F485927

General Info

Members Datasets Scaffolds Average Seq Length
926 364 891 221

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0141796|Ga0496105_0141796_1109_1903
Length 264
Sequence MRTAYHEQLAALTAQLGEMCGLSGRAMERATQALLQADLVLAEQVITDHDQITAMSAKAEETAFVLLALQAPVAGDLRAIVGSIQIVADIDRMGALALHVAKIARRRHPMHALPEEVNGYFAEMGRVAVELGNSAQEVLLSHDPEKAARISEEDDAMDDLHRHLFSVLMDRDWRHGVAAAVDVTLLGRFYERFADHAVEVARRVIFQVTGEYPTDELYTARVGGGVSRSVRKCSPPLPFGADWRRSSRCRRSRPDALACRWPPG

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
6 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
7 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
8 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
9 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
12 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
13 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
14 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
15 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
16 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
17 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
18 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
19 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
20 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
21 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
22 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
23 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
24 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
25 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
26 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
27 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
28 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
29 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
30 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
31 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
32 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
33 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
34 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
35 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
39 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
40 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
41 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
42 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
237 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
241 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
242 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
245 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
246 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
346 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
347 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
348 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
349 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
350 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
351 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
352 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
353 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
354 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
357 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
358 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
359 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
364 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 0
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.42
Nodule 0.11
Rhizoplane 11.34
Rhizosphere 67.39
Stem 0
Stem Tuber 0
Unclassified 8.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1012286 3300000546 Bacteria 911
2 JGI24739J22299_10125974 3300001989 Bacteria 763
3 JGI24737J22298_10030599 3300001990 Bacteria 1684
4 JGI24745J21846_1009800 3300002073 Bacteria 1088
5 JGI24749J21850_1014234 3300002076 Bacteria 1115
6 JGI24744J21845_10000136 3300002077 Bacteria 10379
7 JGI24742J22300_10011007 3300002244 Bacteria 1499
8 JGI24742J22300_10031772 3300002244 Bacteria 924
9 JGI24751J29686_10015836 3300002459 Bacteria 1555
10 rootH2_10067513 3300003320 Bacteria 3558
11 Ga0055540_1000071 3300003792 Bacteria 117607
12 Ga0055540_1000902 3300003792 Bacteria 19547
13 Ga0070676_10024311 3300005328 Bacteria 3412
14 Ga0070676_10139279 3300005328 Bacteria 1543
15 Ga0070683_100052935 3300005329 Bacteria 3761
16 Ga0070683_100769146 3300005329 Bacteria 923
17 Ga0070690_100002173 3300005330 Bacteria 10483
18 Ga0070670_100207599 3300005331 Bacteria 1703
19 Ga0068869_100004732 3300005334 Bacteria 8493
20 Ga0068869_100203799 3300005334 Bacteria 1561
21 Ga0070666_10013750 3300005335 Bacteria 5140
22 Ga0070666_10126881 3300005335 Bacteria 1771
23 Ga0070666_10607723 3300005335 Bacteria 798
24 Ga0070680_100699713 3300005336 Bacteria 872
25 Ga0070682_100012353 3300005337 Bacteria 4896
26 Ga0070682_100022346 3300005337 Bacteria 3746
27 Ga0070682_100030315 3300005337 Bacteria 3264
28 Ga0070682_100094097 3300005337 Bacteria 1965
29 Ga0070682_100218610 3300005337 Bacteria 1354
30 Ga0070682_100294638 3300005337 Bacteria 1188
31 Ga0068868_100008527 3300005338 Bacteria 7338
32 Ga0068868_100009899 3300005338 Bacteria 6884
33 Ga0068868_100022687 3300005338 Bacteria 4741
34 Ga0068868_100172888 3300005338 Bacteria 1789
35 Ga0068868_100193918 3300005338 Bacteria 1690
36 Ga0070660_100070107 3300005339 Bacteria 2735
37 Ga0070660_100088769 3300005339 Bacteria 2435
38 Ga0070660_100094922 3300005339 Bacteria 2357
39 Ga0070689_100077266 3300005340 Bacteria 2609
40 Ga0070689_100151445 3300005340 Bacteria 1871
41 Ga0070691_10005587 3300005341 Bacteria 5722
42 Ga0070691_10081574 3300005341 Bacteria 1584
43 Ga0070687_100121762 3300005343 Bacteria 1493
44 Ga0070692_10110543 3300005345 Bacteria 1519
45 Ga0070692_10232059 3300005345 Bacteria 1096
46 Ga0070668_100005229 3300005347 Bacteria 9627
47 Ga0070668_100052330 3300005347 Bacteria 3147
48 Ga0070668_100191654 3300005347 Bacteria 1674
49 Ga0070668_100226627 3300005347 Bacteria 1544
50 Ga0070668_100243721 3300005347 Bacteria 1490
51 Ga0070668_100246804 3300005347 Bacteria 1481
52 Ga0070669_100010528 3300005353 Bacteria 6569
53 Ga0070669_100044117 3300005353 Bacteria 3249
54 Ga0070669_100252774 3300005353 Bacteria 1404
55 Ga0070675_100051364 3300005354 Bacteria 3388
56 Ga0070675_100166812 3300005354 Bacteria 1897
57 Ga0070671_100009134 3300005355 Bacteria 7960
58 Ga0070671_100093292 3300005355 Bacteria 2523
59 Ga0070671_100257157 3300005355 Bacteria 1484
60 Ga0070674_100000655 3300005356 Bacteria 17474
61 Ga0070674_100041563 3300005356 Bacteria 3117
62 Ga0070674_100062303 3300005356 Bacteria 2606
63 Ga0070674_100307729 3300005356 Bacteria 1265
64 Ga0070688_100060689 3300005365 Bacteria 2389
65 Ga0070688_100115088 3300005365 Bacteria 1794
66 Ga0070659_100221528 3300005366 Bacteria 1561
67 Ga0070667_100000142 3300005367 Bacteria 90696
68 Ga0070667_100000995 3300005367 Bacteria 26025
69 Ga0070667_100014600 3300005367 Bacteria 6490
70 Ga0070667_100069849 3300005367 Bacteria 2989
71 Ga0070709_10172443 3300005434 Bacteria 1513
72 Ga0070709_10381444 3300005434 Bacteria 1048
73 Ga0070713_100018383 3300005436 Bacteria 5313
74 Ga0070713_100140903 3300005436 Bacteria 2136
75 Ga0070710_10011265 3300005437 Bacteria 4416
76 Ga0070710_10024248 3300005437 Bacteria 3198
77 Ga0070710_10026599 3300005437 Bacteria 3075
78 Ga0070701_10008728 3300005438 Bacteria 4401
79 Ga0070701_10167071 3300005438 Bacteria 1279
80 Ga0070711_100002645 3300005439 Bacteria 10256
81 Ga0070711_100002984 3300005439 Bacteria 9773
82 Ga0070705_100005990 3300005440 Bacteria 5946
83 Ga0070705_100007640 3300005440 Bacteria 5332
84 Ga0070705_100247432 3300005440 Bacteria 1249
85 Ga0070700_100011827 3300005441 Bacteria 4847
86 Ga0070700_100031279 3300005441 Bacteria 3187
87 Ga0070700_100197161 3300005441 Bacteria 1412
88 Ga0070700_100216376 3300005441 Bacteria 1355
89 Ga0070694_100018473 3300005444 Bacteria 4424
90 Ga0070694_100322319 3300005444 Bacteria 1190
91 Ga0070708_100238597 3300005445 Bacteria 1707
92 Ga0070663_100009948 3300005455 Bacteria 5911
93 Ga0070663_100014355 3300005455 Bacteria 5083
94 Ga0070663_100095330 3300005455 Bacteria 2211
95 Ga0070663_100198735 3300005455 Bacteria 1564
96 Ga0070678_100001005 3300005456 Bacteria 14642
97 Ga0070678_100141677 3300005456 Bacteria 1924
98 Ga0070678_100417356 3300005456 Bacteria 1169
99 Ga0070662_100006072 3300005457 Bacteria 7755
100 Ga0068867_100007222 3300005459 Bacteria 7854
101 Ga0068867_100182354 3300005459 Bacteria 1670
102 Ga0068867_100366433 3300005459 Bacteria 1207
103 Ga0070685_10020338 3300005466 Bacteria 3592
104 Ga0070679_100289051 3300005530 Bacteria 1591
105 Ga0070697_100478066 3300005536 Bacteria 1088
106 Ga0068853_100001093 3300005539 Bacteria 19199
107 Ga0068853_100004917 3300005539 Bacteria 10401
108 Ga0068853_100166435 3300005539 Bacteria 1992
109 Ga0068853_100412292 3300005539 Bacteria 1266
110 Ga0070695_100085306 3300005545 Bacteria 2097
111 Ga0070696_100026576 3300005546 Bacteria 3938
112 Ga0070696_100124042 3300005546 Bacteria 1872
113 Ga0070693_100071876 3300005547 Bacteria 2040
114 Ga0070693_100379726 3300005547 Bacteria 974
115 Ga0070665_100004853 3300005548 Bacteria 13971
116 Ga0070665_100020302 3300005548 Bacteria 6671
117 Ga0070665_100035221 3300005548 Bacteria 5034
118 Ga0070665_100151143 3300005548 Bacteria 2325
119 Ga0070665_101148117 3300005548 Bacteria 788
120 Ga0070704_100002883 3300005549 Bacteria 9756
121 Ga0070704_100178281 3300005549 Bacteria 1697
122 Ga0070704_100374113 3300005549 Bacteria 1209
123 Ga0068855_100422094 3300005563 Bacteria 1459
124 Ga0068857_100257011 3300005577 Bacteria 1602
125 Ga0068857_101056716 3300005577 Bacteria 783
126 Ga0068854_100003576 3300005578 Bacteria 9714
127 Ga0068854_100115916 3300005578 Bacteria 2027
128 Ga0068854_100122094 3300005578 Bacteria 1979
129 Ga0068854_100231562 3300005578 Bacteria 1467
130 Ga0068854_100239194 3300005578 Bacteria 1445
131 Ga0068856_100113856 3300005614 Bacteria 2704
132 Ga0068856_101118079 3300005614 Bacteria 805
133 Ga0070702_100006048 3300005615 Bacteria 5699
134 Ga0070702_100105928 3300005615 Bacteria 1734
135 Ga0068852_100034773 3300005616 Bacteria 4197
136 Ga0068852_100071410 3300005616 Bacteria 3048
137 Ga0068852_100157381 3300005616 Bacteria 2118
138 Ga0068859_100004138 3300005617 Bacteria 14809
139 Ga0068859_100010110 3300005617 Bacteria 9510
140 Ga0068859_100078249 3300005617 Bacteria 3347
141 Ga0068859_100486812 3300005617 Bacteria 1329
142 Ga0068859_100737090 3300005617 Bacteria 1075
143 Ga0068864_100402641 3300005618 Bacteria 1301
144 Ga0068864_100717458 3300005618 Bacteria 978
145 Ga0068866_10004953 3300005718 Bacteria 5477
146 Ga0068866_10172284 3300005718 Bacteria 1271
147 Ga0068866_10278952 3300005718 Bacteria 1034
148 Ga0068861_100002600 3300005719 Bacteria 11820
149 Ga0068861_100019623 3300005719 Bacteria 4829
150 Ga0068861_100038805 3300005719 Bacteria 3551
151 Ga0068861_100072845 3300005719 Bacteria 2666
152 Ga0068861_100184311 3300005719 Bacteria 1740
153 Ga0068861_100191882 3300005719 Bacteria 1708
154 Ga0068851_10022293 3300005834 Bacteria 3083
155 Ga0068863_100000105 3300005841 Bacteria 90388
156 Ga0068863_100041233 3300005841 Bacteria 4389
157 Ga0068863_100079433 3300005841 Bacteria 3107
158 Ga0068863_100124538 3300005841 Bacteria 2459
159 Ga0068863_100381647 3300005841 Bacteria 1376
160 Ga0068858_100003568 3300005842 Bacteria 15398
161 Ga0068858_100004234 3300005842 Bacteria 14120
162 Ga0068858_100070628 3300005842 Bacteria 3237
163 Ga0068858_100100194 3300005842 Bacteria 2702
164 Ga0068860_100000209 3300005843 Bacteria 92811
165 Ga0068860_100008609 3300005843 Bacteria 10169
166 Ga0068860_100052533 3300005843 Bacteria 3876
167 Ga0068860_100104438 3300005843 Bacteria 2705
168 Ga0068860_100982419 3300005843 Bacteria 862
169 Ga0068860_101147698 3300005843 Bacteria 797
170 Ga0068862_100000400 3300005844 Bacteria 46788
171 Ga0068862_100002572 3300005844 Bacteria 16030
172 Ga0068862_100048732 3300005844 Bacteria 3617
173 Ga0068862_100104296 3300005844 Bacteria 2484
174 Ga0068862_100163475 3300005844 Bacteria 1988
175 Ga0068862_100229328 3300005844 Bacteria 1684
176 Ga0068862_100388237 3300005844 Bacteria 1303
177 Ga0081455_10047499 3300005937 Bacteria 3717
178 Ga0081455_10094873 3300005937 Bacteria 2409
179 Ga0075365_10010402 3300006038 Bacteria 5417
180 Ga0075365_10038783 3300006038 Bacteria 3099
181 Ga0075365_10070006 3300006038 Bacteria 2359
182 Ga0075365_10116061 3300006038 Bacteria 1843
183 Ga0075365_10171014 3300006038 Bacteria 1517
184 Ga0075368_10008553 3300006042 Bacteria 3650
185 Ga0075368_10015687 3300006042 Bacteria 2815
186 Ga0075368_10212463 3300006042 Bacteria 820
187 Ga0075363_100000884 3300006048 Bacteria 10551
188 Ga0075363_100004990 3300006048 Bacteria 5871
189 Ga0075363_100005591 3300006048 Bacteria 5613
190 Ga0075363_100021757 3300006048 Bacteria 3235
191 Ga0075363_100365963 3300006048 Bacteria 844
192 Ga0075364_10000352 3300006051 Bacteria 22844
193 Ga0075364_10004512 3300006051 Bacteria 8021
194 Ga0075364_10007606 3300006051 Bacteria 6442
195 Ga0075364_10010981 3300006051 Bacteria 5492
196 Ga0075364_10043114 3300006051 Bacteria 2933
197 Ga0075364_10044618 3300006051 Bacteria 2884
198 Ga0075364_10068519 3300006051 Bacteria 2333
199 Ga0075364_10211240 3300006051 Bacteria 1316
200 Ga0075364_10225279 3300006051 Bacteria 1273
201 Ga0070715_10007794 3300006163 Bacteria 3701
202 Ga0070716_100011007 3300006173 Bacteria 4551
203 Ga0070716_100036133 3300006173 Bacteria 2722
204 Ga0070716_100052433 3300006173 Bacteria 2322
205 Ga0070712_100002129 3300006175 Bacteria 12178
206 Ga0070712_100014884 3300006175 Bacteria 4999
207 Ga0070712_100031547 3300006175 Bacteria 3571
208 Ga0070712_100270041 3300006175 Bacteria 1366
209 Ga0070712_100521707 3300006175 Bacteria 998
210 Ga0075362_10043805 3300006177 Bacteria 1983
211 Ga0075362_10188957 3300006177 Bacteria 1000
212 Ga0075367_10113946 3300006178 Bacteria 1662
213 Ga0075369_10008349 3300006186 Bacteria 3980
214 Ga0075369_10017624 3300006186 Bacteria 2898
215 Ga0075369_10018475 3300006186 Bacteria 2839
216 Ga0075369_10045575 3300006186 Bacteria 1886
217 Ga0075369_10198616 3300006186 Bacteria 925
218 Ga0097621_100013052 3300006237 Bacteria 6177
219 Ga0097621_100076145 3300006237 Bacteria 2782
220 Ga0075370_10002119 3300006353 Bacteria 9052
221 Ga0075370_10004134 3300006353 Bacteria 6992
222 Ga0075370_10021002 3300006353 Bacteria 3575
223 Ga0075370_10027253 3300006353 Bacteria 3169
224 Ga0075370_10136709 3300006353 Bacteria 1432
225 Ga0075370_10193855 3300006353 Bacteria 1198
226 Ga0075370_10231666 3300006353 Bacteria 1093
227 Ga0068871_100110785 3300006358 Bacteria 2309
228 Ga0068871_100628475 3300006358 Bacteria 978
229 Ga0075428_100004290 3300006844 Bacteria 15702
230 Ga0075428_100552703 3300006844 Bacteria 1231
231 Ga0075430_100175480 3300006846 Bacteria 1783
232 Ga0075430_100661152 3300006846 Bacteria 862
233 Ga0075431_100023715 3300006847 Bacteria 6281
234 Ga0068865_100003040 3300006881 Bacteria 10032
235 Ga0068865_100102184 3300006881 Bacteria 2100
236 Ga0068865_100167476 3300006881 Bacteria 1681
237 Ga0068865_100535958 3300006881 Bacteria 981
238 Ga0097620_100004138 3300006931 Bacteria 14809
239 Ga0097620_100010110 3300006931 Bacteria 9510
240 Ga0097620_100078249 3300006931 Bacteria 3347
241 Ga0097620_100486850 3300006931 Bacteria 1329
242 Ga0097620_100737079 3300006931 Bacteria 1075
243 Ga0099795_10005850 3300007788 Bacteria 3308
244 Ga0105250_10278800 3300009092 Bacteria 719
245 Ga0105240_10459681 3300009093 Bacteria 1423
246 Ga0111539_10367163 3300009094 Bacteria 1675
247 Ga0111539_11465630 3300009094 Bacteria 792
248 Ga0105245_10002210 3300009098 Bacteria 17613
249 Ga0105245_10068575 3300009098 Bacteria 3214
250 Ga0105245_10130798 3300009098 Bacteria 2354
251 Ga0105245_10692328 3300009098 Bacteria 1052
252 Ga0105247_10000141 3300009101 Bacteria 70210
253 Ga0105247_10001401 3300009101 Bacteria 17494
254 Ga0105247_10011479 3300009101 Bacteria 5342
255 Ga0105247_10034274 3300009101 Bacteria 3092
256 Ga0114129_10021114 3300009147 Bacteria 9245
257 Ga0105243_10000877 3300009148 Bacteria 28395
258 Ga0105243_10001026 3300009148 Bacteria 25748
259 Ga0105243_10030337 3300009148 Bacteria 4162
260 Ga0105243_11347761 3300009148 Bacteria 732
261 Ga0105241_10007147 3300009174 Bacteria 8217
262 Ga0105241_10228835 3300009174 Bacteria 1566
263 Ga0105242_10020529 3300009176 Bacteria 5181
264 Ga0105242_10038522 3300009176 Bacteria 3845
265 Ga0105248_10000242 3300009177 Bacteria 63110
266 Ga0105248_10012476 3300009177 Bacteria 9373
267 Ga0105248_10041777 3300009177 Bacteria 5142
268 Ga0105248_10129111 3300009177 Bacteria 2851
269 Ga0105248_11096772 3300009177 Bacteria 900
270 Ga0105237_10017368 3300009545 Bacteria 7460
271 Ga0105237_10036231 3300009545 Bacteria 4990
272 Ga0105237_10042277 3300009545 Bacteria 4597
273 Ga0105237_10048790 3300009545 Bacteria 4255
274 Ga0105238_10055930 3300009551 Bacteria 3959
275 Ga0105249_10000031 3300009553 Bacteria 220006
276 Ga0105249_10003161 3300009553 Bacteria 14248
277 Ga0105249_10339793 3300009553 Bacteria 1518
278 Ga0105249_10656016 3300009553 Bacteria 1107
279 Ga0105249_10670702 3300009553 Bacteria 1095
280 Ga0105249_10965351 3300009553 Bacteria 920
281 Ga0105028_108579 3300009993 Bacteria 1068
282 Ga0105239_10004174 3300010375 Bacteria 17356
283 Ga0105239_10004701 3300010375 Bacteria 16217
284 Ga0105239_10020858 3300010375 Bacteria 7229
285 Ga0105239_10055735 3300010375 Bacteria 4335
286 Ga0105239_10089122 3300010375 Bacteria 3402
287 Ga0105246_10017764 3300011119 Bacteria 4524
288 Ga0105246_10193950 3300011119 Bacteria 1574
289 Ga0157371_10312418 3300013102 Bacteria 1139
290 Ga0157370_10521252 3300013104 Bacteria 1091
291 Ga0157369_10284159 3300013105 Bacteria 1723
292 Ga0157369_10327051 3300013105 Bacteria 1593
293 Ga0157369_10471834 3300013105 Bacteria 1299
294 Ga0157374_10074664 3300013296 Bacteria 3203
295 Ga0157374_10153900 3300013296 Bacteria 2237
296 Ga0157374_10454243 3300013296 Bacteria 1283
297 Ga0157378_10018228 3300013297 Bacteria 6161
298 Ga0157378_10023912 3300013297 Bacteria 5374
299 Ga0157378_10128578 3300013297 Bacteria 2342
300 Ga0157378_10394674 3300013297 Bacteria 1362
301 Ga0163162_10008665 3300013306 Bacteria 9900
302 Ga0163162_10032962 3300013306 Bacteria 5144
303 Ga0163162_10584408 3300013306 Bacteria 1244
304 Ga0157372_10009627 3300013307 Bacteria 10271
305 Ga0157372_10029028 3300013307 Bacteria 6036
306 Ga0157372_10070189 3300013307 Bacteria 3941
307 Ga0157375_10002285 3300013308 Bacteria 16566
308 Ga0157375_10101066 3300013308 Bacteria 2966
309 Ga0157375_10174762 3300013308 Bacteria 2297
310 Ga0157375_10208432 3300013308 Bacteria 2111
311 Ga0157375_10846812 3300013308 Bacteria 1061
312 Ga0157375_10924939 3300013308 Bacteria 1015
313 Ga0163163_10140656 3300014325 Bacteria 2456
314 Ga0163163_10424854 3300014325 Bacteria 1388
315 Ga0163163_10573156 3300014325 Bacteria 1192
316 Ga0163163_10575686 3300014325 Bacteria 1189
317 Ga0157380_10000802 3300014326 Bacteria 19732
318 Ga0157380_10049846 3300014326 Bacteria 3305
319 Ga0157377_10053568 3300014745 Bacteria 2282
320 Ga0157377_10261786 3300014745 Bacteria 1126
321 Ga0157379_10020737 3300014968 Bacteria 5815
322 Ga0157379_10123822 3300014968 Bacteria 2326
323 Ga0157379_10132853 3300014968 Bacteria 2241
324 Ga0157376_10178951 3300014969 Bacteria 1937
325 Ga0163161_10001861 3300017792 Bacteria 15399
326 Ga0163161_10087639 3300017792 Bacteria 2299
327 Ga0213876_10015727 3300021384 Bacteria 4005
328 Ga0213875_10002285 3300021388 Bacteria 11605
329 Ga0213875_10129179 3300021388 Bacteria 1181
330 Ga0209673_1061553 3300025273 Bacteria 935
331 Ga0209051_1000033 3300025303 Bacteria 380540
332 Ga0209051_1001346 3300025303 Bacteria 21328
333 Ga0209051_1001746 3300025303 Bacteria 17326
334 Ga0209051_1027501 3300025303 Bacteria 2265
335 Ga0209051_1094404 3300025303 Bacteria 822
336 Ga0207697_10168474 3300025315 Bacteria 957
337 Ga0207696_1082045 3300025711 Bacteria 889
338 Ga0207692_10154648 3300025898 Bacteria 1316
339 Ga0207692_10252024 3300025898 Bacteria 1058
340 Ga0207642_10020605 3300025899 Bacteria 2578
341 Ga0207642_10099353 3300025899 Bacteria 1457
342 Ga0207710_10000164 3300025900 Bacteria 70180
343 Ga0207710_10000901 3300025900 Bacteria 15906
344 Ga0207710_10105310 3300025900 Bacteria 1335
345 Ga0207688_10000489 3300025901 Bacteria 19052
346 Ga0207688_10003531 3300025901 Bacteria 8530
347 Ga0207688_10003799 3300025901 Bacteria 8239
348 Ga0207688_10011680 3300025901 Bacteria 4776
349 Ga0207688_10056506 3300025901 Bacteria 2205
350 Ga0207688_10088507 3300025901 Bacteria 1776
351 Ga0207688_10105985 3300025901 Bacteria 1627
352 Ga0207680_10160495 3300025903 Bacteria 1507
353 Ga0207647_10017184 3300025904 Bacteria 4923
354 Ga0207647_10028191 3300025904 Bacteria 3651
355 Ga0207685_10004576 3300025905 Bacteria 3539
356 Ga0207699_10134742 3300025906 Bacteria 1616
357 Ga0207645_10020919 3300025907 Bacteria 4274
358 Ga0207645_10048293 3300025907 Bacteria 2718
359 Ga0207705_10069495 3300025909 Bacteria 2551
360 Ga0207654_10032174 3300025911 Bacteria 2895
361 Ga0207695_10133359 3300025913 Bacteria 2439
362 Ga0207671_10043825 3300025914 Bacteria 3308
363 Ga0207693_10003251 3300025915 Bacteria 13942
364 Ga0207693_10008923 3300025915 Bacteria 8185
365 Ga0207693_10014548 3300025915 Bacteria 6323
366 Ga0207693_10513404 3300025915 Bacteria 935
367 Ga0207663_10001940 3300025916 Bacteria 9797
368 Ga0207663_10037667 3300025916 Bacteria 2917
369 Ga0207657_10185531 3300025919 Bacteria 1680
370 Ga0207681_10003879 3300025923 Bacteria 9285
371 Ga0207681_10196019 3300025923 Bacteria 1548
372 Ga0207659_10081641 3300025926 Bacteria 2391
373 Ga0207687_10001856 3300025927 Bacteria 14539
374 Ga0207687_10019541 3300025927 Bacteria 4489
375 Ga0207687_10430869 3300025927 Bacteria 1090
376 Ga0207700_10449531 3300025928 Bacteria 1135
377 Ga0207700_10652159 3300025928 Bacteria 938
378 Ga0207664_10162629 3300025929 Bacteria 1905
379 Ga0207664_10470921 3300025929 Bacteria 1123
380 Ga0207644_10007265 3300025931 Bacteria 7209
381 Ga0207644_10166743 3300025931 Bacteria 1716
382 Ga0207644_10190872 3300025931 Bacteria 1611
383 Ga0207690_10104632 3300025932 Bacteria 2028
384 Ga0207690_10147931 3300025932 Bacteria 1738
385 Ga0207706_10001630 3300025933 Bacteria 22262
386 Ga0207706_10009481 3300025933 Bacteria 8939
387 Ga0207706_10020146 3300025933 Bacteria 5993
388 Ga0207709_10001857 3300025935 Bacteria 14063
389 Ga0207709_10001922 3300025935 Bacteria 13650
390 Ga0207709_10190094 3300025935 Bacteria 1458
391 Ga0207670_10246650 3300025936 Bacteria 1378
392 Ga0207669_10000247 3300025937 Bacteria 24532
393 Ga0207669_10075825 3300025937 Bacteria 2132
394 Ga0207669_10326606 3300025937 Bacteria 1176
395 Ga0207704_10126937 3300025938 Bacteria 1758
396 Ga0207704_10302328 3300025938 Bacteria 1226
397 Ga0207704_10426461 3300025938 Bacteria 1053
398 Ga0207704_10879959 3300025938 Bacteria 752
399 Ga0207665_10006954 3300025939 Bacteria 7490
400 Ga0207665_10033565 3300025939 Bacteria 3403
401 Ga0207665_10051740 3300025939 Bacteria 2765
402 Ga0207711_10000196 3300025941 Bacteria 64910
403 Ga0207711_10007688 3300025941 Bacteria 9012
404 Ga0207711_10014846 3300025941 Bacteria 6470
405 Ga0207711_10083138 3300025941 Bacteria 2800
406 Ga0207689_10010685 3300025942 Bacteria 7899
407 Ga0207689_10350740 3300025942 Bacteria 1227
408 Ga0207689_10363271 3300025942 Bacteria 1204
409 Ga0207689_10606462 3300025942 Bacteria 921
410 Ga0207661_10059162 3300025944 Bacteria 3087
411 Ga0207661_10304329 3300025944 Bacteria 1430
412 Ga0207651_10072512 3300025960 Bacteria 2445
413 Ga0207712_10000029 3300025961 Bacteria 220014
414 Ga0207712_10006529 3300025961 Bacteria 7357
415 Ga0207712_10037734 3300025961 Bacteria 3298
416 Ga0207712_10495532 3300025961 Bacteria 1043
417 Ga0207668_10004559 3300025972 Bacteria 8148
418 Ga0207668_10159708 3300025972 Bacteria 1755
419 Ga0207668_10227885 3300025972 Bacteria 1500
420 Ga0207668_10244930 3300025972 Bacteria 1452
421 Ga0207640_10106297 3300025981 Bacteria 1979
422 Ga0207640_10182661 3300025981 Bacteria 1574
423 Ga0207640_10567177 3300025981 Bacteria 956
424 Ga0207658_10000113 3300025986 Bacteria 88960
425 Ga0207658_10000850 3300025986 Bacteria 25516
426 Ga0207658_10061665 3300025986 Bacteria 2803
427 Ga0207658_10076005 3300025986 Bacteria 2557
428 Ga0207677_10038929 3300026023 Bacteria 3121
429 Ga0207677_10062822 3300026023 Bacteria 2578
430 Ga0207677_10254819 3300026023 Bacteria 1427
431 Ga0207677_10468159 3300026023 Bacteria 1083
432 Ga0207703_10009286 3300026035 Bacteria 7730
433 Ga0207703_10042166 3300026035 Bacteria 3660
434 Ga0207703_10063966 3300026035 Bacteria 3018
435 Ga0207639_10017851 3300026041 Bacteria 5033
436 Ga0207639_10018244 3300026041 Bacteria 4984
437 Ga0207639_10041000 3300026041 Bacteria 3460
438 Ga0207639_10185436 3300026041 Bacteria 1773
439 Ga0207639_10504229 3300026041 Bacteria 1106
440 Ga0207678_10007288 3300026067 Bacteria 9802
441 Ga0207678_10013099 3300026067 Bacteria 7274
442 Ga0207678_10027382 3300026067 Bacteria 4972
443 Ga0207678_10048063 3300026067 Bacteria 3689
444 Ga0207708_10017230 3300026075 Bacteria 5438
445 Ga0207708_10024415 3300026075 Bacteria 4573
446 Ga0207708_10095231 3300026075 Bacteria 2299
447 Ga0207708_10123852 3300026075 Bacteria 2016
448 Ga0207702_10178536 3300026078 Bacteria 1953
449 Ga0207702_10925332 3300026078 Bacteria 864
450 Ga0207641_10000581 3300026088 Bacteria 40291
451 Ga0207641_10009336 3300026088 Bacteria 8090
452 Ga0207641_10254862 3300026088 Bacteria 1640
453 Ga0207641_10375487 3300026088 Bacteria 1360
454 Ga0207648_10003694 3300026089 Bacteria 16021
455 Ga0207648_10025471 3300026089 Bacteria 5268
456 Ga0207648_10380952 3300026089 Bacteria 1275
457 Ga0207676_10043866 3300026095 Bacteria 3446
458 Ga0207676_10331923 3300026095 Bacteria 1400
459 Ga0207674_10291548 3300026116 Bacteria 1580
460 Ga0207675_100002945 3300026118 Bacteria 16742
461 Ga0207675_100027002 3300026118 Bacteria 5345
462 Ga0207675_100141399 3300026118 Bacteria 2287
463 Ga0207675_100213073 3300026118 Bacteria 1859
464 Ga0207675_100845835 3300026118 Bacteria 930
465 Ga0207683_10002056 3300026121 Bacteria 17809
466 Ga0207683_10039140 3300026121 Bacteria 4136
467 Ga0207683_10167976 3300026121 Bacteria 1986
468 Ga0207698_10152452 3300026142 Bacteria 2008
469 Ga0209813_10007905 3300027866 Bacteria 2667
470 Ga0209813_10028970 3300027866 Bacteria 1618
471 Ga0268266_10002346 3300028379 Bacteria 20467
472 Ga0268266_10005470 3300028379 Bacteria 11829
473 Ga0268266_10009545 3300028379 Bacteria 8540
474 Ga0268266_10024368 3300028379 Bacteria 5146
475 Ga0268266_10229142 3300028379 Bacteria 1711
476 Ga0268266_10561158 3300028379 Bacteria 1095
477 Ga0268265_10000389 3300028380 Bacteria 46920
478 Ga0268265_10015507 3300028380 Bacteria 5217
479 Ga0268265_10258970 3300028380 Bacteria 1545
480 Ga0268265_10504661 3300028380 Bacteria 1140
481 Ga0268264_10000017 3300028381 Bacteria 498037
482 Ga0268264_10003370 3300028381 Bacteria 13802
483 Ga0268264_10065616 3300028381 Bacteria 3059
484 Ga0268264_10134545 3300028381 Bacteria 2196
485 Ga0268264_10399488 3300028381 Bacteria 1320
486 Ga0268264_10551298 3300028381 Bacteria 1131
487 Ga0268264_10559332 3300028381 Bacteria 1123
488 Ga0265327_10005155 3300031251 Bacteria 11082
489 Ga0307413_10011863 3300031824 Bacteria 4307
490 Ga0307413_10155258 3300031824 Bacteria 1600
491 Ga0307410_10085227 3300031852 Bacteria 2229
492 Ga0307410_10236001 3300031852 Bacteria 1415
493 Ga0307406_10360275 3300031901 Bacteria 1140
494 Ga0307407_10299772 3300031903 Bacteria 1120
495 Ga0307409_100208747 3300031995 Bacteria 1753
496 Ga0307409_100572613 3300031995 Bacteria 1112
497 Ga0307409_100583494 3300031995 Bacteria 1102
498 Ga0307416_100008033 3300032002 Bacteria 6762
499 Ga0307414_10572730 3300032004 Bacteria 1009
500 Ga0307411_10019451 3300032005 Bacteria 3923
501 Ga0307411_10455732 3300032005 Bacteria 1071
502 Ga0307415_100014180 3300032126 Bacteria 4677
503 Ga0307415_100254600 3300032126 Bacteria 1429
504 Ga0373929_0019268 3300035085 Bacteria 1365
505 Ga0373952_0047262 3300035092 Bacteria 1014
506 Ga0373932_0094504 3300035112 Bacteria 964
507 Ga0373939_0110176 3300035114 Bacteria 958
508 Ga0373941_0213206 3300035115 Bacteria 739
509 Ga0373956_0012775 3300035119 Bacteria 3486
510 Ga0373962_0061104 3300035242 Bacteria 1107
511 Ga0373931_0009804 3300035691 Bacteria 4588
512 Ga0373931_0073050 3300035691 Bacteria 1877
513 Ga0373925_0093905 3300037068 Bacteria 2297
514 Ga0436364_0103584 3300037853 Bacteria 12819
515 Ga0436364_0595872 3300037853 Bacteria 1355
516 Ga0436364_0863821 3300037853 Bacteria 2922
517 Ga0436364_0872298 3300037853 Bacteria 4379
518 Ga0436365_0468901 3300039437 Bacteria 3180
519 Ga0436365_0671847 3300039437 Bacteria 34209
520 Ga0436365_1818399 3300039437 Bacteria 33160
521 Ga0436365_1833781 3300039437 Bacteria 32006
522 Ga0436363_0028512 3300039450 Bacteria 1606
523 Ga0436363_0144694 3300039450 Bacteria 3001
524 Ga0436363_1020415 3300039450 Bacteria 1109
525 Ga0436362_0209322 3300039453 Bacteria 1581
526 Ga0436362_1118236 3300039453 Bacteria 1491
527 Ga0439461_0012679 3300041410 Bacteria 1581
528 Ga0439466_0011616 3300041411 Bacteria 3254
529 Ga0439466_0028438 3300041411 Bacteria 1930
530 Ga0439465_0003685 3300041413 Bacteria 4993
531 Ga0439465_0012464 3300041413 Bacteria 2657
532 Ga0451787_712210 3300041441 Bacteria 1194
533 Ga0451793_0046954 3300041452 Bacteria 3161
534 Ga0451795_0047719 3300041456 Bacteria 978
535 Ga0439431_0003085 3300041997 Bacteria 3659
536 Ga0439431_0006682 3300041997 Bacteria 2557
537 Ga0439442_002061 3300042002 Bacteria 3951
538 Ga0439445_0000875 3300042004 Bacteria 6391
539 Ga0439445_0003741 3300042004 Bacteria 3418
540 Ga0439448_0068831 3300042005 Bacteria 1177
541 Ga0439449_0051669 3300042007 Bacteria 1520
542 Ga0439463_073115 3300042016 Bacteria 879
543 Ga0466969_0006911 3300044656 Bacteria 6041
544 Ga0466972_0005077 3300044658 Bacteria 6595
545 Ga0466965_0001978 3300044683 Bacteria 8568
546 Ga0466965_0003274 3300044683 Bacteria 7085
547 Ga0466965_0018626 3300044683 Bacteria 3330
548 Ga0466966_0002923 3300044684 Bacteria 11260
549 Ga0466966_0003280 3300044684 Bacteria 10665
550 Ga0466966_0003757 3300044684 Bacteria 10005
551 Ga0466966_0128433 3300044684 Bacteria 1553
552 Ga0466961_0001548 3300044693 Bacteria 14230
553 Ga0466961_0015228 3300044693 Bacteria 4938
554 Ga0466961_0016908 3300044693 Bacteria 4687
555 Ga0466961_0062760 3300044693 Bacteria 2361
556 Ga0466963_0073901 3300044694 Bacteria 2299
557 Ga0466963_0091657 3300044694 Bacteria 2070
558 Ga0466963_0451980 3300044694 Bacteria 906
559 Ga0466963_0476151 3300044694 Bacteria 881
560 Ga0466964_0488562 3300044706 Bacteria 659
561 Ga0466971_0015984 3300044719 Bacteria 3307
562 Ga0466971_0039555 3300044719 Bacteria 2116
563 Ga0466971_0066561 3300044719 Bacteria 1633
564 Ga0466971_0072365 3300044719 Bacteria 1566
565 Ga0466968_0001149 3300044735 Bacteria 9375
566 Ga0466968_0002680 3300044735 Bacteria 6556
567 Ga0466968_0007618 3300044735 Bacteria 4122
568 Ga0466968_0222288 3300044735 Bacteria 890
569 Ga0466970_0009842 3300044765 Bacteria 4841
570 Ga0466970_0018512 3300044765 Bacteria 3606
571 Ga0466970_0042689 3300044765 Bacteria 2412
572 Ga0466970_0059807 3300044765 Bacteria 2040
573 Ga0466970_0211197 3300044765 Bacteria 1081
574 Ga0466970_0260256 3300044765 Bacteria 973
575 Ga0466957_0029033 3300044842 Bacteria 3295
576 Ga0466957_0031979 3300044842 Bacteria 3148
577 Ga0466957_0151901 3300044842 Bacteria 1498
578 Ga0466957_0339239 3300044842 Bacteria 1017
579 Ga0466957_0354247 3300044842 Bacteria 996
580 Ga0466960_0000284 3300044901 Bacteria 17649
581 Ga0466960_0000771 3300044901 Bacteria 11234
582 Ga0466960_0000936 3300044901 Bacteria 10325
583 Ga0466960_0012184 3300044901 Bacteria 3621
584 Ga0466960_0427324 3300044901 Bacteria 767
585 Ga0466959_0001606 3300045049 Bacteria 13925
586 Ga0466959_0004912 3300045049 Bacteria 9054
587 Ga0466959_0025876 3300045049 Bacteria 4351
588 Ga0466959_0040983 3300045049 Bacteria 3420
589 Ga0466959_0048146 3300045049 Bacteria 3133
590 Ga0466959_0103168 3300045049 Bacteria 2040
591 Ga0466959_0175721 3300045049 Bacteria 1500
592 Ga0466958_0014460 3300045836 Bacteria 4507
593 Ga0466958_0020132 3300045836 Bacteria 3890
594 Ga0466958_0037233 3300045836 Bacteria 2915
595 Ga0466958_0047855 3300045836 Bacteria 2582
596 Ga0466958_0433419 3300045836 Bacteria 850
597 Ga0466967_0013842 3300045976 Bacteria 6254
598 Ga0466967_0065477 3300045976 Bacteria 3235
599 Ga0466967_0081069 3300045976 Bacteria 2930
600 Ga0466967_0110765 3300045976 Bacteria 2522
601 Ga0466967_0221318 3300045976 Bacteria 1799
602 Ga0466967_0605724 3300045976 Bacteria 1081
603 Ga0466967_0672300 3300045976 Bacteria 1025
604 Ga0495638_0009441 3300046460 Bacteria 6846
605 Ga0495638_0019859 3300046460 Bacteria 4442
606 Ga0495641_0066105 3300046461 Bacteria 1627
607 Ga0495582_0012490 3300046473 Bacteria 4681
608 Ga0495605_0014802 3300046474 Bacteria 4259
609 Ga0495662_0059262 3300046476 Bacteria 1849
610 Ga0495584_0232619 3300046491 Bacteria 937
611 Ga0495585_0200028 3300046492 Bacteria 1018
612 Ga0495644_0006873 3300046523 Bacteria 4404
613 Ga0495648_0005202 3300046524 Bacteria 10883
614 Ga0495663_0084931 3300046525 Bacteria 1024
615 Ga0495640_0072326 3300046533 Bacteria 2311
616 Ga0495668_0016771 3300046616 Bacteria 4257
617 Ga0495668_0059088 3300046616 Bacteria 2116
618 Ga0495668_0223583 3300046616 Bacteria 1031
619 Ga0495668_0270441 3300046616 Bacteria 931
620 Ga0495624_0089241 3300046690 Bacteria 1903
621 Ga0495670_0350501 3300046691 Bacteria 794
622 Ga0495671_0160515 3300046692 Bacteria 1093
623 Ga0495649_0116436 3300046694 Bacteria 1415
624 Ga0495649_0116713 3300046694 Bacteria 1413
625 Ga0495649_0335834 3300046694 Bacteria 765
626 Ga0495636_0163073 3300047318 Bacteria 1005
627 Ga0495674_0685573 3300047319 Bacteria 805
628 Ga0495672_0071334 3300047320 Bacteria 1966
629 Ga0495672_0143777 3300047320 Bacteria 1243
630 Ga0495672_0167182 3300047320 Bacteria 1125
631 Ga0495672_0192261 3300047320 Bacteria 1025
632 Ga0495672_0197568 3300047320 Bacteria 1008
633 Ga0495676_0396577 3300047321 Bacteria 916
634 Ga0495673_0000524 3300047469 Bacteria 40257
635 Ga0495686_0002996 3300047472 Bacteria 15021
636 Ga0495593_0001036 3300047673 Bacteria 16331
637 Ga0496100_0000090 3300048903 Bacteria 51781
638 Ga0496100_0000358 3300048903 Bacteria 22180
639 Ga0496100_0000576 3300048903 Bacteria 17408
640 Ga0496100_0000826 3300048903 Bacteria 14867
641 Ga0496100_0034329 3300048903 Bacteria 3182
642 Ga0496100_0056805 3300048903 Bacteria 2561
643 Ga0496100_0152669 3300048903 Bacteria 1649
644 Ga0496100_0430730 3300048903 Bacteria 1009
645 Ga0496101_0000031 3300048904 Bacteria 195195
646 Ga0496101_0000409 3300048904 Bacteria 27808
647 Ga0496101_0001670 3300048904 Bacteria 13325
648 Ga0496101_0022234 3300048904 Bacteria 4364
649 Ga0496101_0056537 3300048904 Bacteria 2837
650 Ga0496101_0063357 3300048904 Bacteria 2691
651 Ga0496101_0223395 3300048904 Bacteria 1462
652 Ga0496101_0300293 3300048904 Bacteria 1257
653 Ga0496101_0573223 3300048904 Bacteria 892
654 Ga0496102_0000065 3300048905 Bacteria 161370
655 Ga0496102_0000187 3300048905 Bacteria 84207
656 Ga0496102_0000387 3300048905 Bacteria 51915
657 Ga0496102_0002397 3300048905 Bacteria 15999
658 Ga0496102_0008246 3300048905 Bacteria 8922
659 Ga0496102_0034168 3300048905 Bacteria 4573
660 Ga0496102_0034723 3300048905 Bacteria 4537
661 Ga0496102_0081212 3300048905 Bacteria 2988
662 Ga0496102_0083933 3300048905 Bacteria 2939
663 Ga0496102_0088422 3300048905 Bacteria 2864
664 Ga0496102_0288122 3300048905 Bacteria 1548
665 Ga0496102_0620779 3300048905 Bacteria 1004
666 Ga0496103_0000048 3300048906 Bacteria 160911
667 Ga0496103_0000126 3300048906 Bacteria 82291
668 Ga0496103_0000292 3300048906 Bacteria 46843
669 Ga0496103_0001655 3300048906 Bacteria 14592
670 Ga0496103_0018603 3300048906 Bacteria 4168
671 Ga0496103_0092143 3300048906 Bacteria 1913
672 Ga0496103_0266908 3300048906 Bacteria 1101
673 Ga0496104_0020189 3300048907 Bacteria 6104
674 Ga0496104_0066406 3300048907 Bacteria 3425
675 Ga0496104_0113942 3300048907 Bacteria 2593
676 Ga0496104_0140081 3300048907 Bacteria 2324
677 Ga0496104_0191465 3300048907 Bacteria 1957
678 Ga0496104_0221750 3300048907 Bacteria 1803
679 Ga0496104_0305233 3300048907 Bacteria 1504
680 Ga0496105_0010809 3300048908 Bacteria 7189
681 Ga0496105_0016595 3300048908 Bacteria 5880
682 Ga0496105_0103573 3300048908 Bacteria 2350
683 Ga0496105_0141796 3300048908 Bacteria 1978
684 Ga0496106_0002589 3300048909 Bacteria 13464
685 Ga0496106_0020022 3300048909 Bacteria 4962
686 Ga0496106_0048358 3300048909 Bacteria 3203
687 Ga0496106_0086429 3300048909 Bacteria 2415
688 Ga0496106_0200285 3300048909 Bacteria 1589
689 Ga0496106_0248215 3300048909 Bacteria 1423
690 Ga0496106_0258005 3300048909 Bacteria 1394
691 Ga0496106_0583215 3300048909 Bacteria 896
692 Ga0496107_0004431 3300048910 Bacteria 9514
693 Ga0496107_0005397 3300048910 Bacteria 8747
694 Ga0496107_0015900 3300048910 Bacteria 5279
695 Ga0496107_0027297 3300048910 Bacteria 4054
696 Ga0496107_0181389 3300048910 Bacteria 1563
697 Ga0496108_0011488 3300048911 Bacteria 7197
698 Ga0496108_0021420 3300048911 Bacteria 5314
699 Ga0496108_0029357 3300048911 Bacteria 4553
700 Ga0496108_0049471 3300048911 Bacteria 3516
701 Ga0496108_0065918 3300048911 Bacteria 3053
702 Ga0496108_0099750 3300048911 Bacteria 2476
703 Ga0496108_0155881 3300048911 Bacteria 1972
704 Ga0496108_0550235 3300048911 Bacteria 1007
705 Ga0496109_0000134 3300048912 Bacteria 75662
706 Ga0496109_0131394 3300048912 Bacteria 2337
707 Ga0496109_0181830 3300048912 Bacteria 1975
708 Ga0496109_0189902 3300048912 Bacteria 1930
709 Ga0496110_0024896 3300048913 Bacteria 5107
710 Ga0496110_0032195 3300048913 Bacteria 4527
711 Ga0496110_0038335 3300048913 Bacteria 4170
712 Ga0496110_0104973 3300048913 Bacteria 2535
713 Ga0496110_0533657 3300048913 Bacteria 1067
714 Ga0496111_0002609 3300048914 Bacteria 10915
715 Ga0496111_0087238 3300048914 Bacteria 2284
716 Ga0496111_0105904 3300048914 Bacteria 2070
717 Ga0496111_0113591 3300048914 Bacteria 1996
718 Ga0496112_0006326 3300048915 Bacteria 10397
719 Ga0496112_0043147 3300048915 Bacteria 4415
720 Ga0496112_0043544 3300048915 Bacteria 4395
721 Ga0496112_0086809 3300048915 Bacteria 3095
722 Ga0496112_0423509 3300048915 Bacteria 1270
723 Ga0496112_0456254 3300048915 Bacteria 1216
724 Ga0496112_0628987 3300048915 Bacteria 1004
725 Ga0496113_0068031 3300048916 Bacteria 2702
726 Ga0496113_0120482 3300048916 Bacteria 2051
727 Ga0496113_0482791 3300048916 Bacteria 995
728 Ga0496114_0000740 3300048917 Bacteria 24358
729 Ga0496114_0001498 3300048917 Bacteria 17734
730 Ga0496114_0016088 3300048917 Bacteria 6020
731 Ga0496114_0030885 3300048917 Bacteria 4407
732 Ga0496114_0227178 3300048917 Bacteria 1639
733 Ga0496114_0263440 3300048917 Bacteria 1518
734 Ga0496114_0446661 3300048917 Bacteria 1145
735 Ga0496115_0002039 3300048918 Bacteria 14457
736 Ga0496115_0081409 3300048918 Bacteria 2637
737 Ga0496115_0119606 3300048918 Bacteria 2167
738 Ga0496115_0336141 3300048918 Bacteria 1233
739 Ga0496116_0000125 3300048919 Bacteria 160885
740 Ga0496116_0000306 3300048919 Bacteria 82349
741 Ga0496116_0019575 3300048919 Bacteria 5178
742 Ga0496116_0023895 3300048919 Bacteria 4538
743 Ga0496117_0000111 3300048920 Bacteria 184570
744 Ga0496117_0000343 3300048920 Bacteria 82294
745 Ga0496117_0001572 3300048920 Bacteria 32413
746 Ga0496117_0112605 3300048920 Bacteria 1691
747 Ga0496118_0000083 3300048921 Bacteria 184570
748 Ga0496118_0000192 3300048921 Bacteria 107736
749 Ga0496118_0000648 3300048921 Bacteria 56769
750 Ga0496118_0001353 3300048921 Bacteria 36982
751 Ga0496118_0009352 3300048921 Bacteria 9925
752 Ga0496119_0002640 3300048922 Bacteria 19420
753 Ga0496119_0003272 3300048922 Bacteria 16942
754 Ga0496119_0011086 3300048922 Bacteria 7508
755 Ga0496120_0002589 3300048923 Bacteria 17993
756 Ga0496120_0010816 3300048923 Bacteria 6323
757 Ga0496120_0041742 3300048923 Bacteria 2684
758 Ga0496121_0000004 3300048924 Bacteria 1139011
759 Ga0496121_0019295 3300048924 Bacteria 6823
760 Ga0496122_0000138 3300048925 Bacteria 169434
761 Ga0496122_0008620 3300048925 Bacteria 10946
762 Ga0496122_0168948 3300048925 Bacteria 1321
763 Ga0496122_0314589 3300048925 Bacteria 836
764 Ga0496123_0002022 3300048926 Bacteria 26177
765 Ga0496123_0002126 3300048926 Bacteria 25354
766 Ga0496123_0008587 3300048926 Bacteria 9360
767 Ga0496124_0000012 3300048927 Bacteria 512581
768 Ga0496124_0017629 3300048927 Bacteria 6723
769 Ga0496124_0269234 3300048927 Bacteria 1248
770 Ga0496125_0000003 3300048928 Bacteria 1189767
771 Ga0496125_0038840 3300048928 Bacteria 4110
772 Ga0496125_0040927 3300048928 Bacteria 3967
773 Ga0496125_0113555 3300048928 Bacteria 1954
774 Ga0496125_0336277 3300048928 Bacteria 908
775 Ga0496126_0000001 3300048929 Bacteria 1139011
776 Ga0496126_0000220 3300048929 Bacteria 124547
777 Ga0496126_0000433 3300048929 Bacteria 84020
778 Ga0496126_0003794 3300048929 Bacteria 18761
779 Ga0496126_0006077 3300048929 Bacteria 13547
780 Ga0496126_0008463 3300048929 Bacteria 11094
781 Ga0496126_0015093 3300048929 Bacteria 7782
782 Ga0496126_0167002 3300048929 Bacteria 1877
783 Ga0501032_0001198 3300049569 Bacteria 20738
784 Ga0501033_0013056 3300049570 Bacteria 6332
785 Ga0501033_0032246 3300049570 Bacteria 3935
786 Ga0501033_0584369 3300049570 Bacteria 767
787 Ga0501034_0003575 3300049571 Bacteria 17647
788 Ga0501034_0004941 3300049571 Bacteria 14678
789 Ga0501034_0037834 3300049571 Bacteria 4887
790 Ga0501034_0131209 3300049571 Bacteria 2489
791 Ga0501034_0678794 3300049571 Bacteria 930
792 Ga0501036_0035805 3300049572 Bacteria 4201
793 Ga0501036_0064770 3300049572 Bacteria 3093
794 Ga0501037_0002583 3300049573 Bacteria 13082
795 Ga0501037_0007135 3300049573 Bacteria 8167
796 Ga0501037_0184866 3300049573 Bacteria 1477
797 Ga0501038_0000352 3300049574 Bacteria 39429
798 Ga0501039_0002801 3300049575 Bacteria 13027
799 Ga0501043_0002096 3300049579 Bacteria 17025
800 Ga0501043_0029168 3300049579 Bacteria 4333
801 Ga0501046_0000769 3300049580 Bacteria 31025
802 Ga0501047_0005895 3300049581 Bacteria 11526
803 Ga0501047_0010792 3300049581 Bacteria 8637
804 Ga0501068_0238077 3300049584 Bacteria 1158
805 Ga0501069_0045914 3300049585 Bacteria 2421
806 Ga0501070_0006531 3300049586 Bacteria 9918
807 Ga0501070_0010101 3300049586 Bacteria 7989
808 Ga0501070_0143809 3300049586 Bacteria 1969
809 Ga0501073_0016560 3300049589 Bacteria 5343
810 Ga0501075_0306240 3300049591 Bacteria 1211
811 Ga0501077_0325585 3300049593 Bacteria 980
812 Ga0501080_0161831 3300049742 Bacteria 2067
813 Ga0501083_0171294 3300049744 Bacteria 1419
814 Ga0501035_0000886 3300049822 Bacteria 31764
815 Ga0501035_0007162 3300049822 Bacteria 10434
816 Ga0501044_0001635 3300049823 Bacteria 26275
817 Ga0501044_0003142 3300049823 Bacteria 18681
818 Ga0501044_0009219 3300049823 Bacteria 10779
819 nmdc:mga03683_121843_c1 3300050489 Bacteria 1160
820 nmdc:mga03683_200629_c1 3300050489 Bacteria 915
821 nmdc:mga03683_54157_c1 3300050489 Bacteria 1681
822 nmdc:mga03n38_144118_c1 3300050490 Bacteria 1193
823 nmdc:mga03n38_158113_c1 3300050490 Bacteria 1146
824 nmdc:mga03n38_7026_c1 3300050490 Bacteria 3958
825 nmdc:mga00v17_107702_c1 3300050491 Bacteria 1765
826 nmdc:mga00v17_16349_c1 3300050491 Bacteria 4182
827 nmdc:mga00v17_207324_c1 3300050491 Bacteria 1268
828 nmdc:mga00v17_34499_c1 3300050491 Bacteria 3006
829 nmdc:mga00v17_360791_c1 3300050491 Bacteria 945
830 nmdc:mga00v17_43081_c1 3300050491 Bacteria 2717
831 nmdc:mga00v17_63353_c1 3300050491 Bacteria 2277
832 nmdc:mga00v17_71997_c1 3300050491 Bacteria 2144
833 nmdc:mga00v17_77101_c1 3300050491 Bacteria 2075
834 nmdc:mga00v17_8347_c1 3300050491 Bacteria 5275
835 nmdc:mga00v17_94938_c1 3300050491 Bacteria 1877
836 nmdc:mga0yw44_15601_c2 3300050492 Bacteria 2529
837 nmdc:mga0yw44_164212_c1 3300050492 Bacteria 1455
838 nmdc:mga0yw44_19851_c1 3300050492 Bacteria 3715
839 nmdc:mga0yw44_37477_c1 3300050492 Bacteria 2863
840 nmdc:mga0yw44_527685_c1 3300050492 Bacteria 801
841 nmdc:mga0yw44_60015_c1 3300050492 Bacteria 2329
842 nmdc:mga0yw44_61543_c1 3300050492 Bacteria 2304
843 nmdc:mga0yw44_75812_c1 3300050492 Bacteria 2098
844 nmdc:mga0yw44_93711_c1 3300050492 Bacteria 1902
845 nmdc:mga06z11_18177_c1 3300050494 Bacteria 3206
846 nmdc:mga06z11_24314_c1 3300050494 Bacteria 2856
847 nmdc:mga04h51_158250_c1 3300050495 Bacteria 870
848 nmdc:mga04h51_34114_c1 3300050495 Bacteria 1624
849 nmdc:mga07m45_114610_c1 3300050496 Bacteria 1554
850 nmdc:mga07m45_190588_c1 3300050496 Bacteria 1192
851 nmdc:mga07m45_3155_c1 3300050496 Bacteria 7905
852 nmdc:mga07m45_4178_c1 3300050496 Bacteria 7055
853 nmdc:mga07m45_67220_c1 3300050496 Bacteria 2037
854 nmdc:mga07m45_8036_c1 3300050496 Bacteria 5409
855 nmdc:mga07m45_8496_c2 3300050496 Bacteria 4001
856 nmdc:mga05p37_9680_c1 3300050507 Bacteria 11423
857 nmdc:mga0qj67_42343_c1 3300050509 Bacteria 3584
858 nmdc:mga06r32_820_c2 3300050510 Bacteria 3872
859 nmdc:mga0sz30_108537_c2 3300050516 Bacteria 925
860 nmdc:mga0sz30_10998_c1 3300050516 Bacteria 3481
861 nmdc:mga0sz30_20669_c1 3300050516 Bacteria 2657
862 nmdc:mga0sz30_29882_c1 3300050516 Bacteria 2249
863 nmdc:mga0sz30_3067_c2 3300050516 Bacteria 1191
864 nmdc:mga0sz30_43771_c1 3300050516 Bacteria 1885
865 nmdc:mga0sz30_57861_c1 3300050516 Bacteria 1652
866 nmdc:mga0sz30_64232_c1 3300050516 Bacteria 1572
867 nmdc:mga0sz30_681_c1 3300050516 Bacteria 12548
868 nmdc:mga0sz30_75422_c1 3300050516 Bacteria 1455
869 nmdc:mga0sz30_99840_c1 3300050516 Bacteria 1267
870 Ga0500610_0050234 3300053079 Bacteria 2170
871 Ga0500635_0009747 3300053080 Bacteria 2675
872 Ga0500635_0124215 3300053080 Bacteria 968
873 Ga0500643_002089 3300053087 Bacteria 10632
874 Ga0500643_009791 3300053087 Bacteria 3631
875 Ga0500644_0095726 3300053088 Bacteria 1120
876 Ga0500583_0083800 3300053092 Bacteria 1544
877 Ga0500556_0001477 3300053104 Bacteria 9807
878 Ga0500562_010478 3300053108 Bacteria 2349
879 Ga0500608_215978 3300053122 Bacteria 779
880 Ga0500642_0048596 3300053130 Bacteria 1864
881 Ga0500652_211220 3300053131 Bacteria 784
882 Ga0500658_0039142 3300053134 Bacteria 1893
883 Ga0500559_0037586 3300053136 Bacteria 2099
884 Ga0500568_0120570 3300053139 Bacteria 977
885 Ga0500577_0015413 3300053142 Bacteria 2388
886 Ga0500604_0018934 3300053151 Bacteria 1924
887 Ga0500616_0107724 3300053153 Bacteria 1351
888 Ga0500627_0067441 3300053158 Bacteria 1581
889 Ga0500645_005909 3300053730 Bacteria 4435
890 Ga0466962_0025036 3300061719 Bacteria 2865
891 Ga0466962_0110381 3300061719 Bacteria 1324

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0488562 Ga0466964_0488562_14_601 194
2 3300009545 Ga0105237_10017368 Ga0105237_100173684 211
3 3300010375 Ga0105239_10004701 Ga0105239_1000470111 211
4 3300005843 Ga0068860_100104438 Ga0068860_1001044385 213
5 3300028381 Ga0268264_10134545 Ga0268264_101345454 213
6 3300047320 Ga0495672_0197568 Ga0495672_0197568_218_859 213
7 3300050491 nmdc:mga00v17_63353_c1 nmdc:mga00v17_63353_c1_722_1366 213
8 3300050491 nmdc:mga00v17_8347_c1 nmdc:mga00v17_8347_c1_1068_1712 213
9 3300050492 nmdc:mga0yw44_164212_c1 nmdc:mga0yw44_164212_c1_702_1343 213
10 3300050492 nmdc:mga0yw44_60015_c1 nmdc:mga0yw44_60015_c1_678_1322 213
11 3300050494 nmdc:mga06z11_24314_c1 nmdc:mga06z11_24314_c1_1504_2148 213
12 3300050495 nmdc:mga04h51_158250_c1 nmdc:mga04h51_158250_c1_191_835 213
13 3300050496 nmdc:mga07m45_4178_c1 nmdc:mga07m45_4178_c1_5788_6432 213
14 3300050496 nmdc:mga07m45_8496_c2 nmdc:mga07m45_8496_c2_990_1634 213
15 3300050516 nmdc:mga0sz30_29882_c1 nmdc:mga0sz30_29882_c1_1201_1845 213
16 3300050516 nmdc:mga0sz30_57861_c1 nmdc:mga0sz30_57861_c1_336_980 213
17 iso_pu_bacteria 2956939328 2956942063 213
18 iso_pu_bacteria 3001119090 3001119419 213
19 3300006847 Ga0075431_100023715 Ga0075431_1000237153 214
20 3300013308 Ga0157375_10924939 Ga0157375_109249392 214
21 3300048909 Ga0496106_0248215 Ga0496106_0248215_15_710 214
22 3300048915 Ga0496112_0006326 Ga0496112_0006326_2305_2949 214
23 3300050510 nmdc:mga06r32_820_c2 nmdc:mga06r32_820_c2_1604_2248 214
24 iso_pu_bacteria 2558860112 2558911863 214
25 iso_pu_bacteria 2751185725 2753039017 214
26 iso_pu_bacteria 2751185792 2753327378 214
27 iso_pu_bacteria 2870782633 2870787972 214
28 3300005617 Ga0068859_100737090 Ga0068859_1007370902 215
29 3300006173 Ga0070716_100036133 Ga0070716_1000361334 215
30 3300006931 Ga0097620_100737079 Ga0097620_1007370791 215
31 3300009094 Ga0111539_10367163 Ga0111539_103671632 215
32 3300009148 Ga0105243_10001026 Ga0105243_1000102614 215
33 3300014325 Ga0163163_10573156 Ga0163163_105731562 215
34 3300025935 Ga0207709_10001922 Ga0207709_100019223 215
35 3300025939 Ga0207665_10051740 Ga0207665_100517401 215
36 3300037853 Ga0436364_0595872 Ga0436364_0595872_264_911 215
37 3300044658 Ga0466972_0005077 Ga0466972_0005077_1262_1909 215
38 3300044683 Ga0466965_0003274 Ga0466965_0003274_882_1529 215
39 3300044719 Ga0466971_0066561 Ga0466971_0066561_772_1419 215
40 3300044735 Ga0466968_0007618 Ga0466968_0007618_1134_1781 215
41 3300044765 Ga0466970_0018512 Ga0466970_0018512_1577_2224 215
42 3300044901 Ga0466960_0012184 Ga0466960_0012184_783_1430 215
43 3300045049 Ga0466959_0103168 Ga0466959_0103168_1153_1800 215
44 3300045836 Ga0466958_0020132 Ga0466958_0020132_2504_3151 215
45 3300045976 Ga0466967_0110765 Ga0466967_0110765_383_1030 215
46 3300045976 Ga0466967_0605724 Ga0466967_0605724_297_944 215
47 3300048918 Ga0496115_0336141 Ga0496115_0336141_349_996 215
48 3300048925 Ga0496122_0168948 Ga0496122_0168948_539_1186 215
49 3300048926 Ga0496123_0002126 Ga0496123_0002126_17797_18444 215
50 3300048929 Ga0496126_0003794 Ga0496126_0003794_7178_7825 215
51 3300048929 Ga0496126_0008463 Ga0496126_0008463_162_809 215
52 3300050489 nmdc:mga03683_200629_c1 nmdc:mga03683_200629_c1_10_684 215
53 iso_pu_bacteria 2523231044 2523384651 215
54 iso_pu_bacteria 2751185734 2753069695 215
55 iso_pu_bacteria 2842888712 2842890076 215
56 iso_pu_bacteria 2870721527 2870727797 215
57 3300005338 Ga0068868_100172888 Ga0068868_1001728882 216
58 3300005843 Ga0068860_101147698 Ga0068860_1011476981 216
59 3300006175 Ga0070712_100521707 Ga0070712_1005217072 216
60 3300013297 Ga0157378_10394674 Ga0157378_103946741 216
61 3300035119 Ga0373956_0012775 Ga0373956_0012775_409_1059 216
62 iso_pu_bacteria 2558860280 2559428312 216
63 iso_pu_bacteria 2738543011 2739237930 216
64 iso_pu_bacteria 2889300758 2889303555 216
65 iso_pu_bacteria 2939743619 2939747340 216
66 iso_pu_bacteria 8047710418 8047716334 216
67 3300005335 Ga0070666_10607723 Ga0070666_106077231 217
68 3300005356 Ga0070674_100062303 Ga0070674_1000623032 217
69 3300005841 Ga0068863_100079433 Ga0068863_1000794332 217
70 3300006881 Ga0068865_100535958 Ga0068865_1005359581 217
71 3300009177 Ga0105248_10129111 Ga0105248_101291116 217
72 3300013297 Ga0157378_10128578 Ga0157378_101285783 217
73 3300013308 Ga0157375_10846812 Ga0157375_108468122 217
74 3300025937 Ga0207669_10326606 Ga0207669_103266062 217
75 3300025938 Ga0207704_10426461 Ga0207704_104264611 217
76 3300025941 Ga0207711_10083138 Ga0207711_100831383 217
77 3300048903 Ga0496100_0034329 Ga0496100_0034329_2010_2663 217
78 3300048904 Ga0496101_0063357 Ga0496101_0063357_556_1209 217
79 3300048907 Ga0496104_0066406 Ga0496104_0066406_418_1071 217
80 3300048908 Ga0496105_0016595 Ga0496105_0016595_797_1450 217
81 3300048910 Ga0496107_0015900 Ga0496107_0015900_3794_4447 217
82 3300048917 Ga0496114_0000740 Ga0496114_0000740_5690_6343 217
83 iso_pu_bacteria 2738541274 2738706311 217
84 iso_pu_bacteria 2738543028 2739328800 217
85 iso_pu_bacteria 2902799365 2902804090 217
86 iso_pu_bacteria 2904765812 2904766740 217
87 iso_pu_bacteria 2904770941 2904775248 217
88 iso_pu_bacteria 2908811453 2908814434 217
89 iso_pu_bacteria 2919420072 2919420824 217
90 iso_pu_bacteria 2919432681 2919433418 217
91 3300005329 Ga0070683_100052935 Ga0070683_1000529352 218
92 3300005329 Ga0070683_100769146 Ga0070683_1007691462 218
93 3300005334 Ga0068869_100203799 Ga0068869_1002037991 218
94 3300005337 Ga0070682_100022346 Ga0070682_1000223462 218
95 3300005338 Ga0068868_100022687 Ga0068868_1000226876 218
96 3300005339 Ga0070660_100094922 Ga0070660_1000949222 218
97 3300005345 Ga0070692_10232059 Ga0070692_102320591 218
98 3300005347 Ga0070668_100246804 Ga0070668_1002468041 218
99 3300005354 Ga0070675_100166812 Ga0070675_1001668122 218
100 3300005441 Ga0070700_100216376 Ga0070700_1002163761 218
101 3300005455 Ga0070663_100009948 Ga0070663_1000099482 218
102 3300005456 Ga0070678_100417356 Ga0070678_1004173562 218
103 3300005466 Ga0070685_10020338 Ga0070685_100203384 218
104 3300005548 Ga0070665_100020302 Ga0070665_1000203028 218
105 3300005577 Ga0068857_100257011 Ga0068857_1002570111 218
106 3300005578 Ga0068854_100239194 Ga0068854_1002391942 218
107 3300005616 Ga0068852_100157381 Ga0068852_1001573812 218
108 3300005719 Ga0068861_100184311 Ga0068861_1001843112 218
109 3300005834 Ga0068851_10022293 Ga0068851_100222932 218
110 3300005842 Ga0068858_100070628 Ga0068858_1000706282 218
111 3300005843 Ga0068860_100008609 Ga0068860_1000086098 218
112 3300005844 Ga0068862_100104296 Ga0068862_1001042963 218
113 3300005844 Ga0068862_100229328 Ga0068862_1002293281 218
114 3300009092 Ga0105250_10278800 Ga0105250_102788001 218
115 3300009098 Ga0105245_10130798 Ga0105245_101307983 218
116 3300009553 Ga0105249_10670702 Ga0105249_106707021 218
117 3300009993 Ga0105028_108579 Ga0105028_1085792 218
118 3300010375 Ga0105239_10089122 Ga0105239_100891224 218
119 3300011119 Ga0105246_10193950 Ga0105246_101939501 218
120 3300013105 Ga0157369_10471834 Ga0157369_104718341 218
121 3300013307 Ga0157372_10029028 Ga0157372_100290287 218
122 3300013308 Ga0157375_10174762 Ga0157375_101747623 218
123 3300014968 Ga0157379_10020737 Ga0157379_100207374 218
124 3300021384 Ga0213876_10015727 Ga0213876_100157274 218
125 3300025901 Ga0207688_10003531 Ga0207688_100035315 218
126 3300025901 Ga0207688_10056506 Ga0207688_100565062 218
127 3300025909 Ga0207705_10069495 Ga0207705_100694951 218
128 3300025919 Ga0207657_10185531 Ga0207657_101855312 218
129 3300025926 Ga0207659_10081641 Ga0207659_100816412 218
130 3300025927 Ga0207687_10019541 Ga0207687_100195411 218
131 3300025931 Ga0207644_10166743 Ga0207644_101667432 218
132 3300025944 Ga0207661_10059162 Ga0207661_100591623 218
133 3300025944 Ga0207661_10304329 Ga0207661_103043292 218
134 3300025972 Ga0207668_10227885 Ga0207668_102278851 218
135 3300025981 Ga0207640_10106297 Ga0207640_101062971 218
136 3300026023 Ga0207677_10038929 Ga0207677_100389292 218
137 3300026035 Ga0207703_10063966 Ga0207703_100639663 218
138 3300026067 Ga0207678_10027382 Ga0207678_100273822 218
139 3300026075 Ga0207708_10123852 Ga0207708_101238523 218
140 3300026095 Ga0207676_10043866 Ga0207676_100438665 218
141 3300026116 Ga0207674_10291548 Ga0207674_102915481 218
142 3300028379 Ga0268266_10005470 Ga0268266_100054708 218
143 3300028379 Ga0268266_10024368 Ga0268266_100243682 218
144 3300028380 Ga0268265_10258970 Ga0268265_102589701 218
145 3300031901 Ga0307406_10360275 Ga0307406_103602751 218
146 3300039437 Ga0436365_1833781 Ga0436365_1833781_9853_10509 218
147 3300048903 Ga0496100_0056805 Ga0496100_0056805_64_720 218
148 3300048904 Ga0496101_0022234 Ga0496101_0022234_416_1072 218
149 3300048905 Ga0496102_0000187 Ga0496102_0000187_27368_28024 218
150 3300048906 Ga0496103_0000126 Ga0496103_0000126_54268_54924 218
151 3300048907 Ga0496104_0140081 Ga0496104_0140081_808_1464 218
152 3300048907 Ga0496104_0305233 Ga0496104_0305233_737_1420 218
153 3300048911 Ga0496108_0021420 Ga0496108_0021420_3901_4557 218
154 3300048911 Ga0496108_0049471 Ga0496108_0049471_616_1272 218
155 3300048911 Ga0496108_0065918 Ga0496108_0065918_563_1246 218
156 3300048912 Ga0496109_0181830 Ga0496109_0181830_917_1600 218
157 3300048913 Ga0496110_0032195 Ga0496110_0032195_1491_2147 218
158 3300048913 Ga0496110_0104973 Ga0496110_0104973_1693_2349 218
159 3300048914 Ga0496111_0113591 Ga0496111_0113591_1267_1923 218
160 3300048917 Ga0496114_0227178 Ga0496114_0227178_590_1246 218
161 3300048919 Ga0496116_0000306 Ga0496116_0000306_54329_54985 218
162 3300048920 Ga0496117_0000343 Ga0496117_0000343_54131_54787 218
163 3300048921 Ga0496118_0000192 Ga0496118_0000192_52837_53493 218
164 3300048923 Ga0496120_0010816 Ga0496120_0010816_2130_2786 218
165 3300048927 Ga0496124_0017629 Ga0496124_0017629_2419_3075 218
166 3300048928 Ga0496125_0038840 Ga0496125_0038840_2580_3236 218
167 3300048929 Ga0496126_0000433 Ga0496126_0000433_55997_56653 218
168 3300049571 Ga0501034_0678794 Ga0501034_0678794_221_877 218
169 3300049591 Ga0501075_0306240 Ga0501075_0306240_188_844 218
170 iso_pu_bacteria 2643221687 2644491231 218
171 iso_pu_bacteria 2643221715 2644636587 218
172 iso_pu_bacteria 2738541264 2738667322 218
173 iso_pu_bacteria 2738541356 2739146165 218
174 iso_pu_bacteria 2738543005 2739204561 218
175 iso_pu_bacteria 2842134933 2842139538 218
176 iso_pu_bacteria 2902792274 2902797237 218
177 iso_pu_bacteria 2902810491 2902814548 218
178 iso_pu_bacteria 2902837492 2902842985 218
179 iso_pu_bacteria 2928142448 2928145400 218
180 iso_pu_bacteria 2929212328 2929217834 218
181 iso_pu_bacteria 2939582691 2939585087 218
182 3300009551 Ga0105238_10055930 Ga0105238_100559303 220
183 3300021388 Ga0213875_10002285 Ga0213875_1000228512 220
184 3300025929 Ga0207664_10470921 Ga0207664_104709212 220
185 3300026041 Ga0207639_10018244 Ga0207639_100182444 220
186 3300026142 Ga0207698_10152452 Ga0207698_101524521 220
187 3300031824 Ga0307413_10011863 Ga0307413_100118632 220
188 3300032005 Ga0307411_10019451 Ga0307411_100194513 220
189 3300037068 Ga0373925_0093905 Ga0373925_0093905_362_1030 220
190 3300037853 Ga0436364_0103584 Ga0436364_0103584_10529_11197 220
191 3300042007 Ga0439449_0051669 Ga0439449_0051669_170_841 220
192 3300044656 Ga0466969_0006911 Ga0466969_0006911_2616_3284 220
193 3300044683 Ga0466965_0018626 Ga0466965_0018626_33_698 220
194 3300044684 Ga0466966_0002923 Ga0466966_0002923_2794_3498 220
195 3300044684 Ga0466966_0003757 Ga0466966_0003757_5912_6580 220
196 3300044693 Ga0466961_0001548 Ga0466961_0001548_1892_2560 220
197 3300044693 Ga0466961_0062760 Ga0466961_0062760_853_1557 220
198 3300044719 Ga0466971_0072365 Ga0466971_0072365_46_714 220
199 3300044735 Ga0466968_0001149 Ga0466968_0001149_1853_2518 220
200 3300044765 Ga0466970_0042689 Ga0466970_0042689_1025_1729 220
201 3300044765 Ga0466970_0059807 Ga0466970_0059807_1196_1861 220
202 3300044765 Ga0466970_0211197 Ga0466970_0211197_350_1018 220
203 3300044842 Ga0466957_0029033 Ga0466957_0029033_150_815 220
204 3300044842 Ga0466957_0031979 Ga0466957_0031979_1052_1756 220
205 3300044901 Ga0466960_0000771 Ga0466960_0000771_2173_2838 220
206 3300045049 Ga0466959_0001606 Ga0466959_0001606_2421_3089 220
207 3300045049 Ga0466959_0025876 Ga0466959_0025876_3529_4194 220
208 3300045049 Ga0466959_0040983 Ga0466959_0040983_1640_2344 220
209 3300045836 Ga0466958_0047855 Ga0466958_0047855_1051_1755 220
210 3300045836 Ga0466958_0433419 Ga0466958_0433419_108_773 220
211 3300048903 Ga0496100_0430730 Ga0496100_0430730_166_831 220
212 3300048915 Ga0496112_0086809 Ga0496112_0086809_1716_2381 220
213 3300048916 Ga0496113_0068031 Ga0496113_0068031_1787_2452 220
214 3300048925 Ga0496122_0008620 Ga0496122_0008620_3496_4161 220
215 3300048926 Ga0496123_0002022 Ga0496123_0002022_17125_17790 220
216 3300048928 Ga0496125_0336277 Ga0496125_0336277_129_794 220
217 3300048929 Ga0496126_0015093 Ga0496126_0015093_1124_1789 220
218 3300061719 Ga0466962_0025036 Ga0466962_0025036_555_1223 220
219 3300002073 JGI24745J21846_1009800 JGI24745J21846_10098001 221
220 3300002244 JGI24742J22300_10031772 JGI24742J22300_100317722 221
221 3300005337 Ga0070682_100218610 Ga0070682_1002186101 221
222 3300005337 Ga0070682_100294638 Ga0070682_1002946382 221
223 3300005338 Ga0068868_100193918 Ga0068868_1001939182 221
224 3300005341 Ga0070691_10005587 Ga0070691_100055872 221
225 3300005353 Ga0070669_100252774 Ga0070669_1002527742 221
226 3300005354 Ga0070675_100051364 Ga0070675_1000513643 221
227 3300005356 Ga0070674_100041563 Ga0070674_1000415635 221
228 3300005366 Ga0070659_100221528 Ga0070659_1002215281 221
229 3300005437 Ga0070710_10024248 Ga0070710_100242484 221
230 3300005440 Ga0070705_100247432 Ga0070705_1002474321 221
231 3300005441 Ga0070700_100031279 Ga0070700_1000312791 221
232 3300005444 Ga0070694_100018473 Ga0070694_1000184731 221
233 3300005456 Ga0070678_100141677 Ga0070678_1001416773 221
234 3300005459 Ga0068867_100182354 Ga0068867_1001823541 221
235 3300005530 Ga0070679_100289051 Ga0070679_1002890513 221
236 3300005536 Ga0070697_100478066 Ga0070697_1004780661 221
237 3300005539 Ga0068853_100412292 Ga0068853_1004122921 221
238 3300005545 Ga0070695_100085306 Ga0070695_1000853062 221
239 3300005546 Ga0070696_100026576 Ga0070696_1000265761 221
240 3300005548 Ga0070665_100151143 Ga0070665_1001511433 221
241 3300005578 Ga0068854_100122094 Ga0068854_1001220943 221
242 3300005615 Ga0070702_100006048 Ga0070702_1000060482 221
243 3300005617 Ga0068859_100486812 Ga0068859_1004868122 221
244 3300005718 Ga0068866_10278952 Ga0068866_102789522 221
245 3300005842 Ga0068858_100100194 Ga0068858_1001001943 221
246 3300005843 Ga0068860_100052533 Ga0068860_1000525334 221
247 3300005844 Ga0068862_100048732 Ga0068862_1000487324 221
248 3300006038 Ga0075365_10010402 Ga0075365_100104024 221
249 3300006038 Ga0075365_10038783 Ga0075365_100387833 221
250 3300006042 Ga0075368_10008553 Ga0075368_100085533 221
251 3300006042 Ga0075368_10015687 Ga0075368_100156872 221
252 3300006048 Ga0075363_100004990 Ga0075363_1000049903 221
253 3300006048 Ga0075363_100005591 Ga0075363_1000055914 221
254 3300006048 Ga0075363_100021757 Ga0075363_1000217572 221
255 3300006048 Ga0075363_100365963 Ga0075363_1003659631 221
256 3300006051 Ga0075364_10010981 Ga0075364_100109814 221
257 3300006051 Ga0075364_10043114 Ga0075364_100431142 221
258 3300006175 Ga0070712_100031547 Ga0070712_1000315471 221
259 3300006175 Ga0070712_100270041 Ga0070712_1002700411 221
260 3300006177 Ga0075362_10043805 Ga0075362_100438052 221
261 3300006178 Ga0075367_10113946 Ga0075367_101139462 221
262 3300006186 Ga0075369_10045575 Ga0075369_100455752 221
263 3300006186 Ga0075369_10198616 Ga0075369_101986161 221
264 3300006237 Ga0097621_100076145 Ga0097621_1000761453 221
265 3300006353 Ga0075370_10002119 Ga0075370_100021194 221
266 3300006353 Ga0075370_10004134 Ga0075370_100041343 221
267 3300006353 Ga0075370_10193855 Ga0075370_101938552 221
268 3300006358 Ga0068871_100628475 Ga0068871_1006284752 221
269 3300006881 Ga0068865_100102184 Ga0068865_1001021843 221
270 3300006931 Ga0097620_100486850 Ga0097620_1004868502 221
271 3300009098 Ga0105245_10068575 Ga0105245_100685752 221
272 3300009101 Ga0105247_10034274 Ga0105247_100342742 221
273 3300009553 Ga0105249_10339793 Ga0105249_103397932 221
274 3300009553 Ga0105249_10656016 Ga0105249_106560162 221
275 3300013296 Ga0157374_10153900 Ga0157374_101539003 221
276 3300013307 Ga0157372_10070189 Ga0157372_100701892 221
277 3300013308 Ga0157375_10101066 Ga0157375_101010664 221
278 3300014326 Ga0157380_10049846 Ga0157380_100498461 221
279 3300017792 Ga0163161_10087639 Ga0163161_100876395 221
280 3300025303 Ga0209051_1027501 Ga0209051_10275012 221
281 3300025898 Ga0207692_10252024 Ga0207692_102520241 221
282 3300025901 Ga0207688_10011680 Ga0207688_100116804 221
283 3300025915 Ga0207693_10014548 Ga0207693_100145483 221
284 3300025915 Ga0207693_10513404 Ga0207693_105134042 221
285 3300025932 Ga0207690_10147931 Ga0207690_101479311 221
286 3300025933 Ga0207706_10020146 Ga0207706_100201465 221
287 3300025935 Ga0207709_10190094 Ga0207709_101900942 221
288 3300025938 Ga0207704_10126937 Ga0207704_101269373 221
289 3300025981 Ga0207640_10567177 Ga0207640_105671771 221
290 3300026023 Ga0207677_10254819 Ga0207677_102548192 221
291 3300026041 Ga0207639_10504229 Ga0207639_105042292 221
292 3300026075 Ga0207708_10024415 Ga0207708_100244155 221
293 3300026089 Ga0207648_10380952 Ga0207648_103809521 221
294 3300026118 Ga0207675_100027002 Ga0207675_1000270021 221
295 3300026121 Ga0207683_10039140 Ga0207683_100391404 221
296 3300027866 Ga0209813_10007905 Ga0209813_100079051 221
297 3300028379 Ga0268266_10229142 Ga0268266_102291421 221
298 3300028381 Ga0268264_10399488 Ga0268264_103994881 221
299 3300028381 Ga0268264_10559332 Ga0268264_105593321 221
300 3300031824 Ga0307413_10155258 Ga0307413_101552582 221
301 3300031852 Ga0307410_10085227 Ga0307410_100852272 221
302 3300031995 Ga0307409_100208747 Ga0307409_1002087471 221
303 3300032002 Ga0307416_100008033 Ga0307416_1000080332 221
304 3300032004 Ga0307414_10572730 Ga0307414_105727301 221
305 3300032126 Ga0307415_100014180 Ga0307415_1000141802 221
306 3300044842 Ga0466957_0354247 Ga0466957_0354247_169_834 221
307 3300046461 Ga0495641_0066105 Ga0495641_0066105_538_1203 221
308 3300046473 Ga0495582_0012490 Ga0495582_0012490_3658_4323 221
309 3300046474 Ga0495605_0014802 Ga0495605_0014802_2281_2946 221
310 3300046476 Ga0495662_0059262 Ga0495662_0059262_574_1239 221
311 3300046491 Ga0495584_0232619 Ga0495584_0232619_93_758 221
312 3300046492 Ga0495585_0200028 Ga0495585_0200028_106_771 221
313 3300046523 Ga0495644_0006873 Ga0495644_0006873_1463_2128 221
314 3300046525 Ga0495663_0084931 Ga0495663_0084931_299_964 221
315 3300046533 Ga0495640_0072326 Ga0495640_0072326_151_816 221
316 3300046616 Ga0495668_0059088 Ga0495668_0059088_115_780 221
317 3300046690 Ga0495624_0089241 Ga0495624_0089241_202_867 221
318 3300046691 Ga0495670_0350501 Ga0495670_0350501_90_755 221
319 3300046692 Ga0495671_0160515 Ga0495671_0160515_363_1028 221
320 3300046694 Ga0495649_0116436 Ga0495649_0116436_523_1188 221
321 3300046694 Ga0495649_0335834 Ga0495649_0335834_31_696 221
322 3300047318 Ga0495636_0163073 Ga0495636_0163073_173_838 221
323 3300047319 Ga0495674_0685573 Ga0495674_0685573_67_732 221
324 3300047320 Ga0495672_0071334 Ga0495672_0071334_292_957 221
325 3300047320 Ga0495672_0143777 Ga0495672_0143777_193_858 221
326 3300047321 Ga0495676_0396577 Ga0495676_0396577_151_816 221
327 3300047673 Ga0495593_0001036 Ga0495593_0001036_12468_13133 221
328 3300048903 Ga0496100_0152669 Ga0496100_0152669_418_1083 221
329 3300048904 Ga0496101_0056537 Ga0496101_0056537_40_705 221
330 3300048905 Ga0496102_0083933 Ga0496102_0083933_417_1082 221
331 3300048905 Ga0496102_0088422 Ga0496102_0088422_515_1180 221
332 3300048905 Ga0496102_0620779 Ga0496102_0620779_237_902 221
333 3300048906 Ga0496103_0266908 Ga0496103_0266908_224_889 221
334 3300048907 Ga0496104_0191465 Ga0496104_0191465_1175_1840 221
335 3300048908 Ga0496105_0141796 Ga0496105_0141796_1109_1903 221
336 3300048909 Ga0496106_0086429 Ga0496106_0086429_20_685 221
337 3300048909 Ga0496106_0200285 Ga0496106_0200285_223_888 221
338 3300048909 Ga0496106_0258005 Ga0496106_0258005_252_917 221
339 3300048911 Ga0496108_0550235 Ga0496108_0550235_228_893 221
340 3300048912 Ga0496109_0131394 Ga0496109_0131394_739_1404 221
341 3300048913 Ga0496110_0533657 Ga0496110_0533657_168_833 221
342 3300048915 Ga0496112_0043147 Ga0496112_0043147_835_1500 221
343 3300048915 Ga0496112_0456254 Ga0496112_0456254_235_900 221
344 3300048915 Ga0496112_0628987 Ga0496112_0628987_241_906 221
345 3300048917 Ga0496114_0263440 Ga0496114_0263440_374_1039 221
346 3300048925 Ga0496122_0314589 Ga0496122_0314589_88_753 221
347 3300048928 Ga0496125_0113555 Ga0496125_0113555_919_1584 221
348 3300048929 Ga0496126_0167002 Ga0496126_0167002_1173_1838 221
349 3300050489 nmdc:mga03683_121843_c1 nmdc:mga03683_121843_c1_99_764 221
350 3300050490 nmdc:mga03n38_144118_c1 nmdc:mga03n38_144118_c1_268_933 221
351 3300050490 nmdc:mga03n38_158113_c1 nmdc:mga03n38_158113_c1_388_1053 221
352 3300050491 nmdc:mga00v17_16349_c1 nmdc:mga00v17_16349_c1_547_1212 221
353 3300050491 nmdc:mga00v17_360791_c1 nmdc:mga00v17_360791_c1_190_864 221
354 3300050491 nmdc:mga00v17_43081_c1 nmdc:mga00v17_43081_c1_1685_2350 221
355 3300050492 nmdc:mga0yw44_19851_c1 nmdc:mga0yw44_19851_c1_438_1103 221
356 3300050492 nmdc:mga0yw44_527685_c1 nmdc:mga0yw44_527685_c1_31_696 221
357 3300050492 nmdc:mga0yw44_75812_c1 nmdc:mga0yw44_75812_c1_1325_1990 221
358 3300050494 nmdc:mga06z11_18177_c1 nmdc:mga06z11_18177_c1_1775_2440 221
359 3300050495 nmdc:mga04h51_34114_c1 nmdc:mga04h51_34114_c1_404_1069 221
360 3300050496 nmdc:mga07m45_3155_c1 nmdc:mga07m45_3155_c1_4290_4955 221
361 3300050496 nmdc:mga07m45_67220_c1 nmdc:mga07m45_67220_c1_695_1360 221
362 3300050496 nmdc:mga07m45_8036_c1 nmdc:mga07m45_8036_c1_97_762 221
363 3300050516 nmdc:mga0sz30_108537_c2 nmdc:mga0sz30_108537_c2_210_875 221
364 3300050516 nmdc:mga0sz30_64232_c1 nmdc:mga0sz30_64232_c1_98_763 221
365 3300050516 nmdc:mga0sz30_99840_c1 nmdc:mga0sz30_99840_c1_112_777 221
366 3300053080 Ga0500635_0124215 Ga0500635_0124215_254_919 221
367 3300053087 Ga0500643_002089 Ga0500643_002089_6493_7158 221
368 3300053092 Ga0500583_0083800 Ga0500583_0083800_749_1414 221
369 3300053122 Ga0500608_215978 Ga0500608_215978_36_701 221
370 3300053134 Ga0500658_0039142 Ga0500658_0039142_233_898 221
371 3300053136 Ga0500559_0037586 Ga0500559_0037586_1389_2054 221
372 3300053158 Ga0500627_0067441 Ga0500627_0067441_472_1137 221
373 3300053730 Ga0500645_005909 Ga0500645_005909_1758_2423 221
374 3300000546 LJNas_1012286 LJNas_10122861 222
375 3300001989 JGI24739J22299_10125974 JGI24739J22299_101259741 222
376 3300001990 JGI24737J22298_10030599 JGI24737J22298_100305992 222
377 3300002076 JGI24749J21850_1014234 JGI24749J21850_10142342 222
378 3300002077 JGI24744J21845_10000136 JGI24744J21845_1000013610 222
379 3300002244 JGI24742J22300_10011007 JGI24742J22300_100110072 222
380 3300002459 JGI24751J29686_10015836 JGI24751J29686_100158362 222
381 3300003320 rootH2_10067513 rootH2_100675131 222
382 3300003792 Ga0055540_1000071 Ga0055540_100007134 222
383 3300003792 Ga0055540_1000902 Ga0055540_100090210 222
384 3300005328 Ga0070676_10024311 Ga0070676_100243112 222
385 3300005328 Ga0070676_10139279 Ga0070676_101392792 222
386 3300005330 Ga0070690_100002173 Ga0070690_1000021736 222
387 3300005331 Ga0070670_100207599 Ga0070670_1002075992 222
388 3300005334 Ga0068869_100004732 Ga0068869_1000047326 222
389 3300005335 Ga0070666_10013750 Ga0070666_100137503 222
390 3300005335 Ga0070666_10126881 Ga0070666_101268812 222
391 3300005336 Ga0070680_100699713 Ga0070680_1006997131 222
392 3300005337 Ga0070682_100012353 Ga0070682_1000123532 222
393 3300005337 Ga0070682_100030315 Ga0070682_1000303153 222
394 3300005337 Ga0070682_100094097 Ga0070682_1000940972 222
395 3300005338 Ga0068868_100008527 Ga0068868_1000085272 222
396 3300005338 Ga0068868_100009899 Ga0068868_1000098992 222
397 3300005339 Ga0070660_100070107 Ga0070660_1000701073 222
398 3300005339 Ga0070660_100088769 Ga0070660_1000887692 222
399 3300005340 Ga0070689_100077266 Ga0070689_1000772662 222
400 3300005340 Ga0070689_100151445 Ga0070689_1001514452 222
401 3300005341 Ga0070691_10081574 Ga0070691_100815742 222
402 3300005343 Ga0070687_100121762 Ga0070687_1001217621 222
403 3300005345 Ga0070692_10110543 Ga0070692_101105432 222
404 3300005347 Ga0070668_100005229 Ga0070668_1000052294 222
405 3300005347 Ga0070668_100052330 Ga0070668_1000523302 222
406 3300005347 Ga0070668_100191654 Ga0070668_1001916542 222
407 3300005347 Ga0070668_100226627 Ga0070668_1002266272 222
408 3300005347 Ga0070668_100243721 Ga0070668_1002437212 222
409 3300005353 Ga0070669_100010528 Ga0070669_1000105282 222
410 3300005353 Ga0070669_100044117 Ga0070669_1000441174 222
411 3300005355 Ga0070671_100009134 Ga0070671_1000091348 222
412 3300005355 Ga0070671_100093292 Ga0070671_1000932922 222
413 3300005355 Ga0070671_100257157 Ga0070671_1002571572 222
414 3300005356 Ga0070674_100000655 Ga0070674_10000065519 222
415 3300005356 Ga0070674_100307729 Ga0070674_1003077292 222
416 3300005365 Ga0070688_100060689 Ga0070688_1000606892 222
417 3300005365 Ga0070688_100115088 Ga0070688_1001150882 222
418 3300005367 Ga0070667_100000142 Ga0070667_1000001426 222
419 3300005367 Ga0070667_100000995 Ga0070667_1000009954 222
420 3300005367 Ga0070667_100014600 Ga0070667_1000146006 222
421 3300005367 Ga0070667_100069849 Ga0070667_1000698492 222
422 3300005434 Ga0070709_10172443 Ga0070709_101724432 222
423 3300005434 Ga0070709_10381444 Ga0070709_103814442 222
424 3300005436 Ga0070713_100018383 Ga0070713_1000183832 222
425 3300005436 Ga0070713_100140903 Ga0070713_1001409032 222
426 3300005437 Ga0070710_10011265 Ga0070710_100112654 222
427 3300005437 Ga0070710_10026599 Ga0070710_100265992 222
428 3300005438 Ga0070701_10008728 Ga0070701_100087282 222
429 3300005438 Ga0070701_10167071 Ga0070701_101670712 222
430 3300005439 Ga0070711_100002645 Ga0070711_1000026456 222
431 3300005439 Ga0070711_100002984 Ga0070711_1000029846 222
432 3300005440 Ga0070705_100005990 Ga0070705_1000059902 222
433 3300005440 Ga0070705_100007640 Ga0070705_1000076401 222
434 3300005441 Ga0070700_100011827 Ga0070700_1000118272 222
435 3300005441 Ga0070700_100197161 Ga0070700_1001971612 222
436 3300005444 Ga0070694_100322319 Ga0070694_1003223191 222
437 3300005445 Ga0070708_100238597 Ga0070708_1002385972 222
438 3300005455 Ga0070663_100014355 Ga0070663_1000143554 222
439 3300005455 Ga0070663_100095330 Ga0070663_1000953302 222
440 3300005455 Ga0070663_100198735 Ga0070663_1001987352 222
441 3300005456 Ga0070678_100001005 Ga0070678_10000100512 222
442 3300005457 Ga0070662_100006072 Ga0070662_1000060723 222
443 3300005459 Ga0068867_100007222 Ga0068867_1000072223 222
444 3300005459 Ga0068867_100366433 Ga0068867_1003664331 222
445 3300005539 Ga0068853_100001093 Ga0068853_10000109310 222
446 3300005539 Ga0068853_100004917 Ga0068853_1000049177 222
447 3300005539 Ga0068853_100166435 Ga0068853_1001664352 222
448 3300005546 Ga0070696_100124042 Ga0070696_1001240422 222
449 3300005547 Ga0070693_100071876 Ga0070693_1000718762 222
450 3300005547 Ga0070693_100379726 Ga0070693_1003797262 222
451 3300005548 Ga0070665_100004853 Ga0070665_10000485316 222
452 3300005548 Ga0070665_100035221 Ga0070665_1000352211 222
453 3300005548 Ga0070665_101148117 Ga0070665_1011481171 222
454 3300005549 Ga0070704_100002883 Ga0070704_1000028834 222
455 3300005549 Ga0070704_100178281 Ga0070704_1001782811 222
456 3300005549 Ga0070704_100374113 Ga0070704_1003741131 222
457 3300005563 Ga0068855_100422094 Ga0068855_1004220942 222
458 3300005577 Ga0068857_101056716 Ga0068857_1010567162 222
459 3300005578 Ga0068854_100003576 Ga0068854_1000035764 222
460 3300005578 Ga0068854_100115916 Ga0068854_1001159162 222
461 3300005578 Ga0068854_100231562 Ga0068854_1002315622 222
462 3300005614 Ga0068856_100113856 Ga0068856_1001138562 222
463 3300005614 Ga0068856_101118079 Ga0068856_1011180791 222
464 3300005615 Ga0070702_100105928 Ga0070702_1001059282 222
465 3300005616 Ga0068852_100034773 Ga0068852_1000347734 222
466 3300005616 Ga0068852_100071410 Ga0068852_1000714102 222
467 3300005617 Ga0068859_100004138 Ga0068859_10000413814 222
468 3300005617 Ga0068859_100010110 Ga0068859_1000101107 222
469 3300005617 Ga0068859_100078249 Ga0068859_1000782492 222
470 3300005618 Ga0068864_100402641 Ga0068864_1004026412 222
471 3300005618 Ga0068864_100717458 Ga0068864_1007174581 222
472 3300005718 Ga0068866_10004953 Ga0068866_100049534 222
473 3300005718 Ga0068866_10172284 Ga0068866_101722842 222
474 3300005719 Ga0068861_100002600 Ga0068861_1000026006 222
475 3300005719 Ga0068861_100019623 Ga0068861_1000196232 222
476 3300005719 Ga0068861_100038805 Ga0068861_1000388052 222
477 3300005719 Ga0068861_100072845 Ga0068861_1000728452 222
478 3300005719 Ga0068861_100191882 Ga0068861_1001918822 222
479 3300005841 Ga0068863_100000105 Ga0068863_10000010538 222
480 3300005841 Ga0068863_100041233 Ga0068863_1000412333 222
481 3300005841 Ga0068863_100124538 Ga0068863_1001245382 222
482 3300005841 Ga0068863_100381647 Ga0068863_1003816472 222
483 3300005842 Ga0068858_100003568 Ga0068858_1000035682 222
484 3300005842 Ga0068858_100004234 Ga0068858_10000423411 222
485 3300005843 Ga0068860_100000209 Ga0068860_10000020937 222
486 3300005843 Ga0068860_100982419 Ga0068860_1009824191 222
487 3300005844 Ga0068862_100000400 Ga0068862_10000040038 222
488 3300005844 Ga0068862_100002572 Ga0068862_1000025727 222
489 3300005844 Ga0068862_100163475 Ga0068862_1001634752 222
490 3300005844 Ga0068862_100388237 Ga0068862_1003882372 222
491 3300005937 Ga0081455_10047499 Ga0081455_100474992 222
492 3300005937 Ga0081455_10094873 Ga0081455_100948732 222
493 3300006038 Ga0075365_10070006 Ga0075365_100700062 222
494 3300006038 Ga0075365_10116061 Ga0075365_101160612 222
495 3300006038 Ga0075365_10171014 Ga0075365_101710142 222
496 3300006042 Ga0075368_10212463 Ga0075368_102124631 222
497 3300006048 Ga0075363_100000884 Ga0075363_1000008848 222
498 3300006051 Ga0075364_10000352 Ga0075364_100003522 222
499 3300006051 Ga0075364_10004512 Ga0075364_100045123 222
500 3300006051 Ga0075364_10007606 Ga0075364_100076064 222
501 3300006051 Ga0075364_10044618 Ga0075364_100446182 222
502 3300006051 Ga0075364_10068519 Ga0075364_100685192 222
503 3300006051 Ga0075364_10211240 Ga0075364_102112402 222
504 3300006051 Ga0075364_10225279 Ga0075364_102252792 222
505 3300006163 Ga0070715_10007794 Ga0070715_100077942 222
506 3300006173 Ga0070716_100011007 Ga0070716_1000110076 222
507 3300006173 Ga0070716_100052433 Ga0070716_1000524332 222
508 3300006175 Ga0070712_100002129 Ga0070712_1000021292 222
509 3300006175 Ga0070712_100014884 Ga0070712_1000148842 222
510 3300006177 Ga0075362_10188957 Ga0075362_101889572 222
511 3300006186 Ga0075369_10008349 Ga0075369_100083492 222
512 3300006186 Ga0075369_10017624 Ga0075369_100176243 222
513 3300006186 Ga0075369_10018475 Ga0075369_100184753 222
514 3300006237 Ga0097621_100013052 Ga0097621_1000130522 222
515 3300006353 Ga0075370_10021002 Ga0075370_100210022 222
516 3300006353 Ga0075370_10027253 Ga0075370_100272532 222
517 3300006353 Ga0075370_10136709 Ga0075370_101367092 222
518 3300006353 Ga0075370_10231666 Ga0075370_102316662 222
519 3300006358 Ga0068871_100110785 Ga0068871_1001107853 222
520 3300006844 Ga0075428_100004290 Ga0075428_10000429017 222
521 3300006844 Ga0075428_100552703 Ga0075428_1005527032 222
522 3300006846 Ga0075430_100175480 Ga0075430_1001754802 222
523 3300006846 Ga0075430_100661152 Ga0075430_1006611522 222
524 3300006881 Ga0068865_100003040 Ga0068865_1000030408 222
525 3300006881 Ga0068865_100167476 Ga0068865_1001674762 222
526 3300006931 Ga0097620_100004138 Ga0097620_1000041384 222
527 3300006931 Ga0097620_100010110 Ga0097620_1000101103 222
528 3300006931 Ga0097620_100078249 Ga0097620_1000782492 222
529 3300007788 Ga0099795_10005850 Ga0099795_100058502 222
530 3300009093 Ga0105240_10459681 Ga0105240_104596813 222
531 3300009094 Ga0111539_11465630 Ga0111539_114656301 222
532 3300009098 Ga0105245_10002210 Ga0105245_1000221014 222
533 3300009098 Ga0105245_10692328 Ga0105245_106923281 222
534 3300009101 Ga0105247_10000141 Ga0105247_1000014135 222
535 3300009101 Ga0105247_10001401 Ga0105247_1000140118 222
536 3300009101 Ga0105247_10011479 Ga0105247_100114792 222
537 3300009147 Ga0114129_10021114 Ga0114129_100211144 222
538 3300009148 Ga0105243_10000877 Ga0105243_1000087716 222
539 3300009148 Ga0105243_10030337 Ga0105243_100303374 222
540 3300009148 Ga0105243_11347761 Ga0105243_113477611 222
541 3300009174 Ga0105241_10007147 Ga0105241_100071474 222
542 3300009174 Ga0105241_10228835 Ga0105241_102288352 222
543 3300009176 Ga0105242_10020529 Ga0105242_100205293 222
544 3300009176 Ga0105242_10038522 Ga0105242_100385222 222
545 3300009177 Ga0105248_10000242 Ga0105248_100002422 222
546 3300009177 Ga0105248_10012476 Ga0105248_100124767 222
547 3300009177 Ga0105248_10041777 Ga0105248_100417773 222
548 3300009177 Ga0105248_11096772 Ga0105248_110967721 222
549 3300009545 Ga0105237_10036231 Ga0105237_100362315 222
550 3300009545 Ga0105237_10042277 Ga0105237_100422772 222
551 3300009545 Ga0105237_10048790 Ga0105237_100487904 222
552 3300009553 Ga0105249_10000031 Ga0105249_10000031194 222
553 3300009553 Ga0105249_10003161 Ga0105249_100031616 222
554 3300009553 Ga0105249_10965351 Ga0105249_109653512 222
555 3300010375 Ga0105239_10004174 Ga0105239_100041746 222
556 3300010375 Ga0105239_10020858 Ga0105239_100208586 222
557 3300010375 Ga0105239_10055735 Ga0105239_100557354 222
558 3300011119 Ga0105246_10017764 Ga0105246_100177645 222
559 3300013102 Ga0157371_10312418 Ga0157371_103124182 222
560 3300013104 Ga0157370_10521252 Ga0157370_105212522 222
561 3300013105 Ga0157369_10284159 Ga0157369_102841592 222
562 3300013105 Ga0157369_10327051 Ga0157369_103270512 222
563 3300013296 Ga0157374_10074664 Ga0157374_100746642 222
564 3300013296 Ga0157374_10454243 Ga0157374_104542432 222
565 3300013297 Ga0157378_10018228 Ga0157378_100182284 222
566 3300013297 Ga0157378_10023912 Ga0157378_100239124 222
567 3300013306 Ga0163162_10008665 Ga0163162_100086659 222
568 3300013306 Ga0163162_10032962 Ga0163162_100329623 222
569 3300013306 Ga0163162_10584408 Ga0163162_105844082 222
570 3300013307 Ga0157372_10009627 Ga0157372_100096277 222
571 3300013308 Ga0157375_10002285 Ga0157375_1000228516 222
572 3300013308 Ga0157375_10208432 Ga0157375_102084322 222
573 3300014325 Ga0163163_10140656 Ga0163163_101406562 222
574 3300014325 Ga0163163_10424854 Ga0163163_104248542 222
575 3300014325 Ga0163163_10575686 Ga0163163_105756861 222
576 3300014326 Ga0157380_10000802 Ga0157380_1000080212 222
577 3300014745 Ga0157377_10053568 Ga0157377_100535682 222
578 3300014745 Ga0157377_10261786 Ga0157377_102617861 222
579 3300014968 Ga0157379_10123822 Ga0157379_101238222 222
580 3300014968 Ga0157379_10132853 Ga0157379_101328532 222
581 3300014969 Ga0157376_10178951 Ga0157376_101789512 222
582 3300017792 Ga0163161_10001861 Ga0163161_1000186118 222
583 3300021388 Ga0213875_10129179 Ga0213875_101291792 222
584 3300025273 Ga0209673_1061553 Ga0209673_10615532 222
585 3300025303 Ga0209051_1000033 Ga0209051_1000033265 222
586 3300025303 Ga0209051_1001346 Ga0209051_100134613 222
587 3300025303 Ga0209051_1001746 Ga0209051_10017468 222
588 3300025303 Ga0209051_1094404 Ga0209051_10944042 222
589 3300025315 Ga0207697_10168474 Ga0207697_101684741 222
590 3300025711 Ga0207696_1082045 Ga0207696_10820452 222
591 3300025898 Ga0207692_10154648 Ga0207692_101546482 222
592 3300025899 Ga0207642_10020605 Ga0207642_100206052 222
593 3300025899 Ga0207642_10099353 Ga0207642_100993532 222
594 3300025900 Ga0207710_10000164 Ga0207710_1000016435 222
595 3300025900 Ga0207710_10000901 Ga0207710_1000090119 222
596 3300025900 Ga0207710_10105310 Ga0207710_101053102 222
597 3300025901 Ga0207688_10000489 Ga0207688_1000048911 222
598 3300025901 Ga0207688_10003799 Ga0207688_100037993 222
599 3300025901 Ga0207688_10088507 Ga0207688_100885072 222
600 3300025901 Ga0207688_10105985 Ga0207688_101059852 222
601 3300025903 Ga0207680_10160495 Ga0207680_101604952 222
602 3300025904 Ga0207647_10017184 Ga0207647_100171842 222
603 3300025904 Ga0207647_10028191 Ga0207647_100281912 222
604 3300025905 Ga0207685_10004576 Ga0207685_100045763 222
605 3300025906 Ga0207699_10134742 Ga0207699_101347422 222
606 3300025907 Ga0207645_10020919 Ga0207645_100209192 222
607 3300025907 Ga0207645_10048293 Ga0207645_100482932 222
608 3300025911 Ga0207654_10032174 Ga0207654_100321742 222
609 3300025913 Ga0207695_10133359 Ga0207695_101333592 222
610 3300025914 Ga0207671_10043825 Ga0207671_100438252 222
611 3300025915 Ga0207693_10003251 Ga0207693_1000325111 222
612 3300025915 Ga0207693_10008923 Ga0207693_100089234 222
613 3300025916 Ga0207663_10001940 Ga0207663_100019406 222
614 3300025916 Ga0207663_10037667 Ga0207663_100376672 222
615 3300025923 Ga0207681_10003879 Ga0207681_100038799 222
616 3300025923 Ga0207681_10196019 Ga0207681_101960192 222
617 3300025927 Ga0207687_10001856 Ga0207687_1000185614 222
618 3300025927 Ga0207687_10430869 Ga0207687_104308691 222
619 3300025928 Ga0207700_10449531 Ga0207700_104495311 222
620 3300025928 Ga0207700_10652159 Ga0207700_106521591 222
621 3300025929 Ga0207664_10162629 Ga0207664_101626292 222
622 3300025931 Ga0207644_10007265 Ga0207644_100072657 222
623 3300025931 Ga0207644_10190872 Ga0207644_101908722 222
624 3300025932 Ga0207690_10104632 Ga0207690_101046322 222
625 3300025933 Ga0207706_10001630 Ga0207706_1000163016 222
626 3300025933 Ga0207706_10009481 Ga0207706_100094814 222
627 3300025935 Ga0207709_10001857 Ga0207709_1000185714 222
628 3300025936 Ga0207670_10246650 Ga0207670_102466502 222
629 3300025937 Ga0207669_10000247 Ga0207669_1000024714 222
630 3300025937 Ga0207669_10075825 Ga0207669_100758252 222
631 3300025938 Ga0207704_10302328 Ga0207704_103023282 222
632 3300025938 Ga0207704_10879959 Ga0207704_108799591 222
633 3300025939 Ga0207665_10006954 Ga0207665_100069547 222
634 3300025939 Ga0207665_10033565 Ga0207665_100335651 222
635 3300025941 Ga0207711_10000196 Ga0207711_1000019632 222
636 3300025941 Ga0207711_10007688 Ga0207711_100076882 222
637 3300025941 Ga0207711_10014846 Ga0207711_100148463 222
638 3300025942 Ga0207689_10010685 Ga0207689_100106857 222
639 3300025942 Ga0207689_10350740 Ga0207689_103507402 222
640 3300025942 Ga0207689_10363271 Ga0207689_103632712 222
641 3300025942 Ga0207689_10606462 Ga0207689_106064621 222
642 3300025960 Ga0207651_10072512 Ga0207651_100725123 222
643 3300025961 Ga0207712_10000029 Ga0207712_10000029194 222
644 3300025961 Ga0207712_10006529 Ga0207712_100065296 222
645 3300025961 Ga0207712_10037734 Ga0207712_100377342 222
646 3300025961 Ga0207712_10495532 Ga0207712_104955321 222
647 3300025972 Ga0207668_10004559 Ga0207668_100045592 222
648 3300025972 Ga0207668_10159708 Ga0207668_101597082 222
649 3300025972 Ga0207668_10244930 Ga0207668_102449302 222
650 3300025981 Ga0207640_10182661 Ga0207640_101826612 222
651 3300025986 Ga0207658_10000113 Ga0207658_100001134 222
652 3300025986 Ga0207658_10000850 Ga0207658_100008502 222
653 3300025986 Ga0207658_10061665 Ga0207658_100616653 222
654 3300025986 Ga0207658_10076005 Ga0207658_100760052 222
655 3300026023 Ga0207677_10062822 Ga0207677_100628222 222
656 3300026023 Ga0207677_10468159 Ga0207677_104681592 222
657 3300026035 Ga0207703_10009286 Ga0207703_100092864 222
658 3300026035 Ga0207703_10042166 Ga0207703_100421664 222
659 3300026041 Ga0207639_10017851 Ga0207639_100178513 222
660 3300026041 Ga0207639_10041000 Ga0207639_100410003 222
661 3300026041 Ga0207639_10185436 Ga0207639_101854362 222
662 3300026067 Ga0207678_10007288 Ga0207678_100072885 222
663 3300026067 Ga0207678_10013099 Ga0207678_100130994 222
664 3300026067 Ga0207678_10048063 Ga0207678_100480632 222
665 3300026075 Ga0207708_10017230 Ga0207708_100172302 222
666 3300026075 Ga0207708_10095231 Ga0207708_100952312 222
667 3300026078 Ga0207702_10178536 Ga0207702_101785362 222
668 3300026078 Ga0207702_10925332 Ga0207702_109253321 222
669 3300026088 Ga0207641_10000581 Ga0207641_1000058123 222
670 3300026088 Ga0207641_10009336 Ga0207641_100093366 222
671 3300026088 Ga0207641_10254862 Ga0207641_102548622 222
672 3300026088 Ga0207641_10375487 Ga0207641_103754872 222
673 3300026089 Ga0207648_10003694 Ga0207648_100036943 222
674 3300026089 Ga0207648_10025471 Ga0207648_100254714 222
675 3300026095 Ga0207676_10331923 Ga0207676_103319231 222
676 3300026118 Ga0207675_100002945 Ga0207675_1000029455 222
677 3300026118 Ga0207675_100141399 Ga0207675_1001413992 222
678 3300026118 Ga0207675_100213073 Ga0207675_1002130732 222
679 3300026118 Ga0207675_100845835 Ga0207675_1008458351 222
680 3300026121 Ga0207683_10002056 Ga0207683_1000205620 222
681 3300026121 Ga0207683_10167976 Ga0207683_101679763 222
682 3300027866 Ga0209813_10028970 Ga0209813_100289702 222
683 3300028379 Ga0268266_10002346 Ga0268266_1000234612 222
684 3300028379 Ga0268266_10009545 Ga0268266_100095452 222
685 3300028379 Ga0268266_10561158 Ga0268266_105611581 222
686 3300028380 Ga0268265_10000389 Ga0268265_1000038937 222
687 3300028380 Ga0268265_10015507 Ga0268265_100155073 222
688 3300028380 Ga0268265_10504661 Ga0268265_105046612 222
689 3300028381 Ga0268264_10000017 Ga0268264_10000017182 222
690 3300028381 Ga0268264_10003370 Ga0268264_100033702 222
691 3300028381 Ga0268264_10065616 Ga0268264_100656163 222
692 3300028381 Ga0268264_10551298 Ga0268264_105512982 222
693 3300031251 Ga0265327_10005155 Ga0265327_100051559 222
694 3300031852 Ga0307410_10236001 Ga0307410_102360011 222
695 3300031903 Ga0307407_10299772 Ga0307407_102997722 222
696 3300031995 Ga0307409_100572613 Ga0307409_1005726132 222
697 3300031995 Ga0307409_100583494 Ga0307409_1005834941 222
698 3300032005 Ga0307411_10455732 Ga0307411_104557322 222
699 3300032126 Ga0307415_100254600 Ga0307415_1002546001 222
700 3300035085 Ga0373929_0019268 Ga0373929_0019268_419_1087 222
701 3300035092 Ga0373952_0047262 Ga0373952_0047262_212_880 222
702 3300035112 Ga0373932_0094504 Ga0373932_0094504_276_944 222
703 3300035114 Ga0373939_0110176 Ga0373939_0110176_270_938 222
704 3300035115 Ga0373941_0213206 Ga0373941_0213206_54_722 222
705 3300035242 Ga0373962_0061104 Ga0373962_0061104_106_774 222
706 3300035691 Ga0373931_0009804 Ga0373931_0009804_1799_2467 222
707 3300035691 Ga0373931_0073050 Ga0373931_0073050_748_1416 222
708 3300037853 Ga0436364_0863821 Ga0436364_0863821_142_813 222
709 3300037853 Ga0436364_0872298 Ga0436364_0872298_2138_2812 222
710 3300039437 Ga0436365_0468901 Ga0436365_0468901_974_1660 222
711 3300039437 Ga0436365_0671847 Ga0436365_0671847_30617_31285 222
712 3300039437 Ga0436365_1818399 Ga0436365_1818399_16991_17659 222
713 3300039450 Ga0436363_0028512 Ga0436363_0028512_356_1024 222
714 3300039450 Ga0436363_0144694 Ga0436363_0144694_2198_2866 222
715 3300039450 Ga0436363_1020415 Ga0436363_1020415_384_1052 222
716 3300039453 Ga0436362_0209322 Ga0436362_0209322_395_1132 222
717 3300039453 Ga0436362_1118236 Ga0436362_1118236_503_1171 222
718 3300041410 Ga0439461_0012679 Ga0439461_0012679_276_944 222
719 3300041411 Ga0439466_0011616 Ga0439466_0011616_589_1257 222
720 3300041411 Ga0439466_0028438 Ga0439466_0028438_754_1422 222
721 3300041413 Ga0439465_0003685 Ga0439465_0003685_2177_2845 222
722 3300041413 Ga0439465_0012464 Ga0439465_0012464_182_850 222
723 3300041441 Ga0451787_712210 Ga0451787_712210_15_683 222
724 3300041452 Ga0451793_0046954 Ga0451793_0046954_802_1470 222
725 3300041456 Ga0451795_0047719 Ga0451795_0047719_158_826 222
726 3300041997 Ga0439431_0003085 Ga0439431_0003085_2835_3503 222
727 3300041997 Ga0439431_0006682 Ga0439431_0006682_1136_1804 222
728 3300042002 Ga0439442_002061 Ga0439442_002061_290_958 222
729 3300042004 Ga0439445_0000875 Ga0439445_0000875_2929_3597 222
730 3300042004 Ga0439445_0003741 Ga0439445_0003741_389_1057 222
731 3300042005 Ga0439448_0068831 Ga0439448_0068831_150_818 222
732 3300042016 Ga0439463_073115 Ga0439463_073115_179_847 222
733 3300044683 Ga0466965_0001978 Ga0466965_0001978_568_1236 222
734 3300044684 Ga0466966_0003280 Ga0466966_0003280_8505_9173 222
735 3300044684 Ga0466966_0128433 Ga0466966_0128433_414_1082 222
736 3300044693 Ga0466961_0015228 Ga0466961_0015228_2709_3377 222
737 3300044693 Ga0466961_0016908 Ga0466961_0016908_3326_3994 222
738 3300044694 Ga0466963_0073901 Ga0466963_0073901_643_1311 222
739 3300044694 Ga0466963_0091657 Ga0466963_0091657_144_812 222
740 3300044694 Ga0466963_0451980 Ga0466963_0451980_150_818 222
741 3300044694 Ga0466963_0476151 Ga0466963_0476151_109_792 222
742 3300044719 Ga0466971_0015984 Ga0466971_0015984_1470_2138 222
743 3300044719 Ga0466971_0039555 Ga0466971_0039555_1222_1890 222
744 3300044735 Ga0466968_0002680 Ga0466968_0002680_2574_3242 222
745 3300044735 Ga0466968_0222288 Ga0466968_0222288_64_732 222
746 3300044765 Ga0466970_0009842 Ga0466970_0009842_893_1561 222
747 3300044765 Ga0466970_0260256 Ga0466970_0260256_205_873 222
748 3300044842 Ga0466957_0151901 Ga0466957_0151901_311_979 222
749 3300044842 Ga0466957_0339239 Ga0466957_0339239_285_953 222
750 3300044901 Ga0466960_0000284 Ga0466960_0000284_13994_14662 222
751 3300044901 Ga0466960_0000936 Ga0466960_0000936_957_1625 222
752 3300044901 Ga0466960_0427324 Ga0466960_0427324_22_690 222
753 3300045049 Ga0466959_0004912 Ga0466959_0004912_6976_7644 222
754 3300045049 Ga0466959_0048146 Ga0466959_0048146_777_1445 222
755 3300045049 Ga0466959_0175721 Ga0466959_0175721_354_1022 222
756 3300045836 Ga0466958_0014460 Ga0466958_0014460_822_1490 222
757 3300045836 Ga0466958_0037233 Ga0466958_0037233_370_1038 222
758 3300045976 Ga0466967_0013842 Ga0466967_0013842_615_1283 222
759 3300045976 Ga0466967_0065477 Ga0466967_0065477_392_1060 222
760 3300045976 Ga0466967_0081069 Ga0466967_0081069_675_1343 222
761 3300045976 Ga0466967_0221318 Ga0466967_0221318_680_1348 222
762 3300045976 Ga0466967_0672300 Ga0466967_0672300_227_907 222
763 3300046460 Ga0495638_0009441 Ga0495638_0009441_2980_3648 222
764 3300046460 Ga0495638_0019859 Ga0495638_0019859_1472_2140 222
765 3300046524 Ga0495648_0005202 Ga0495648_0005202_5358_6026 222
766 3300046616 Ga0495668_0016771 Ga0495668_0016771_2224_2892 222
767 3300046616 Ga0495668_0223583 Ga0495668_0223583_295_963 222
768 3300046616 Ga0495668_0270441 Ga0495668_0270441_204_872 222
769 3300046694 Ga0495649_0116713 Ga0495649_0116713_691_1359 222
770 3300047320 Ga0495672_0167182 Ga0495672_0167182_425_1093 222
771 3300047320 Ga0495672_0192261 Ga0495672_0192261_71_739 222
772 3300047469 Ga0495673_0000524 Ga0495673_0000524_34060_34728 222
773 3300047472 Ga0495686_0002996 Ga0495686_0002996_3142_3810 222
774 3300048903 Ga0496100_0000090 Ga0496100_0000090_24386_25054 222
775 3300048903 Ga0496100_0000358 Ga0496100_0000358_12445_13113 222
776 3300048903 Ga0496100_0000576 Ga0496100_0000576_10511_11179 222
777 3300048903 Ga0496100_0000826 Ga0496100_0000826_5677_6345 222
778 3300048904 Ga0496101_0000031 Ga0496101_0000031_86137_86805 222
779 3300048904 Ga0496101_0000409 Ga0496101_0000409_2729_3397 222
780 3300048904 Ga0496101_0001670 Ga0496101_0001670_6141_6809 222
781 3300048904 Ga0496101_0223395 Ga0496101_0223395_75_743 222
782 3300048904 Ga0496101_0300293 Ga0496101_0300293_495_1163 222
783 3300048904 Ga0496101_0573223 Ga0496101_0573223_149_817 222
784 3300048905 Ga0496102_0000065 Ga0496102_0000065_132576_133244 222
785 3300048905 Ga0496102_0000387 Ga0496102_0000387_21295_21963 222
786 3300048905 Ga0496102_0002397 Ga0496102_0002397_6009_6677 222
787 3300048905 Ga0496102_0008246 Ga0496102_0008246_882_1550 222
788 3300048905 Ga0496102_0034168 Ga0496102_0034168_3088_3756 222
789 3300048905 Ga0496102_0034723 Ga0496102_0034723_1959_2627 222
790 3300048905 Ga0496102_0081212 Ga0496102_0081212_999_1667 222
791 3300048905 Ga0496102_0288122 Ga0496102_0288122_821_1489 222
792 3300048906 Ga0496103_0000048 Ga0496103_0000048_132117_132785 222
793 3300048906 Ga0496103_0000292 Ga0496103_0000292_15621_16289 222
794 3300048906 Ga0496103_0001655 Ga0496103_0001655_13232_13900 222
795 3300048906 Ga0496103_0018603 Ga0496103_0018603_1430_2098 222
796 3300048906 Ga0496103_0092143 Ga0496103_0092143_260_928 222
797 3300048907 Ga0496104_0020189 Ga0496104_0020189_5146_5814 222
798 3300048907 Ga0496104_0113942 Ga0496104_0113942_845_1513 222
799 3300048907 Ga0496104_0221750 Ga0496104_0221750_111_779 222
800 3300048908 Ga0496105_0010809 Ga0496105_0010809_1222_1890 222
801 3300048908 Ga0496105_0103573 Ga0496105_0103573_1080_1748 222
802 3300048909 Ga0496106_0002589 Ga0496106_0002589_2766_3434 222
803 3300048909 Ga0496106_0020022 Ga0496106_0020022_960_1628 222
804 3300048909 Ga0496106_0048358 Ga0496106_0048358_2113_2781 222
805 3300048909 Ga0496106_0583215 Ga0496106_0583215_211_879 222
806 3300048910 Ga0496107_0004431 Ga0496107_0004431_6658_7326 222
807 3300048910 Ga0496107_0005397 Ga0496107_0005397_6855_7523 222
808 3300048910 Ga0496107_0027297 Ga0496107_0027297_1009_1677 222
809 3300048910 Ga0496107_0181389 Ga0496107_0181389_685_1353 222
810 3300048911 Ga0496108_0011488 Ga0496108_0011488_3293_3961 222
811 3300048911 Ga0496108_0029357 Ga0496108_0029357_2948_3616 222
812 3300048911 Ga0496108_0099750 Ga0496108_0099750_441_1109 222
813 3300048911 Ga0496108_0155881 Ga0496108_0155881_358_1026 222
814 3300048912 Ga0496109_0000134 Ga0496109_0000134_50583_51251 222
815 3300048912 Ga0496109_0189902 Ga0496109_0189902_1185_1853 222
816 3300048913 Ga0496110_0024896 Ga0496110_0024896_634_1302 222
817 3300048913 Ga0496110_0038335 Ga0496110_0038335_340_1008 222
818 3300048914 Ga0496111_0002609 Ga0496111_0002609_279_947 222
819 3300048914 Ga0496111_0087238 Ga0496111_0087238_1330_1998 222
820 3300048914 Ga0496111_0105904 Ga0496111_0105904_80_748 222
821 3300048915 Ga0496112_0043544 Ga0496112_0043544_3502_4170 222
822 3300048915 Ga0496112_0423509 Ga0496112_0423509_236_904 222
823 3300048916 Ga0496113_0120482 Ga0496113_0120482_55_723 222
824 3300048916 Ga0496113_0482791 Ga0496113_0482791_217_885 222
825 3300048917 Ga0496114_0001498 Ga0496114_0001498_2892_3560 222
826 3300048917 Ga0496114_0016088 Ga0496114_0016088_80_748 222
827 3300048917 Ga0496114_0030885 Ga0496114_0030885_2398_3066 222
828 3300048917 Ga0496114_0446661 Ga0496114_0446661_26_694 222
829 3300048918 Ga0496115_0002039 Ga0496115_0002039_1472_2140 222
830 3300048918 Ga0496115_0081409 Ga0496115_0081409_1894_2562 222
831 3300048918 Ga0496115_0119606 Ga0496115_0119606_678_1346 222
832 3300048919 Ga0496116_0000125 Ga0496116_0000125_28127_28795 222
833 3300048919 Ga0496116_0019575 Ga0496116_0019575_1705_2373 222
834 3300048919 Ga0496116_0023895 Ga0496116_0023895_2465_3133 222
835 3300048920 Ga0496117_0000111 Ga0496117_0000111_28127_28795 222
836 3300048920 Ga0496117_0001572 Ga0496117_0001572_1793_2461 222
837 3300048920 Ga0496117_0112605 Ga0496117_0112605_178_846 222
838 3300048921 Ga0496118_0000083 Ga0496118_0000083_28127_28795 222
839 3300048921 Ga0496118_0000648 Ga0496118_0000648_44860_45528 222
840 3300048921 Ga0496118_0001353 Ga0496118_0001353_15502_16170 222
841 3300048921 Ga0496118_0009352 Ga0496118_0009352_7683_8351 222
842 3300048922 Ga0496119_0002640 Ga0496119_0002640_371_1039 222
843 3300048922 Ga0496119_0003272 Ga0496119_0003272_2247_2915 222
844 3300048922 Ga0496119_0011086 Ga0496119_0011086_2101_2769 222
845 3300048923 Ga0496120_0002589 Ga0496120_0002589_2375_3043 222
846 3300048923 Ga0496120_0041742 Ga0496120_0041742_1342_2010 222
847 3300048924 Ga0496121_0000004 Ga0496121_0000004_531738_532406 222
848 3300048924 Ga0496121_0019295 Ga0496121_0019295_2551_3219 222
849 3300048925 Ga0496122_0000138 Ga0496122_0000138_33721_34389 222
850 3300048926 Ga0496123_0008587 Ga0496123_0008587_3408_4076 222
851 3300048927 Ga0496124_0000012 Ga0496124_0000012_256531_257199 222
852 3300048927 Ga0496124_0269234 Ga0496124_0269234_559_1227 222
853 3300048928 Ga0496125_0000003 Ga0496125_0000003_657362_658030 222
854 3300048928 Ga0496125_0040927 Ga0496125_0040927_1552_2220 222
855 3300048929 Ga0496126_0000001 Ga0496126_0000001_531738_532406 222
856 3300048929 Ga0496126_0000220 Ga0496126_0000220_90047_90715 222
857 3300048929 Ga0496126_0006077 Ga0496126_0006077_3966_4634 222
858 3300049569 Ga0501032_0001198 Ga0501032_0001198_11641_12309 222
859 3300049570 Ga0501033_0013056 Ga0501033_0013056_1324_1992 222
860 3300049570 Ga0501033_0032246 Ga0501033_0032246_1734_2402 222
861 3300049570 Ga0501033_0584369 Ga0501033_0584369_33_701 222
862 3300049571 Ga0501034_0003575 Ga0501034_0003575_15279_15947 222
863 3300049571 Ga0501034_0004941 Ga0501034_0004941_7583_8251 222
864 3300049571 Ga0501034_0037834 Ga0501034_0037834_1442_2110 222
865 3300049571 Ga0501034_0131209 Ga0501034_0131209_1489_2157 222
866 3300049572 Ga0501036_0035805 Ga0501036_0035805_2015_2683 222
867 3300049572 Ga0501036_0064770 Ga0501036_0064770_1914_2582 222
868 3300049573 Ga0501037_0002583 Ga0501037_0002583_11362_12030 222
869 3300049573 Ga0501037_0007135 Ga0501037_0007135_5943_6611 222
870 3300049573 Ga0501037_0184866 Ga0501037_0184866_464_1132 222
871 3300049574 Ga0501038_0000352 Ga0501038_0000352_1358_2026 222
872 3300049575 Ga0501039_0002801 Ga0501039_0002801_551_1219 222
873 3300049579 Ga0501043_0002096 Ga0501043_0002096_15476_16144 222
874 3300049579 Ga0501043_0029168 Ga0501043_0029168_2668_3336 222
875 3300049580 Ga0501046_0000769 Ga0501046_0000769_6650_7318 222
876 3300049581 Ga0501047_0005895 Ga0501047_0005895_6299_6967 222
877 3300049581 Ga0501047_0010792 Ga0501047_0010792_6631_7299 222
878 3300049584 Ga0501068_0238077 Ga0501068_0238077_329_997 222
879 3300049585 Ga0501069_0045914 Ga0501069_0045914_1313_1981 222
880 3300049586 Ga0501070_0006531 Ga0501070_0006531_9180_9848 222
881 3300049586 Ga0501070_0010101 Ga0501070_0010101_6091_6759 222
882 3300049586 Ga0501070_0143809 Ga0501070_0143809_116_784 222
883 3300049589 Ga0501073_0016560 Ga0501073_0016560_942_1610 222
884 3300049593 Ga0501077_0325585 Ga0501077_0325585_246_914 222
885 3300049742 Ga0501080_0161831 Ga0501080_0161831_1089_1757 222
886 3300049744 Ga0501083_0171294 Ga0501083_0171294_206_874 222
887 3300049822 Ga0501035_0000886 Ga0501035_0000886_5797_6465 222
888 3300049822 Ga0501035_0007162 Ga0501035_0007162_5012_5680 222
889 3300049823 Ga0501044_0001635 Ga0501044_0001635_11877_12545 222
890 3300049823 Ga0501044_0003142 Ga0501044_0003142_8139_8807 222
891 3300049823 Ga0501044_0009219 Ga0501044_0009219_583_1251 222
892 3300050489 nmdc:mga03683_54157_c1 nmdc:mga03683_54157_c1_875_1543 222
893 3300050490 nmdc:mga03n38_7026_c1 nmdc:mga03n38_7026_c1_2547_3215 222
894 3300050491 nmdc:mga00v17_107702_c1 nmdc:mga00v17_107702_c1_316_984 222
895 3300050491 nmdc:mga00v17_207324_c1 nmdc:mga00v17_207324_c1_44_712 222
896 3300050491 nmdc:mga00v17_34499_c1 nmdc:mga00v17_34499_c1_1162_1830 222
897 3300050491 nmdc:mga00v17_71997_c1 nmdc:mga00v17_71997_c1_1243_1911 222
898 3300050491 nmdc:mga00v17_77101_c1 nmdc:mga00v17_77101_c1_404_1072 222
899 3300050491 nmdc:mga00v17_94938_c1 nmdc:mga00v17_94938_c1_963_1631 222
900 3300050492 nmdc:mga0yw44_15601_c2 nmdc:mga0yw44_15601_c2_1698_2366 222
901 3300050492 nmdc:mga0yw44_37477_c1 nmdc:mga0yw44_37477_c1_338_1006 222
902 3300050492 nmdc:mga0yw44_61543_c1 nmdc:mga0yw44_61543_c1_1518_2186 222
903 3300050492 nmdc:mga0yw44_93711_c1 nmdc:mga0yw44_93711_c1_177_845 222
904 3300050496 nmdc:mga07m45_114610_c1 nmdc:mga07m45_114610_c1_866_1534 222
905 3300050496 nmdc:mga07m45_190588_c1 nmdc:mga07m45_190588_c1_304_972 222
906 3300050507 nmdc:mga05p37_9680_c1 nmdc:mga05p37_9680_c1_4173_4841 222
907 3300050509 nmdc:mga0qj67_42343_c1 nmdc:mga0qj67_42343_c1_2345_3013 222
908 3300050516 nmdc:mga0sz30_10998_c1 nmdc:mga0sz30_10998_c1_1839_2507 222
909 3300050516 nmdc:mga0sz30_20669_c1 nmdc:mga0sz30_20669_c1_1782_2450 222
910 3300050516 nmdc:mga0sz30_3067_c2 nmdc:mga0sz30_3067_c2_381_1052 222
911 3300050516 nmdc:mga0sz30_43771_c1 nmdc:mga0sz30_43771_c1_248_916 222
912 3300050516 nmdc:mga0sz30_681_c1 nmdc:mga0sz30_681_c1_6444_7112 222
913 3300050516 nmdc:mga0sz30_75422_c1 nmdc:mga0sz30_75422_c1_309_977 222
914 3300053079 Ga0500610_0050234 Ga0500610_0050234_1432_2100 222
915 3300053080 Ga0500635_0009747 Ga0500635_0009747_201_869 222
916 3300053087 Ga0500643_009791 Ga0500643_009791_941_1609 222
917 3300053088 Ga0500644_0095726 Ga0500644_0095726_104_772 222
918 3300053104 Ga0500556_0001477 Ga0500556_0001477_7664_8332 222
919 3300053108 Ga0500562_010478 Ga0500562_010478_1227_1895 222
920 3300053130 Ga0500642_0048596 Ga0500642_0048596_236_904 222
921 3300053131 Ga0500652_211220 Ga0500652_211220_26_694 222
922 3300053139 Ga0500568_0120570 Ga0500568_0120570_64_732 222
923 3300053142 Ga0500577_0015413 Ga0500577_0015413_829_1497 222
924 3300053151 Ga0500604_0018934 Ga0500604_0018934_962_1630 222
925 3300053153 Ga0500616_0107724 Ga0500616_0107724_68_736 222
926 3300061719 Ga0466962_0110381 Ga0466962_0110381_148_816 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01895

PhoU

PhoU domain

16

104

0.97

PF01895

PhoU

PhoU domain

121

204

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t72-assembly1.cif.gz_A crystal structure of phosphate transport system protein phou from aquifex aeolicus 0.9123 3 211
1xwm-assembly1.cif.gz_A-2 the crystal structure of phou (phosphate uptake regulator), structural genomics 0.8978 5 215
2i0m-assembly1.cif.gz_A crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae 0.897 5 215
1xwm-assembly1.cif.gz_A-2 the crystal structure of phou (phosphate uptake regulator), structural genomics 0.8899 5 215
2i0m-assembly1.cif.gz_A crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae 0.8889 5 215
ID Description Score Start End Superfamily
af_P9WI97_1_212_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9871 1 212 1.20.58.220
af_P9WI97_1_212_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9825 1 212 1.20.58.220
af_P0A9K7_1_117_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9698 2 104 1.20.58.220
1t8bA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9655 4 106 1.20.58.220
1t8bB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9648 4 106 1.20.58.220
ID Description Score Start End GO Terms
AF-A0A222TNG5-F1-model_v4 deleted 0.9952 1 213
AF-P9WI94-F1-model_v4 Phosphate-specific transport system accessory protein PhoU homolog 2 (Pst system accessory protein PhoU homolog 2) 0.9924 1 213 GO:0005737
GO:0006817
GO:0030643
GO:0042803
GO:0045936
GO:2000186
AF-V8D0E9-F1-model_v4 PhoU family transcriptional regulator 0.9922 20 213 GO:0006817
GO:0030643
GO:0045936
AF-A0A7U8UDA9-F1-model_v4 deleted 0.9912 1 163
AF-H5TYA6-F1-model_v4 Phosphate-specific transport system accessory protein PhoU 0.9889 1 213 GO:0005737
GO:0006817
GO:0030643
GO:0045936

Feature Viewer

pLDDT pTM Quality
92.79 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map