F485946

General Info

Members Datasets Scaffolds Average Seq Length
927 335 908 357

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10153558|Ga0157374_101535582
Length 417
Sequence VILKQPNKMNEHHYIVIMAGGIGSRFWPMSRQDYPKQFLDILNTGQTLIQGTFERFAHFVPVENIYVVTSNEYMDIVKEQLPGLPAENVLGEPSRKNTAPCIAYISFKLQQKDPKASLIVAPADHIIKDQKAFTKVCLEALSFVNKHNAFITLGITPLQPNTGYGYIQREQHSVSDNVYKVKTFTEKPNLELAKTFLASGDFLWNAGIFIWQVKNVIKAFEKYLPEMYDVFVAEKDAFNTPEERKALEHIYPLCTNISIDFGIMEKAENVYVIPSSFGWSDLGTWNSAYENLEKDSRENAIAGENVMIVDAEKCIVHASDKKLLVLQGLKDFIIVDTEDVLLICKKDKEQDIKDYVAEVKKSMGDDYLECECGNVEMWECENSQQAVISNGRSEKSNRITSDKTATYYRCRRIDSNE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
8 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
9 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
10 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
11 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
12 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
13 2914759650 Rhizosphaericola mali Isolate Rhizosphere
14 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
15 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
16 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
17 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
18 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
19 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
20 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
223 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
226 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
229 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
232 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
233 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
289 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
290 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
291 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
292 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
293 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
294 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
295 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
296 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
297 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
298 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
299 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
303 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
316 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
317 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
320 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
321 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
322 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
323 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
326 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
327 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0.11
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.58
Nodule 0
Rhizoplane 0.22
Rhizosphere 87.49
Stem 0
Stem Tuber 0
Unclassified 5.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1538117 2162886007 Bacteria 1196
2 JGI24740J21852_10002379 3300001979 Bacteria 8555
3 JGI24739J22299_10000062 3300001989 Bacteria 29944
4 JGI24744J21845_10003674 3300002077 Bacteria 3161
5 JGI25154J39366_1000023 3300002738 Bacteria 219569
6 JGI25154J39366_1007774 3300002738 Bacteria 1434
7 JGI25159J45721_1009609 3300002987 Bacteria 2538
8 JGI25153J46596_10002509 3300003215 Bacteria 10537
9 JGI25153J46596_10023575 3300003215 Bacteria 2239
10 rootH1_10013813 3300003316 Bacteria 11218
11 rootH1_10013813 3300003323 Bacteria 1368
12 rootH1_10166897 3300003316 Bacteria 1381
13 rootH2_10007005 3300003320 Bacteria 1761
14 rootH2_10017798 3300003320 Bacteria 14280
15 rootH2_10039673 3300003320 Bacteria 11437
16 rootH2_10092694 3300003320 Bacteria 2548
17 rootH2_10135544 3300003320 Bacteria 6928
18 rootL2_10023331 3300003322 Bacteria 2597
19 rootL2_10027551 3300003322 Bacteria 8632
20 rootL2_10038898 3300003322 Bacteria 4134
21 rootL2_10062550 3300003322 Bacteria 3641
22 rootL2_10075820 3300003322 Bacteria 3561
23 rootL2_10082800 3300003322 Bacteria 3650
24 rootH1_10044529 3300003323 Bacteria 12446
25 rootH1_10175021 3300003323 Bacteria 3205
26 JGI25160J50197_1001239 3300003354 Bacteria 12966
27 JGI25160J50197_1003881 3300003354 Bacteria 6553
28 Ga0055528_1001011 3300003790 Bacteria 18675
29 Ga0055530_10000880 3300003791 Bacteria 24686
30 Ga0055531_10000054 3300003794 Bacteria 123684
31 Ga0055531_10013120 3300003794 Bacteria 3845
32 Ga0065165_1000027 3300005262 Bacteria 228507
33 Ga0065165_1007410 3300005262 Bacteria 5401
34 Ga0065704_10088342 3300005289 Bacteria 2947
35 Ga0065704_10094599 3300005289 Bacteria 2535
36 Ga0065704_10101212 3300005289 Unclassified 2240
37 Ga0065712_10080579 3300005290 Bacteria 3089
38 Ga0065715_10127934 3300005293 Bacteria 2073
39 Ga0070658_10051009 3300005327 Bacteria 3353
40 Ga0070658_10063181 3300005327 Bacteria 3018
41 Ga0070676_10010918 3300005328 Bacteria 4934
42 Ga0070676_10083899 3300005328 Bacteria 1939
43 Ga0070676_10145117 3300005328 Bacteria 1514
44 Ga0070683_100011019 3300005329 Bacteria 7792
45 Ga0070683_100167963 3300005329 Bacteria 2082
46 Ga0070683_100208234 3300005329 Bacteria 1857
47 Ga0070670_100026886 3300005331 Bacteria 4949
48 Ga0070670_100082020 3300005331 Bacteria 2771
49 Ga0070670_100100801 3300005331 Unclassified 2486
50 Ga0070670_100304256 3300005331 Bacteria 1395
51 Ga0068869_100004838 3300005334 Bacteria 8409
52 Ga0068869_100009710 3300005334 Bacteria 6249
53 Ga0068869_100017987 3300005334 Bacteria 4803
54 Ga0068869_100089615 3300005334 Bacteria 2310
55 Ga0068869_100244713 3300005334 Bacteria 1430
56 Ga0070666_10000112 3300005335 Bacteria 55997
57 Ga0070666_10015901 3300005335 Bacteria 4806
58 Ga0070666_10057022 3300005335 Bacteria 2639
59 Ga0070680_100024630 3300005336 Unclassified 4810
60 Ga0070680_100039686 3300005336 Bacteria 3809
61 Ga0070682_100036209 3300005337 Unclassified 3016
62 Ga0070682_100081306 3300005337 Bacteria 2097
63 Ga0068868_100001123 3300005338 Bacteria 18309
64 Ga0068868_100008985 3300005338 Bacteria 7171
65 Ga0068868_100030169 3300005338 Bacteria 4158
66 Ga0068868_100045803 3300005338 Bacteria 3423
67 Ga0070660_100000435 3300005339 Bacteria 27665
68 Ga0070660_100006706 3300005339 Bacteria 7988
69 Ga0070660_100007671 3300005339 Bacteria 7520
70 Ga0070660_100028232 3300005339 Bacteria 4196
71 Ga0070660_100086771 3300005339 Bacteria 2463
72 Ga0070660_100222396 3300005339 Unclassified 1535
73 Ga0070689_100054995 3300005340 Bacteria 3082
74 Ga0070689_100098025 3300005340 Unclassified 2318
75 Ga0070689_100123580 3300005340 Bacteria 2069
76 Ga0070691_10018185 3300005341 Bacteria 3239
77 Ga0070687_100049691 3300005343 Bacteria 2162
78 Ga0070661_100046932 3300005344 Bacteria 3160
79 Ga0070668_100063236 3300005347 Bacteria 2868
80 Ga0070668_100294488 3300005347 Bacteria 1359
81 Ga0070669_100006429 3300005353 Bacteria 8458
82 Ga0070669_100014257 3300005353 Bacteria 5656
83 Ga0070669_100038623 3300005353 Bacteria 3466
84 Ga0070669_100042143 3300005353 Bacteria 3321
85 Ga0070669_100228034 3300005353 Unclassified 1475
86 Ga0070675_100096056 3300005354 Bacteria 2489
87 Ga0070675_100117262 3300005354 Bacteria 2259
88 Ga0070675_100226650 3300005354 Unclassified 1629
89 Ga0070675_100321286 3300005354 Bacteria 1367
90 Ga0070671_100079539 3300005355 Bacteria 2740
91 Ga0070671_100092367 3300005355 Bacteria 2535
92 Ga0070674_100034018 3300005356 Bacteria 3399
93 Ga0070674_100077838 3300005356 Bacteria 2362
94 Ga0070673_100022084 3300005364 Bacteria 4627
95 Ga0070673_100032786 3300005364 Bacteria 3916
96 Ga0070673_100102983 3300005364 Bacteria 2354
97 Ga0070673_100112954 3300005364 Bacteria 2255
98 Ga0070673_100118290 3300005364 Bacteria 2206
99 Ga0070673_100420777 3300005364 Unclassified 1198
100 Ga0070659_100007146 3300005366 Bacteria 8102
101 Ga0070659_100008871 3300005366 Bacteria 7367
102 Ga0070659_100126170 3300005366 Bacteria 2076
103 Ga0070667_100008519 3300005367 Bacteria 8501
104 Ga0070667_100017599 3300005367 Bacteria 5921
105 Ga0070667_100050896 3300005367 Bacteria 3491
106 Ga0070667_100059753 3300005367 Bacteria 3225
107 Ga0070667_100114046 3300005367 Bacteria 2346
108 Ga0070667_100157773 3300005367 Bacteria 1997
109 Ga0070667_100413693 3300005367 Unclassified 1229
110 Ga0070663_100096476 3300005455 Bacteria 2199
111 Ga0070663_100290238 3300005455 Bacteria 1306
112 Ga0070678_100011344 3300005456 Bacteria 5491
113 Ga0070678_100081222 3300005456 Bacteria 2457
114 Ga0070662_100046050 3300005457 Bacteria 3133
115 Ga0070662_100127996 3300005457 Bacteria 1954
116 Ga0070662_100139466 3300005457 Bacteria 1877
117 Ga0070681_10012536 3300005458 Bacteria 8413
118 Ga0070681_10037752 3300005458 Bacteria 4845
119 Ga0068867_100018835 3300005459 Bacteria 4911
120 Ga0068867_100039779 3300005459 Bacteria 3430
121 Ga0068867_100076839 3300005459 Bacteria 2508
122 Ga0068867_100098355 3300005459 Bacteria 2231
123 Ga0068867_100284436 3300005459 Bacteria 1357
124 Ga0070685_10005017 3300005466 Bacteria 6705
125 Ga0070685_10236915 3300005466 Bacteria 1203
126 Ga0070698_100000282 3300005471 Bacteria 51827
127 Ga0070698_100002541 3300005471 Bacteria 20094
128 Ga0070698_100006847 3300005471 Bacteria 12348
129 Ga0070698_100151107 3300005471 Bacteria 2270
130 Ga0070679_100000908 3300005530 Bacteria 25669
131 Ga0070679_100002354 3300005530 Bacteria 17120
132 Ga0070679_100023183 3300005530 Bacteria 6075
133 Ga0070679_100094063 3300005530 Bacteria 2984
134 Ga0070679_100132523 3300005530 Bacteria 2473
135 Ga0070679_100221834 3300005530 Bacteria 1851
136 Ga0070684_100008818 3300005535 Bacteria 7905
137 Ga0070684_100023317 3300005535 Bacteria 5174
138 Ga0070684_100140304 3300005535 Bacteria 2185
139 Ga0068853_100001871 3300005539 Bacteria 15486
140 Ga0068853_100003897 3300005539 Bacteria 11438
141 Ga0068853_100004597 3300005539 Bacteria 10710
142 Ga0068853_100009821 3300005539 Bacteria 7723
143 Ga0068853_100015375 3300005539 Bacteria 6288
144 Ga0068853_100029290 3300005539 Bacteria 4639
145 Ga0068853_100041203 3300005539 Bacteria 3943
146 Ga0068853_100078345 3300005539 Bacteria 2888
147 Ga0068853_100087689 3300005539 Bacteria 2731
148 Ga0068853_100150799 3300005539 Bacteria 2093
149 Ga0068853_100170414 3300005539 Bacteria 1969
150 Ga0068853_100247288 3300005539 Unclassified 1636
151 Ga0070672_100008190 3300005543 Bacteria 7143
152 Ga0070672_100079570 3300005543 Bacteria 2624
153 Ga0070672_100119585 3300005543 Bacteria 2155
154 Ga0070672_100210328 3300005543 Bacteria 1629
155 Ga0070686_100001004 3300005544 Bacteria 16245
156 Ga0070686_100015742 3300005544 Bacteria 4388
157 Ga0070686_100072943 3300005544 Bacteria 2252
158 Ga0070693_100205551 3300005547 Bacteria 1282
159 Ga0070665_100000014 3300005548 Bacteria 484881
160 Ga0070665_100012136 3300005548 Bacteria 8689
161 Ga0068855_100000081 3300005563 Bacteria 115707
162 Ga0068855_100002548 3300005563 Bacteria 22452
163 Ga0068855_100013609 3300005563 Bacteria 9810
164 Ga0068855_100023253 3300005563 Bacteria 7424
165 Ga0068855_100024021 3300005563 Bacteria 7298
166 Ga0068855_100059131 3300005563 Bacteria 4486
167 Ga0068855_100062546 3300005563 Unclassified 4345
168 Ga0068855_100107987 3300005563 Bacteria 3197
169 Ga0068855_100198910 3300005563 Bacteria 2257
170 Ga0070664_100008601 3300005564 Bacteria 8259
171 Ga0070664_100027903 3300005564 Bacteria 4695
172 Ga0070664_100218228 3300005564 Unclassified 1706
173 Ga0070664_100226085 3300005564 Unclassified 1676
174 Ga0068857_100002654 3300005577 Bacteria 14675
175 Ga0068857_100038718 3300005577 Bacteria 4222
176 Ga0068857_100098455 3300005577 Bacteria 2623
177 Ga0068857_100174035 3300005577 Bacteria 1957
178 Ga0068854_100026545 3300005578 Bacteria 3982
179 Ga0068854_100046669 3300005578 Bacteria 3085
180 Ga0068854_100087630 3300005578 Bacteria 2310
181 Ga0068854_100094419 3300005578 Bacteria 2231
182 Ga0068854_100124907 3300005578 Bacteria 1958
183 Ga0068856_100024646 3300005614 Bacteria 5857
184 Ga0068856_100032149 3300005614 Bacteria 5137
185 Ga0068856_100054252 3300005614 Bacteria 3953
186 Ga0068856_100099043 3300005614 Bacteria 2906
187 Ga0068856_100178106 3300005614 Unclassified 2138
188 Ga0068852_100000900 3300005616 Bacteria 19686
189 Ga0068852_100003313 3300005616 Bacteria 11246
190 Ga0068852_100005128 3300005616 Bacteria 9334
191 Ga0068852_100020548 3300005616 Bacteria 5252
192 Ga0068852_100038926 3300005616 Bacteria 4000
193 Ga0068852_100043565 3300005616 Bacteria 3807
194 Ga0068852_100075342 3300005616 Bacteria 2976
195 Ga0068852_100090210 3300005616 Bacteria 2741
196 Ga0068852_100148892 3300005616 Bacteria 2175
197 Ga0068852_100156709 3300005616 Bacteria 2122
198 Ga0068852_100160219 3300005616 Bacteria 2100
199 Ga0068852_100229781 3300005616 Bacteria 1768
200 Ga0068852_100236699 3300005616 Unclassified 1743
201 Ga0068852_100486253 3300005616 Bacteria 1227
202 Ga0068859_100000018 3300005617 Bacteria 248813
203 Ga0068859_100000289 3300005617 Bacteria 49979
204 Ga0068859_100017809 3300005617 Bacteria 7141
205 Ga0068859_100086698 3300005617 Bacteria 3178
206 Ga0068859_100123833 3300005617 Bacteria 2653
207 Ga0068859_100226485 3300005617 Bacteria 1958
208 Ga0068859_100292465 3300005617 Bacteria 1722
209 Ga0068864_100002226 3300005618 Bacteria 16023
210 Ga0068864_100002659 3300005618 Bacteria 14761
211 Ga0068864_100026453 3300005618 Bacteria 4893
212 Ga0068864_100043128 3300005618 Bacteria 3862
213 Ga0068864_100088090 3300005618 Bacteria 2734
214 Ga0068864_100173896 3300005618 Bacteria 1965
215 Ga0068866_10014018 3300005718 Bacteria 3530
216 Ga0068866_10060672 3300005718 Bacteria 1962
217 Ga0068861_100001502 3300005719 Bacteria 14807
218 Ga0068861_100049553 3300005719 Bacteria 3181
219 Ga0068861_100146876 3300005719 Bacteria 1930
220 Ga0068851_10008435 3300005834 Bacteria 4762
221 Ga0068851_10041605 3300005834 Bacteria 2311
222 Ga0068851_10049634 3300005834 Bacteria 2129
223 Ga0068870_10002263 3300005840 Bacteria 7992
224 Ga0068870_10048875 3300005840 Bacteria 2229
225 Ga0068863_100004036 3300005841 Bacteria 14494
226 Ga0068863_100005189 3300005841 Bacteria 12849
227 Ga0068863_100026959 3300005841 Bacteria 5479
228 Ga0068863_100105425 3300005841 Bacteria 2682
229 Ga0068858_100013296 3300005842 Bacteria 7761
230 Ga0068860_100000024 3300005843 Bacteria 271902
231 Ga0068860_100001161 3300005843 Bacteria 28804
232 Ga0068860_100004223 3300005843 Bacteria 14727
233 Ga0068860_100008699 3300005843 Bacteria 10113
234 Ga0068860_100010496 3300005843 Bacteria 9156
235 Ga0068860_100032753 3300005843 Bacteria 4993
236 Ga0068860_100066223 3300005843 Bacteria 3431
237 Ga0068860_100097121 3300005843 Unclassified 2808
238 Ga0068860_100148099 3300005843 Bacteria 2260
239 Ga0068860_100253286 3300005843 Bacteria 1715
240 Ga0068860_100301772 3300005843 Bacteria 1569
241 Ga0068862_100011939 3300005844 Bacteria 7176
242 Ga0068862_100025468 3300005844 Bacteria 4967
243 Ga0068862_100027366 3300005844 Bacteria 4799
244 Ga0068862_100199458 3300005844 Unclassified 1804
245 Ga0081540_1020265 3300005983 Bacteria 4008
246 Ga0081539_10000402 3300005985 Bacteria 92866
247 Ga0075366_10002904 3300006195 Bacteria 8904
248 Ga0075366_10008292 3300006195 Bacteria 5772
249 Ga0097621_100005119 3300006237 Bacteria 9211
250 Ga0097621_100015237 3300006237 Bacteria 5779
251 Ga0097621_100086635 3300006237 Unclassified 2614
252 Ga0097621_100224467 3300006237 Bacteria 1638
253 Ga0097621_100377478 3300006237 Bacteria 1266
254 Ga0068871_100003481 3300006358 Bacteria 10814
255 Ga0068871_100029501 3300006358 Bacteria 4309
256 Ga0068871_100044243 3300006358 Bacteria 3579
257 Ga0068871_100100034 3300006358 Bacteria 2428
258 Ga0068871_100298801 3300006358 Bacteria 1413
259 Ga0068871_100305082 3300006358 Bacteria 1398
260 Ga0075428_100093975 3300006844 Bacteria 3269
261 Ga0075428_100152663 3300006844 Bacteria 2509
262 Ga0075430_100001793 3300006846 Bacteria 17561
263 Ga0075431_100055523 3300006847 Bacteria 4085
264 Ga0075434_100118073 3300006871 Bacteria 2666
265 Ga0075429_100000136 3300006880 Bacteria 44169
266 Ga0068865_100014717 3300006881 Bacteria 4977
267 Ga0068865_100052116 3300006881 Bacteria 2835
268 Ga0097620_100000018 3300006931 Bacteria 248813
269 Ga0097620_100000289 3300006931 Bacteria 49979
270 Ga0097620_100017809 3300006931 Bacteria 7141
271 Ga0097620_100086694 3300006931 Bacteria 3178
272 Ga0097620_100123837 3300006931 Bacteria 2653
273 Ga0097620_100226484 3300006931 Bacteria 1958
274 Ga0097620_100292450 3300006931 Bacteria 1722
275 Ga0105240_10000106 3300009093 Bacteria 171825
276 Ga0105240_10000606 3300009093 Bacteria 66467
277 Ga0105240_10002298 3300009093 Bacteria 30947
278 Ga0105240_10003660 3300009093 Bacteria 23789
279 Ga0105240_10006503 3300009093 Bacteria 17166
280 Ga0105240_10019918 3300009093 Bacteria 8960
281 Ga0105240_10055153 3300009093 Bacteria 4977
282 Ga0105240_10067774 3300009093 Bacteria 4423
283 Ga0105240_10085981 3300009093 Bacteria 3852
284 Ga0105240_10091296 3300009093 Bacteria 3721
285 Ga0105240_10368623 3300009093 Bacteria 1624
286 Ga0111539_10033061 3300009094 Bacteria 6280
287 Ga0111539_10033256 3300009094 Bacteria 6262
288 Ga0111539_10176061 3300009094 Bacteria 2499
289 Ga0111539_10279378 3300009094 Bacteria 1943
290 Ga0111539_10463430 3300009094 Bacteria 1476
291 Ga0105245_10052931 3300009098 Bacteria 3642
292 Ga0105245_10159481 3300009098 Bacteria 2139
293 Ga0105247_10001391 3300009101 Bacteria 17555
294 Ga0105247_10042996 3300009101 Bacteria 2768
295 Ga0105247_10165010 3300009101 Bacteria 1469
296 Ga0114129_10004956 3300009147 Bacteria 18775
297 Ga0114129_10007484 3300009147 Bacteria 15553
298 Ga0114129_10039792 3300009147 Bacteria 6631
299 Ga0105243_10461794 3300009148 Bacteria 1194
300 Ga0105241_10000590 3300009174 Bacteria 27344
301 Ga0105241_10001966 3300009174 Bacteria 15555
302 Ga0105241_10004142 3300009174 Bacteria 10702
303 Ga0105241_10013483 3300009174 Bacteria 5990
304 Ga0105241_10019697 3300009174 Bacteria 4979
305 Ga0105242_10002943 3300009176 Bacteria 13315
306 Ga0105242_10140077 3300009176 Bacteria 2098
307 Ga0105242_10246472 3300009176 Bacteria 1608
308 Ga0105237_10001093 3300009545 Bacteria 36314
309 Ga0105237_10003013 3300009545 Bacteria 20323
310 Ga0105237_10003222 3300009545 Bacteria 19554
311 Ga0105237_10003412 3300009545 Bacteria 18886
312 Ga0105237_10014210 3300009545 Bacteria 8336
313 Ga0105237_10015959 3300009545 Bacteria 7809
314 Ga0105237_10016066 3300009545 Bacteria 7784
315 Ga0105237_10190612 3300009545 Bacteria 2050
316 Ga0105237_10233270 3300009545 Bacteria 1841
317 Ga0105237_10244455 3300009545 Bacteria 1796
318 Ga0105238_10002205 3300009551 Bacteria 19643
319 Ga0105238_10080747 3300009551 Bacteria 3241
320 Ga0105249_10000635 3300009553 Bacteria 32011
321 Ga0105249_10001404 3300009553 Bacteria 21086
322 Ga0105249_10012962 3300009553 Bacteria 7357
323 Ga0105249_10044696 3300009553 Bacteria 4027
324 Ga0105249_10048465 3300009553 Bacteria 3873
325 Ga0105249_10298373 3300009553 Bacteria 1615
326 Ga0105249_10315997 3300009553 Bacteria 1572
327 Ga0105249_10339620 3300009553 Bacteria 1518
328 Ga0105249_10567068 3300009553 Bacteria 1187
329 Ga0105239_10000404 3300010375 Bacteria 63332
330 Ga0105239_10006093 3300010375 Bacteria 14040
331 Ga0105239_10006097 3300010375 Bacteria 14036
332 Ga0105239_10006227 3300010375 Bacteria 13883
333 Ga0105239_10015063 3300010375 Bacteria 8572
334 Ga0105239_10017847 3300010375 Bacteria 7848
335 Ga0105239_10225431 3300010375 Bacteria 2102
336 Ga0105239_10239255 3300010375 Bacteria 2037
337 Ga0105239_10677477 3300010375 Bacteria 1178
338 Ga0157373_10002753 3300013100 Bacteria 13315
339 Ga0157373_10012587 3300013100 Bacteria 6219
340 Ga0157373_10013999 3300013100 Bacteria 5880
341 Ga0157373_10044393 3300013100 Bacteria 3173
342 Ga0157373_10048356 3300013100 Unclassified 3033
343 Ga0157373_10076302 3300013100 Bacteria 2365
344 Ga0157371_10000518 3300013102 Bacteria 46197
345 Ga0157371_10000668 3300013102 Bacteria 40664
346 Ga0157371_10002698 3300013102 Bacteria 16766
347 Ga0157371_10002845 3300013102 Bacteria 16172
348 Ga0157371_10012494 3300013102 Bacteria 6489
349 Ga0157371_10012758 3300013102 Bacteria 6406
350 Ga0157371_10022192 3300013102 Bacteria 4654
351 Ga0157371_10036915 3300013102 Bacteria 3500
352 Ga0157371_10056930 3300013102 Bacteria 2772
353 Ga0157371_10168127 3300013102 Bacteria 1566
354 Ga0157370_10000408 3300013104 Bacteria 54355
355 Ga0157370_10001339 3300013104 Bacteria 30595
356 Ga0157370_10016291 3300013104 Bacteria 7532
357 Ga0157370_10055556 3300013104 Bacteria 3771
358 Ga0157370_10087246 3300013104 Bacteria 2931
359 Ga0157370_10141669 3300013104 Bacteria 2240
360 Ga0157370_10169686 3300013104 Unclassified 2029
361 Ga0157370_10356359 3300013104 Unclassified 1348
362 Ga0157369_10004046 3300013105 Bacteria 17375
363 Ga0157369_10027741 3300013105 Bacteria 6272
364 Ga0157369_10049589 3300013105 Bacteria 4551
365 Ga0157369_10052340 3300013105 Bacteria 4418
366 Ga0157369_10082517 3300013105 Bacteria 3439
367 Ga0157369_10131361 3300013105 Bacteria 2653
368 Ga0157369_10137179 3300013105 Bacteria 2589
369 Ga0157369_10163681 3300013105 Bacteria 2347
370 Ga0157369_10263946 3300013105 Bacteria 1795
371 Ga0157369_10353582 3300013105 Unclassified 1526
372 Ga0157374_10000027 3300013296 Bacteria 233444
373 Ga0157374_10001866 3300013296 Bacteria 17736
374 Ga0157374_10062246 3300013296 Bacteria 3497
375 Ga0157374_10091760 3300013296 Bacteria 2897
376 Ga0157374_10153558 3300013296 Bacteria 2240
377 Ga0157374_10262288 3300013296 Bacteria 1702
378 Ga0157378_10001243 3300013297 Bacteria 23019
379 Ga0157378_10006230 3300013297 Bacteria 10445
380 Ga0157378_10006792 3300013297 Bacteria 9981
381 Ga0157378_10015554 3300013297 Bacteria 6664
382 Ga0157378_10018115 3300013297 Bacteria 6184
383 Ga0157378_10032011 3300013297 Bacteria 4645
384 Ga0157378_10075180 3300013297 Bacteria 3041
385 Ga0157378_10158144 3300013297 Bacteria 2117
386 Ga0157378_10198855 3300013297 Bacteria 1895
387 Ga0163162_10000888 3300013306 Bacteria 27841
388 Ga0163162_10001107 3300013306 Bacteria 24993
389 Ga0163162_10002571 3300013306 Bacteria 17169
390 Ga0163162_10002830 3300013306 Bacteria 16503
391 Ga0163162_10023096 3300013306 Bacteria 6135
392 Ga0163162_10031725 3300013306 Bacteria 5242
393 Ga0163162_10077356 3300013306 Bacteria 3390
394 Ga0163162_10077963 3300013306 Bacteria 3378
395 Ga0163162_10292251 3300013306 Bacteria 1761
396 Ga0163162_10450680 3300013306 Bacteria 1419
397 Ga0157372_10000171 3300013307 Bacteria 71956
398 Ga0157372_10001188 3300013307 Bacteria 28174
399 Ga0157372_10002627 3300013307 Bacteria 19456
400 Ga0157372_10011662 3300013307 Bacteria 9356
401 Ga0157372_10013407 3300013307 Bacteria 8753
402 Ga0157372_10018986 3300013307 Bacteria 7399
403 Ga0157372_10026460 3300013307 Bacteria 6312
404 Ga0157372_10029218 3300013307 Bacteria 6018
405 Ga0157372_10034639 3300013307 Bacteria 5553
406 Ga0157372_10052938 3300013307 Bacteria 4522
407 Ga0157372_10061464 3300013307 Bacteria 4207
408 Ga0157372_10078140 3300013307 Bacteria 3739
409 Ga0157372_10098783 3300013307 Bacteria 3330
410 Ga0157372_10203342 3300013307 Unclassified 2295
411 Ga0157372_10406214 3300013307 Bacteria 1587
412 Ga0157372_10469987 3300013307 Bacteria 1466
413 Ga0157372_10646583 3300013307 Bacteria 1232
414 Ga0157375_10033658 3300013308 Bacteria 4872
415 Ga0157375_10057621 3300013308 Unclassified 3841
416 Ga0157375_10137864 3300013308 Bacteria 2565
417 Ga0157375_10202173 3300013308 Unclassified 2143
418 Ga0157375_10319002 3300013308 Unclassified 1718
419 Ga0157375_10356905 3300013308 Bacteria 1628
420 Ga0157375_10648474 3300013308 Bacteria 1212
421 Ga0163163_10000432 3300014325 Bacteria 38603
422 Ga0163163_10014374 3300014325 Bacteria 7277
423 Ga0163163_10107022 3300014325 Bacteria 2823
424 Ga0163163_10128193 3300014325 Bacteria 2576
425 Ga0163163_10253183 3300014325 Bacteria 1812
426 Ga0163163_10277075 3300014325 Bacteria 1729
427 Ga0157380_10146948 3300014326 Bacteria 2033
428 Ga0157380_10147135 3300014326 Bacteria 2031
429 Ga0157380_10455292 3300014326 Bacteria 1230
430 Ga0157379_10168865 3300014968 Bacteria 1975
431 Ga0157376_10000341 3300014969 Bacteria 31058
432 Ga0157376_10002166 3300014969 Bacteria 13231
433 Ga0157376_10060857 3300014969 Bacteria 3173
434 Ga0157376_10095786 3300014969 Bacteria 2582
435 Ga0157376_10113044 3300014969 Bacteria 2394
436 Ga0157376_10115471 3300014969 Bacteria 2370
437 Ga0157376_10150201 3300014969 Bacteria 2100
438 Ga0182005_1000097 3300015265 Bacteria 66720
439 Ga0163161_10210996 3300017792 Unclassified 1500
440 Ga0213876_10001574 3300021384 Bacteria 14029
441 Ga0213876_10066116 3300021384 Bacteria 1908
442 Ga0209436_100324 3300025208 Bacteria 21828
443 Ga0209258_100302 3300025242 Bacteria 79794
444 Ga0209646_1000004 3300025246 Bacteria 786587
445 Ga0209646_1001349 3300025246 Bacteria 6775
446 Ga0209026_1000095 3300025250 Bacteria 164309
447 Ga0209148_1000131 3300025254 Bacteria 174079
448 Ga0209129_1008612 3300025258 Bacteria 2814
449 Ga0209673_1000203 3300025273 Bacteria 119623
450 Ga0209130_1001297 3300025284 Bacteria 17208
451 Ga0209675_1026138 3300025291 Bacteria 1458
452 Ga0209564_1022859 3300025295 Bacteria 2192
453 Ga0209564_1022867 3300025295 Bacteria 2192
454 Ga0209758_1004975 3300025297 Bacteria 10628
455 Ga0209050_1000888 3300025298 Bacteria 39848
456 Ga0207426_1000024 3300025302 Bacteria 534075
457 Ga0207426_1000026 3300025302 Bacteria 515228
458 Ga0207426_1000313 3300025302 Bacteria 94934
459 Ga0207426_1000806 3300025302 Bacteria 33910
460 Ga0209257_1000070 3300025304 Bacteria 336454
461 Ga0209257_1002474 3300025304 Bacteria 18274
462 Ga0207656_10024838 3300025321 Bacteria 2428
463 Ga0207656_10062548 3300025321 Unclassified 1636
464 Ga0207642_10019137 3300025899 Bacteria 2645
465 Ga0207710_10000673 3300025900 Bacteria 19242
466 Ga0207710_10004125 3300025900 Bacteria 6380
467 Ga0207688_10002217 3300025901 Bacteria 10462
468 Ga0207688_10011466 3300025901 Bacteria 4826
469 Ga0207680_10000193 3300025903 Bacteria 29312
470 Ga0207680_10036735 3300025903 Bacteria 2823
471 Ga0207647_10000210 3300025904 Bacteria 47384
472 Ga0207647_10006574 3300025904 Bacteria 8445
473 Ga0207647_10044652 3300025904 Bacteria 2767
474 Ga0207647_10045343 3300025904 Bacteria 2744
475 Ga0207647_10128473 3300025904 Bacteria 1490
476 Ga0207645_10002084 3300025907 Bacteria 16005
477 Ga0207645_10012266 3300025907 Bacteria 5821
478 Ga0207645_10022290 3300025907 Bacteria 4122
479 Ga0207645_10040712 3300025907 Bacteria 2976
480 Ga0207645_10070775 3300025907 Bacteria 2232
481 Ga0207643_10005282 3300025908 Bacteria 6909
482 Ga0207705_10056135 3300025909 Bacteria 2839
483 Ga0207705_10084572 3300025909 Unclassified 2316
484 Ga0207654_10001980 3300025911 Bacteria 10581
485 Ga0207654_10017862 3300025911 Bacteria 3716
486 Ga0207707_10007370 3300025912 Bacteria 9582
487 Ga0207707_10013675 3300025912 Bacteria 7079
488 Ga0207707_10096103 3300025912 Unclassified 2589
489 Ga0207707_10126301 3300025912 Bacteria 2237
490 Ga0207695_10000087 3300025913 Bacteria 276412
491 Ga0207695_10000685 3300025913 Bacteria 66448
492 Ga0207695_10000917 3300025913 Bacteria 52754
493 Ga0207695_10001873 3300025913 Bacteria 32931
494 Ga0207695_10008256 3300025913 Bacteria 13070
495 Ga0207695_10028845 3300025913 Bacteria 6143
496 Ga0207695_10038240 3300025913 Bacteria 5169
497 Ga0207695_10088165 3300025913 Bacteria 3124
498 Ga0207695_10118885 3300025913 Bacteria 2613
499 Ga0207671_10000637 3300025914 Bacteria 45954
500 Ga0207671_10001799 3300025914 Bacteria 23966
501 Ga0207671_10002779 3300025914 Bacteria 18262
502 Ga0207671_10004496 3300025914 Bacteria 13275
503 Ga0207671_10007714 3300025914 Bacteria 9281
504 Ga0207671_10008078 3300025914 Bacteria 8989
505 Ga0207671_10011235 3300025914 Bacteria 7305
506 Ga0207671_10051595 3300025914 Bacteria 3048
507 Ga0207671_10053268 3300025914 Bacteria 2998
508 Ga0207671_10256304 3300025914 Bacteria 1376
509 Ga0207660_10035163 3300025917 Bacteria 3476
510 Ga0207660_10115889 3300025917 Unclassified 2023
511 Ga0207657_10003743 3300025919 Bacteria 16162
512 Ga0207657_10004066 3300025919 Bacteria 15521
513 Ga0207657_10013683 3300025919 Bacteria 7947
514 Ga0207657_10014890 3300025919 Bacteria 7566
515 Ga0207657_10050054 3300025919 Bacteria 3637
516 Ga0207657_10094958 3300025919 Bacteria 2482
517 Ga0207652_10000098 3300025921 Bacteria 94858
518 Ga0207652_10000771 3300025921 Bacteria 30684
519 Ga0207652_10007027 3300025921 Bacteria 9072
520 Ga0207652_10052600 3300025921 Bacteria 3496
521 Ga0207652_10070241 3300025921 Bacteria 3041
522 Ga0207652_10075289 3300025921 Bacteria 2941
523 Ga0207652_10138414 3300025921 Unclassified 2175
524 Ga0207652_10207612 3300025921 Bacteria 1763
525 Ga0207681_10010977 3300025923 Bacteria 5563
526 Ga0207681_10020930 3300025923 Bacteria 4151
527 Ga0207681_10034340 3300025923 Bacteria 3334
528 Ga0207681_10034444 3300025923 Bacteria 3330
529 Ga0207681_10046936 3300025923 Bacteria 2907
530 Ga0207694_10004594 3300025924 Bacteria 10748
531 Ga0207694_10259943 3300025924 Bacteria 1422
532 Ga0207650_10001513 3300025925 Bacteria 16609
533 Ga0207650_10047461 3300025925 Bacteria 3165
534 Ga0207650_10154590 3300025925 Bacteria 1813
535 Ga0207650_10169646 3300025925 Bacteria 1734
536 Ga0207659_10023695 3300025926 Bacteria 4101
537 Ga0207659_10268367 3300025926 Bacteria 1391
538 Ga0207644_10318802 3300025931 Bacteria 1256
539 Ga0207690_10010426 3300025932 Bacteria 5522
540 Ga0207690_10088374 3300025932 Bacteria 2183
541 Ga0207706_10017700 3300025933 Bacteria 6420
542 Ga0207706_10029724 3300025933 Bacteria 4877
543 Ga0207686_10000709 3300025934 Bacteria 20683
544 Ga0207686_10127732 3300025934 Bacteria 1740
545 Ga0207670_10039676 3300025936 Bacteria 3085
546 Ga0207669_10018579 3300025937 Bacteria 3598
547 Ga0207669_10054671 3300025937 Bacteria 2413
548 Ga0207669_10057781 3300025937 Bacteria 2364
549 Ga0207704_10006232 3300025938 Bacteria 5547
550 Ga0207704_10009596 3300025938 Bacteria 4677
551 Ga0207704_10084718 3300025938 Bacteria 2061
552 Ga0207691_10030097 3300025940 Bacteria 5075
553 Ga0207691_10045472 3300025940 Bacteria 4035
554 Ga0207691_10080271 3300025940 Bacteria 2934
555 Ga0207691_10080607 3300025940 Bacteria 2927
556 Ga0207689_10003649 3300025942 Bacteria 14045
557 Ga0207689_10007268 3300025942 Bacteria 9723
558 Ga0207689_10008486 3300025942 Bacteria 8952
559 Ga0207689_10031074 3300025942 Bacteria 4448
560 Ga0207689_10058060 3300025942 Bacteria 3183
561 Ga0207689_10149580 3300025942 Unclassified 1925
562 Ga0207679_10008949 3300025945 Bacteria 6396
563 Ga0207679_10039923 3300025945 Bacteria 3356
564 Ga0207679_10077262 3300025945 Bacteria 2532
565 Ga0207679_10141067 3300025945 Unclassified 1948
566 Ga0207667_10000172 3300025949 Bacteria 95455
567 Ga0207667_10000630 3300025949 Bacteria 45583
568 Ga0207667_10001836 3300025949 Bacteria 26673
569 Ga0207667_10008374 3300025949 Bacteria 12289
570 Ga0207667_10031326 3300025949 Bacteria 5742
571 Ga0207667_10055066 3300025949 Bacteria 4182
572 Ga0207667_10138798 3300025949 Bacteria 2503
573 Ga0207667_10230902 3300025949 Bacteria 1895
574 Ga0207651_10009901 3300025960 Bacteria 5248
575 Ga0207651_10017040 3300025960 Bacteria 4279
576 Ga0207651_10020151 3300025960 Bacteria 4018
577 Ga0207651_10207041 3300025960 Bacteria 1576
578 Ga0207712_10001470 3300025961 Bacteria 16071
579 Ga0207712_10002610 3300025961 Bacteria 11559
580 Ga0207712_10002895 3300025961 Bacteria 10971
581 Ga0207712_10007405 3300025961 Bacteria 6931
582 Ga0207712_10017162 3300025961 Bacteria 4697
583 Ga0207712_10239308 3300025961 Unclassified 1461
584 Ga0207668_10116964 3300025972 Unclassified 2011
585 Ga0207640_10070822 3300025981 Bacteria 2347
586 Ga0207640_10089746 3300025981 Bacteria 2125
587 Ga0207658_10004993 3300025986 Bacteria 9143
588 Ga0207658_10026815 3300025986 Bacteria 4044
589 Ga0207658_10031720 3300025986 Bacteria 3755
590 Ga0207658_10123177 3300025986 Bacteria 2071
591 Ga0207677_10000816 3300026023 Bacteria 17807
592 Ga0207677_10004544 3300026023 Bacteria 7462
593 Ga0207703_10015149 3300026035 Bacteria 6018
594 Ga0207639_10002886 3300026041 Bacteria 11551
595 Ga0207639_10018447 3300026041 Bacteria 4958
596 Ga0207639_10049666 3300026041 Bacteria 3182
597 Ga0207639_10052285 3300026041 Bacteria 3112
598 Ga0207639_10055557 3300026041 Bacteria 3031
599 Ga0207639_10074264 3300026041 Unclassified 2669
600 Ga0207639_10136311 3300026041 Bacteria 2039
601 Ga0207639_10226103 3300026041 Bacteria 1619
602 Ga0207678_10033889 3300026067 Unclassified 4448
603 Ga0207708_10020703 3300026075 Bacteria 4961
604 Ga0207702_10082483 3300026078 Bacteria 2796
605 Ga0207702_10085938 3300026078 Unclassified 2742
606 Ga0207702_10318199 3300026078 Bacteria 1481
607 Ga0207702_10396376 3300026078 Bacteria 1330
608 Ga0207641_10000015 3300026088 Bacteria 321332
609 Ga0207641_10128901 3300026088 Bacteria 2269
610 Ga0207641_10167509 3300026088 Bacteria 2002
611 Ga0207641_10204148 3300026088 Bacteria 1824
612 Ga0207648_10000384 3300026089 Bacteria 48937
613 Ga0207648_10010983 3300026089 Bacteria 8553
614 Ga0207648_10013448 3300026089 Bacteria 7615
615 Ga0207648_10039543 3300026089 Bacteria 4147
616 Ga0207648_10280134 3300026089 Bacteria 1491
617 Ga0207648_10331629 3300026089 Bacteria 1369
618 Ga0207676_10005777 3300026095 Bacteria 8750
619 Ga0207676_10008363 3300026095 Bacteria 7355
620 Ga0207676_10010736 3300026095 Bacteria 6530
621 Ga0207676_10025572 3300026095 Bacteria 4381
622 Ga0207676_10043389 3300026095 Bacteria 3462
623 Ga0207676_10076021 3300026095 Bacteria 2712
624 Ga0207674_10004626 3300026116 Bacteria 16516
625 Ga0207674_10033161 3300026116 Bacteria 5407
626 Ga0207674_10043007 3300026116 Bacteria 4660
627 Ga0207674_10080599 3300026116 Bacteria 3258
628 Ga0207674_10131836 3300026116 Unclassified 2462
629 Ga0207674_10152040 3300026116 Bacteria 2271
630 Ga0207674_10170701 3300026116 Bacteria 2128
631 Ga0207674_10483231 3300026116 Bacteria 1197
632 Ga0207675_100009007 3300026118 Bacteria 9365
633 Ga0207675_100012296 3300026118 Bacteria 7996
634 Ga0207675_100064596 3300026118 Bacteria 3421
635 Ga0207675_100155488 3300026118 Bacteria 2179
636 Ga0207675_100266074 3300026118 Unclassified 1663
637 Ga0207675_100270750 3300026118 Bacteria 1648
638 Ga0207683_10007595 3300026121 Bacteria 9286
639 Ga0207683_10109372 3300026121 Bacteria 2474
640 Ga0207698_10009978 3300026142 Bacteria 6078
641 Ga0207698_10018321 3300026142 Bacteria 4769
642 Ga0207698_10037614 3300026142 Bacteria 3566
643 Ga0207698_10051120 3300026142 Bacteria 3158
644 Ga0207698_10073059 3300026142 Bacteria 2729
645 Ga0207698_10080910 3300026142 Bacteria 2619
646 Ga0207698_10102320 3300026142 Bacteria 2377
647 Ga0207698_10160932 3300026142 Unclassified 1963
648 Ga0207698_10242148 3300026142 Bacteria 1645
649 Ga0207698_10297218 3300026142 Unclassified 1501
650 Ga0207698_10370944 3300026142 Unclassified 1358
651 Ga0207698_10439612 3300026142 Bacteria 1256
652 Ga0207698_10494465 3300026142 Bacteria 1189
653 Ga0207698_10511397 3300026142 Bacteria 1170
654 Ga0207428_10047103 3300027907 Bacteria 3463
655 Ga0268266_10000048 3300028379 Bacteria 310336
656 Ga0268266_10128363 3300028379 Unclassified 2265
657 Ga0268265_10009060 3300028380 Bacteria 6731
658 Ga0268264_10000028 3300028381 Bacteria 426662
659 Ga0268264_10001761 3300028381 Bacteria 19835
660 Ga0268264_10006760 3300028381 Bacteria 9638
661 Ga0268264_10009685 3300028381 Bacteria 7982
662 Ga0268264_10010034 3300028381 Bacteria 7841
663 Ga0268264_10028275 3300028381 Bacteria 4585
664 Ga0268264_10037291 3300028381 Bacteria 4007
665 Ga0268264_10075394 3300028381 Bacteria 2868
666 Ga0268264_10086516 3300028381 Bacteria 2693
667 Ga0268264_10276301 3300028381 Bacteria 1571
668 Ga0268264_10363318 3300028381 Bacteria 1381
669 Ga0307517_10004393 3300028786 Bacteria 21657
670 Ga0307517_10137171 3300028786 Bacteria 1735
671 Ga0307515_10000001 3300028794 Bacteria 4259510
672 Ga0307515_10000031 3300028794 Bacteria 358648
673 Ga0307511_10000002 3300030521 Bacteria 199923
674 Ga0265327_10000024 3300031251 Bacteria 382499
675 Ga0265327_10001248 3300031251 Bacteria 33913
676 Ga0265327_10075405 3300031251 Bacteria 1677
677 Ga0265313_10092838 3300031595 Bacteria 1351
678 Ga0307516_10000159 3300031730 Bacteria 84553
679 Ga0307516_10189430 3300031730 Bacteria 1784
680 Ga0307414_10046302 3300032004 Bacteria 2985
681 Ga0307414_10222252 3300032004 Unclassified 1551
682 Ga0316583_10005637 3300032133 Bacteria 4501
683 Ga0307510_10004925 3300033180 Bacteria 15802
684 Ga0373943_0010590 3300035170 Bacteria 4136
685 Ga0373955_0025009 3300035172 Bacteria 3061
686 Ga0373935_0056690 3300035692 Unclassified 2499
687 Ga0373927_0103964 3300035695 Bacteria 1849
688 Ga0373933_0036103 3300035724 Bacteria 2891
689 Ga0373937_0142441 3300036401 Unclassified 2243
690 Ga0316582_0072857 3300036647 Bacteria 2228
691 Ga0395899_0002500 3300037312 Bacteria 14918
692 Ga0395899_0044855 3300037312 Bacteria 3293
693 Ga0395899_0071908 3300037312 Bacteria 2531
694 Ga0395899_0146615 3300037312 Bacteria 1675
695 Ga0395900_0006705 3300037418 Bacteria 11964
696 Ga0395900_0016665 3300037418 Bacteria 7494
697 Ga0395900_0041142 3300037418 Bacteria 4765
698 Ga0395900_0169824 3300037418 Bacteria 2221
699 Ga0395900_0226618 3300037418 Bacteria 1881
700 Ga0395900_0325488 3300037418 Bacteria 1516
701 Ga0395898_0001101 3300037466 Bacteria 41709
702 Ga0395898_0010318 3300037466 Bacteria 9772
703 Ga0395898_0059676 3300037466 Bacteria 3710
704 Ga0395898_0091791 3300037466 Unclassified 2921
705 Ga0395905_0000340 3300037471 Bacteria 66412
706 Ga0395905_0003668 3300037471 Bacteria 16282
707 Ga0395905_0021187 3300037471 Bacteria 6152
708 Ga0395905_0095804 3300037471 Bacteria 2786
709 Ga0395901_0022528 3300038443 Bacteria 6457
710 Ga0395901_0022924 3300038443 Bacteria 6400
711 Ga0395901_0063597 3300038443 Bacteria 3840
712 Ga0395901_0341982 3300038443 Bacteria 1546
713 Ga0436365_0565109 3300039437 Bacteria 6714
714 Ga0436365_0850637 3300039437 Bacteria 2704
715 Ga0436365_1118032 3300039437 Bacteria 1503
716 Ga0436365_1249677 3300039437 Bacteria 17339
717 Ga0436365_1261027 3300039437 Bacteria 1957
718 Ga0439436_0002706 3300041404 Bacteria 5349
719 Ga0439439_0034645 3300041406 Bacteria 1295
720 Ga0451795_0780786 3300041456 Bacteria 1292
721 Ga0451795_0781871 3300041456 Bacteria 1586
722 Ga0451852_31448 3300041508 Unclassified 1567
723 Ga0439431_0002553 3300041997 Bacteria 4018
724 Ga0439433_0012360 3300041999 Bacteria 1871
725 Ga0439445_0007815 3300042004 Bacteria 2491
726 Ga0439448_0040628 3300042005 Bacteria 1503
727 Ga0439449_0002729 3300042007 Bacteria 6868
728 Ga0439449_0007774 3300042007 Bacteria 4071
729 Ga0439457_002111 3300042014 Bacteria 5781
730 Ga0439462_0004635 3300042015 Bacteria 3362
731 Ga0450923_000505 3300042125 Bacteria 4323
732 Ga0450897_000793 3300042128 Bacteria 1917
733 Ga0450898_001475 3300042134 Bacteria 3109
734 Ga0451577_0006113 3300042876 Bacteria 12094
735 Ga0451577_0119657 3300042876 Bacteria 2359
736 Ga0451577_0150514 3300042876 Bacteria 2094
737 Ga0451577_0352884 3300042876 Bacteria 1334
738 Ga0466969_0000127 3300044656 Bacteria 41196
739 Ga0466972_0000001 3300044658 Bacteria 412457
740 Ga0466972_0000080 3300044658 Bacteria 89226
741 Ga0466972_0020001 3300044658 Bacteria 3346
742 Ga0466972_0032921 3300044658 Bacteria 2543
743 Ga0466972_0046660 3300044658 Bacteria 2097
744 Ga0453683_0138195 3300044673 Unclassified 1537
745 Ga0466965_0148639 3300044683 Bacteria 1224
746 Ga0466966_0000120 3300044684 Bacteria 49271
747 Ga0453684_0002335 3300044712 Bacteria 46440
748 Ga0453684_0021550 3300044712 Bacteria 9621
749 Ga0453684_0026631 3300044712 Bacteria 8337
750 Ga0453684_0108162 3300044712 Bacteria 3384
751 Ga0453684_0147752 3300044712 Bacteria 2797
752 Ga0453684_0153958 3300044712 Bacteria 2728
753 Ga0453684_0231776 3300044712 Bacteria 2131
754 Ga0453684_0532170 3300044712 Bacteria 1297
755 Ga0466971_0015332 3300044719 Bacteria 3372
756 Ga0466968_0087464 3300044735 Bacteria 1376
757 Ga0466970_0003312 3300044765 Bacteria 7829
758 Ga0466957_0000380 3300044842 Bacteria 21740
759 Ga0466957_0022142 3300044842 Bacteria 3747
760 Ga0466957_0082602 3300044842 Bacteria 2003
761 Ga0466959_0000014 3300045049 Bacteria 150962
762 Ga0466959_0032834 3300045049 Bacteria 3842
763 Ga0466959_0034324 3300045049 Bacteria 3752
764 Ga0451576_0000002 3300045051 Bacteria 1670975
765 Ga0451576_0295748 3300045051 Bacteria 1693
766 Ga0451576_0299422 3300045051 Bacteria 1682
767 Ga0466958_0013285 3300045836 Bacteria 4685
768 Ga0495627_032001 3300046453 Bacteria 1657
769 Ga0495638_0036074 3300046460 Bacteria 3151
770 Ga0495638_0048927 3300046460 Bacteria 2645
771 Ga0495638_0084937 3300046460 Bacteria 1915
772 Ga0495653_0064121 3300046463 Bacteria 2769
773 Ga0495650_0031064 3300046471 Bacteria 2409
774 Ga0495580_0174334 3300046472 Unclassified 1486
775 Ga0495606_0005804 3300046507 Bacteria 11654
776 Ga0495618_0096219 3300046514 Unclassified 1894
777 Ga0495628_0027888 3300046516 Bacteria 4591
778 Ga0495643_0037388 3300046522 Bacteria 2663
779 Ga0495645_0128073 3300046543 Bacteria 1782
780 Ga0495633_0000125 3300046558 Bacteria 104459
781 Ga0495668_0000082 3300046616 Bacteria 154982
782 Ga0495634_0009802 3300046642 Bacteria 7051
783 Ga0495625_0081734 3300046660 Bacteria 2248
784 Ga0495670_0066473 3300046691 Unclassified 1819
785 Ga0495649_0033106 3300046694 Bacteria 2845
786 Ga0495672_0021009 3300047320 Unclassified 4265
787 Ga0495672_0043145 3300047320 Bacteria 2714
788 Ga0495687_000261 3300047443 Bacteria 71090
789 Ga0495684_0142488 3300047471 Bacteria 1797
790 Ga0495686_0000005 3300047472 Bacteria 827143
791 Ga0495686_0007643 3300047472 Bacteria 8070
792 Ga0495686_0056486 3300047472 Bacteria 2452
793 Ga0496121_0000081 3300048924 Bacteria 229506
794 Ga0496126_0042525 3300048929 Bacteria 4196
795 Ga0501298_002627 3300049521 Bacteria 2735
796 Ga0501032_0001909 3300049569 Bacteria 16464
797 Ga0501033_0225055 3300049570 Bacteria 1334
798 Ga0501034_0000004 3300049571 Bacteria 382255
799 Ga0501034_0007421 3300049571 Bacteria 11669
800 Ga0501034_0011664 3300049571 Bacteria 9096
801 Ga0501034_0024828 3300049571 Bacteria 6098
802 Ga0501034_0032084 3300049571 Bacteria 5336
803 Ga0501034_0054317 3300049571 Bacteria 4033
804 Ga0501034_0074752 3300049571 Bacteria 3396
805 Ga0501034_0123271 3300049571 Bacteria 2577
806 Ga0501036_0034595 3300049572 Bacteria 4274
807 Ga0501037_0018719 3300049573 Bacteria 5103
808 Ga0501037_0031925 3300049573 Bacteria 3888
809 Ga0501038_0030627 3300049574 Bacteria 4758
810 Ga0501039_0084825 3300049575 Bacteria 2467
811 Ga0501039_0166752 3300049575 Bacteria 1731
812 Ga0501043_0003893 3300049579 Bacteria 12252
813 Ga0501043_0068367 3300049579 Unclassified 2789
814 Ga0501043_0087841 3300049579 Bacteria 2443
815 Ga0501043_0152891 3300049579 Bacteria 1805
816 Ga0501046_0045392 3300049580 Bacteria 3492
817 Ga0501046_0056453 3300049580 Bacteria 3082
818 Ga0501047_0006704 3300049581 Bacteria 10826
819 Ga0501047_0006977 3300049581 Bacteria 10603
820 Ga0501047_0013596 3300049581 Bacteria 7720
821 Ga0501047_0082793 3300049581 Bacteria 3084
822 Ga0501047_0404324 3300049581 Bacteria 1198
823 Ga0501048_0006258 3300049582 Bacteria 9053
824 Ga0501067_0036099 3300049583 Bacteria 2745
825 Ga0501067_0150962 3300049583 Bacteria 1294
826 Ga0501068_0027869 3300049584 Bacteria 3338
827 Ga0501069_0074172 3300049585 Unclassified 1909
828 Ga0501070_0082958 3300049586 Bacteria 2653
829 Ga0501070_0148251 3300049586 Bacteria 1936
830 Ga0501070_0195039 3300049586 Bacteria 1663
831 Ga0501073_0006651 3300049589 Bacteria 8610
832 Ga0501073_0031419 3300049589 Bacteria 3789
833 Ga0501074_0002599 3300049590 Bacteria 12616
834 Ga0501201_000165 3300049651 Bacteria 5738
835 Ga0501202_006692 3300049652 Bacteria 2069
836 Ga0501217_006558 3300049661 Bacteria 2477
837 Ga0501223_001832 3300049663 Bacteria 4805
838 Ga0501224_001013 3300049664 Bacteria 3640
839 Ga0501233_005424 3300049668 Bacteria 2366
840 Ga0501235_001196 3300049669 Bacteria 5453
841 Ga0501257_009245 3300049686 Bacteria 2223
842 Ga0501257_023514 3300049686 Bacteria 1462
843 Ga0501261_004740 3300049690 Bacteria 1694
844 Ga0501219_000133 3300049703 Bacteria 13105
845 Ga0501221_002892 3300049704 Bacteria 2829
846 Ga0501225_0005194 3300049705 Bacteria 3833
847 Ga0501080_0030856 3300049742 Bacteria 4994
848 Ga0501080_0231967 3300049742 Bacteria 1687
849 Ga0501083_0015427 3300049744 Bacteria 5350
850 Ga0501083_0050834 3300049744 Bacteria 2788
851 Ga0501241_003764 3300049758 Bacteria 2858
852 Ga0501275_004810 3300049772 Bacteria 1279
853 Ga0501035_0002433 3300049822 Bacteria 18202
854 Ga0501035_0007289 3300049822 Bacteria 10349
855 Ga0501035_0101410 3300049822 Bacteria 2526
856 Ga0501035_0114099 3300049822 Bacteria 2366
857 Ga0501044_0013650 3300049823 Bacteria 8779
858 Ga0501044_0016689 3300049823 Bacteria 7884
859 Ga0501044_0021227 3300049823 Bacteria 6932
860 Ga0501044_0021518 3300049823 Bacteria 6878
861 Ga0501044_0100055 3300049823 Bacteria 2918
862 Ga0501044_0208382 3300049823 Bacteria 1910
863 Ga0501044_0294316 3300049823 Bacteria 1554
864 Ga0501284_00007 3300050005 Bacteria 147956
865 nmdc:mga0k408_40938_c1 3300050493 Bacteria 2667
866 nmdc:mga0k408_7554_c1 3300050493 Bacteria 5806
867 nmdc:mga07m45_63327_c1 3300050496 Bacteria 2097
868 nmdc:mga05p37_23584_c1 3300050507 Bacteria 7467
869 nmdc:mga05p37_525609_c1 3300050507 Bacteria 1352
870 nmdc:mga05p37_827_c1 3300050507 Bacteria 34726
871 nmdc:mga09592_3608_c1 3300050508 Bacteria 12484
872 nmdc:mga09592_5573_c1 3300050508 Bacteria 10252
873 nmdc:mga09592_97382_c1 3300050508 Bacteria 2518
874 nmdc:mga0qj67_145895_c1 3300050509 Bacteria 1919
875 nmdc:mga06r32_14340_c1 3300050510 Bacteria 7191
876 nmdc:mga06r32_48896_c1 3300050510 Bacteria 4044
877 nmdc:mga08y16_77511_c1 3300050511 Bacteria 3465
878 nmdc:mga0n895_83806_c1 3300050512 Bacteria 3180
879 Ga0500644_0000026 3300053088 Bacteria 93328
880 Ga0500644_0002655 3300053088 Bacteria 4465
881 Ga0500644_0022480 3300053088 Bacteria 1902
882 Ga0500646_0001794 3300053090 Bacteria 5655
883 Ga0500583_0000001 3300053092 Bacteria 241642
884 Ga0500583_0001510 3300053092 Bacteria 6700
885 Ga0500583_0002299 3300053092 Bacteria 5712
886 Ga0500583_0042259 3300053092 Bacteria 2076
887 Ga0500651_0044135 3300053093 Bacteria 2808
888 Ga0500562_000018 3300053108 Bacteria 126890
889 Ga0500569_000047 3300053109 Bacteria 22066
890 Ga0500607_046686 3300053121 Bacteria 2321
891 Ga0500652_033644 3300053131 Bacteria 2026
892 Ga0500658_0003491 3300053134 Bacteria 5931
893 Ga0500559_0002568 3300053136 Bacteria 9306
894 Ga0500568_0000142 3300053139 Bacteria 64049
895 Ga0500568_0003595 3300053139 Bacteria 8563
896 Ga0500577_0006329 3300053142 Bacteria 3257
897 Ga0500577_0045393 3300053142 Bacteria 1624
898 Ga0500589_014113 3300053147 Bacteria 3536
899 Ga0500616_0002235 3300053153 Bacteria 16549
900 Ga0500622_0000114 3300053156 Bacteria 83162
901 Ga0500622_0000692 3300053156 Bacteria 29667
902 Ga0500622_0005506 3300053156 Bacteria 7585
903 Ga0500622_0025494 3300053156 Bacteria 3124
904 Ga0500636_0030666 3300053177 Bacteria 3182
905 Ga0500611_000003 3300053727 Bacteria 333431
906 Ga0501084_0059210 3300054114 Bacteria 3205
907 Ga0500661_006998 3300055283 Bacteria 2093
908 Ga0501082_0225538 3300060353 Bacteria 1630

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100024630 Ga0070680_1000246302 324
2 3300005339 Ga0070660_100086771 Ga0070660_1000867712 324
3 3300005563 Ga0068855_100062546 Ga0068855_1000625463 324
4 3300025919 Ga0207657_10094958 Ga0207657_100949582 324
5 3300025949 Ga0207667_10000630 Ga0207667_1000063038 324
6 3300044658 Ga0466972_0046660 Ga0466972_0046660_1008_2063 324
7 3300005336 Ga0070680_100039686 Ga0070680_1000396862 328
8 3300013307 Ga0157372_10018986 Ga0157372_100189865 328
9 3300025904 Ga0207647_10045343 Ga0207647_100453432 328
10 3300025921 Ga0207652_10138414 Ga0207652_101384142 328
11 3300026116 Ga0207674_10043007 Ga0207674_100430074 328
12 3300049571 Ga0501034_0054317 Ga0501034_0054317_2679_3767 328
13 3300049822 Ga0501035_0114099 Ga0501035_0114099_455_1543 328
14 3300005339 Ga0070660_100000435 Ga0070660_10000043512 329
15 3300013102 Ga0157371_10002845 Ga0157371_100028451 329
16 3300013307 Ga0157372_10078140 Ga0157372_100781403 329
17 3300025919 Ga0207657_10004066 Ga0207657_100040661 329
18 3300005339 Ga0070660_100028232 Ga0070660_1000282323 330
19 3300005366 Ga0070659_100008871 Ga0070659_1000088715 330
20 3300005457 Ga0070662_100127996 Ga0070662_1001279962 330
21 3300005530 Ga0070679_100094063 Ga0070679_1000940633 330
22 3300005539 Ga0068853_100087689 Ga0068853_1000876893 330
23 3300005563 Ga0068855_100024021 Ga0068855_1000240215 330
24 3300013100 Ga0157373_10076302 Ga0157373_100763022 330
25 3300013102 Ga0157371_10036915 Ga0157371_100369152 330
26 3300013307 Ga0157372_10029218 Ga0157372_100292182 330
27 3300025912 Ga0207707_10126301 Ga0207707_101263012 330
28 3300025919 Ga0207657_10014890 Ga0207657_100148902 330
29 3300025921 Ga0207652_10007027 Ga0207652_100070274 330
30 3300025932 Ga0207690_10010426 Ga0207690_100104264 330
31 3300025949 Ga0207667_10055066 Ga0207667_100550662 330
32 3300026041 Ga0207639_10074264 Ga0207639_100742643 330
33 3300026116 Ga0207674_10152040 Ga0207674_101520402 330
34 3300037418 Ga0395900_0169824 Ga0395900_0169824_263_1351 330
35 3300041456 Ga0451795_0781871 Ga0451795_0781871_98_1270 330
36 3300053121 Ga0500607_046686 Ga0500607_046686_1041_2096 330
37 3300005577 Ga0068857_100174035 Ga0068857_1001740352 331
38 3300026095 Ga0207676_10043389 Ga0207676_100433893 331
39 3300049571 Ga0501034_0074752 Ga0501034_0074752_1940_3028 331
40 3300049586 Ga0501070_0148251 Ga0501070_0148251_640_1728 331
41 3300013307 Ga0157372_10001188 Ga0157372_100011885 332
42 3300005843 Ga0068860_100301772 Ga0068860_1003017722 333
43 3300005844 Ga0068862_100025468 Ga0068862_1000254682 333
44 3300014326 Ga0157380_10455292 Ga0157380_104552921 333
45 3300025907 Ga0207645_10022290 Ga0207645_100222901 333
46 3300025942 Ga0207689_10007268 Ga0207689_100072684 333
47 3300042876 Ga0451577_0150514 Ga0451577_0150514_530_1552 333
48 3300042876 Ga0451577_0352884 Ga0451577_0352884_34_1083 333
49 3300044712 Ga0453684_0002335 Ga0453684_0002335_8729_9784 333
50 3300044712 Ga0453684_0231776 Ga0453684_0231776_527_1549 333
51 3300045051 Ga0451576_0299422 Ga0451576_0299422_60_1082 333
52 3300046691 Ga0495670_0066473 Ga0495670_0066473_775_1797 333
53 3300041508 Ga0451852_31448 Ga0451852_31448_136_1194 334
54 3300042005 Ga0439448_0040628 Ga0439448_0040628_399_1454 335
55 3300045051 Ga0451576_0000002 Ga0451576_0000002_868246_869307 335
56 3300045049 Ga0466959_0032834 Ga0466959_0032834_1656_2747 336
57 3300041456 Ga0451795_0780786 Ga0451795_0780786_226_1269 337
58 3300005563 Ga0068855_100013609 Ga0068855_1000136093 338
59 3300009545 Ga0105237_10003013 Ga0105237_1000301312 338
60 3300010375 Ga0105239_10000404 Ga0105239_1000040448 338
61 3300025914 Ga0207671_10011235 Ga0207671_100112354 338
62 3300025949 Ga0207667_10138798 Ga0207667_101387983 338
63 3300005341 Ga0070691_10018185 Ga0070691_100181853 339
64 3300046453 Ga0495627_032001 Ga0495627_032001_140_1195 339
65 3300046558 Ga0495633_0000125 Ga0495633_0000125_65770_66825 339
66 3300049686 Ga0501257_023514 Ga0501257_023514_391_1446 339
67 3300053093 Ga0500651_0044135 Ga0500651_0044135_277_1332 339
68 3300005455 Ga0070663_100096476 Ga0070663_1000964762 340
69 3300005458 Ga0070681_10012536 Ga0070681_100125363 340
70 3300013105 Ga0157369_10049589 Ga0157369_100495895 340
71 3300025909 Ga0207705_10084572 Ga0207705_100845722 340
72 3300025912 Ga0207707_10096103 Ga0207707_100961032 340
73 3300025917 Ga0207660_10115889 Ga0207660_101158892 340
74 3300025921 Ga0207652_10000771 Ga0207652_1000077124 340
75 3300026067 Ga0207678_10033889 Ga0207678_100338892 340
76 3300037312 Ga0395899_0044855 Ga0395899_0044855_67_1149 340
77 3300037466 Ga0395898_0010318 Ga0395898_0010318_5297_6379 340
78 3300038443 Ga0395901_0022528 Ga0395901_0022528_5331_6413 340
79 iso_pu_bacteria 2738541278 2738725418 340
80 iso_pu_bacteria 2929239360 2929240123 340
81 3300003320 rootH2_10017798 rootH2_1001779810 341
82 3300005262 Ga0065165_1007410 Ga0065165_10074102 341
83 3300005618 Ga0068864_100088090 Ga0068864_1000880902 341
84 3300009553 Ga0105249_10567068 Ga0105249_105670681 341
85 3300013104 Ga0157370_10000408 Ga0157370_1000040824 341
86 3300013104 Ga0157370_10356359 Ga0157370_103563592 341
87 3300015265 Ga0182005_1000097 Ga0182005_100009740 341
88 3300053088 Ga0500644_0000026 Ga0500644_0000026_59571_60662 341
89 3300005353 Ga0070669_100042143 Ga0070669_1000421433 342
90 3300025242 Ga0209258_100302 Ga0209258_10030261 342
91 3300025254 Ga0209148_1000131 Ga0209148_100013120 342
92 3300025923 Ga0207681_10020930 Ga0207681_100209304 342
93 3300044842 Ga0466957_0022142 Ga0466957_0022142_1395_2486 342
94 3300046694 Ga0495649_0033106 Ga0495649_0033106_1234_2316 342
95 3300053092 Ga0500583_0002299 Ga0500583_0002299_2437_3528 342
96 3300053109 Ga0500569_000047 Ga0500569_000047_8579_9670 342
97 3300053134 Ga0500658_0003491 Ga0500658_0003491_3342_4433 342
98 3300053136 Ga0500559_0002568 Ga0500559_0002568_5515_6606 342
99 3300053142 Ga0500577_0006329 Ga0500577_0006329_959_2050 342
100 3300053153 Ga0500616_0002235 Ga0500616_0002235_10595_11686 342
101 3300005339 Ga0070660_100222396 Ga0070660_1002223961 343
102 3300005366 Ga0070659_100007146 Ga0070659_1000071464 343
103 3300005366 Ga0070659_100126170 Ga0070659_1001261702 343
104 3300005530 Ga0070679_100002354 Ga0070679_10000235411 343
105 3300005563 Ga0068855_100002548 Ga0068855_10000254823 343
106 3300005577 Ga0068857_100098455 Ga0068857_1000984552 343
107 3300013100 Ga0157373_10013999 Ga0157373_100139992 343
108 3300013100 Ga0157373_10048356 Ga0157373_100483562 343
109 3300013102 Ga0157371_10000668 Ga0157371_100006689 343
110 3300013104 Ga0157370_10001339 Ga0157370_1000133924 343
111 3300013104 Ga0157370_10141669 Ga0157370_101416692 343
112 3300025919 Ga0207657_10050054 Ga0207657_100500543 343
113 3300025921 Ga0207652_10000098 Ga0207652_1000009877 343
114 3300025949 Ga0207667_10031326 Ga0207667_100313262 343
115 3300026116 Ga0207674_10033161 Ga0207674_100331614 343
116 3300026142 Ga0207698_10297218 Ga0207698_102972182 343
117 3300037312 Ga0395899_0002500 Ga0395899_0002500_763_1845 343
118 3300037312 Ga0395899_0071908 Ga0395899_0071908_518_1600 343
119 3300037418 Ga0395900_0006705 Ga0395900_0006705_7246_8328 343
120 3300037418 Ga0395900_0016665 Ga0395900_0016665_2270_3352 343
121 3300037418 Ga0395900_0041142 Ga0395900_0041142_22_1104 343
122 3300037466 Ga0395898_0001101 Ga0395898_0001101_10982_12064 343
123 3300037466 Ga0395898_0091791 Ga0395898_0091791_964_2046 343
124 3300038443 Ga0395901_0022924 Ga0395901_0022924_3609_4691 343
125 3300002738 JGI25154J39366_1007774 JGI25154J39366_10077741 344
126 3300003316 rootH1_10013813 rootH1_100138136 344
127 3300003320 rootH2_10039673 rootH2_100396733 344
128 3300005289 Ga0065704_10094599 Ga0065704_100945992 344
129 3300005293 Ga0065715_10127934 Ga0065715_101279342 344
130 3300005329 Ga0070683_100167963 Ga0070683_1001679631 344
131 3300005335 Ga0070666_10057022 Ga0070666_100570221 344
132 3300005337 Ga0070682_100036209 Ga0070682_1000362092 344
133 3300005347 Ga0070668_100294488 Ga0070668_1002944882 344
134 3300005353 Ga0070669_100228034 Ga0070669_1002280342 344
135 3300005354 Ga0070675_100321286 Ga0070675_1003212862 344
136 3300005471 Ga0070698_100002541 Ga0070698_1000025415 344
137 3300005539 Ga0068853_100003897 Ga0068853_10000389713 344
138 3300005539 Ga0068853_100009821 Ga0068853_1000098212 344
139 3300005539 Ga0068853_100041203 Ga0068853_1000412033 344
140 3300005539 Ga0068853_100078345 Ga0068853_1000783453 344
141 3300005543 Ga0070672_100079570 Ga0070672_1000795702 344
142 3300005563 Ga0068855_100000081 Ga0068855_10000008155 344
143 3300005614 Ga0068856_100054252 Ga0068856_1000542523 344
144 3300005616 Ga0068852_100075342 Ga0068852_1000753422 344
145 3300005616 Ga0068852_100090210 Ga0068852_1000902102 344
146 3300005617 Ga0068859_100000289 Ga0068859_10000028929 344
147 3300005618 Ga0068864_100173896 Ga0068864_1001738962 344
148 3300005841 Ga0068863_100105425 Ga0068863_1001054253 344
149 3300005844 Ga0068862_100011939 Ga0068862_1000119393 344
150 3300006237 Ga0097621_100377478 Ga0097621_1003774782 344
151 3300006358 Ga0068871_100100034 Ga0068871_1001000341 344
152 3300006931 Ga0097620_100000289 Ga0097620_10000028922 344
153 3300009093 Ga0105240_10067774 Ga0105240_100677742 344
154 3300009093 Ga0105240_10085981 Ga0105240_100859814 344
155 3300009094 Ga0111539_10033061 Ga0111539_100330613 344
156 3300009094 Ga0111539_10033256 Ga0111539_100332565 344
157 3300009098 Ga0105245_10159481 Ga0105245_101594812 344
158 3300009147 Ga0114129_10007484 Ga0114129_1000748412 344
159 3300010375 Ga0105239_10677477 Ga0105239_106774771 344
160 3300013104 Ga0157370_10169686 Ga0157370_101696862 344
161 3300013297 Ga0157378_10001243 Ga0157378_1000124326 344
162 3300013307 Ga0157372_10052938 Ga0157372_100529382 344
163 3300014326 Ga0157380_10147135 Ga0157380_101471353 344
164 3300025246 Ga0209646_1001349 Ga0209646_10013497 344
165 3300025911 Ga0207654_10017862 Ga0207654_100178623 344
166 3300025913 Ga0207695_10000087 Ga0207695_10000087197 344
167 3300025925 Ga0207650_10169646 Ga0207650_101696461 344
168 3300025926 Ga0207659_10268367 Ga0207659_102683671 344
169 3300025949 Ga0207667_10000172 Ga0207667_1000017225 344
170 3300026041 Ga0207639_10002886 Ga0207639_100028869 344
171 3300026041 Ga0207639_10052285 Ga0207639_100522854 344
172 3300026041 Ga0207639_10226103 Ga0207639_102261032 344
173 3300026078 Ga0207702_10396376 Ga0207702_103963762 344
174 3300026088 Ga0207641_10204148 Ga0207641_102041482 344
175 3300026118 Ga0207675_100270750 Ga0207675_1002707502 344
176 3300026121 Ga0207683_10109372 Ga0207683_101093723 344
177 3300026142 Ga0207698_10018321 Ga0207698_100183213 344
178 3300026142 Ga0207698_10080910 Ga0207698_100809103 344
179 3300028381 Ga0268264_10363318 Ga0268264_103633182 344
180 3300030521 Ga0307511_10000002 Ga0307511_1000000221 344
181 3300031251 Ga0265327_10000024 Ga0265327_1000002492 344
182 3300031595 Ga0265313_10092838 Ga0265313_100928382 344
183 3300032004 Ga0307414_10222252 Ga0307414_102222522 344
184 3300035695 Ga0373927_0103964 Ga0373927_0103964_455_1510 344
185 3300041406 Ga0439439_0034645 Ga0439439_0034645_42_1097 344
186 3300042007 Ga0439449_0002729 Ga0439449_0002729_1289_2344 344
187 3300042128 Ga0450897_000793 Ga0450897_000793_749_1804 344
188 3300042876 Ga0451577_0006113 Ga0451577_0006113_1786_2841 344
189 3300044683 Ga0466965_0148639 Ga0466965_0148639_52_1107 344
190 3300044735 Ga0466968_0087464 Ga0466968_0087464_309_1364 344
191 3300046460 Ga0495638_0048927 Ga0495638_0048927_76_1131 344
192 3300046460 Ga0495638_0084937 Ga0495638_0084937_778_1833 344
193 3300046472 Ga0495580_0174334 Ga0495580_0174334_280_1335 344
194 3300046660 Ga0495625_0081734 Ga0495625_0081734_14_1069 344
195 3300047320 Ga0495672_0043145 Ga0495672_0043145_928_1983 344
196 3300047471 Ga0495684_0142488 Ga0495684_0142488_304_1359 344
197 3300047472 Ga0495686_0056486 Ga0495686_0056486_279_1334 344
198 3300049570 Ga0501033_0225055 Ga0501033_0225055_15_1070 344
199 3300049571 Ga0501034_0007421 Ga0501034_0007421_6716_7771 344
200 3300049573 Ga0501037_0018719 Ga0501037_0018719_820_1875 344
201 3300049579 Ga0501043_0068367 Ga0501043_0068367_1217_2272 344
202 3300049581 Ga0501047_0013596 Ga0501047_0013596_4952_6007 344
203 3300049581 Ga0501047_0404324 Ga0501047_0404324_38_1093 344
204 3300049652 Ga0501202_006692 Ga0501202_006692_430_1485 344
205 3300049822 Ga0501035_0007289 Ga0501035_0007289_4414_5469 344
206 3300049823 Ga0501044_0013650 Ga0501044_0013650_6205_7260 344
207 3300049823 Ga0501044_0021518 Ga0501044_0021518_5183_6238 344
208 3300049823 Ga0501044_0208382 Ga0501044_0208382_14_1069 344
209 3300050493 nmdc:mga0k408_7554_c1 nmdc:mga0k408_7554_c1_1281_2336 344
210 3300050507 nmdc:mga05p37_23584_c1 nmdc:mga05p37_23584_c1_3202_4257 344
211 3300050507 nmdc:mga05p37_827_c1 nmdc:mga05p37_827_c1_15684_16739 344
212 3300050508 nmdc:mga09592_3608_c1 nmdc:mga09592_3608_c1_11048_12103 344
213 3300050510 nmdc:mga06r32_14340_c1 nmdc:mga06r32_14340_c1_1767_2822 344
214 3300053092 Ga0500583_0001510 Ga0500583_0001510_880_1935 344
215 3300053139 Ga0500568_0000142 Ga0500568_0000142_18807_19862 344
216 3300053727 Ga0500611_000003 Ga0500611_000003_107717_108772 344
217 3300005543 Ga0070672_100210328 Ga0070672_1002103282 345
218 3300013296 Ga0157374_10000027 Ga0157374_1000002727 345
219 3300013307 Ga0157372_10000171 Ga0157372_100001712 345
220 3300014969 Ga0157376_10000341 Ga0157376_1000034113 345
221 3300025904 Ga0207647_10006574 Ga0207647_100065748 345
222 3300049651 Ga0501201_000165 Ga0501201_000165_4389_5480 345
223 3300049664 Ga0501224_001013 Ga0501224_001013_1652_2743 345
224 3300049668 Ga0501233_005424 Ga0501233_005424_97_1188 345
225 3300049669 Ga0501235_001196 Ga0501235_001196_91_1182 345
226 3300049690 Ga0501261_004740 Ga0501261_004740_226_1317 345
227 3300009094 Ga0111539_10279378 Ga0111539_102793782 346
228 3300025932 Ga0207690_10088374 Ga0207690_100883742 346
229 iso_pu_bacteria 2971410472 2971412383 346
230 3300001979 JGI24740J21852_10002379 JGI24740J21852_100023794 347
231 3300002738 JGI25154J39366_1000023 JGI25154J39366_100002391 347
232 3300003320 rootH2_10092694 rootH2_100926943 347
233 3300005289 Ga0065704_10088342 Ga0065704_100883423 347
234 3300005983 Ga0081540_1020265 Ga0081540_10202654 347
235 3300025246 Ga0209646_1000004 Ga0209646_1000004507 347
236 3300025250 Ga0209026_1000095 Ga0209026_1000095115 347
237 3300032133 Ga0316583_10005637 Ga0316583_100056372 347
238 3300036647 Ga0316582_0072857 Ga0316582_0072857_111_1184 347
239 3300037471 Ga0395905_0000340 Ga0395905_0000340_45748_46839 347
240 3300006844 Ga0075428_100152663 Ga0075428_1001526632 348
241 3300049521 Ga0501298_002627 Ga0501298_002627_240_1331 348
242 3300049663 Ga0501223_001832 Ga0501223_001832_3105_4196 348
243 3300049704 Ga0501221_002892 Ga0501221_002892_1515_2606 348
244 3300049705 Ga0501225_0005194 Ga0501225_0005194_2554_3645 348
245 3300003215 JGI25153J46596_10002509 JGI25153J46596_100025099 349
246 3300003354 JGI25160J50197_1003881 JGI25160J50197_10038814 349
247 3300025258 Ga0209129_1008612 Ga0209129_10086123 349
248 3300025297 Ga0209758_1004975 Ga0209758_10049756 349
249 3300025302 Ga0207426_1000313 Ga0207426_100031338 349
250 iso_pu_bacteria 2818991444 2819585832 349
251 iso_pu_bacteria 2914759650 2914762894 349
252 iso_pu_bacteria 2929154850 2929159414 349
253 3300001989 JGI24739J22299_10000062 JGI24739J22299_100000626 350
254 3300003320 rootH2_10007005 rootH2_100070051 350
255 3300003354 JGI25160J50197_1001239 JGI25160J50197_10012398 350
256 3300003790 Ga0055528_1001011 Ga0055528_10010112 350
257 3300003791 Ga0055530_10000880 Ga0055530_1000088016 350
258 3300003794 Ga0055531_10013120 Ga0055531_100131204 350
259 3300005262 Ga0065165_1000027 Ga0065165_1000027124 350
260 3300025273 Ga0209673_1000203 Ga0209673_100020316 350
261 3300025291 Ga0209675_1026138 Ga0209675_10261382 350
262 3300025295 Ga0209564_1022867 Ga0209564_10228672 350
263 3300025298 Ga0209050_1000888 Ga0209050_100088814 350
264 3300025302 Ga0207426_1000806 Ga0207426_100080627 350
265 3300025304 Ga0209257_1002474 Ga0209257_10024748 350
266 3300044712 Ga0453684_0021550 Ga0453684_0021550_4188_5282 350
267 3300049581 Ga0501047_0006704 Ga0501047_0006704_6036_7127 350
268 3300003320 rootH2_10135544 rootH2_101355443 351
269 3300003323 rootH1_10044529 rootH1_100445295 351
270 3300005616 Ga0068852_100148892 Ga0068852_1001488922 351
271 3300013105 Ga0157369_10137179 Ga0157369_101371792 351
272 3300013307 Ga0157372_10013407 Ga0157372_100134073 351
273 3300025921 Ga0207652_10052600 Ga0207652_100526002 351
274 3300026116 Ga0207674_10170701 Ga0207674_101707012 351
275 3300026142 Ga0207698_10051120 Ga0207698_100511202 351
276 3300039437 Ga0436365_1261027 Ga0436365_1261027_704_1789 351
277 3300053131 Ga0500652_033644 Ga0500652_033644_383_1474 351
278 3300002987 JGI25159J45721_1009609 JGI25159J45721_10096092 352
279 3300003322 rootL2_10023331 rootL2_100233312 352
280 3300003322 rootL2_10027551 rootL2_100275515 352
281 3300003322 rootL2_10082800 rootL2_100828003 352
282 3300005328 Ga0070676_10145117 Ga0070676_101451171 352
283 3300005329 Ga0070683_100011019 Ga0070683_1000110198 352
284 3300005337 Ga0070682_100081306 Ga0070682_1000813062 352
285 3300005339 Ga0070660_100007671 Ga0070660_1000076716 352
286 3300005344 Ga0070661_100046932 Ga0070661_1000469322 352
287 3300005355 Ga0070671_100079539 Ga0070671_1000795393 352
288 3300005364 Ga0070673_100032786 Ga0070673_1000327862 352
289 3300005455 Ga0070663_100290238 Ga0070663_1002902381 352
290 3300005457 Ga0070662_100139466 Ga0070662_1001394662 352
291 3300005530 Ga0070679_100221834 Ga0070679_1002218341 352
292 3300005535 Ga0070684_100008818 Ga0070684_1000088183 352
293 3300005539 Ga0068853_100004597 Ga0068853_1000045975 352
294 3300005577 Ga0068857_100038718 Ga0068857_1000387182 352
295 3300005578 Ga0068854_100026545 Ga0068854_1000265452 352
296 3300005614 Ga0068856_100032149 Ga0068856_1000321495 352
297 3300005616 Ga0068852_100020548 Ga0068852_1000205483 352
298 3300005834 Ga0068851_10041605 Ga0068851_100416052 352
299 3300005985 Ga0081539_10000402 Ga0081539_1000040262 352
300 3300006237 Ga0097621_100015237 Ga0097621_1000152373 352
301 3300006358 Ga0068871_100003481 Ga0068871_10000348111 352
302 3300009148 Ga0105243_10461794 Ga0105243_104617941 352
303 3300013100 Ga0157373_10012587 Ga0157373_100125873 352
304 3300013102 Ga0157371_10022192 Ga0157371_100221923 352
305 3300013105 Ga0157369_10027741 Ga0157369_100277413 352
306 3300013296 Ga0157374_10001866 Ga0157374_100018668 352
307 3300013297 Ga0157378_10006230 Ga0157378_100062308 352
308 3300013307 Ga0157372_10061464 Ga0157372_100614641 352
309 3300013307 Ga0157372_10469987 Ga0157372_104699871 352
310 3300025208 Ga0209436_100324 Ga0209436_10032417 352
311 3300025284 Ga0209130_1001297 Ga0209130_100129714 352
312 3300025302 Ga0207426_1000024 Ga0207426_100002412 352
313 3300025904 Ga0207647_10128473 Ga0207647_101284732 352
314 3300025919 Ga0207657_10003743 Ga0207657_100037437 352
315 3300025921 Ga0207652_10207612 Ga0207652_102076121 352
316 3300025926 Ga0207659_10023695 Ga0207659_100236952 352
317 3300025933 Ga0207706_10029724 Ga0207706_100297242 352
318 3300025945 Ga0207679_10008949 Ga0207679_100089495 352
319 3300025981 Ga0207640_10070822 Ga0207640_100708222 352
320 3300026041 Ga0207639_10049666 Ga0207639_100496662 352
321 3300026116 Ga0207674_10080599 Ga0207674_100805993 352
322 3300038443 Ga0395901_0341982 Ga0395901_0341982_62_1141 352
323 3300044658 Ga0466972_0020001 Ga0466972_0020001_2130_3212 352
324 3300048929 Ga0496126_0042525 Ga0496126_0042525_517_1608 352
325 3300053156 Ga0500622_0000692 Ga0500622_0000692_26379_27470 352
326 iso_pu_bacteria 2818991442 2819574921 352
327 iso_pu_bacteria 2818991460 2819676869 352
328 iso_pu_bacteria 2821136567 2821141022 352
329 iso_pu_bacteria 2840677318 2840678820 352
330 iso_pu_bacteria 2883068021 2883069148 352
331 iso_pu_bacteria 2884791551 2884796723 352
332 iso_pu_bacteria 2896085136 2896086638 352
333 iso_pu_bacteria 2896109856 2896113057 352
334 iso_pu_bacteria 2904467357 2904471522 352
335 iso_pu_bacteria 2929177148 2929177759 352
336 iso_pu_bacteria 2945977869 2945980106 352
337 iso_pu_bacteria 2946013367 2946014032 352
338 3300002077 JGI24744J21845_10003674 JGI24744J21845_100036742 353
339 3300003215 JGI25153J46596_10023575 JGI25153J46596_100235752 353
340 3300003316 rootH1_10166897 rootH1_101668972 353
341 3300003322 rootL2_10038898 rootL2_100388983 353
342 3300003322 rootL2_10062550 rootL2_100625503 353
343 3300003322 rootL2_10075820 rootL2_100758203 353
344 3300003323 rootH1_10175021 rootH1_101750213 353
345 3300003794 Ga0055531_10000054 Ga0055531_1000005478 353
346 3300005327 Ga0070658_10063181 Ga0070658_100631813 353
347 3300005328 Ga0070676_10010918 Ga0070676_100109182 353
348 3300005328 Ga0070676_10083899 Ga0070676_100838991 353
349 3300005331 Ga0070670_100026886 Ga0070670_1000268862 353
350 3300005331 Ga0070670_100082020 Ga0070670_1000820202 353
351 3300005331 Ga0070670_100304256 Ga0070670_1003042561 353
352 3300005334 Ga0068869_100004838 Ga0068869_1000048389 353
353 3300005334 Ga0068869_100009710 Ga0068869_1000097105 353
354 3300005334 Ga0068869_100017987 Ga0068869_1000179872 353
355 3300005334 Ga0068869_100089615 Ga0068869_1000896152 353
356 3300005334 Ga0068869_100244713 Ga0068869_1002447132 353
357 3300005335 Ga0070666_10000112 Ga0070666_100001129 353
358 3300005335 Ga0070666_10015901 Ga0070666_100159014 353
359 3300005338 Ga0068868_100001123 Ga0068868_1000011233 353
360 3300005338 Ga0068868_100008985 Ga0068868_1000089854 353
361 3300005338 Ga0068868_100030169 Ga0068868_1000301692 353
362 3300005338 Ga0068868_100045803 Ga0068868_1000458033 353
363 3300005339 Ga0070660_100006706 Ga0070660_1000067062 353
364 3300005340 Ga0070689_100098025 Ga0070689_1000980252 353
365 3300005340 Ga0070689_100123580 Ga0070689_1001235802 353
366 3300005347 Ga0070668_100063236 Ga0070668_1000632362 353
367 3300005353 Ga0070669_100006429 Ga0070669_1000064296 353
368 3300005353 Ga0070669_100014257 Ga0070669_1000142576 353
369 3300005354 Ga0070675_100226650 Ga0070675_1002266502 353
370 3300005356 Ga0070674_100034018 Ga0070674_1000340182 353
371 3300005356 Ga0070674_100077838 Ga0070674_1000778382 353
372 3300005364 Ga0070673_100022084 Ga0070673_1000220845 353
373 3300005364 Ga0070673_100112954 Ga0070673_1001129542 353
374 3300005364 Ga0070673_100420777 Ga0070673_1004207771 353
375 3300005367 Ga0070667_100008519 Ga0070667_1000085199 353
376 3300005367 Ga0070667_100017599 Ga0070667_1000175992 353
377 3300005367 Ga0070667_100050896 Ga0070667_1000508961 353
378 3300005367 Ga0070667_100059753 Ga0070667_1000597532 353
379 3300005367 Ga0070667_100114046 Ga0070667_1001140462 353
380 3300005367 Ga0070667_100157773 Ga0070667_1001577731 353
381 3300005367 Ga0070667_100413693 Ga0070667_1004136931 353
382 3300005456 Ga0070678_100011344 Ga0070678_1000113442 353
383 3300005456 Ga0070678_100081222 Ga0070678_1000812222 353
384 3300005457 Ga0070662_100046050 Ga0070662_1000460502 353
385 3300005458 Ga0070681_10037752 Ga0070681_100377523 353
386 3300005459 Ga0068867_100018835 Ga0068867_1000188356 353
387 3300005459 Ga0068867_100039779 Ga0068867_1000397792 353
388 3300005459 Ga0068867_100076839 Ga0068867_1000768392 353
389 3300005459 Ga0068867_100098355 Ga0068867_1000983552 353
390 3300005459 Ga0068867_100284436 Ga0068867_1002844361 353
391 3300005466 Ga0070685_10236915 Ga0070685_102369151 353
392 3300005471 Ga0070698_100151107 Ga0070698_1001511072 353
393 3300005530 Ga0070679_100000908 Ga0070679_1000009082 353
394 3300005530 Ga0070679_100023183 Ga0070679_1000231836 353
395 3300005530 Ga0070679_100132523 Ga0070679_1001325231 353
396 3300005535 Ga0070684_100023317 Ga0070684_1000233172 353
397 3300005539 Ga0068853_100001871 Ga0068853_1000018716 353
398 3300005539 Ga0068853_100015375 Ga0068853_1000153752 353
399 3300005539 Ga0068853_100029290 Ga0068853_1000292902 353
400 3300005539 Ga0068853_100150799 Ga0068853_1001507992 353
401 3300005539 Ga0068853_100170414 Ga0068853_1001704141 353
402 3300005539 Ga0068853_100247288 Ga0068853_1002472882 353
403 3300005543 Ga0070672_100008190 Ga0070672_1000081906 353
404 3300005543 Ga0070672_100119585 Ga0070672_1001195852 353
405 3300005544 Ga0070686_100001004 Ga0070686_10000100418 353
406 3300005544 Ga0070686_100015742 Ga0070686_1000157423 353
407 3300005547 Ga0070693_100205551 Ga0070693_1002055511 353
408 3300005548 Ga0070665_100000014 Ga0070665_10000001429 353
409 3300005548 Ga0070665_100012136 Ga0070665_1000121368 353
410 3300005563 Ga0068855_100023253 Ga0068855_1000232533 353
411 3300005563 Ga0068855_100059131 Ga0068855_1000591314 353
412 3300005563 Ga0068855_100107987 Ga0068855_1001079872 353
413 3300005563 Ga0068855_100198910 Ga0068855_1001989102 353
414 3300005564 Ga0070664_100027903 Ga0070664_1000279033 353
415 3300005564 Ga0070664_100226085 Ga0070664_1002260852 353
416 3300005577 Ga0068857_100002654 Ga0068857_1000026548 353
417 3300005578 Ga0068854_100046669 Ga0068854_1000466692 353
418 3300005578 Ga0068854_100087630 Ga0068854_1000876303 353
419 3300005578 Ga0068854_100094419 Ga0068854_1000944193 353
420 3300005578 Ga0068854_100124907 Ga0068854_1001249072 353
421 3300005614 Ga0068856_100024646 Ga0068856_1000246463 353
422 3300005614 Ga0068856_100099043 Ga0068856_1000990433 353
423 3300005614 Ga0068856_100178106 Ga0068856_1001781062 353
424 3300005616 Ga0068852_100000900 Ga0068852_1000009002 353
425 3300005616 Ga0068852_100005128 Ga0068852_1000051284 353
426 3300005616 Ga0068852_100043565 Ga0068852_1000435653 353
427 3300005616 Ga0068852_100156709 Ga0068852_1001567091 353
428 3300005616 Ga0068852_100229781 Ga0068852_1002297812 353
429 3300005616 Ga0068852_100236699 Ga0068852_1002366992 353
430 3300005616 Ga0068852_100486253 Ga0068852_1004862531 353
431 3300005617 Ga0068859_100000018 Ga0068859_10000001857 353
432 3300005617 Ga0068859_100086698 Ga0068859_1000866982 353
433 3300005617 Ga0068859_100123833 Ga0068859_1001238332 353
434 3300005617 Ga0068859_100226485 Ga0068859_1002264852 353
435 3300005617 Ga0068859_100292465 Ga0068859_1002924652 353
436 3300005618 Ga0068864_100002226 Ga0068864_10000222611 353
437 3300005618 Ga0068864_100002659 Ga0068864_1000026598 353
438 3300005618 Ga0068864_100026453 Ga0068864_1000264532 353
439 3300005618 Ga0068864_100043128 Ga0068864_1000431285 353
440 3300005718 Ga0068866_10014018 Ga0068866_100140183 353
441 3300005718 Ga0068866_10060672 Ga0068866_100606722 353
442 3300005719 Ga0068861_100049553 Ga0068861_1000495533 353
443 3300005834 Ga0068851_10049634 Ga0068851_100496341 353
444 3300005840 Ga0068870_10002263 Ga0068870_100022633 353
445 3300005840 Ga0068870_10048875 Ga0068870_100488752 353
446 3300005841 Ga0068863_100004036 Ga0068863_1000040362 353
447 3300005841 Ga0068863_100005189 Ga0068863_10000518914 353
448 3300005841 Ga0068863_100026959 Ga0068863_1000269595 353
449 3300005842 Ga0068858_100013296 Ga0068858_1000132962 353
450 3300005843 Ga0068860_100000024 Ga0068860_10000002482 353
451 3300005843 Ga0068860_100001161 Ga0068860_10000116121 353
452 3300005843 Ga0068860_100004223 Ga0068860_1000042239 353
453 3300005843 Ga0068860_100010496 Ga0068860_10001049610 353
454 3300005843 Ga0068860_100032753 Ga0068860_1000327533 353
455 3300005843 Ga0068860_100066223 Ga0068860_1000662233 353
456 3300005843 Ga0068860_100097121 Ga0068860_1000971213 353
457 3300005843 Ga0068860_100148099 Ga0068860_1001480992 353
458 3300005843 Ga0068860_100253286 Ga0068860_1002532862 353
459 3300005844 Ga0068862_100027366 Ga0068862_1000273665 353
460 3300005844 Ga0068862_100199458 Ga0068862_1001994582 353
461 3300006195 Ga0075366_10002904 Ga0075366_100029042 353
462 3300006195 Ga0075366_10008292 Ga0075366_100082923 353
463 3300006237 Ga0097621_100005119 Ga0097621_1000051198 353
464 3300006237 Ga0097621_100086635 Ga0097621_1000866352 353
465 3300006237 Ga0097621_100224467 Ga0097621_1002244671 353
466 3300006358 Ga0068871_100029501 Ga0068871_1000295014 353
467 3300006358 Ga0068871_100044243 Ga0068871_1000442432 353
468 3300006358 Ga0068871_100298801 Ga0068871_1002988011 353
469 3300006871 Ga0075434_100118073 Ga0075434_1001180733 353
470 3300006881 Ga0068865_100014717 Ga0068865_1000147175 353
471 3300006881 Ga0068865_100052116 Ga0068865_1000521162 353
472 3300006931 Ga0097620_100000018 Ga0097620_10000001857 353
473 3300006931 Ga0097620_100086694 Ga0097620_1000866944 353
474 3300006931 Ga0097620_100123837 Ga0097620_1001238372 353
475 3300006931 Ga0097620_100226484 Ga0097620_1002264842 353
476 3300006931 Ga0097620_100292450 Ga0097620_1002924502 353
477 3300009093 Ga0105240_10000106 Ga0105240_100001069 353
478 3300009093 Ga0105240_10000606 Ga0105240_1000060643 353
479 3300009093 Ga0105240_10002298 Ga0105240_1000229821 353
480 3300009093 Ga0105240_10003660 Ga0105240_100036602 353
481 3300009093 Ga0105240_10006503 Ga0105240_100065037 353
482 3300009093 Ga0105240_10019918 Ga0105240_100199185 353
483 3300009093 Ga0105240_10055153 Ga0105240_100551532 353
484 3300009093 Ga0105240_10091296 Ga0105240_100912962 353
485 3300009093 Ga0105240_10368623 Ga0105240_103686232 353
486 3300009094 Ga0111539_10463430 Ga0111539_104634302 353
487 3300009098 Ga0105245_10052931 Ga0105245_100529312 353
488 3300009101 Ga0105247_10001391 Ga0105247_1000139111 353
489 3300009101 Ga0105247_10042996 Ga0105247_100429962 353
490 3300009101 Ga0105247_10165010 Ga0105247_101650102 353
491 3300009147 Ga0114129_10004956 Ga0114129_100049567 353
492 3300009174 Ga0105241_10000590 Ga0105241_1000059017 353
493 3300009174 Ga0105241_10001966 Ga0105241_1000196612 353
494 3300009174 Ga0105241_10004142 Ga0105241_100041428 353
495 3300009174 Ga0105241_10013483 Ga0105241_100134832 353
496 3300009174 Ga0105241_10019697 Ga0105241_100196974 353
497 3300009545 Ga0105237_10001093 Ga0105237_100010935 353
498 3300009545 Ga0105237_10003222 Ga0105237_100032225 353
499 3300009545 Ga0105237_10003412 Ga0105237_1000341220 353
500 3300009545 Ga0105237_10014210 Ga0105237_100142106 353
501 3300009545 Ga0105237_10015959 Ga0105237_100159593 353
502 3300009545 Ga0105237_10016066 Ga0105237_100160665 353
503 3300009545 Ga0105237_10190612 Ga0105237_101906122 353
504 3300009545 Ga0105237_10233270 Ga0105237_102332702 353
505 3300009545 Ga0105237_10244455 Ga0105237_102444551 353
506 3300009551 Ga0105238_10002205 Ga0105238_1000220513 353
507 3300009551 Ga0105238_10080747 Ga0105238_100807473 353
508 3300009553 Ga0105249_10000635 Ga0105249_100006358 353
509 3300009553 Ga0105249_10001404 Ga0105249_100014044 353
510 3300009553 Ga0105249_10048465 Ga0105249_100484652 353
511 3300009553 Ga0105249_10315997 Ga0105249_103159971 353
512 3300009553 Ga0105249_10339620 Ga0105249_103396202 353
513 3300010375 Ga0105239_10006093 Ga0105239_100060933 353
514 3300010375 Ga0105239_10006097 Ga0105239_100060979 353
515 3300010375 Ga0105239_10006227 Ga0105239_100062279 353
516 3300010375 Ga0105239_10015063 Ga0105239_100150633 353
517 3300010375 Ga0105239_10017847 Ga0105239_100178477 353
518 3300010375 Ga0105239_10225431 Ga0105239_102254313 353
519 3300010375 Ga0105239_10239255 Ga0105239_102392552 353
520 3300013100 Ga0157373_10002753 Ga0157373_1000275311 353
521 3300013100 Ga0157373_10044393 Ga0157373_100443932 353
522 3300013102 Ga0157371_10002698 Ga0157371_1000269811 353
523 3300013102 Ga0157371_10012758 Ga0157371_100127585 353
524 3300013104 Ga0157370_10016291 Ga0157370_100162914 353
525 3300013104 Ga0157370_10055556 Ga0157370_100555561 353
526 3300013105 Ga0157369_10004046 Ga0157369_100040465 353
527 3300013105 Ga0157369_10052340 Ga0157369_100523405 353
528 3300013105 Ga0157369_10082517 Ga0157369_100825172 353
529 3300013105 Ga0157369_10163681 Ga0157369_101636812 353
530 3300013105 Ga0157369_10263946 Ga0157369_102639462 353
531 3300013296 Ga0157374_10091760 Ga0157374_100917603 353
532 3300013296 Ga0157374_10262288 Ga0157374_102622881 353
533 3300013297 Ga0157378_10006792 Ga0157378_100067923 353
534 3300013297 Ga0157378_10015554 Ga0157378_100155546 353
535 3300013297 Ga0157378_10018115 Ga0157378_100181154 353
536 3300013297 Ga0157378_10032011 Ga0157378_100320112 353
537 3300013297 Ga0157378_10075180 Ga0157378_100751802 353
538 3300013297 Ga0157378_10158144 Ga0157378_101581442 353
539 3300013297 Ga0157378_10198855 Ga0157378_101988552 353
540 3300013306 Ga0163162_10000888 Ga0163162_100008888 353
541 3300013306 Ga0163162_10001107 Ga0163162_1000110712 353
542 3300013306 Ga0163162_10002830 Ga0163162_100028306 353
543 3300013306 Ga0163162_10023096 Ga0163162_100230966 353
544 3300013306 Ga0163162_10031725 Ga0163162_100317254 353
545 3300013306 Ga0163162_10077963 Ga0163162_100779634 353
546 3300013306 Ga0163162_10292251 Ga0163162_102922512 353
547 3300013307 Ga0157372_10002627 Ga0157372_1000262713 353
548 3300013307 Ga0157372_10011662 Ga0157372_100116623 353
549 3300013307 Ga0157372_10026460 Ga0157372_100264606 353
550 3300013307 Ga0157372_10203342 Ga0157372_102033422 353
551 3300013307 Ga0157372_10406214 Ga0157372_104062141 353
552 3300013307 Ga0157372_10646583 Ga0157372_106465831 353
553 3300013308 Ga0157375_10033658 Ga0157375_100336582 353
554 3300013308 Ga0157375_10057621 Ga0157375_100576213 353
555 3300013308 Ga0157375_10319002 Ga0157375_103190022 353
556 3300013308 Ga0157375_10356905 Ga0157375_103569051 353
557 3300013308 Ga0157375_10648474 Ga0157375_106484741 353
558 3300014325 Ga0163163_10107022 Ga0163163_101070221 353
559 3300014325 Ga0163163_10128193 Ga0163163_101281932 353
560 3300014325 Ga0163163_10253183 Ga0163163_102531832 353
561 3300014325 Ga0163163_10277075 Ga0163163_102770752 353
562 3300014968 Ga0157379_10168865 Ga0157379_101688651 353
563 3300014969 Ga0157376_10002166 Ga0157376_100021664 353
564 3300014969 Ga0157376_10060857 Ga0157376_100608571 353
565 3300014969 Ga0157376_10095786 Ga0157376_100957862 353
566 3300014969 Ga0157376_10113044 Ga0157376_101130442 353
567 3300017792 Ga0163161_10210996 Ga0163161_102109962 353
568 3300021384 Ga0213876_10001574 Ga0213876_100015748 353
569 3300021384 Ga0213876_10066116 Ga0213876_100661162 353
570 3300025295 Ga0209564_1022859 Ga0209564_10228592 353
571 3300025302 Ga0207426_1000026 Ga0207426_1000026299 353
572 3300025304 Ga0209257_1000070 Ga0209257_100007030 353
573 3300025321 Ga0207656_10062548 Ga0207656_100625482 353
574 3300025899 Ga0207642_10019137 Ga0207642_100191373 353
575 3300025900 Ga0207710_10000673 Ga0207710_100006736 353
576 3300025900 Ga0207710_10004125 Ga0207710_100041254 353
577 3300025901 Ga0207688_10002217 Ga0207688_100022173 353
578 3300025901 Ga0207688_10011466 Ga0207688_100114663 353
579 3300025903 Ga0207680_10000193 Ga0207680_100001934 353
580 3300025903 Ga0207680_10036735 Ga0207680_100367352 353
581 3300025904 Ga0207647_10044652 Ga0207647_100446523 353
582 3300025907 Ga0207645_10002084 Ga0207645_100020846 353
583 3300025907 Ga0207645_10012266 Ga0207645_100122665 353
584 3300025907 Ga0207645_10040712 Ga0207645_100407123 353
585 3300025907 Ga0207645_10070775 Ga0207645_100707753 353
586 3300025908 Ga0207643_10005282 Ga0207643_100052822 353
587 3300025909 Ga0207705_10056135 Ga0207705_100561352 353
588 3300025911 Ga0207654_10001980 Ga0207654_100019809 353
589 3300025912 Ga0207707_10007370 Ga0207707_100073707 353
590 3300025912 Ga0207707_10013675 Ga0207707_100136753 353
591 3300025913 Ga0207695_10000685 Ga0207695_1000068543 353
592 3300025913 Ga0207695_10000917 Ga0207695_1000091719 353
593 3300025913 Ga0207695_10001873 Ga0207695_1000187322 353
594 3300025913 Ga0207695_10008256 Ga0207695_1000825613 353
595 3300025913 Ga0207695_10028845 Ga0207695_100288455 353
596 3300025913 Ga0207695_10038240 Ga0207695_100382403 353
597 3300025913 Ga0207695_10088165 Ga0207695_100881653 353
598 3300025913 Ga0207695_10118885 Ga0207695_101188852 353
599 3300025914 Ga0207671_10000637 Ga0207671_1000063735 353
600 3300025914 Ga0207671_10001799 Ga0207671_1000179910 353
601 3300025914 Ga0207671_10002779 Ga0207671_100027792 353
602 3300025914 Ga0207671_10004496 Ga0207671_100044969 353
603 3300025914 Ga0207671_10007714 Ga0207671_100077146 353
604 3300025914 Ga0207671_10008078 Ga0207671_100080782 353
605 3300025914 Ga0207671_10051595 Ga0207671_100515952 353
606 3300025914 Ga0207671_10053268 Ga0207671_100532682 353
607 3300025914 Ga0207671_10256304 Ga0207671_102563041 353
608 3300025917 Ga0207660_10035163 Ga0207660_100351631 353
609 3300025919 Ga0207657_10013683 Ga0207657_100136836 353
610 3300025921 Ga0207652_10070241 Ga0207652_100702412 353
611 3300025921 Ga0207652_10075289 Ga0207652_100752892 353
612 3300025923 Ga0207681_10010977 Ga0207681_100109774 353
613 3300025923 Ga0207681_10034340 Ga0207681_100343402 353
614 3300025923 Ga0207681_10046936 Ga0207681_100469362 353
615 3300025924 Ga0207694_10004594 Ga0207694_100045949 353
616 3300025924 Ga0207694_10259943 Ga0207694_102599431 353
617 3300025925 Ga0207650_10154590 Ga0207650_101545903 353
618 3300025931 Ga0207644_10318802 Ga0207644_103188022 353
619 3300025933 Ga0207706_10017700 Ga0207706_100177005 353
620 3300025937 Ga0207669_10018579 Ga0207669_100185792 353
621 3300025937 Ga0207669_10054671 Ga0207669_100546713 353
622 3300025937 Ga0207669_10057781 Ga0207669_100577812 353
623 3300025938 Ga0207704_10006232 Ga0207704_100062323 353
624 3300025938 Ga0207704_10009596 Ga0207704_100095963 353
625 3300025940 Ga0207691_10030097 Ga0207691_100300973 353
626 3300025940 Ga0207691_10045472 Ga0207691_100454723 353
627 3300025940 Ga0207691_10080607 Ga0207691_100806073 353
628 3300025942 Ga0207689_10003649 Ga0207689_100036495 353
629 3300025942 Ga0207689_10008486 Ga0207689_100084865 353
630 3300025942 Ga0207689_10031074 Ga0207689_100310743 353
631 3300025942 Ga0207689_10058060 Ga0207689_100580602 353
632 3300025942 Ga0207689_10149580 Ga0207689_101495803 353
633 3300025945 Ga0207679_10039923 Ga0207679_100399232 353
634 3300025949 Ga0207667_10001836 Ga0207667_100018362 353
635 3300025949 Ga0207667_10008374 Ga0207667_100083746 353
636 3300025949 Ga0207667_10230902 Ga0207667_102309022 353
637 3300025960 Ga0207651_10009901 Ga0207651_100099015 353
638 3300025960 Ga0207651_10017040 Ga0207651_100170403 353
639 3300025960 Ga0207651_10207041 Ga0207651_102070411 353
640 3300025961 Ga0207712_10002610 Ga0207712_100026101 353
641 3300025961 Ga0207712_10002895 Ga0207712_1000289513 353
642 3300025961 Ga0207712_10007405 Ga0207712_100074052 353
643 3300025961 Ga0207712_10239308 Ga0207712_102393081 353
644 3300025972 Ga0207668_10116964 Ga0207668_101169642 353
645 3300025981 Ga0207640_10089746 Ga0207640_100897462 353
646 3300025986 Ga0207658_10004993 Ga0207658_100049933 353
647 3300025986 Ga0207658_10026815 Ga0207658_100268155 353
648 3300025986 Ga0207658_10031720 Ga0207658_100317203 353
649 3300025986 Ga0207658_10123177 Ga0207658_101231771 353
650 3300026023 Ga0207677_10000816 Ga0207677_1000081614 353
651 3300026023 Ga0207677_10004544 Ga0207677_100045443 353
652 3300026035 Ga0207703_10015149 Ga0207703_100151497 353
653 3300026041 Ga0207639_10018447 Ga0207639_100184475 353
654 3300026041 Ga0207639_10055557 Ga0207639_100555572 353
655 3300026041 Ga0207639_10136311 Ga0207639_101363112 353
656 3300026078 Ga0207702_10082483 Ga0207702_100824832 353
657 3300026078 Ga0207702_10085938 Ga0207702_100859381 353
658 3300026078 Ga0207702_10318199 Ga0207702_103181992 353
659 3300026088 Ga0207641_10000015 Ga0207641_1000001548 353
660 3300026088 Ga0207641_10128901 Ga0207641_101289012 353
661 3300026088 Ga0207641_10167509 Ga0207641_101675092 353
662 3300026089 Ga0207648_10000384 Ga0207648_1000038414 353
663 3300026089 Ga0207648_10010983 Ga0207648_100109835 353
664 3300026089 Ga0207648_10013448 Ga0207648_1001344810 353
665 3300026089 Ga0207648_10039543 Ga0207648_100395434 353
666 3300026089 Ga0207648_10280134 Ga0207648_102801342 353
667 3300026089 Ga0207648_10331629 Ga0207648_103316292 353
668 3300026095 Ga0207676_10005777 Ga0207676_1000577710 353
669 3300026095 Ga0207676_10008363 Ga0207676_100083638 353
670 3300026095 Ga0207676_10010736 Ga0207676_100107362 353
671 3300026095 Ga0207676_10025572 Ga0207676_100255722 353
672 3300026095 Ga0207676_10076021 Ga0207676_100760212 353
673 3300026116 Ga0207674_10004626 Ga0207674_100046266 353
674 3300026116 Ga0207674_10131836 Ga0207674_101318362 353
675 3300026116 Ga0207674_10483231 Ga0207674_104832311 353
676 3300026118 Ga0207675_100012296 Ga0207675_1000122965 353
677 3300026118 Ga0207675_100064596 Ga0207675_1000645962 353
678 3300026118 Ga0207675_100155488 Ga0207675_1001554882 353
679 3300026118 Ga0207675_100266074 Ga0207675_1002660742 353
680 3300026121 Ga0207683_10007595 Ga0207683_100075958 353
681 3300026142 Ga0207698_10009978 Ga0207698_100099784 353
682 3300026142 Ga0207698_10037614 Ga0207698_100376142 353
683 3300026142 Ga0207698_10073059 Ga0207698_100730592 353
684 3300026142 Ga0207698_10160932 Ga0207698_101609321 353
685 3300026142 Ga0207698_10439612 Ga0207698_104396121 353
686 3300026142 Ga0207698_10494465 Ga0207698_104944651 353
687 3300026142 Ga0207698_10511397 Ga0207698_105113971 353
688 3300028379 Ga0268266_10000048 Ga0268266_10000048107 353
689 3300028379 Ga0268266_10128363 Ga0268266_101283632 353
690 3300028381 Ga0268264_10000028 Ga0268264_10000028262 353
691 3300028381 Ga0268264_10001761 Ga0268264_100017619 353
692 3300028381 Ga0268264_10006760 Ga0268264_100067604 353
693 3300028381 Ga0268264_10009685 Ga0268264_100096856 353
694 3300028381 Ga0268264_10028275 Ga0268264_100282752 353
695 3300028381 Ga0268264_10037291 Ga0268264_100372913 353
696 3300028381 Ga0268264_10075394 Ga0268264_100753943 353
697 3300028381 Ga0268264_10086516 Ga0268264_100865162 353
698 3300028381 Ga0268264_10276301 Ga0268264_102763012 353
699 3300028786 Ga0307517_10004393 Ga0307517_1000439313 353
700 3300028786 Ga0307517_10137171 Ga0307517_101371712 353
701 3300028794 Ga0307515_10000001 Ga0307515_100000012848 353
702 3300028794 Ga0307515_10000031 Ga0307515_10000031211 353
703 3300031251 Ga0265327_10001248 Ga0265327_1000124823 353
704 3300031251 Ga0265327_10075405 Ga0265327_100754052 353
705 3300031730 Ga0307516_10000159 Ga0307516_1000015967 353
706 3300031730 Ga0307516_10189430 Ga0307516_101894302 353
707 3300032004 Ga0307414_10046302 Ga0307414_100463024 353
708 3300033180 Ga0307510_10004925 Ga0307510_100049258 353
709 3300035170 Ga0373943_0010590 Ga0373943_0010590_303_1385 353
710 3300035172 Ga0373955_0025009 Ga0373955_0025009_985_2067 353
711 3300035692 Ga0373935_0056690 Ga0373935_0056690_1402_2484 353
712 3300035724 Ga0373933_0036103 Ga0373933_0036103_506_1588 353
713 3300036401 Ga0373937_0142441 Ga0373937_0142441_32_1114 353
714 3300037312 Ga0395899_0146615 Ga0395899_0146615_170_1252 353
715 3300037418 Ga0395900_0226618 Ga0395900_0226618_170_1252 353
716 3300037418 Ga0395900_0325488 Ga0395900_0325488_314_1399 353
717 3300037471 Ga0395905_0021187 Ga0395905_0021187_1785_2867 353
718 3300038443 Ga0395901_0063597 Ga0395901_0063597_2335_3417 353
719 3300039437 Ga0436365_0565109 Ga0436365_0565109_3807_4892 353
720 3300039437 Ga0436365_0850637 Ga0436365_0850637_1388_2473 353
721 3300039437 Ga0436365_1118032 Ga0436365_1118032_166_1248 353
722 3300039437 Ga0436365_1249677 Ga0436365_1249677_5716_6798 353
723 3300041404 Ga0439436_0002706 Ga0439436_0002706_4006_5088 353
724 3300041997 Ga0439431_0002553 Ga0439431_0002553_2530_3621 353
725 3300041999 Ga0439433_0012360 Ga0439433_0012360_505_1587 353
726 3300042004 Ga0439445_0007815 Ga0439445_0007815_327_1418 353
727 3300042007 Ga0439449_0007774 Ga0439449_0007774_2485_3567 353
728 3300042014 Ga0439457_002111 Ga0439457_002111_2115_3197 353
729 3300042015 Ga0439462_0004635 Ga0439462_0004635_1862_2944 353
730 3300042134 Ga0450898_001475 Ga0450898_001475_321_1403 353
731 3300044656 Ga0466969_0000127 Ga0466969_0000127_18669_19751 353
732 3300044658 Ga0466972_0000001 Ga0466972_0000001_301828_302910 353
733 3300044658 Ga0466972_0000080 Ga0466972_0000080_83097_84179 353
734 3300044658 Ga0466972_0032921 Ga0466972_0032921_945_2027 353
735 3300044684 Ga0466966_0000120 Ga0466966_0000120_20094_21176 353
736 3300044712 Ga0453684_0026631 Ga0453684_0026631_2891_3973 353
737 3300044712 Ga0453684_0108162 Ga0453684_0108162_1108_2190 353
738 3300044712 Ga0453684_0147752 Ga0453684_0147752_15_1097 353
739 3300044712 Ga0453684_0532170 Ga0453684_0532170_130_1212 353
740 3300044719 Ga0466971_0015332 Ga0466971_0015332_47_1129 353
741 3300044765 Ga0466970_0003312 Ga0466970_0003312_372_1454 353
742 3300044842 Ga0466957_0000380 Ga0466957_0000380_396_1478 353
743 3300044842 Ga0466957_0082602 Ga0466957_0082602_216_1298 353
744 3300045049 Ga0466959_0000014 Ga0466959_0000014_99480_100562 353
745 3300045836 Ga0466958_0013285 Ga0466958_0013285_2626_3708 353
746 3300046460 Ga0495638_0036074 Ga0495638_0036074_625_1707 353
747 3300046463 Ga0495653_0064121 Ga0495653_0064121_143_1225 353
748 3300046471 Ga0495650_0031064 Ga0495650_0031064_110_1192 353
749 3300046507 Ga0495606_0005804 Ga0495606_0005804_20_1102 353
750 3300046514 Ga0495618_0096219 Ga0495618_0096219_206_1288 353
751 3300046516 Ga0495628_0027888 Ga0495628_0027888_1761_2843 353
752 3300046522 Ga0495643_0037388 Ga0495643_0037388_742_1824 353
753 3300046543 Ga0495645_0128073 Ga0495645_0128073_541_1623 353
754 3300046616 Ga0495668_0000082 Ga0495668_0000082_72864_73946 353
755 3300046642 Ga0495634_0009802 Ga0495634_0009802_4559_5641 353
756 3300047320 Ga0495672_0021009 Ga0495672_0021009_3117_4199 353
757 3300047443 Ga0495687_000261 Ga0495687_000261_32451_33533 353
758 3300047472 Ga0495686_0000005 Ga0495686_0000005_671148_672230 353
759 3300047472 Ga0495686_0007643 Ga0495686_0007643_6698_7780 353
760 3300048924 Ga0496121_0000081 Ga0496121_0000081_64859_65950 353
761 3300049569 Ga0501032_0001909 Ga0501032_0001909_10479_11561 353
762 3300049571 Ga0501034_0000004 Ga0501034_0000004_3733_4815 353
763 3300049571 Ga0501034_0011664 Ga0501034_0011664_6129_7220 353
764 3300049571 Ga0501034_0024828 Ga0501034_0024828_3192_4274 353
765 3300049571 Ga0501034_0032084 Ga0501034_0032084_787_1869 353
766 3300049571 Ga0501034_0123271 Ga0501034_0123271_1406_2488 353
767 3300049572 Ga0501036_0034595 Ga0501036_0034595_2718_3800 353
768 3300049573 Ga0501037_0031925 Ga0501037_0031925_1878_2960 353
769 3300049574 Ga0501038_0030627 Ga0501038_0030627_2052_3134 353
770 3300049575 Ga0501039_0084825 Ga0501039_0084825_40_1122 353
771 3300049575 Ga0501039_0166752 Ga0501039_0166752_244_1326 353
772 3300049579 Ga0501043_0003893 Ga0501043_0003893_4144_5226 353
773 3300049579 Ga0501043_0152891 Ga0501043_0152891_465_1547 353
774 3300049580 Ga0501046_0045392 Ga0501046_0045392_432_1514 353
775 3300049580 Ga0501046_0056453 Ga0501046_0056453_1867_2949 353
776 3300049581 Ga0501047_0006977 Ga0501047_0006977_9388_10470 353
777 3300049581 Ga0501047_0082793 Ga0501047_0082793_387_1469 353
778 3300049582 Ga0501048_0006258 Ga0501048_0006258_4062_5144 353
779 3300049583 Ga0501067_0036099 Ga0501067_0036099_289_1371 353
780 3300049583 Ga0501067_0150962 Ga0501067_0150962_15_1097 353
781 3300049584 Ga0501068_0027869 Ga0501068_0027869_1426_2508 353
782 3300049585 Ga0501069_0074172 Ga0501069_0074172_307_1389 353
783 3300049586 Ga0501070_0082958 Ga0501070_0082958_12_1094 353
784 3300049586 Ga0501070_0195039 Ga0501070_0195039_101_1183 353
785 3300049589 Ga0501073_0006651 Ga0501073_0006651_1541_2623 353
786 3300049589 Ga0501073_0031419 Ga0501073_0031419_2004_3086 353
787 3300049590 Ga0501074_0002599 Ga0501074_0002599_1541_2623 353
788 3300049703 Ga0501219_000133 Ga0501219_000133_7294_8376 353
789 3300049742 Ga0501080_0030856 Ga0501080_0030856_1541_2623 353
790 3300049742 Ga0501080_0231967 Ga0501080_0231967_150_1232 353
791 3300049744 Ga0501083_0015427 Ga0501083_0015427_1350_2432 353
792 3300049744 Ga0501083_0050834 Ga0501083_0050834_1510_2592 353
793 3300049758 Ga0501241_003764 Ga0501241_003764_1042_2133 353
794 3300049822 Ga0501035_0002433 Ga0501035_0002433_2765_3847 353
795 3300049822 Ga0501035_0101410 Ga0501035_0101410_315_1397 353
796 3300049823 Ga0501044_0016689 Ga0501044_0016689_1358_2440 353
797 3300049823 Ga0501044_0021227 Ga0501044_0021227_3344_4426 353
798 3300049823 Ga0501044_0100055 Ga0501044_0100055_757_1839 353
799 3300049823 Ga0501044_0294316 Ga0501044_0294316_197_1279 353
800 3300050005 Ga0501284_00007 Ga0501284_00007_116738_117820 353
801 3300050493 nmdc:mga0k408_40938_c1 nmdc:mga0k408_40938_c1_227_1309 353
802 3300050496 nmdc:mga07m45_63327_c1 nmdc:mga07m45_63327_c1_170_1261 353
803 3300050512 nmdc:mga0n895_83806_c1 nmdc:mga0n895_83806_c1_1176_2258 353
804 3300053088 Ga0500644_0002655 Ga0500644_0002655_772_1854 353
805 3300053088 Ga0500644_0022480 Ga0500644_0022480_108_1190 353
806 3300053092 Ga0500583_0000001 Ga0500583_0000001_90447_91529 353
807 3300053092 Ga0500583_0042259 Ga0500583_0042259_431_1513 353
808 3300053108 Ga0500562_000018 Ga0500562_000018_27544_28626 353
809 3300053139 Ga0500568_0003595 Ga0500568_0003595_4652_5734 353
810 3300053142 Ga0500577_0045393 Ga0500577_0045393_371_1453 353
811 3300053147 Ga0500589_014113 Ga0500589_014113_2087_3169 353
812 3300053156 Ga0500622_0000114 Ga0500622_0000114_54128_55210 353
813 3300053156 Ga0500622_0005506 Ga0500622_0005506_1056_2138 353
814 3300053156 Ga0500622_0025494 Ga0500622_0025494_952_2034 353
815 3300053177 Ga0500636_0030666 Ga0500636_0030666_986_2068 353
816 3300054114 Ga0501084_0059210 Ga0501084_0059210_1706_2788 353
817 3300055283 Ga0500661_006998 Ga0500661_006998_742_1824 353
818 3300060353 Ga0501082_0225538 Ga0501082_0225538_121_1203 353
819 iso_pu_bacteria 2929921140 2929921816 353
820 iso_pu_bacteria 8003151029 8003154114 353
821 3300005289 Ga0065704_10101212 Ga0065704_101012122 354
822 3300005290 Ga0065712_10080579 Ga0065712_100805792 354
823 3300005340 Ga0070689_100054995 Ga0070689_1000549952 354
824 3300005343 Ga0070687_100049691 Ga0070687_1000496912 354
825 3300005353 Ga0070669_100038623 Ga0070669_1000386232 354
826 3300005354 Ga0070675_100096056 Ga0070675_1000960562 354
827 3300005354 Ga0070675_100117262 Ga0070675_1001172622 354
828 3300005364 Ga0070673_100102983 Ga0070673_1001029832 354
829 3300005364 Ga0070673_100118290 Ga0070673_1001182902 354
830 3300005466 Ga0070685_10005017 Ga0070685_100050172 354
831 3300005471 Ga0070698_100000282 Ga0070698_10000028223 354
832 3300005471 Ga0070698_100006847 Ga0070698_1000068475 354
833 3300005544 Ga0070686_100072943 Ga0070686_1000729431 354
834 3300005616 Ga0068852_100160219 Ga0068852_1001602192 354
835 3300005719 Ga0068861_100001502 Ga0068861_10000150217 354
836 3300005719 Ga0068861_100146876 Ga0068861_1001468761 354
837 3300006358 Ga0068871_100305082 Ga0068871_1003050821 354
838 3300006844 Ga0075428_100093975 Ga0075428_1000939752 354
839 3300006846 Ga0075430_100001793 Ga0075430_1000017932 354
840 3300006847 Ga0075431_100055523 Ga0075431_1000555233 354
841 3300006880 Ga0075429_100000136 Ga0075429_10000013623 354
842 3300009094 Ga0111539_10176061 Ga0111539_101760613 354
843 3300009147 Ga0114129_10039792 Ga0114129_100397923 354
844 3300009176 Ga0105242_10002943 Ga0105242_100029431 354
845 3300009176 Ga0105242_10140077 Ga0105242_101400773 354
846 3300009176 Ga0105242_10246472 Ga0105242_102464722 354
847 3300009553 Ga0105249_10012962 Ga0105249_100129627 354
848 3300009553 Ga0105249_10044696 Ga0105249_100446962 354
849 3300013104 Ga0157370_10087246 Ga0157370_100872462 354
850 3300013306 Ga0163162_10077356 Ga0163162_100773563 354
851 3300013306 Ga0163162_10450680 Ga0163162_104506802 354
852 3300013308 Ga0157375_10137864 Ga0157375_101378643 354
853 3300013308 Ga0157375_10202173 Ga0157375_102021732 354
854 3300014326 Ga0157380_10146948 Ga0157380_101469482 354
855 3300014969 Ga0157376_10115471 Ga0157376_101154712 354
856 3300025923 Ga0207681_10034444 Ga0207681_100344443 354
857 3300025934 Ga0207686_10000709 Ga0207686_1000070920 354
858 3300025934 Ga0207686_10127732 Ga0207686_101277322 354
859 3300025936 Ga0207670_10039676 Ga0207670_100396762 354
860 3300025938 Ga0207704_10084718 Ga0207704_100847182 354
861 3300025940 Ga0207691_10080271 Ga0207691_100802713 354
862 3300025961 Ga0207712_10001470 Ga0207712_100014704 354
863 3300025961 Ga0207712_10017162 Ga0207712_100171622 354
864 3300026075 Ga0207708_10020703 Ga0207708_100207033 354
865 3300026118 Ga0207675_100009007 Ga0207675_1000090074 354
866 3300026142 Ga0207698_10242148 Ga0207698_102421482 354
867 3300027907 Ga0207428_10047103 Ga0207428_100471033 354
868 3300042125 Ga0450923_000505 Ga0450923_000505_1971_3056 354
869 3300050507 nmdc:mga05p37_525609_c1 nmdc:mga05p37_525609_c1_248_1333 354
870 3300050508 nmdc:mga09592_5573_c1 nmdc:mga09592_5573_c1_1039_2124 354
871 3300050508 nmdc:mga09592_97382_c1 nmdc:mga09592_97382_c1_911_1996 354
872 3300050509 nmdc:mga0qj67_145895_c1 nmdc:mga0qj67_145895_c1_286_1371 354
873 3300050510 nmdc:mga06r32_48896_c1 nmdc:mga06r32_48896_c1_413_1498 354
874 3300050511 nmdc:mga08y16_77511_c1 nmdc:mga08y16_77511_c1_77_1162 354
875 3300005327 Ga0070658_10051009 Ga0070658_100510092 355
876 3300005329 Ga0070683_100208234 Ga0070683_1002082342 355
877 3300005331 Ga0070670_100100801 Ga0070670_1001008012 355
878 3300005355 Ga0070671_100092367 Ga0070671_1000923672 355
879 3300005535 Ga0070684_100140304 Ga0070684_1001403042 355
880 3300005564 Ga0070664_100008601 Ga0070664_1000086012 355
881 3300005564 Ga0070664_100218228 Ga0070664_1002182281 355
882 3300005616 Ga0068852_100003313 Ga0068852_1000033132 355
883 3300005616 Ga0068852_100038926 Ga0068852_1000389262 355
884 3300005617 Ga0068859_100017809 Ga0068859_1000178095 355
885 3300005834 Ga0068851_10008435 Ga0068851_100084351 355
886 3300005843 Ga0068860_100008699 Ga0068860_1000086994 355
887 3300006931 Ga0097620_100017809 Ga0097620_1000178095 355
888 3300009553 Ga0105249_10298373 Ga0105249_102983732 355
889 3300013102 Ga0157371_10000518 Ga0157371_1000051813 355
890 3300013102 Ga0157371_10012494 Ga0157371_100124944 355
891 3300013102 Ga0157371_10056930 Ga0157371_100569302 355
892 3300013102 Ga0157371_10168127 Ga0157371_101681271 355
893 3300013105 Ga0157369_10131361 Ga0157369_101313613 355
894 3300013105 Ga0157369_10353582 Ga0157369_103535822 355
895 3300013296 Ga0157374_10062246 Ga0157374_100622462 355
896 3300013296 Ga0157374_10153558 Ga0157374_101535582 355
897 3300013306 Ga0163162_10002571 Ga0163162_100025716 355
898 3300013307 Ga0157372_10034639 Ga0157372_100346393 355
899 3300013307 Ga0157372_10098783 Ga0157372_100987832 355
900 3300014325 Ga0163163_10000432 Ga0163163_1000043224 355
901 3300014325 Ga0163163_10014374 Ga0163163_100143743 355
902 3300014969 Ga0157376_10150201 Ga0157376_101502012 355
903 3300025321 Ga0207656_10024838 Ga0207656_100248382 355
904 3300025904 Ga0207647_10000210 Ga0207647_1000021044 355
905 3300025925 Ga0207650_10001513 Ga0207650_1000151315 355
906 3300025925 Ga0207650_10047461 Ga0207650_100474613 355
907 3300025945 Ga0207679_10077262 Ga0207679_100772622 355
908 3300025945 Ga0207679_10141067 Ga0207679_101410672 355
909 3300025960 Ga0207651_10020151 Ga0207651_100201514 355
910 3300026142 Ga0207698_10102320 Ga0207698_101023203 355
911 3300026142 Ga0207698_10370944 Ga0207698_103709441 355
912 3300028380 Ga0268265_10009060 Ga0268265_100090602 355
913 3300028381 Ga0268264_10010034 Ga0268264_100100343 355
914 3300037466 Ga0395898_0059676 Ga0395898_0059676_2183_3283 355
915 3300037471 Ga0395905_0003668 Ga0395905_0003668_14826_15929 355
916 3300037471 Ga0395905_0095804 Ga0395905_0095804_605_1708 355
917 3300042876 Ga0451577_0119657 Ga0451577_0119657_180_1283 355
918 3300044712 Ga0453684_0153958 Ga0453684_0153958_1529_2632 355
919 3300045049 Ga0466959_0034324 Ga0466959_0034324_1914_3017 355
920 3300045051 Ga0451576_0295748 Ga0451576_0295748_77_1180 355
921 3300049579 Ga0501043_0087841 Ga0501043_0087841_1260_2363 355
922 3300049661 Ga0501217_006558 Ga0501217_006558_949_2052 355
923 3300049686 Ga0501257_009245 Ga0501257_009245_309_1412 355
924 3300049772 Ga0501275_004810 Ga0501275_004810_68_1171 355
925 2162886007 SwRhRL2b_contig_1538117 SwRhRL2b_0072.00007040 356
926 3300044673 Ga0453683_0138195 Ga0453683_0138195_325_1437 356
927 3300053090 Ga0500646_0001794 Ga0500646_0001794_3819_4940 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22640

ManC_GMP_beta-helix

MannoseP isomerase/GMP-like beta-helix domain

303

359

0.91

PF00483

NTP_transferase

Nucleotidyl transferase

14

298

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cu2-assembly1.cif.gz_A-2 crystal structure of mannose-1-phosphate geranyltransferase from thermus thermophilus hb8 0.9071 7 348
2cu2-assembly1.cif.gz_A-2 crystal structure of mannose-1-phosphate geranyltransferase from thermus thermophilus hb8 0.8994 7 348
2x5s-assembly1.cif.gz_B crystal structure of t. maritima gdp-mannose pyrophosphorylase in apo state. 0.8902 8 347
2x5s-assembly1.cif.gz_B crystal structure of t. maritima gdp-mannose pyrophosphorylase in apo state. 0.8827 8 347
2qh5-assembly1.cif.gz_A crystal structure of mannose-6-phosphate isomerase from helicobacter pylori 0.8394 7 269
ID Description Score Start End Superfamily
2cu2A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9071 7 348 3.90.550.10
2cu2A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8994 7 348 3.90.550.10
af_P24174_4_358_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8966 7 349 3.90.550.10
2x5sB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8902 8 347 3.90.550.10
2x5sB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8827 8 347 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A662BLU3-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9925 5 85 GO:0004475
GO:0009298
AF-A0A3D2S5U4-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9916 5 102 GO:0004475
GO:0009298
AF-A0A5N7Z8A1-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9898 5 109 GO:0004475
GO:0009298
AF-A0A520C348-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9898 5 108 GO:0004475
GO:0009298
AF-A0A7X0CR72-F1-model_v4 Mannose-1-phosphate guanylyltransferase (EC 2.7.7.13) 0.9894 5 116 GO:0004475
GO:0009298

Feature Viewer

pLDDT pTM Quality
89.91 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map