068859_100123833 | Ga0068859_1001238332 | 353 |
| 434 | 3300005617 | Ga0068859_100226485 | Ga0068859_1002264852 | 353 |
| 435 | 3300005617 | Ga0068859_100292465 | Ga0068859_1002924652 | 353 |
| 436 | 3300005618 | Ga0068864_100002226 | Ga0068864_10000222611 | 353 |
| 437 | 3300005618 | Ga0068864_100002659 | Ga0068864_1000026598 | 353 |
| 438 | 3300005618 | Ga0068864_100026453 | Ga0068864_1000264532 | 353 |
| 439 | 3300005618 | Ga0068864_100043128 | Ga0068864_1000431285 | 353 |
| 440 | 3300005718 | Ga0068866_10014018 | Ga0068866_100140183 | 353 |
| 441 | 3300005718 | Ga0068866_10060672 | Ga0068866_100606722 | 353 |
| 442 | 3300005719 | Ga0068861_100049553 | Ga0068861_1000495533 | 353 |
| 443 | 3300005834 | Ga0068851_10049634 | Ga0068851_100496341 | 353 |
| 444 | 3300005840 | Ga0068870_10002263 | Ga0068870_100022633 | 353 |
| 445 | 3300005840 | Ga0068870_10048875 | Ga0068870_100488752 | 353 |
| 446 | 3300005841 | Ga0068863_100004036 | Ga0068863_1000040362 | 353 |
| 447 | 3300005841 | Ga0068863_100005189 | Ga0068863_10000518914 | 353 |
| 448 | 3300005841 | Ga0068863_100026959 | Ga0068863_1000269595 | 353 |
| 449 | 3300005842 | Ga0068858_100013296 | Ga0068858_1000132962 | 353 |
| 450 | 3300005843 | Ga0068860_100000024 | Ga0068860_10000002482 | 353 |
| 451 | 3300005843 | Ga0068860_100001161 | Ga0068860_10000116121 | 353 |
| 452 | 3300005843 | Ga0068860_100004223 | Ga0068860_1000042239 | 353 |
| 453 | 3300005843 | Ga0068860_100010496 | Ga0068860_10001049610 | 353 |
| 454 | 3300005843 | Ga0068860_100032753 | Ga0068860_1000327533 | 353 |
| 455 | 3300005843 | Ga0068860_100066223 | Ga0068860_1000662233 | 353 |
| 456 | 3300005843 | Ga0068860_100097121 | Ga0068860_1000971213 | 353 |
| 457 | 3300005843 | Ga0068860_100148099 | Ga0068860_1001480992 | 353 |
| 458 | 3300005843 | Ga0068860_100253286 | Ga0068860_1002532862 | 353 |
| 459 | 3300005844 | Ga0068862_100027366 | Ga0068862_1000273665 | 353 |
| 460 | 3300005844 | Ga0068862_100199458 | Ga0068862_1001994582 | 353 |
| 461 | 3300006195 | Ga0075366_10002904 | Ga0075366_100029042 | 353 |
| 462 | 3300006195 | Ga0075366_10008292 | Ga0075366_100082923 | 353 |
| 463 | 3300006237 | Ga0097621_100005119 | Ga0097621_1000051198 | 353 |
| 464 | 3300006237 | Ga0097621_100086635 | Ga0097621_1000866352 | 353 |
| 465 | 3300006237 | Ga0097621_100224467 | Ga0097621_1002244671 | 353 |
| 466 | 3300006358 | Ga0068871_100029501 | Ga0068871_1000295014 | 353 |
| 467 | 3300006358 | Ga0068871_100044243 | Ga0068871_1000442432 | 353 |
| 468 | 3300006358 | Ga0068871_100298801 | Ga0068871_1002988011 | 353 |
| 469 | 3300006871 | Ga0075434_100118073 | Ga0075434_1001180733 | 353 |
| 470 | 3300006881 | Ga0068865_100014717 | Ga0068865_1000147175 | 353 |
| 471 | 3300006881 | Ga0068865_100052116 | Ga0068865_1000521162 | 353 |
| 472 | 3300006931 | Ga0097620_100000018 | Ga0097620_10000001857 | 353 |
| 473 | 3300006931 | Ga0097620_100086694 | Ga0097620_1000866944 | 353 |
| 474 | 3300006931 | Ga0097620_100123837 | Ga0097620_1001238372 | 353 |
| 475 | 3300006931 | Ga0097620_100226484 | Ga0097620_1002264842 | 353 |
| 476 | 3300006931 | Ga0097620_100292450 | Ga0097620_1002924502 | 353 |
| 477 | 3300009093 | Ga0105240_10000106 | Ga0105240_100001069 | 353 |
| 478 | 3300009093 | Ga0105240_10000606 | Ga0105240_1000060643 | 353 |
| 479 | 3300009093 | Ga0105240_10002298 | Ga0105240_1000229821 | 353 |
| 480 | 3300009093 | Ga0105240_10003660 | Ga0105240_100036602 | 353 |
| 481 | 3300009093 | Ga0105240_10006503 | Ga0105240_100065037 | 353 |
| 482 | 3300009093 | Ga0105240_10019918 | Ga0105240_100199185 | 353 |
| 483 | 3300009093 | Ga0105240_10055153 | Ga0105240_100551532 | 353 |
| 484 | 3300009093 | Ga0105240_10091296 | Ga0105240_100912962 | 353 |
| 485 | 3300009093 | Ga0105240_10368623 | Ga0105240_103686232 | 353 |
| 486 | 3300009094 | Ga0111539_10463430 | Ga0111539_104634302 | 353 |
| 487 | 3300009098 | Ga0105245_10052931 | Ga0105245_100529312 | 353 |
| 488 | 3300009101 | Ga0105247_10001391 | Ga0105247_1000139111 | 353 |
| 489 | 3300009101 | Ga0105247_10042996 | Ga0105247_100429962 | 353 |
| 490 | 3300009101 | Ga0105247_10165010 | Ga0105247_101650102 | 353 |
| 491 | 3300009147 | Ga0114129_10004956 | Ga0114129_100049567 | 353 |
| 492 | 3300009174 | Ga0105241_10000590 | Ga0105241_1000059017 | 353 |
| 493 | 3300009174 | Ga0105241_10001966 | Ga0105241_1000196612 | 353 |
| 494 | 3300009174 | Ga0105241_10004142 | Ga0105241_100041428 | 353 |
| 495 | 3300009174 | Ga0105241_10013483 | Ga0105241_100134832 | 353 |
| 496 | 3300009174 | Ga0105241_10019697 | Ga0105241_100196974 | 353 |
| 497 | 3300009545 | Ga0105237_10001093 | Ga0105237_100010935 | 353 |
| 498 | 3300009545 | Ga0105237_10003222 | Ga0105237_100032225 | 353 |
| 499 | 3300009545 | Ga0105237_10003412 | Ga0105237_1000341220 | 353 |
| 500 | 3300009545 | Ga0105237_10014210 | Ga0105237_100142106 | 353 |
| 501 | 3300009545 | Ga0105237_10015959 | Ga0105237_100159593 | 353 |
| 502 | 3300009545 | Ga0105237_10016066 | Ga0105237_100160665 | 353 |
| 503 | 3300009545 | Ga0105237_10190612 | Ga0105237_101906122 | 353 |
| 504 | 3300009545 | Ga0105237_10233270 | Ga0105237_102332702 | 353 |
| 505 | 3300009545 | Ga0105237_10244455 | Ga0105237_102444551 | 353 |
| 506 | 3300009551 | Ga0105238_10002205 | Ga0105238_1000220513 | 353 |
| 507 | 3300009551 | Ga0105238_10080747 | Ga0105238_100807473 | 353 |
| 508 | 3300009553 | Ga0105249_10000635 | Ga0105249_100006358 | 353 |
| 509 | 3300009553 | Ga0105249_10001404 | Ga0105249_100014044 | 353 |
| 510 | 3300009553 | Ga0105249_10048465 | Ga0105249_100484652 | 353 |
| 511 | 3300009553 | Ga0105249_10315997 | Ga0105249_103159971 | 353 |
| 512 | 3300009553 | Ga0105249_10339620 | Ga0105249_103396202 | 353 |
| 513 | 3300010375 | Ga0105239_10006093 | Ga0105239_100060933 | 353 |
| 514 | 3300010375 | Ga0105239_10006097 | Ga0105239_100060979 | 353 |
| 515 | 3300010375 | Ga0105239_10006227 | Ga0105239_100062279 | 353 |
| 516 | 3300010375 | Ga0105239_10015063 | Ga0105239_100150633 | 353 |
| 517 | 3300010375 | Ga0105239_10017847 | Ga0105239_100178477 | 353 |
| 518 | 3300010375 | Ga0105239_10225431 | Ga0105239_102254313 | 353 |
| 519 | 3300010375 | Ga0105239_10239255 | Ga0105239_102392552 | 353 |
| 520 | 3300013100 | Ga0157373_10002753 | Ga0157373_1000275311 | 353 |
| 521 | 3300013100 | Ga0157373_10044393 | Ga0157373_100443932 | 353 |
| 522 | 3300013102 | Ga0157371_10002698 | Ga0157371_1000269811 | 353 |
| 523 | 3300013102 | Ga0157371_10012758 | Ga0157371_100127585 | 353 |
| 524 | 3300013104 | Ga0157370_10016291 | Ga0157370_100162914 | 353 |
| 525 | 3300013104 | Ga0157370_10055556 | Ga0157370_100555561 | 353 |
| 526 | 3300013105 | Ga0157369_10004046 | Ga0157369_100040465 | 353 |
| 527 | 3300013105 | Ga0157369_10052340 | Ga0157369_100523405 | 353 |
| 528 | 3300013105 | Ga0157369_10082517 | Ga0157369_100825172 | 353 |
| 529 | 3300013105 | Ga0157369_10163681 | Ga0157369_101636812 | 353 |
| 530 | 3300013105 | Ga0157369_10263946 | Ga0157369_102639462 | 353 |
| 531 | 3300013296 | Ga0157374_10091760 | Ga0157374_100917603 | 353 |
| 532 | 3300013296 | Ga0157374_10262288 | Ga0157374_102622881 | 353 |
| 533 | 3300013297 | Ga0157378_10006792 | Ga0157378_100067923 | 353 |
| 534 | 3300013297 | Ga0157378_10015554 | Ga0157378_100155546 | 353 |
| 535 | 3300013297 | Ga0157378_10018115 | Ga0157378_100181154 | 353 |
| 536 | 3300013297 | Ga0157378_10032011 | Ga0157378_100320112 | 353 |
| 537 | 3300013297 | Ga0157378_10075180 | Ga0157378_100751802 | 353 |
| 538 | 3300013297 | Ga0157378_10158144 | Ga0157378_101581442 | 353 |
| 539 | 3300013297 | Ga0157378_10198855 | Ga0157378_101988552 | 353 |
| 540 | 3300013306 | Ga0163162_10000888 | Ga0163162_100008888 | 353 |
| 541 | 3300013306 | Ga0163162_10001107 | Ga0163162_1000110712 | 353 |
| 542 | 3300013306 | Ga0163162_10002830 | Ga0163162_100028306 | 353 |
| 543 | 3300013306 | Ga0163162_10023096 | Ga0163162_100230966 | 353 |
| 544 | 3300013306 | Ga0163162_10031725 | Ga0163162_100317254 | 353 |
| 545 | 3300013306 | Ga0163162_10077963 | Ga0163162_100779634 | 353 |
| 546 | 3300013306 | Ga0163162_10292251 | Ga0163162_102922512 | 353 |
| 547 | 3300013307 | Ga0157372_10002627 | Ga0157372_1000262713 | 353 |
| 548 | 3300013307 | Ga0157372_10011662 | Ga0157372_100116623 | 353 |
| 549 | 3300013307 | Ga0157372_10026460 | Ga0157372_100264606 | 353 |
| 550 | 3300013307 | Ga0157372_10203342 | Ga0157372_102033422 | 353 |
| 551 | 3300013307 | Ga0157372_10406214 | Ga0157372_104062141 | 353 |
| 552 | 3300013307 | Ga0157372_10646583 | Ga0157372_106465831 | 353 |
| 553 | 3300013308 | Ga0157375_10033658 | Ga0157375_100336582 | 353 |
| 554 | 3300013308 | Ga0157375_10057621 | Ga0157375_100576213 | 353 |
| 555 | 3300013308 | Ga0157375_10319002 | Ga0157375_103190022 | 353 |
| 556 | 3300013308 | Ga0157375_10356905 | Ga0157375_103569051 | 353 |
| 557 | 3300013308 | Ga0157375_10648474 | Ga0157375_106484741 | 353 |
| 558 | 3300014325 | Ga0163163_10107022 | Ga0163163_101070221 | 353 |
| 559 | 3300014325 | Ga0163163_10128193 | Ga0163163_101281932 | 353 |
| 560 | 3300014325 | Ga0163163_10253183 | Ga0163163_102531832 | 353 |
| 561 | 3300014325 | Ga0163163_10277075 | Ga0163163_102770752 | 353 |
| 562 | 3300014968 | Ga0157379_10168865 | Ga0157379_101688651 | 353 |
| 563 | 3300014969 | Ga0157376_10002166 | Ga0157376_100021664 | 353 |
| 564 | 3300014969 | Ga0157376_10060857 | Ga0157376_100608571 | 353 |
| 565 | 3300014969 | Ga0157376_10095786 | Ga0157376_100957862 | 353 |
| 566 | 3300014969 | Ga0157376_10113044 | Ga0157376_101130442 | 353 |
| 567 | 3300017792 | Ga0163161_10210996 | Ga0163161_102109962 | 353 |
| 568 | 3300021384 | Ga0213876_10001574 | Ga0213876_100015748 | 353 |
| 569 | 3300021384 | Ga0213876_10066116 | Ga0213876_100661162 | 353 |
| 570 | 3300025295 | Ga0209564_1022859 | Ga0209564_10228592 | 353 |
| 571 | 3300025302 | Ga0207426_1000026 | Ga0207426_1000026299 | 353 |
| 572 | 3300025304 | Ga0209257_1000070 | Ga0209257_100007030 | 353 |
| 573 | 3300025321 | Ga0207656_10062548 | Ga0207656_100625482 | 353 |
| 574 | 3300025899 | Ga0207642_10019137 | Ga0207642_100191373 | 353 |
| 575 | 3300025900 | Ga0207710_10000673 | Ga0207710_100006736 | 353 |
| 576 | 3300025900 | Ga0207710_10004125 | Ga0207710_100041254 | 353 |
| 577 | 3300025901 | Ga0207688_10002217 | Ga0207688_100022173 | 353 |
| 578 | 3300025901 | Ga0207688_10011466 | Ga0207688_100114663 | 353 |
| 579 | 3300025903 | Ga0207680_10000193 | Ga0207680_100001934 | 353 |
| 580 | 3300025903 | Ga0207680_10036735 | Ga0207680_100367352 | 353 |
| 581 | 3300025904 | Ga0207647_10044652 | Ga0207647_100446523 | 353 |
| 582 | 3300025907 | Ga0207645_10002084 | Ga0207645_100020846 | 353 |
| 583 | 3300025907 | Ga0207645_10012266 | Ga0207645_100122665 | 353 |
| 584 | 3300025907 | Ga0207645_10040712 | Ga0207645_100407123 | 353 |
| 585 | 3300025907 | Ga0207645_10070775 | Ga0207645_100707753 | 353 |
| 586 | 3300025908 | Ga0207643_10005282 | Ga0207643_100052822 | 353 |
| 587 | 3300025909 | Ga0207705_10056135 | Ga0207705_100561352 | 353 |
| 588 | 3300025911 | Ga0207654_10001980 | Ga0207654_100019809 | 353 |
| 589 | 3300025912 | Ga0207707_10007370 | Ga0207707_100073707 | 353 |
| 590 | 3300025912 | Ga0207707_10013675 | Ga0207707_100136753 | 353 |
| 591 | 3300025913 | Ga0207695_10000685 | Ga0207695_1000068543 | 353 |
| 592 | 3300025913 | Ga0207695_10000917 | Ga0207695_1000091719 | 353 |
| 593 | 3300025913 | Ga0207695_10001873 | Ga0207695_1000187322 | 353 |
| 594 | 3300025913 | Ga0207695_10008256 | Ga0207695_1000825613 | 353 |
| 595 | 3300025913 | Ga0207695_10028845 | Ga0207695_100288455 | 353 |
| 596 | 3300025913 | Ga0207695_10038240 | Ga0207695_100382403 | 353 |
| 597 | 3300025913 | Ga0207695_10088165 | Ga0207695_100881653 | 353 |
| 598 | 3300025913 | Ga0207695_10118885 | Ga0207695_101188852 | 353 |
| 599 | 3300025914 | Ga0207671_10000637 | Ga0207671_1000063735 | 353 |
| 600 | 3300025914 | Ga0207671_10001799 | Ga0207671_1000179910 | 353 |
| 601 | 3300025914 | Ga0207671_10002779 | Ga0207671_100027792 | 353 |
| 602 | 3300025914 | Ga0207671_10004496 | Ga0207671_100044969 | 353 |
| 603 | 3300025914 | Ga0207671_10007714 | Ga0207671_100077146 | 353 |
| 604 | 3300025914 | Ga0207671_10008078 | Ga0207671_100080782 | 353 |
| 605 | 3300025914 | Ga0207671_10051595 | Ga0207671_100515952 | 353 |
| 606 | 3300025914 | Ga0207671_10053268 | Ga0207671_100532682 | 353 |
| 607 | 3300025914 | Ga0207671_10256304 | Ga0207671_102563041 | 353 |
| 608 | 3300025917 | Ga0207660_10035163 | Ga0207660_100351631 | 353 |
| 609 | 3300025919 | Ga0207657_10013683 | Ga0207657_100136836 | 353 |
| 610 | 3300025921 | Ga0207652_10070241 | Ga0207652_100702412 | 353 |
| 611 | 3300025921 | Ga0207652_10075289 | Ga0207652_100752892 | 353 |
| 612 | 3300025923 | Ga0207681_10010977 | Ga0207681_100109774 | 353 |
| 613 | 3300025923 | Ga0207681_10034340 | Ga0207681_100343402 | 353 |
| 614 | 3300025923 | Ga0207681_10046936 | Ga0207681_100469362 | 353 |
| 615 | 3300025924 | Ga0207694_10004594 | Ga0207694_100045949 | 353 |
| 616 | 3300025924 | Ga0207694_10259943 | Ga0207694_102599431 | 353 |
| 617 | 3300025925 | Ga0207650_10154590 | Ga0207650_101545903 | 353 |
| 618 | 3300025931 | Ga0207644_10318802 | Ga0207644_103188022 | 353 |
| 619 | 3300025933 | Ga0207706_10017700 | Ga0207706_100177005 | 353 |
| 620 | 3300025937 | Ga0207669_10018579 | Ga0207669_100185792 | 353 |
| 621 | 3300025937 | Ga0207669_10054671 | Ga0207669_100546713 | 353 |
| 622 | 3300025937 | Ga0207669_10057781 | Ga0207669_100577812 | 353 |
| 623 | 3300025938 | Ga0207704_10006232 | Ga0207704_100062323 | 353 |
| 624 | 3300025938 | Ga0207704_10009596 | Ga0207704_100095963 | 353 |
| 625 | 3300025940 | Ga0207691_10030097 | Ga0207691_100300973 | 353 |
| 626 | 3300025940 | Ga0207691_10045472 | Ga0207691_100454723 | 353 |
| 627 | 3300025940 | Ga0207691_10080607 | Ga0207691_100806073 | 353 |
| 628 | 3300025942 | Ga0207689_10003649 | Ga0207689_100036495 | 353 |
| 629 | 3300025942 | Ga0207689_10008486 | Ga0207689_100084865 | 353 |
| 630 | 3300025942 | Ga0207689_10031074 | Ga0207689_100310743 | 353 |
| 631 | 3300025942 | Ga0207689_10058060 | Ga0207689_100580602 | 353 |
| 632 | 3300025942 | Ga0207689_10149580 | Ga0207689_101495803 | 353 |
| 633 | 3300025945 | Ga0207679_10039923 | Ga0207679_100399232 | 353 |
| 634 | 3300025949 | Ga0207667_10001836 | Ga0207667_100018362 | 353 |
| 635 | 3300025949 | Ga0207667_10008374 | Ga0207667_100083746 | 353 |
| 636 | 3300025949 | Ga0207667_10230902 | Ga0207667_102309022 | 353 |
| 637 | 3300025960 | Ga0207651_10009901 | Ga0207651_100099015 | 353 |
| 638 | 3300025960 | Ga0207651_10017040 | Ga0207651_100170403 | 353 |
| 639 | 3300025960 | Ga0207651_10207041 | Ga0207651_102070411 | 353 |
| 640 | 3300025961 | Ga0207712_10002610 | Ga0207712_100026101 | 353 |
| 641 | 3300025961 | Ga0207712_10002895 | Ga0207712_1000289513 | 353 |
| 642 | 3300025961 | Ga0207712_10007405 | Ga0207712_100074052 | 353 |
| 643 | 3300025961 | Ga0207712_10239308 | Ga0207712_102393081 | 353 |
| 644 | 3300025972 | Ga0207668_10116964 | Ga0207668_101169642 | 353 |
| 645 | 3300025981 | Ga0207640_10089746 | Ga0207640_100897462 | 353 |
| 646 | 3300025986 | Ga0207658_10004993 | Ga0207658_100049933 | 353 |
| 647 | 3300025986 | Ga0207658_10026815 | Ga0207658_100268155 | 353 |
| 648 | 3300025986 | Ga0207658_10031720 | Ga0207658_100317203 | 353 |
| 649 | 3300025986 | Ga0207658_10123177 | Ga0207658_101231771 | 353 |
| 650 | 3300026023 | Ga0207677_10000816 | Ga0207677_1000081614 | 353 |
| 651 | 3300026023 | Ga0207677_10004544 | Ga0207677_100045443 | 353 |
| 652 | 3300026035 | Ga0207703_10015149 | Ga0207703_100151497 | 353 |
| 653 | 3300026041 | Ga0207639_10018447 | Ga0207639_100184475 | 353 |
| 654 | 3300026041 | Ga0207639_10055557 | Ga0207639_100555572 | 353 |
| 655 | 3300026041 | Ga0207639_10136311 | Ga0207639_101363112 | 353 |
| 656 | 3300026078 | Ga0207702_10082483 | Ga0207702_100824832 | 353 |
| 657 | 3300026078 | Ga0207702_10085938 | Ga0207702_100859381 | 353 |
| 658 | 3300026078 | Ga0207702_10318199 | Ga0207702_103181992 | 353 |
| 659 | 3300026088 | Ga0207641_10000015 | Ga0207641_1000001548 | 353 |
| 660 | 3300026088 | Ga0207641_10128901 | Ga0207641_101289012 | 353 |
| 661 | 3300026088 | Ga0207641_10167509 | Ga0207641_101675092 | 353 |
| 662 | 3300026089 | Ga0207648_10000384 | Ga0207648_1000038414 | 353 |
| 663 | 3300026089 | Ga0207648_10010983 | Ga0207648_100109835 | 353 |
| 664 | 3300026089 | Ga0207648_10013448 | Ga0207648_1001344810 | 353 |
| 665 | 3300026089 | Ga0207648_10039543 | Ga0207648_100395434 | 353 |
| 666 | 3300026089 | Ga0207648_10280134 | Ga0207648_102801342 | 353 |
| 667 | 3300026089 | Ga0207648_10331629 | Ga0207648_103316292 | 353 |
| 668 | 3300026095 | Ga0207676_10005777 | Ga0207676_1000577710 | 353 |
| 669 | 3300026095 | Ga0207676_10008363 | Ga0207676_100083638 | 353 |
| 670 | 3300026095 | Ga0207676_10010736 | Ga0207676_100107362 | 353 |
| 671 | 3300026095 | Ga0207676_10025572 | Ga0207676_100255722 | 353 |
| 672 | 3300026095 | Ga0207676_10076021 | Ga0207676_100760212 | 353 |
| 673 | 3300026116 | Ga0207674_10004626 | Ga0207674_100046266 | 353 |
| 674 | 3300026116 | Ga0207674_10131836 | Ga0207674_101318362 | 353 |
| 675 | 3300026116 | Ga0207674_10483231 | Ga0207674_104832311 | 353 |
| 676 | 3300026118 | Ga0207675_100012296 | Ga0207675_1000122965 | 353 |
| 677 | 3300026118 | Ga0207675_100064596 | Ga0207675_1000645962 | 353 |
| 678 | 3300026118 | Ga0207675_100155488 | Ga0207675_1001554882 | 353 |
| 679 | 3300026118 | Ga0207675_100266074 | Ga0207675_1002660742 | 353 |
| 680 | 3300026121 | Ga0207683_10007595 | Ga0207683_100075958 | 353 |
| 681 | 3300026142 | Ga0207698_10009978 | Ga0207698_100099784 | 353 |
| 682 | 3300026142 | Ga0207698_10037614 | Ga0207698_100376142 | 353 |
| 683 | 3300026142 | Ga0207698_10073059 | Ga0207698_100730592 | 353 |
| 684 | 3300026142 | Ga0207698_10160932 | Ga0207698_101609321 | 353 |
| 685 | 3300026142 | Ga0207698_10439612 | Ga0207698_104396121 | 353 |
| 686 | 3300026142 | Ga0207698_10494465 | Ga0207698_104944651 | 353 |
| 687 | 3300026142 | Ga0207698_10511397 | Ga0207698_105113971 | 353 |
| 688 | 3300028379 | Ga0268266_10000048 | Ga0268266_10000048107 | 353 |
| 689 | 3300028379 | Ga0268266_10128363 | Ga0268266_101283632 | 353 |
| 690 | 3300028381 | Ga0268264_10000028 | Ga0268264_10000028262 | 353 |
| 691 | 3300028381 | Ga0268264_10001761 | Ga0268264_100017619 | 353 |
| 692 | 3300028381 | Ga0268264_10006760 | Ga0268264_100067604 | 353 |
| 693 | 3300028381 | Ga0268264_10009685 | Ga0268264_100096856 | 353 |
| 694 | 3300028381 | Ga0268264_10028275 | Ga0268264_100282752 | 353 |
| 695 | 3300028381 | Ga0268264_10037291 | Ga0268264_100372913 | 353 |
| 696 | 3300028381 | Ga0268264_10075394 | Ga0268264_100753943 | 353 |
| 697 | 3300028381 | Ga0268264_10086516 | Ga0268264_100865162 | 353 |
| 698 | 3300028381 | Ga0268264_10276301 | Ga0268264_102763012 | 353 |
| 699 | 3300028786 | Ga0307517_10004393 | Ga0307517_1000439313 | 353 |
| 700 | 3300028786 | Ga0307517_10137171 | Ga0307517_101371712 | 353 |
| 701 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012848 | 353 |
| 702 | 3300028794 | Ga0307515_10000031 | Ga0307515_10000031211 | 353 |
| 703 | 3300031251 | Ga0265327_10001248 | Ga0265327_1000124823 | 353 |
| 704 | 3300031251 | Ga0265327_10075405 | Ga0265327_100754052 | 353 |
| 705 | 3300031730 | Ga0307516_10000159 | Ga0307516_1000015967 | 353 |
| 706 | 3300031730 | Ga0307516_10189430 | Ga0307516_101894302 | 353 |
| 707 | 3300032004 | Ga0307414_10046302 | Ga0307414_100463024 | 353 |
| 708 | 3300033180 | Ga0307510_10004925 | Ga0307510_100049258 | 353 |
| 709 | 3300035170 | Ga0373943_0010590 | Ga0373943_0010590_303_1385 | 353 |
| 710 | 3300035172 | Ga0373955_0025009 | Ga0373955_0025009_985_2067 | 353 |
| 711 | 3300035692 | Ga0373935_0056690 | Ga0373935_0056690_1402_2484 | 353 |
| 712 | 3300035724 | Ga0373933_0036103 | Ga0373933_0036103_506_1588 | 353 |
| 713 | 3300036401 | Ga0373937_0142441 | Ga0373937_0142441_32_1114 | 353 |
| 714 | 3300037312 | Ga0395899_0146615 | Ga0395899_0146615_170_1252 | 353 |
| 715 | 3300037418 | Ga0395900_0226618 | Ga0395900_0226618_170_1252 | 353 |
| 716 | 3300037418 | Ga0395900_0325488 | Ga0395900_0325488_314_1399 | 353 |
| 717 | 3300037471 | Ga0395905_0021187 | Ga0395905_0021187_1785_2867 | 353 |
| 718 | 3300038443 | Ga0395901_0063597 | Ga0395901_0063597_2335_3417 | 353 |
| 719 | 3300039437 | Ga0436365_0565109 | Ga0436365_0565109_3807_4892 | 353 |
| 720 | 3300039437 | Ga0436365_0850637 | Ga0436365_0850637_1388_2473 | 353 |
| 721 | 3300039437 | Ga0436365_1118032 | Ga0436365_1118032_166_1248 | 353 |
| 722 | 3300039437 | Ga0436365_1249677 | Ga0436365_1249677_5716_6798 | 353 |
| 723 | 3300041404 | Ga0439436_0002706 | Ga0439436_0002706_4006_5088 | 353 |
| 724 | 3300041997 | Ga0439431_0002553 | Ga0439431_0002553_2530_3621 | 353 |
| 725 | 3300041999 | Ga0439433_0012360 | Ga0439433_0012360_505_1587 | 353 |
| 726 | 3300042004 | Ga0439445_0007815 | Ga0439445_0007815_327_1418 | 353 |
| 727 | 3300042007 | Ga0439449_0007774 | Ga0439449_0007774_2485_3567 | 353 |
| 728 | 3300042014 | Ga0439457_002111 | Ga0439457_002111_2115_3197 | 353 |
| 729 | 3300042015 | Ga0439462_0004635 | Ga0439462_0004635_1862_2944 | 353 |
| 730 | 3300042134 | Ga0450898_001475 | Ga0450898_001475_321_1403 | 353 |
| 731 | 3300044656 | Ga0466969_0000127 | Ga0466969_0000127_18669_19751 | 353 |
| 732 | 3300044658 | Ga0466972_0000001 | Ga0466972_0000001_301828_302910 | 353 |
| 733 | 3300044658 | Ga0466972_0000080 | Ga0466972_0000080_83097_84179 | 353 |
| 734 | 3300044658 | Ga0466972_0032921 | Ga0466972_0032921_945_2027 | 353 |
| 735 | 3300044684 | Ga0466966_0000120 | Ga0466966_0000120_20094_21176 | 353 |
| 736 | 3300044712 | Ga0453684_0026631 | Ga0453684_0026631_2891_3973 | 353 |
| 737 | 3300044712 | Ga0453684_0108162 | Ga0453684_0108162_1108_2190 | 353 |
| 738 | 3300044712 | Ga0453684_0147752 | Ga0453684_0147752_15_1097 | 353 |
| 739 | 3300044712 | Ga0453684_0532170 | Ga0453684_0532170_130_1212 | 353 |
| 740 | 3300044719 | Ga0466971_0015332 | Ga0466971_0015332_47_1129 | 353 |
| 741 | 3300044765 | Ga0466970_0003312 | Ga0466970_0003312_372_1454 | 353 |
| 742 | 3300044842 | Ga0466957_0000380 | Ga0466957_0000380_396_1478 | 353 |
| 743 | 3300044842 | Ga0466957_0082602 | Ga0466957_0082602_216_1298 | 353 |
| 744 | 3300045049 | Ga0466959_0000014 | Ga0466959_0000014_99480_100562 | 353 |
| 745 | 3300045836 | Ga0466958_0013285 | Ga0466958_0013285_2626_3708 | 353 |
| 746 | 3300046460 | Ga0495638_0036074 | Ga0495638_0036074_625_1707 | 353 |
| 747 | 3300046463 | Ga0495653_0064121 | Ga0495653_0064121_143_1225 | 353 |
| 748 | 3300046471 | Ga0495650_0031064 | Ga0495650_0031064_110_1192 | 353 |
| 749 | 3300046507 | Ga0495606_0005804 | Ga0495606_0005804_20_1102 | 353 |
| 750 | 3300046514 | Ga0495618_0096219 | Ga0495618_0096219_206_1288 | 353 |
| 751 | 3300046516 | Ga0495628_0027888 | Ga0495628_0027888_1761_2843 | 353 |
| 752 | 3300046522 | Ga0495643_0037388 | Ga0495643_0037388_742_1824 | 353 |
| 753 | 3300046543 | Ga0495645_0128073 | Ga0495645_0128073_541_1623 | 353 |
| 754 | 3300046616 | Ga0495668_0000082 | Ga0495668_0000082_72864_73946 | 353 |
| 755 | 3300046642 | Ga0495634_0009802 | Ga0495634_0009802_4559_5641 | 353 |
| 756 | 3300047320 | Ga0495672_0021009 | Ga0495672_0021009_3117_4199 | 353 |
| 757 | 3300047443 | Ga0495687_000261 | Ga0495687_000261_32451_33533 | 353 |
| 758 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_671148_672230 | 353 |
| 759 | 3300047472 | Ga0495686_0007643 | Ga0495686_0007643_6698_7780 | 353 |
| 760 | 3300048924 | Ga0496121_0000081 | Ga0496121_0000081_64859_65950 | 353 |
| 761 | 3300049569 | Ga0501032_0001909 | Ga0501032_0001909_10479_11561 | 353 |
| 762 | 3300049571 | Ga0501034_0000004 | Ga0501034_0000004_3733_4815 | 353 |
| 763 | 3300049571 | Ga0501034_0011664 | Ga0501034_0011664_6129_7220 | 353 |
| 764 | 3300049571 | Ga0501034_0024828 | Ga0501034_0024828_3192_4274 | 353 |
| 765 | 3300049571 | Ga0501034_0032084 | Ga0501034_0032084_787_1869 | 353 |
| 766 | 3300049571 | Ga0501034_0123271 | Ga0501034_0123271_1406_2488 | 353 |
| 767 | 3300049572 | Ga0501036_0034595 | Ga0501036_0034595_2718_3800 | 353 |
| 768 | 3300049573 | Ga0501037_0031925 | Ga0501037_0031925_1878_2960 | 353 |
| 769 | 3300049574 | Ga0501038_0030627 | Ga0501038_0030627_2052_3134 | 353 |
| 770 | 3300049575 | Ga0501039_0084825 | Ga0501039_0084825_40_1122 | 353 |
| 771 | 3300049575 | Ga0501039_0166752 | Ga0501039_0166752_244_1326 | 353 |
| 772 | 3300049579 | Ga0501043_0003893 | Ga0501043_0003893_4144_5226 | 353 |
| 773 | 3300049579 | Ga0501043_0152891 | Ga0501043_0152891_465_1547 | 353 |
| 774 | 3300049580 | Ga0501046_0045392 | Ga0501046_0045392_432_1514 | 353 |
| 775 | 3300049580 | Ga0501046_0056453 | Ga0501046_0056453_1867_2949 | 353 |
| 776 | 3300049581 | Ga0501047_0006977 | Ga0501047_0006977_9388_10470 | 353 |
| 777 | 3300049581 | Ga0501047_0082793 | Ga0501047_0082793_387_1469 | 353 |
| 778 | 3300049582 | Ga0501048_0006258 | Ga0501048_0006258_4062_5144 | 353 |
| 779 | 3300049583 | Ga0501067_0036099 | Ga0501067_0036099_289_1371 | 353 |
| 780 | 3300049583 | Ga0501067_0150962 | Ga0501067_0150962_15_1097 | 353 |
| 781 | 3300049584 | Ga0501068_0027869 | Ga0501068_0027869_1426_2508 | 353 |
| 782 | 3300049585 | Ga0501069_0074172 | Ga0501069_0074172_307_1389 | 353 |
| 783 | 3300049586 | Ga0501070_0082958 | Ga0501070_0082958_12_1094 | 353 |
| 784 | 3300049586 | Ga0501070_0195039 | Ga0501070_0195039_101_1183 | 353 |
| 785 | 3300049589 | Ga0501073_0006651 | Ga0501073_0006651_1541_2623 | 353 |
| 786 | 3300049589 | Ga0501073_0031419 | Ga0501073_0031419_2004_3086 | 353 |
| 787 | 3300049590 | Ga0501074_0002599 | Ga0501074_0002599_1541_2623 | 353 |
| 788 | 3300049703 | Ga0501219_000133 | Ga0501219_000133_7294_8376 | 353 |
| 789 | 3300049742 | Ga0501080_0030856 | Ga0501080_0030856_1541_2623 | 353 |
| 790 | 3300049742 | Ga0501080_0231967 | Ga0501080_0231967_150_1232 | 353 |
| 791 | 3300049744 | Ga0501083_0015427 | Ga0501083_0015427_1350_2432 | 353 |
| 792 | 3300049744 | Ga0501083_0050834 | Ga0501083_0050834_1510_2592 | 353 |
| 793 | 3300049758 | Ga0501241_003764 | Ga0501241_003764_1042_2133 | 353 |
| 794 | 3300049822 | Ga0501035_0002433 | Ga0501035_0002433_2765_3847 | 353 |
| 795 | 3300049822 | Ga0501035_0101410 | Ga0501035_0101410_315_1397 | 353 |
| 796 | 3300049823 | Ga0501044_0016689 | Ga0501044_0016689_1358_2440 | 353 |
| 797 | 3300049823 | Ga0501044_0021227 | Ga0501044_0021227_3344_4426 | 353 |
| 798 | 3300049823 | Ga0501044_0100055 | Ga0501044_0100055_757_1839 | 353 |
| 799 | 3300049823 | Ga0501044_0294316 | Ga0501044_0294316_197_1279 | 353 |
| 800 | 3300050005 | Ga0501284_00007 | Ga0501284_00007_116738_117820 | 353 |
| 801 | 3300050493 | nmdc:mga0k408_40938_c1 | nmdc:mga0k408_40938_c1_227_1309 | 353 |
| 802 | 3300050496 | nmdc:mga07m45_63327_c1 | nmdc:mga07m45_63327_c1_170_1261 | 353 |
| 803 | 3300050512 | nmdc:mga0n895_83806_c1 | nmdc:mga0n895_83806_c1_1176_2258 | 353 |
| 804 | 3300053088 | Ga0500644_0002655 | Ga0500644_0002655_772_1854 | 353 |
| 805 | 3300053088 | Ga0500644_0022480 | Ga0500644_0022480_108_1190 | 353 |
| 806 | 3300053092 | Ga0500583_0000001 | Ga0500583_0000001_90447_91529 | 353 |
| 807 | 3300053092 | Ga0500583_0042259 | Ga0500583_0042259_431_1513 | 353 |
| 808 | 3300053108 | Ga0500562_000018 | Ga0500562_000018_27544_28626 | 353 |
| 809 | 3300053139 | Ga0500568_0003595 | Ga0500568_0003595_4652_5734 | 353 |
| 810 | 3300053142 | Ga0500577_0045393 | Ga0500577_0045393_371_1453 | 353 |
| 811 | 3300053147 | Ga0500589_014113 | Ga0500589_014113_2087_3169 | 353 |
| 812 | 3300053156 | Ga0500622_0000114 | Ga0500622_0000114_54128_55210 | 353 |
| 813 | 3300053156 | Ga0500622_0005506 | Ga0500622_0005506_1056_2138 | 353 |
| 814 | 3300053156 | Ga0500622_0025494 | Ga0500622_0025494_952_2034 | 353 |
| 815 | 3300053177 | Ga0500636_0030666 | Ga0500636_0030666_986_2068 | 353 |
| 816 | 3300054114 | Ga0501084_0059210 | Ga0501084_0059210_1706_2788 | 353 |
| 817 | 3300055283 | Ga0500661_006998 | Ga0500661_006998_742_1824 | 353 |
| 818 | 3300060353 | Ga0501082_0225538 | Ga0501082_0225538_121_1203 | 353 |
| 819 | iso_pu_bacteria | 2929921140 | 2929921816 | 353 |
| 820 | iso_pu_bacteria | 8003151029 | 8003154114 | 353 |
| 821 | 3300005289 | Ga0065704_10101212 | Ga0065704_101012122 | 354 |
| 822 | 3300005290 | Ga0065712_10080579 | Ga0065712_100805792 | 354 |
| 823 | 3300005340 | Ga0070689_100054995 | Ga0070689_1000549952 | 354 |
| 824 | 3300005343 | Ga0070687_100049691 | Ga0070687_1000496912 | 354 |
| 825 | 3300005353 | Ga0070669_100038623 | Ga0070669_1000386232 | 354 |
| 826 | 3300005354 | Ga0070675_100096056 | Ga0070675_1000960562 | 354 |
| 827 | 3300005354 | Ga0070675_100117262 | Ga0070675_1001172622 | 354 |
| 828 | 3300005364 | Ga0070673_100102983 | Ga0070673_1001029832 | 354 |
| 829 | 3300005364 | Ga0070673_100118290 | Ga0070673_1001182902 | 354 |
| 830 | 3300005466 | Ga0070685_10005017 | Ga0070685_100050172 | 354 |
| 831 | 3300005471 | Ga0070698_100000282 | Ga0070698_10000028223 | 354 |
| 832 | 3300005471 | Ga0070698_100006847 | Ga0070698_1000068475 | 354 |
| 833 | 3300005544 | Ga0070686_100072943 | Ga0070686_1000729431 | 354 |
| 834 | 3300005616 | Ga0068852_100160219 | Ga0068852_1001602192 | 354 |
| 835 | 3300005719 | Ga0068861_100001502 | Ga0068861_10000150217 | 354 |
| 836 | 3300005719 | Ga0068861_100146876 | Ga0068861_1001468761 | 354 |
| 837 | 3300006358 | Ga0068871_100305082 | Ga0068871_1003050821 | 354 |
| 838 | 3300006844 | Ga0075428_100093975 | Ga0075428_1000939752 | 354 |
| 839 | 3300006846 | Ga0075430_100001793 | Ga0075430_1000017932 | 354 |
| 840 | 3300006847 | Ga0075431_100055523 | Ga0075431_1000555233 | 354 |
| 841 | 3300006880 | Ga0075429_100000136 | Ga0075429_10000013623 | 354 |
| 842 | 3300009094 | Ga0111539_10176061 | Ga0111539_101760613 | 354 |
| 843 | 3300009147 | Ga0114129_10039792 | Ga0114129_100397923 | 354 |
| 844 | 3300009176 | Ga0105242_10002943 | Ga0105242_100029431 | 354 |
| 845 | 3300009176 | Ga0105242_10140077 | Ga0105242_101400773 | 354 |
| 846 | 3300009176 | Ga0105242_10246472 | Ga0105242_102464722 | 354 |
| 847 | 3300009553 | Ga0105249_10012962 | Ga0105249_100129627 | 354 |
| 848 | 3300009553 | Ga0105249_10044696 | Ga0105249_100446962 | 354 |
| 849 | 3300013104 | Ga0157370_10087246 | Ga0157370_100872462 | 354 |
| 850 | 3300013306 | Ga0163162_10077356 | Ga0163162_100773563 | 354 |
| 851 | 3300013306 | Ga0163162_10450680 | Ga0163162_104506802 | 354 |
| 852 | 3300013308 | Ga0157375_10137864 | Ga0157375_101378643 | 354 |
| 853 | 3300013308 | Ga0157375_10202173 | Ga0157375_102021732 | 354 |
| 854 | 3300014326 | Ga0157380_10146948 | Ga0157380_101469482 | 354 |
| 855 | 3300014969 | Ga0157376_10115471 | Ga0157376_101154712 | 354 |
| 856 | 3300025923 | Ga0207681_10034444 | Ga0207681_100344443 | 354 |
| 857 | 3300025934 | Ga0207686_10000709 | Ga0207686_1000070920 | 354 |
| 858 | 3300025934 | Ga0207686_10127732 | Ga0207686_101277322 | 354 |
| 859 | 3300025936 | Ga0207670_10039676 | Ga0207670_100396762 | 354 |
| 860 | 3300025938 | Ga0207704_10084718 | Ga0207704_100847182 | 354 |
| 861 | 3300025940 | Ga0207691_10080271 | Ga0207691_100802713 | 354 |
| 862 | 3300025961 | Ga0207712_10001470 | Ga0207712_100014704 | 354 |
| 863 | 3300025961 | Ga0207712_10017162 | Ga0207712_100171622 | 354 |
| 864 | 3300026075 | Ga0207708_10020703 | Ga0207708_100207033 | 354 |
| 865 | 3300026118 | Ga0207675_100009007 | Ga0207675_1000090074 | 354 |
| 866 | 3300026142 | Ga0207698_10242148 | Ga0207698_102421482 | 354 |
| 867 | 3300027907 | Ga0207428_10047103 | Ga0207428_100471033 | 354 |
| 868 | 3300042125 | Ga0450923_000505 | Ga0450923_000505_1971_3056 | 354 |
| 869 | 3300050507 | nmdc:mga05p37_525609_c1 | nmdc:mga05p37_525609_c1_248_1333 | 354 |
| 870 | 3300050508 | nmdc:mga09592_5573_c1 | nmdc:mga09592_5573_c1_1039_2124 | 354 |
| 871 | 3300050508 | nmdc:mga09592_97382_c1 | nmdc:mga09592_97382_c1_911_1996 | 354 |
| 872 | 3300050509 | nmdc:mga0qj67_145895_c1 | nmdc:mga0qj67_145895_c1_286_1371 | 354 |
| 873 | 3300050510 | nmdc:mga06r32_48896_c1 | nmdc:mga06r32_48896_c1_413_1498 | 354 |
| 874 | 3300050511 | nmdc:mga08y16_77511_c1 | nmdc:mga08y16_77511_c1_77_1162 | 354 |
| 875 | 3300005327 | Ga0070658_10051009 | Ga0070658_100510092 | 355 |
| 876 | 3300005329 | Ga0070683_100208234 | Ga0070683_1002082342 | 355 |
| 877 | 3300005331 | Ga0070670_100100801 | Ga0070670_1001008012 | 355 |
| 878 | 3300005355 | Ga0070671_100092367 | Ga0070671_1000923672 | 355 |
| 879 | 3300005535 | Ga0070684_100140304 | Ga0070684_1001403042 | 355 |
| 880 | 3300005564 | Ga0070664_100008601 | Ga0070664_1000086012 | 355 |
| 881 | 3300005564 | Ga0070664_100218228 | Ga0070664_1002182281 | 355 |
| 882 | 3300005616 | Ga0068852_100003313 | Ga0068852_1000033132 | 355 |
| 883 | 3300005616 | Ga0068852_100038926 | Ga0068852_1000389262 | 355 |
| 884 | 3300005617 | Ga0068859_100017809 | Ga0068859_1000178095 | 355 |
| 885 | 3300005834 | Ga0068851_10008435 | Ga0068851_100084351 | 355 |
| 886 | 3300005843 | Ga0068860_100008699 | Ga0068860_1000086994 | 355 |
| 887 | 3300006931 | Ga0097620_100017809 | Ga0097620_1000178095 | 355 |
| 888 | 3300009553 | Ga0105249_10298373 | Ga0105249_102983732 | 355 |
| 889 | 3300013102 | Ga0157371_10000518 | Ga0157371_1000051813 | 355 |
| 890 | 3300013102 | Ga0157371_10012494 | Ga0157371_100124944 | 355 |
| 891 | 3300013102 | Ga0157371_10056930 | Ga0157371_100569302 | 355 |
| 892 | 3300013102 | Ga0157371_10168127 | Ga0157371_101681271 | 355 |
| 893 | 3300013105 | Ga0157369_10131361 | Ga0157369_101313613 | 355 |
| 894 | 3300013105 | Ga0157369_10353582 | Ga0157369_103535822 | 355 |
| 895 | 3300013296 | Ga0157374_10062246 | Ga0157374_100622462 | 355 |
| 896 | 3300013296 | Ga0157374_10153558 | Ga0157374_101535582 | 355 |
| 897 | 3300013306 | Ga0163162_10002571 | Ga0163162_100025716 | 355 |
| 898 | 3300013307 | Ga0157372_10034639 | Ga0157372_100346393 | 355 |
| 899 | 3300013307 | Ga0157372_10098783 | Ga0157372_100987832 | 355 |
| 900 | 3300014325 | Ga0163163_10000432 | Ga0163163_1000043224 | 355 |
| 901 | 3300014325 | Ga0163163_10014374 | Ga0163163_100143743 | 355 |
| 902 | 3300014969 | Ga0157376_10150201 | Ga0157376_101502012 | 355 |
| 903 | 3300025321 | Ga0207656_10024838 | Ga0207656_100248382 | 355 |
| 904 | 3300025904 | Ga0207647_10000210 | Ga0207647_1000021044 | 355 |
| 905 | 3300025925 | Ga0207650_10001513 | Ga0207650_1000151315 | 355 |
| 906 | 3300025925 | Ga0207650_10047461 | Ga0207650_100474613 | 355 |
| 907 | 3300025945 | Ga0207679_10077262 | Ga0207679_100772622 | 355 |
| 908 | 3300025945 | Ga0207679_10141067 | Ga0207679_101410672 | 355 |
| 909 | 3300025960 | Ga0207651_10020151 | Ga0207651_100201514 | 355 |
| 910 | 3300026142 | Ga0207698_10102320 | Ga0207698_101023203 | 355 |
| 911 | 3300026142 | Ga0207698_10370944 | Ga0207698_103709441 | 355 |
| 912 | 3300028380 | Ga0268265_10009060 | Ga0268265_100090602 | 355 |
| 913 | 3300028381 | Ga0268264_10010034 | Ga0268264_100100343 | 355 |
| 914 | 3300037466 | Ga0395898_0059676 | Ga0395898_0059676_2183_3283 | 355 |
| 915 | 3300037471 | Ga0395905_0003668 | Ga0395905_0003668_14826_15929 | 355 |
| 916 | 3300037471 | Ga0395905_0095804 | Ga0395905_0095804_605_1708 | 355 |
| 917 | 3300042876 | Ga0451577_0119657 | Ga0451577_0119657_180_1283 | 355 |
| 918 | 3300044712 | Ga0453684_0153958 | Ga0453684_0153958_1529_2632 | 355 |
| 919 | 3300045049 | Ga0466959_0034324 | Ga0466959_0034324_1914_3017 | 355 |
| 920 | 3300045051 | Ga0451576_0295748 | Ga0451576_0295748_77_1180 | 355 |
| 921 | 3300049579 | Ga0501043_0087841 | Ga0501043_0087841_1260_2363 | 355 |
| 922 | 3300049661 | Ga0501217_006558 | Ga0501217_006558_949_2052 | 355 |
| 923 | 3300049686 | Ga0501257_009245 | Ga0501257_009245_309_1412 | 355 |
| 924 | 3300049772 | Ga0501275_004810 | Ga0501275_004810_68_1171 | 355 |
| 925 | 2162886007 | SwRhRL2b_contig_1538117 | SwRhRL2b_0072.00007040 | 356 |
| 926 | 3300044673 | Ga0453683_0138195 | Ga0453683_0138195_325_1437 | 356 |
| 927 | 3300053090 | Ga0500646_0001794 | Ga0500646_0001794_3819_4940 | 356 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cu2-assembly1.cif.gz_A-2 | crystal structure of mannose-1-phosphate geranyltransferase from thermus thermophilus hb8 | 0.9071 | 7 | 348 |
| 2cu2-assembly1.cif.gz_A-2 | crystal structure of mannose-1-phosphate geranyltransferase from thermus thermophilus hb8 | 0.8994 | 7 | 348 |
| 2x5s-assembly1.cif.gz_B | crystal structure of t. maritima gdp-mannose pyrophosphorylase in apo state. | 0.8902 | 8 | 347 |
| 2x5s-assembly1.cif.gz_B | crystal structure of t. maritima gdp-mannose pyrophosphorylase in apo state. | 0.8827 | 8 | 347 |
| 2qh5-assembly1.cif.gz_A | crystal structure of mannose-6-phosphate isomerase from helicobacter pylori | 0.8394 | 7 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cu2A00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9071 | 7 | 348 | 3.90.550.10 |
| 2cu2A00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8994 | 7 | 348 | 3.90.550.10 |
| af_P24174_4_358_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8966 | 7 | 349 | 3.90.550.10 |
| 2x5sB00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8902 | 8 | 347 | 3.90.550.10 |
| 2x5sB00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8827 | 8 | 347 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A662BLU3-F1-model_v4 | Mannose-1-phosphate guanylyltransferase | 0.9925 | 5 | 85 |
GO:0004475
GO:0009298 |
| AF-A0A3D2S5U4-F1-model_v4 | Mannose-1-phosphate guanylyltransferase | 0.9916 | 5 | 102 |
GO:0004475
GO:0009298 |
| AF-A0A5N7Z8A1-F1-model_v4 | Mannose-1-phosphate guanylyltransferase | 0.9898 | 5 | 109 |
GO:0004475
GO:0009298 |
| AF-A0A520C348-F1-model_v4 | Mannose-1-phosphate guanylyltransferase | 0.9898 | 5 | 108 |
GO:0004475
GO:0009298 |
| AF-A0A7X0CR72-F1-model_v4 | Mannose-1-phosphate guanylyltransferase (EC 2.7.7.13) | 0.9894 | 5 | 116 |
GO:0004475
GO:0009298 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar