F485927
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 926 | 364 | 891 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0141796|Ga0496105_0141796_1109_1903 |
| Length | 264 |
| Sequence | MRTAYHEQLAALTAQLGEMCGLSGRAMERATQALLQADLVLAEQVITDHDQITAMSAKAEETAFVLLALQAPVAGDLRAIVGSIQIVADIDRMGALALHVAKIARRRHPMHALPEEVNGYFAEMGRVAVELGNSAQEVLLSHDPEKAARISEEDDAMDDLHRHLFSVLMDRDWRHGVAAAVDVTLLGRFYERFADHAVEVARRVIFQVTGEYPTDELYTARVGGGVSRSVRKCSPPLPFGADWRRSSRCRRSRPDALACRWPPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 3 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 4 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 5 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 6 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 7 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 8 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 9 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 10 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 11 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 12 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 13 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 14 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 15 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 16 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 17 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 18 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 19 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 20 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 21 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 22 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 23 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 24 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 25 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 26 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 27 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 28 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 29 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 30 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 31 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 32 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 33 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 34 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 35 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 36 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 37 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 38 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 39 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 40 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 41 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 42 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 43 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 44 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 106 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 107 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 108 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 109 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 124 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 236 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 237 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 238 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 239 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 240 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 244 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 245 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 246 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 247 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 248 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 257 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 258 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 261 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 262 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 347 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 348 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 350 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 353 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 354 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 355 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 357 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 358 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 359 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 363 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 364 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.22 |
| Metatranscriptomes | 0 |
| Isolates | 3.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.42 |
| Nodule | 0.11 |
| Rhizoplane | 11.34 |
| Rhizosphere | 67.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1012286 | 3300000546 | Bacteria | 911 |
| 2 | JGI24739J22299_10125974 | 3300001989 | Bacteria | 763 |
| 3 | JGI24737J22298_10030599 | 3300001990 | Bacteria | 1684 |
| 4 | JGI24745J21846_1009800 | 3300002073 | Bacteria | 1088 |
| 5 | JGI24749J21850_1014234 | 3300002076 | Bacteria | 1115 |
| 6 | JGI24744J21845_10000136 | 3300002077 | Bacteria | 10379 |
| 7 | JGI24742J22300_10011007 | 3300002244 | Bacteria | 1499 |
| 8 | JGI24742J22300_10031772 | 3300002244 | Bacteria | 924 |
| 9 | JGI24751J29686_10015836 | 3300002459 | Bacteria | 1555 |
| 10 | rootH2_10067513 | 3300003320 | Bacteria | 3558 |
| 11 | Ga0055540_1000071 | 3300003792 | Bacteria | 117607 |
| 12 | Ga0055540_1000902 | 3300003792 | Bacteria | 19547 |
| 13 | Ga0070676_10024311 | 3300005328 | Bacteria | 3412 |
| 14 | Ga0070676_10139279 | 3300005328 | Bacteria | 1543 |
| 15 | Ga0070683_100052935 | 3300005329 | Bacteria | 3761 |
| 16 | Ga0070683_100769146 | 3300005329 | Bacteria | 923 |
| 17 | Ga0070690_100002173 | 3300005330 | Bacteria | 10483 |
| 18 | Ga0070670_100207599 | 3300005331 | Bacteria | 1703 |
| 19 | Ga0068869_100004732 | 3300005334 | Bacteria | 8493 |
| 20 | Ga0068869_100203799 | 3300005334 | Bacteria | 1561 |
| 21 | Ga0070666_10013750 | 3300005335 | Bacteria | 5140 |
| 22 | Ga0070666_10126881 | 3300005335 | Bacteria | 1771 |
| 23 | Ga0070666_10607723 | 3300005335 | Bacteria | 798 |
| 24 | Ga0070680_100699713 | 3300005336 | Bacteria | 872 |
| 25 | Ga0070682_100012353 | 3300005337 | Bacteria | 4896 |
| 26 | Ga0070682_100022346 | 3300005337 | Bacteria | 3746 |
| 27 | Ga0070682_100030315 | 3300005337 | Bacteria | 3264 |
| 28 | Ga0070682_100094097 | 3300005337 | Bacteria | 1965 |
| 29 | Ga0070682_100218610 | 3300005337 | Bacteria | 1354 |
| 30 | Ga0070682_100294638 | 3300005337 | Bacteria | 1188 |
| 31 | Ga0068868_100008527 | 3300005338 | Bacteria | 7338 |
| 32 | Ga0068868_100009899 | 3300005338 | Bacteria | 6884 |
| 33 | Ga0068868_100022687 | 3300005338 | Bacteria | 4741 |
| 34 | Ga0068868_100172888 | 3300005338 | Bacteria | 1789 |
| 35 | Ga0068868_100193918 | 3300005338 | Bacteria | 1690 |
| 36 | Ga0070660_100070107 | 3300005339 | Bacteria | 2735 |
| 37 | Ga0070660_100088769 | 3300005339 | Bacteria | 2435 |
| 38 | Ga0070660_100094922 | 3300005339 | Bacteria | 2357 |
| 39 | Ga0070689_100077266 | 3300005340 | Bacteria | 2609 |
| 40 | Ga0070689_100151445 | 3300005340 | Bacteria | 1871 |
| 41 | Ga0070691_10005587 | 3300005341 | Bacteria | 5722 |
| 42 | Ga0070691_10081574 | 3300005341 | Bacteria | 1584 |
| 43 | Ga0070687_100121762 | 3300005343 | Bacteria | 1493 |
| 44 | Ga0070692_10110543 | 3300005345 | Bacteria | 1519 |
| 45 | Ga0070692_10232059 | 3300005345 | Bacteria | 1096 |
| 46 | Ga0070668_100005229 | 3300005347 | Bacteria | 9627 |
| 47 | Ga0070668_100052330 | 3300005347 | Bacteria | 3147 |
| 48 | Ga0070668_100191654 | 3300005347 | Bacteria | 1674 |
| 49 | Ga0070668_100226627 | 3300005347 | Bacteria | 1544 |
| 50 | Ga0070668_100243721 | 3300005347 | Bacteria | 1490 |
| 51 | Ga0070668_100246804 | 3300005347 | Bacteria | 1481 |
| 52 | Ga0070669_100010528 | 3300005353 | Bacteria | 6569 |
| 53 | Ga0070669_100044117 | 3300005353 | Bacteria | 3249 |
| 54 | Ga0070669_100252774 | 3300005353 | Bacteria | 1404 |
| 55 | Ga0070675_100051364 | 3300005354 | Bacteria | 3388 |
| 56 | Ga0070675_100166812 | 3300005354 | Bacteria | 1897 |
| 57 | Ga0070671_100009134 | 3300005355 | Bacteria | 7960 |
| 58 | Ga0070671_100093292 | 3300005355 | Bacteria | 2523 |
| 59 | Ga0070671_100257157 | 3300005355 | Bacteria | 1484 |
| 60 | Ga0070674_100000655 | 3300005356 | Bacteria | 17474 |
| 61 | Ga0070674_100041563 | 3300005356 | Bacteria | 3117 |
| 62 | Ga0070674_100062303 | 3300005356 | Bacteria | 2606 |
| 63 | Ga0070674_100307729 | 3300005356 | Bacteria | 1265 |
| 64 | Ga0070688_100060689 | 3300005365 | Bacteria | 2389 |
| 65 | Ga0070688_100115088 | 3300005365 | Bacteria | 1794 |
| 66 | Ga0070659_100221528 | 3300005366 | Bacteria | 1561 |
| 67 | Ga0070667_100000142 | 3300005367 | Bacteria | 90696 |
| 68 | Ga0070667_100000995 | 3300005367 | Bacteria | 26025 |
| 69 | Ga0070667_100014600 | 3300005367 | Bacteria | 6490 |
| 70 | Ga0070667_100069849 | 3300005367 | Bacteria | 2989 |
| 71 | Ga0070709_10172443 | 3300005434 | Bacteria | 1513 |
| 72 | Ga0070709_10381444 | 3300005434 | Bacteria | 1048 |
| 73 | Ga0070713_100018383 | 3300005436 | Bacteria | 5313 |
| 74 | Ga0070713_100140903 | 3300005436 | Bacteria | 2136 |
| 75 | Ga0070710_10011265 | 3300005437 | Bacteria | 4416 |
| 76 | Ga0070710_10024248 | 3300005437 | Bacteria | 3198 |
| 77 | Ga0070710_10026599 | 3300005437 | Bacteria | 3075 |
| 78 | Ga0070701_10008728 | 3300005438 | Bacteria | 4401 |
| 79 | Ga0070701_10167071 | 3300005438 | Bacteria | 1279 |
| 80 | Ga0070711_100002645 | 3300005439 | Bacteria | 10256 |
| 81 | Ga0070711_100002984 | 3300005439 | Bacteria | 9773 |
| 82 | Ga0070705_100005990 | 3300005440 | Bacteria | 5946 |
| 83 | Ga0070705_100007640 | 3300005440 | Bacteria | 5332 |
| 84 | Ga0070705_100247432 | 3300005440 | Bacteria | 1249 |
| 85 | Ga0070700_100011827 | 3300005441 | Bacteria | 4847 |
| 86 | Ga0070700_100031279 | 3300005441 | Bacteria | 3187 |
| 87 | Ga0070700_100197161 | 3300005441 | Bacteria | 1412 |
| 88 | Ga0070700_100216376 | 3300005441 | Bacteria | 1355 |
| 89 | Ga0070694_100018473 | 3300005444 | Bacteria | 4424 |
| 90 | Ga0070694_100322319 | 3300005444 | Bacteria | 1190 |
| 91 | Ga0070708_100238597 | 3300005445 | Bacteria | 1707 |
| 92 | Ga0070663_100009948 | 3300005455 | Bacteria | 5911 |
| 93 | Ga0070663_100014355 | 3300005455 | Bacteria | 5083 |
| 94 | Ga0070663_100095330 | 3300005455 | Bacteria | 2211 |
| 95 | Ga0070663_100198735 | 3300005455 | Bacteria | 1564 |
| 96 | Ga0070678_100001005 | 3300005456 | Bacteria | 14642 |
| 97 | Ga0070678_100141677 | 3300005456 | Bacteria | 1924 |
| 98 | Ga0070678_100417356 | 3300005456 | Bacteria | 1169 |
| 99 | Ga0070662_100006072 | 3300005457 | Bacteria | 7755 |
| 100 | Ga0068867_100007222 | 3300005459 | Bacteria | 7854 |
| 101 | Ga0068867_100182354 | 3300005459 | Bacteria | 1670 |
| 102 | Ga0068867_100366433 | 3300005459 | Bacteria | 1207 |
| 103 | Ga0070685_10020338 | 3300005466 | Bacteria | 3592 |
| 104 | Ga0070679_100289051 | 3300005530 | Bacteria | 1591 |
| 105 | Ga0070697_100478066 | 3300005536 | Bacteria | 1088 |
| 106 | Ga0068853_100001093 | 3300005539 | Bacteria | 19199 |
| 107 | Ga0068853_100004917 | 3300005539 | Bacteria | 10401 |
| 108 | Ga0068853_100166435 | 3300005539 | Bacteria | 1992 |
| 109 | Ga0068853_100412292 | 3300005539 | Bacteria | 1266 |
| 110 | Ga0070695_100085306 | 3300005545 | Bacteria | 2097 |
| 111 | Ga0070696_100026576 | 3300005546 | Bacteria | 3938 |
| 112 | Ga0070696_100124042 | 3300005546 | Bacteria | 1872 |
| 113 | Ga0070693_100071876 | 3300005547 | Bacteria | 2040 |
| 114 | Ga0070693_100379726 | 3300005547 | Bacteria | 974 |
| 115 | Ga0070665_100004853 | 3300005548 | Bacteria | 13971 |
| 116 | Ga0070665_100020302 | 3300005548 | Bacteria | 6671 |
| 117 | Ga0070665_100035221 | 3300005548 | Bacteria | 5034 |
| 118 | Ga0070665_100151143 | 3300005548 | Bacteria | 2325 |
| 119 | Ga0070665_101148117 | 3300005548 | Bacteria | 788 |
| 120 | Ga0070704_100002883 | 3300005549 | Bacteria | 9756 |
| 121 | Ga0070704_100178281 | 3300005549 | Bacteria | 1697 |
| 122 | Ga0070704_100374113 | 3300005549 | Bacteria | 1209 |
| 123 | Ga0068855_100422094 | 3300005563 | Bacteria | 1459 |
| 124 | Ga0068857_100257011 | 3300005577 | Bacteria | 1602 |
| 125 | Ga0068857_101056716 | 3300005577 | Bacteria | 783 |
| 126 | Ga0068854_100003576 | 3300005578 | Bacteria | 9714 |
| 127 | Ga0068854_100115916 | 3300005578 | Bacteria | 2027 |
| 128 | Ga0068854_100122094 | 3300005578 | Bacteria | 1979 |
| 129 | Ga0068854_100231562 | 3300005578 | Bacteria | 1467 |
| 130 | Ga0068854_100239194 | 3300005578 | Bacteria | 1445 |
| 131 | Ga0068856_100113856 | 3300005614 | Bacteria | 2704 |
| 132 | Ga0068856_101118079 | 3300005614 | Bacteria | 805 |
| 133 | Ga0070702_100006048 | 3300005615 | Bacteria | 5699 |
| 134 | Ga0070702_100105928 | 3300005615 | Bacteria | 1734 |
| 135 | Ga0068852_100034773 | 3300005616 | Bacteria | 4197 |
| 136 | Ga0068852_100071410 | 3300005616 | Bacteria | 3048 |
| 137 | Ga0068852_100157381 | 3300005616 | Bacteria | 2118 |
| 138 | Ga0068859_100004138 | 3300005617 | Bacteria | 14809 |
| 139 | Ga0068859_100010110 | 3300005617 | Bacteria | 9510 |
| 140 | Ga0068859_100078249 | 3300005617 | Bacteria | 3347 |
| 141 | Ga0068859_100486812 | 3300005617 | Bacteria | 1329 |
| 142 | Ga0068859_100737090 | 3300005617 | Bacteria | 1075 |
| 143 | Ga0068864_100402641 | 3300005618 | Bacteria | 1301 |
| 144 | Ga0068864_100717458 | 3300005618 | Bacteria | 978 |
| 145 | Ga0068866_10004953 | 3300005718 | Bacteria | 5477 |
| 146 | Ga0068866_10172284 | 3300005718 | Bacteria | 1271 |
| 147 | Ga0068866_10278952 | 3300005718 | Bacteria | 1034 |
| 148 | Ga0068861_100002600 | 3300005719 | Bacteria | 11820 |
| 149 | Ga0068861_100019623 | 3300005719 | Bacteria | 4829 |
| 150 | Ga0068861_100038805 | 3300005719 | Bacteria | 3551 |
| 151 | Ga0068861_100072845 | 3300005719 | Bacteria | 2666 |
| 152 | Ga0068861_100184311 | 3300005719 | Bacteria | 1740 |
| 153 | Ga0068861_100191882 | 3300005719 | Bacteria | 1708 |
| 154 | Ga0068851_10022293 | 3300005834 | Bacteria | 3083 |
| 155 | Ga0068863_100000105 | 3300005841 | Bacteria | 90388 |
| 156 | Ga0068863_100041233 | 3300005841 | Bacteria | 4389 |
| 157 | Ga0068863_100079433 | 3300005841 | Bacteria | 3107 |
| 158 | Ga0068863_100124538 | 3300005841 | Bacteria | 2459 |
| 159 | Ga0068863_100381647 | 3300005841 | Bacteria | 1376 |
| 160 | Ga0068858_100003568 | 3300005842 | Bacteria | 15398 |
| 161 | Ga0068858_100004234 | 3300005842 | Bacteria | 14120 |
| 162 | Ga0068858_100070628 | 3300005842 | Bacteria | 3237 |
| 163 | Ga0068858_100100194 | 3300005842 | Bacteria | 2702 |
| 164 | Ga0068860_100000209 | 3300005843 | Bacteria | 92811 |
| 165 | Ga0068860_100008609 | 3300005843 | Bacteria | 10169 |
| 166 | Ga0068860_100052533 | 3300005843 | Bacteria | 3876 |
| 167 | Ga0068860_100104438 | 3300005843 | Bacteria | 2705 |
| 168 | Ga0068860_100982419 | 3300005843 | Bacteria | 862 |
| 169 | Ga0068860_101147698 | 3300005843 | Bacteria | 797 |
| 170 | Ga0068862_100000400 | 3300005844 | Bacteria | 46788 |
| 171 | Ga0068862_100002572 | 3300005844 | Bacteria | 16030 |
| 172 | Ga0068862_100048732 | 3300005844 | Bacteria | 3617 |
| 173 | Ga0068862_100104296 | 3300005844 | Bacteria | 2484 |
| 174 | Ga0068862_100163475 | 3300005844 | Bacteria | 1988 |
| 175 | Ga0068862_100229328 | 3300005844 | Bacteria | 1684 |
| 176 | Ga0068862_100388237 | 3300005844 | Bacteria | 1303 |
| 177 | Ga0081455_10047499 | 3300005937 | Bacteria | 3717 |
| 178 | Ga0081455_10094873 | 3300005937 | Bacteria | 2409 |
| 179 | Ga0075365_10010402 | 3300006038 | Bacteria | 5417 |
| 180 | Ga0075365_10038783 | 3300006038 | Bacteria | 3099 |
| 181 | Ga0075365_10070006 | 3300006038 | Bacteria | 2359 |
| 182 | Ga0075365_10116061 | 3300006038 | Bacteria | 1843 |
| 183 | Ga0075365_10171014 | 3300006038 | Bacteria | 1517 |
| 184 | Ga0075368_10008553 | 3300006042 | Bacteria | 3650 |
| 185 | Ga0075368_10015687 | 3300006042 | Bacteria | 2815 |
| 186 | Ga0075368_10212463 | 3300006042 | Bacteria | 820 |
| 187 | Ga0075363_100000884 | 3300006048 | Bacteria | 10551 |
| 188 | Ga0075363_100004990 | 3300006048 | Bacteria | 5871 |
| 189 | Ga0075363_100005591 | 3300006048 | Bacteria | 5613 |
| 190 | Ga0075363_100021757 | 3300006048 | Bacteria | 3235 |
| 191 | Ga0075363_100365963 | 3300006048 | Bacteria | 844 |
| 192 | Ga0075364_10000352 | 3300006051 | Bacteria | 22844 |
| 193 | Ga0075364_10004512 | 3300006051 | Bacteria | 8021 |
| 194 | Ga0075364_10007606 | 3300006051 | Bacteria | 6442 |
| 195 | Ga0075364_10010981 | 3300006051 | Bacteria | 5492 |
| 196 | Ga0075364_10043114 | 3300006051 | Bacteria | 2933 |
| 197 | Ga0075364_10044618 | 3300006051 | Bacteria | 2884 |
| 198 | Ga0075364_10068519 | 3300006051 | Bacteria | 2333 |
| 199 | Ga0075364_10211240 | 3300006051 | Bacteria | 1316 |
| 200 | Ga0075364_10225279 | 3300006051 | Bacteria | 1273 |
| 201 | Ga0070715_10007794 | 3300006163 | Bacteria | 3701 |
| 202 | Ga0070716_100011007 | 3300006173 | Bacteria | 4551 |
| 203 | Ga0070716_100036133 | 3300006173 | Bacteria | 2722 |
| 204 | Ga0070716_100052433 | 3300006173 | Bacteria | 2322 |
| 205 | Ga0070712_100002129 | 3300006175 | Bacteria | 12178 |
| 206 | Ga0070712_100014884 | 3300006175 | Bacteria | 4999 |
| 207 | Ga0070712_100031547 | 3300006175 | Bacteria | 3571 |
| 208 | Ga0070712_100270041 | 3300006175 | Bacteria | 1366 |
| 209 | Ga0070712_100521707 | 3300006175 | Bacteria | 998 |
| 210 | Ga0075362_10043805 | 3300006177 | Bacteria | 1983 |
| 211 | Ga0075362_10188957 | 3300006177 | Bacteria | 1000 |
| 212 | Ga0075367_10113946 | 3300006178 | Bacteria | 1662 |
| 213 | Ga0075369_10008349 | 3300006186 | Bacteria | 3980 |
| 214 | Ga0075369_10017624 | 3300006186 | Bacteria | 2898 |
| 215 | Ga0075369_10018475 | 3300006186 | Bacteria | 2839 |
| 216 | Ga0075369_10045575 | 3300006186 | Bacteria | 1886 |
| 217 | Ga0075369_10198616 | 3300006186 | Bacteria | 925 |
| 218 | Ga0097621_100013052 | 3300006237 | Bacteria | 6177 |
| 219 | Ga0097621_100076145 | 3300006237 | Bacteria | 2782 |
| 220 | Ga0075370_10002119 | 3300006353 | Bacteria | 9052 |
| 221 | Ga0075370_10004134 | 3300006353 | Bacteria | 6992 |
| 222 | Ga0075370_10021002 | 3300006353 | Bacteria | 3575 |
| 223 | Ga0075370_10027253 | 3300006353 | Bacteria | 3169 |
| 224 | Ga0075370_10136709 | 3300006353 | Bacteria | 1432 |
| 225 | Ga0075370_10193855 | 3300006353 | Bacteria | 1198 |
| 226 | Ga0075370_10231666 | 3300006353 | Bacteria | 1093 |
| 227 | Ga0068871_100110785 | 3300006358 | Bacteria | 2309 |
| 228 | Ga0068871_100628475 | 3300006358 | Bacteria | 978 |
| 229 | Ga0075428_100004290 | 3300006844 | Bacteria | 15702 |
| 230 | Ga0075428_100552703 | 3300006844 | Bacteria | 1231 |
| 231 | Ga0075430_100175480 | 3300006846 | Bacteria | 1783 |
| 232 | Ga0075430_100661152 | 3300006846 | Bacteria | 862 |
| 233 | Ga0075431_100023715 | 3300006847 | Bacteria | 6281 |
| 234 | Ga0068865_100003040 | 3300006881 | Bacteria | 10032 |
| 235 | Ga0068865_100102184 | 3300006881 | Bacteria | 2100 |
| 236 | Ga0068865_100167476 | 3300006881 | Bacteria | 1681 |
| 237 | Ga0068865_100535958 | 3300006881 | Bacteria | 981 |
| 238 | Ga0097620_100004138 | 3300006931 | Bacteria | 14809 |
| 239 | Ga0097620_100010110 | 3300006931 | Bacteria | 9510 |
| 240 | Ga0097620_100078249 | 3300006931 | Bacteria | 3347 |
| 241 | Ga0097620_100486850 | 3300006931 | Bacteria | 1329 |
| 242 | Ga0097620_100737079 | 3300006931 | Bacteria | 1075 |
| 243 | Ga0099795_10005850 | 3300007788 | Bacteria | 3308 |
| 244 | Ga0105250_10278800 | 3300009092 | Bacteria | 719 |
| 245 | Ga0105240_10459681 | 3300009093 | Bacteria | 1423 |
| 246 | Ga0111539_10367163 | 3300009094 | Bacteria | 1675 |
| 247 | Ga0111539_11465630 | 3300009094 | Bacteria | 792 |
| 248 | Ga0105245_10002210 | 3300009098 | Bacteria | 17613 |
| 249 | Ga0105245_10068575 | 3300009098 | Bacteria | 3214 |
| 250 | Ga0105245_10130798 | 3300009098 | Bacteria | 2354 |
| 251 | Ga0105245_10692328 | 3300009098 | Bacteria | 1052 |
| 252 | Ga0105247_10000141 | 3300009101 | Bacteria | 70210 |
| 253 | Ga0105247_10001401 | 3300009101 | Bacteria | 17494 |
| 254 | Ga0105247_10011479 | 3300009101 | Bacteria | 5342 |
| 255 | Ga0105247_10034274 | 3300009101 | Bacteria | 3092 |
| 256 | Ga0114129_10021114 | 3300009147 | Bacteria | 9245 |
| 257 | Ga0105243_10000877 | 3300009148 | Bacteria | 28395 |
| 258 | Ga0105243_10001026 | 3300009148 | Bacteria | 25748 |
| 259 | Ga0105243_10030337 | 3300009148 | Bacteria | 4162 |
| 260 | Ga0105243_11347761 | 3300009148 | Bacteria | 732 |
| 261 | Ga0105241_10007147 | 3300009174 | Bacteria | 8217 |
| 262 | Ga0105241_10228835 | 3300009174 | Bacteria | 1566 |
| 263 | Ga0105242_10020529 | 3300009176 | Bacteria | 5181 |
| 264 | Ga0105242_10038522 | 3300009176 | Bacteria | 3845 |
| 265 | Ga0105248_10000242 | 3300009177 | Bacteria | 63110 |
| 266 | Ga0105248_10012476 | 3300009177 | Bacteria | 9373 |
| 267 | Ga0105248_10041777 | 3300009177 | Bacteria | 5142 |
| 268 | Ga0105248_10129111 | 3300009177 | Bacteria | 2851 |
| 269 | Ga0105248_11096772 | 3300009177 | Bacteria | 900 |
| 270 | Ga0105237_10017368 | 3300009545 | Bacteria | 7460 |
| 271 | Ga0105237_10036231 | 3300009545 | Bacteria | 4990 |
| 272 | Ga0105237_10042277 | 3300009545 | Bacteria | 4597 |
| 273 | Ga0105237_10048790 | 3300009545 | Bacteria | 4255 |
| 274 | Ga0105238_10055930 | 3300009551 | Bacteria | 3959 |
| 275 | Ga0105249_10000031 | 3300009553 | Bacteria | 220006 |
| 276 | Ga0105249_10003161 | 3300009553 | Bacteria | 14248 |
| 277 | Ga0105249_10339793 | 3300009553 | Bacteria | 1518 |
| 278 | Ga0105249_10656016 | 3300009553 | Bacteria | 1107 |
| 279 | Ga0105249_10670702 | 3300009553 | Bacteria | 1095 |
| 280 | Ga0105249_10965351 | 3300009553 | Bacteria | 920 |
| 281 | Ga0105028_108579 | 3300009993 | Bacteria | 1068 |
| 282 | Ga0105239_10004174 | 3300010375 | Bacteria | 17356 |
| 283 | Ga0105239_10004701 | 3300010375 | Bacteria | 16217 |
| 284 | Ga0105239_10020858 | 3300010375 | Bacteria | 7229 |
| 285 | Ga0105239_10055735 | 3300010375 | Bacteria | 4335 |
| 286 | Ga0105239_10089122 | 3300010375 | Bacteria | 3402 |
| 287 | Ga0105246_10017764 | 3300011119 | Bacteria | 4524 |
| 288 | Ga0105246_10193950 | 3300011119 | Bacteria | 1574 |
| 289 | Ga0157371_10312418 | 3300013102 | Bacteria | 1139 |
| 290 | Ga0157370_10521252 | 3300013104 | Bacteria | 1091 |
| 291 | Ga0157369_10284159 | 3300013105 | Bacteria | 1723 |
| 292 | Ga0157369_10327051 | 3300013105 | Bacteria | 1593 |
| 293 | Ga0157369_10471834 | 3300013105 | Bacteria | 1299 |
| 294 | Ga0157374_10074664 | 3300013296 | Bacteria | 3203 |
| 295 | Ga0157374_10153900 | 3300013296 | Bacteria | 2237 |
| 296 | Ga0157374_10454243 | 3300013296 | Bacteria | 1283 |
| 297 | Ga0157378_10018228 | 3300013297 | Bacteria | 6161 |
| 298 | Ga0157378_10023912 | 3300013297 | Bacteria | 5374 |
| 299 | Ga0157378_10128578 | 3300013297 | Bacteria | 2342 |
| 300 | Ga0157378_10394674 | 3300013297 | Bacteria | 1362 |
| 301 | Ga0163162_10008665 | 3300013306 | Bacteria | 9900 |
| 302 | Ga0163162_10032962 | 3300013306 | Bacteria | 5144 |
| 303 | Ga0163162_10584408 | 3300013306 | Bacteria | 1244 |
| 304 | Ga0157372_10009627 | 3300013307 | Bacteria | 10271 |
| 305 | Ga0157372_10029028 | 3300013307 | Bacteria | 6036 |
| 306 | Ga0157372_10070189 | 3300013307 | Bacteria | 3941 |
| 307 | Ga0157375_10002285 | 3300013308 | Bacteria | 16566 |
| 308 | Ga0157375_10101066 | 3300013308 | Bacteria | 2966 |
| 309 | Ga0157375_10174762 | 3300013308 | Bacteria | 2297 |
| 310 | Ga0157375_10208432 | 3300013308 | Bacteria | 2111 |
| 311 | Ga0157375_10846812 | 3300013308 | Bacteria | 1061 |
| 312 | Ga0157375_10924939 | 3300013308 | Bacteria | 1015 |
| 313 | Ga0163163_10140656 | 3300014325 | Bacteria | 2456 |
| 314 | Ga0163163_10424854 | 3300014325 | Bacteria | 1388 |
| 315 | Ga0163163_10573156 | 3300014325 | Bacteria | 1192 |
| 316 | Ga0163163_10575686 | 3300014325 | Bacteria | 1189 |
| 317 | Ga0157380_10000802 | 3300014326 | Bacteria | 19732 |
| 318 | Ga0157380_10049846 | 3300014326 | Bacteria | 3305 |
| 319 | Ga0157377_10053568 | 3300014745 | Bacteria | 2282 |
| 320 | Ga0157377_10261786 | 3300014745 | Bacteria | 1126 |
| 321 | Ga0157379_10020737 | 3300014968 | Bacteria | 5815 |
| 322 | Ga0157379_10123822 | 3300014968 | Bacteria | 2326 |
| 323 | Ga0157379_10132853 | 3300014968 | Bacteria | 2241 |
| 324 | Ga0157376_10178951 | 3300014969 | Bacteria | 1937 |
| 325 | Ga0163161_10001861 | 3300017792 | Bacteria | 15399 |
| 326 | Ga0163161_10087639 | 3300017792 | Bacteria | 2299 |
| 327 | Ga0213876_10015727 | 3300021384 | Bacteria | 4005 |
| 328 | Ga0213875_10002285 | 3300021388 | Bacteria | 11605 |
| 329 | Ga0213875_10129179 | 3300021388 | Bacteria | 1181 |
| 330 | Ga0209673_1061553 | 3300025273 | Bacteria | 935 |
| 331 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 332 | Ga0209051_1001346 | 3300025303 | Bacteria | 21328 |
| 333 | Ga0209051_1001746 | 3300025303 | Bacteria | 17326 |
| 334 | Ga0209051_1027501 | 3300025303 | Bacteria | 2265 |
| 335 | Ga0209051_1094404 | 3300025303 | Bacteria | 822 |
| 336 | Ga0207697_10168474 | 3300025315 | Bacteria | 957 |
| 337 | Ga0207696_1082045 | 3300025711 | Bacteria | 889 |
| 338 | Ga0207692_10154648 | 3300025898 | Bacteria | 1316 |
| 339 | Ga0207692_10252024 | 3300025898 | Bacteria | 1058 |
| 340 | Ga0207642_10020605 | 3300025899 | Bacteria | 2578 |
| 341 | Ga0207642_10099353 | 3300025899 | Bacteria | 1457 |
| 342 | Ga0207710_10000164 | 3300025900 | Bacteria | 70180 |
| 343 | Ga0207710_10000901 | 3300025900 | Bacteria | 15906 |
| 344 | Ga0207710_10105310 | 3300025900 | Bacteria | 1335 |
| 345 | Ga0207688_10000489 | 3300025901 | Bacteria | 19052 |
| 346 | Ga0207688_10003531 | 3300025901 | Bacteria | 8530 |
| 347 | Ga0207688_10003799 | 3300025901 | Bacteria | 8239 |
| 348 | Ga0207688_10011680 | 3300025901 | Bacteria | 4776 |
| 349 | Ga0207688_10056506 | 3300025901 | Bacteria | 2205 |
| 350 | Ga0207688_10088507 | 3300025901 | Bacteria | 1776 |
| 351 | Ga0207688_10105985 | 3300025901 | Bacteria | 1627 |
| 352 | Ga0207680_10160495 | 3300025903 | Bacteria | 1507 |
| 353 | Ga0207647_10017184 | 3300025904 | Bacteria | 4923 |
| 354 | Ga0207647_10028191 | 3300025904 | Bacteria | 3651 |
| 355 | Ga0207685_10004576 | 3300025905 | Bacteria | 3539 |
| 356 | Ga0207699_10134742 | 3300025906 | Bacteria | 1616 |
| 357 | Ga0207645_10020919 | 3300025907 | Bacteria | 4274 |
| 358 | Ga0207645_10048293 | 3300025907 | Bacteria | 2718 |
| 359 | Ga0207705_10069495 | 3300025909 | Bacteria | 2551 |
| 360 | Ga0207654_10032174 | 3300025911 | Bacteria | 2895 |
| 361 | Ga0207695_10133359 | 3300025913 | Bacteria | 2439 |
| 362 | Ga0207671_10043825 | 3300025914 | Bacteria | 3308 |
| 363 | Ga0207693_10003251 | 3300025915 | Bacteria | 13942 |
| 364 | Ga0207693_10008923 | 3300025915 | Bacteria | 8185 |
| 365 | Ga0207693_10014548 | 3300025915 | Bacteria | 6323 |
| 366 | Ga0207693_10513404 | 3300025915 | Bacteria | 935 |
| 367 | Ga0207663_10001940 | 3300025916 | Bacteria | 9797 |
| 368 | Ga0207663_10037667 | 3300025916 | Bacteria | 2917 |
| 369 | Ga0207657_10185531 | 3300025919 | Bacteria | 1680 |
| 370 | Ga0207681_10003879 | 3300025923 | Bacteria | 9285 |
| 371 | Ga0207681_10196019 | 3300025923 | Bacteria | 1548 |
| 372 | Ga0207659_10081641 | 3300025926 | Bacteria | 2391 |
| 373 | Ga0207687_10001856 | 3300025927 | Bacteria | 14539 |
| 374 | Ga0207687_10019541 | 3300025927 | Bacteria | 4489 |
| 375 | Ga0207687_10430869 | 3300025927 | Bacteria | 1090 |
| 376 | Ga0207700_10449531 | 3300025928 | Bacteria | 1135 |
| 377 | Ga0207700_10652159 | 3300025928 | Bacteria | 938 |
| 378 | Ga0207664_10162629 | 3300025929 | Bacteria | 1905 |
| 379 | Ga0207664_10470921 | 3300025929 | Bacteria | 1123 |
| 380 | Ga0207644_10007265 | 3300025931 | Bacteria | 7209 |
| 381 | Ga0207644_10166743 | 3300025931 | Bacteria | 1716 |
| 382 | Ga0207644_10190872 | 3300025931 | Bacteria | 1611 |
| 383 | Ga0207690_10104632 | 3300025932 | Bacteria | 2028 |
| 384 | Ga0207690_10147931 | 3300025932 | Bacteria | 1738 |
| 385 | Ga0207706_10001630 | 3300025933 | Bacteria | 22262 |
| 386 | Ga0207706_10009481 | 3300025933 | Bacteria | 8939 |
| 387 | Ga0207706_10020146 | 3300025933 | Bacteria | 5993 |
| 388 | Ga0207709_10001857 | 3300025935 | Bacteria | 14063 |
| 389 | Ga0207709_10001922 | 3300025935 | Bacteria | 13650 |
| 390 | Ga0207709_10190094 | 3300025935 | Bacteria | 1458 |
| 391 | Ga0207670_10246650 | 3300025936 | Bacteria | 1378 |
| 392 | Ga0207669_10000247 | 3300025937 | Bacteria | 24532 |
| 393 | Ga0207669_10075825 | 3300025937 | Bacteria | 2132 |
| 394 | Ga0207669_10326606 | 3300025937 | Bacteria | 1176 |
| 395 | Ga0207704_10126937 | 3300025938 | Bacteria | 1758 |
| 396 | Ga0207704_10302328 | 3300025938 | Bacteria | 1226 |
| 397 | Ga0207704_10426461 | 3300025938 | Bacteria | 1053 |
| 398 | Ga0207704_10879959 | 3300025938 | Bacteria | 752 |
| 399 | Ga0207665_10006954 | 3300025939 | Bacteria | 7490 |
| 400 | Ga0207665_10033565 | 3300025939 | Bacteria | 3403 |
| 401 | Ga0207665_10051740 | 3300025939 | Bacteria | 2765 |
| 402 | Ga0207711_10000196 | 3300025941 | Bacteria | 64910 |
| 403 | Ga0207711_10007688 | 3300025941 | Bacteria | 9012 |
| 404 | Ga0207711_10014846 | 3300025941 | Bacteria | 6470 |
| 405 | Ga0207711_10083138 | 3300025941 | Bacteria | 2800 |
| 406 | Ga0207689_10010685 | 3300025942 | Bacteria | 7899 |
| 407 | Ga0207689_10350740 | 3300025942 | Bacteria | 1227 |
| 408 | Ga0207689_10363271 | 3300025942 | Bacteria | 1204 |
| 409 | Ga0207689_10606462 | 3300025942 | Bacteria | 921 |
| 410 | Ga0207661_10059162 | 3300025944 | Bacteria | 3087 |
| 411 | Ga0207661_10304329 | 3300025944 | Bacteria | 1430 |
| 412 | Ga0207651_10072512 | 3300025960 | Bacteria | 2445 |
| 413 | Ga0207712_10000029 | 3300025961 | Bacteria | 220014 |
| 414 | Ga0207712_10006529 | 3300025961 | Bacteria | 7357 |
| 415 | Ga0207712_10037734 | 3300025961 | Bacteria | 3298 |
| 416 | Ga0207712_10495532 | 3300025961 | Bacteria | 1043 |
| 417 | Ga0207668_10004559 | 3300025972 | Bacteria | 8148 |
| 418 | Ga0207668_10159708 | 3300025972 | Bacteria | 1755 |
| 419 | Ga0207668_10227885 | 3300025972 | Bacteria | 1500 |
| 420 | Ga0207668_10244930 | 3300025972 | Bacteria | 1452 |
| 421 | Ga0207640_10106297 | 3300025981 | Bacteria | 1979 |
| 422 | Ga0207640_10182661 | 3300025981 | Bacteria | 1574 |
| 423 | Ga0207640_10567177 | 3300025981 | Bacteria | 956 |
| 424 | Ga0207658_10000113 | 3300025986 | Bacteria | 88960 |
| 425 | Ga0207658_10000850 | 3300025986 | Bacteria | 25516 |
| 426 | Ga0207658_10061665 | 3300025986 | Bacteria | 2803 |
| 427 | Ga0207658_10076005 | 3300025986 | Bacteria | 2557 |
| 428 | Ga0207677_10038929 | 3300026023 | Bacteria | 3121 |
| 429 | Ga0207677_10062822 | 3300026023 | Bacteria | 2578 |
| 430 | Ga0207677_10254819 | 3300026023 | Bacteria | 1427 |
| 431 | Ga0207677_10468159 | 3300026023 | Bacteria | 1083 |
| 432 | Ga0207703_10009286 | 3300026035 | Bacteria | 7730 |
| 433 | Ga0207703_10042166 | 3300026035 | Bacteria | 3660 |
| 434 | Ga0207703_10063966 | 3300026035 | Bacteria | 3018 |
| 435 | Ga0207639_10017851 | 3300026041 | Bacteria | 5033 |
| 436 | Ga0207639_10018244 | 3300026041 | Bacteria | 4984 |
| 437 | Ga0207639_10041000 | 3300026041 | Bacteria | 3460 |
| 438 | Ga0207639_10185436 | 3300026041 | Bacteria | 1773 |
| 439 | Ga0207639_10504229 | 3300026041 | Bacteria | 1106 |
| 440 | Ga0207678_10007288 | 3300026067 | Bacteria | 9802 |
| 441 | Ga0207678_10013099 | 3300026067 | Bacteria | 7274 |
| 442 | Ga0207678_10027382 | 3300026067 | Bacteria | 4972 |
| 443 | Ga0207678_10048063 | 3300026067 | Bacteria | 3689 |
| 444 | Ga0207708_10017230 | 3300026075 | Bacteria | 5438 |
| 445 | Ga0207708_10024415 | 3300026075 | Bacteria | 4573 |
| 446 | Ga0207708_10095231 | 3300026075 | Bacteria | 2299 |
| 447 | Ga0207708_10123852 | 3300026075 | Bacteria | 2016 |
| 448 | Ga0207702_10178536 | 3300026078 | Bacteria | 1953 |
| 449 | Ga0207702_10925332 | 3300026078 | Bacteria | 864 |
| 450 | Ga0207641_10000581 | 3300026088 | Bacteria | 40291 |
| 451 | Ga0207641_10009336 | 3300026088 | Bacteria | 8090 |
| 452 | Ga0207641_10254862 | 3300026088 | Bacteria | 1640 |
| 453 | Ga0207641_10375487 | 3300026088 | Bacteria | 1360 |
| 454 | Ga0207648_10003694 | 3300026089 | Bacteria | 16021 |
| 455 | Ga0207648_10025471 | 3300026089 | Bacteria | 5268 |
| 456 | Ga0207648_10380952 | 3300026089 | Bacteria | 1275 |
| 457 | Ga0207676_10043866 | 3300026095 | Bacteria | 3446 |
| 458 | Ga0207676_10331923 | 3300026095 | Bacteria | 1400 |
| 459 | Ga0207674_10291548 | 3300026116 | Bacteria | 1580 |
| 460 | Ga0207675_100002945 | 3300026118 | Bacteria | 16742 |
| 461 | Ga0207675_100027002 | 3300026118 | Bacteria | 5345 |
| 462 | Ga0207675_100141399 | 3300026118 | Bacteria | 2287 |
| 463 | Ga0207675_100213073 | 3300026118 | Bacteria | 1859 |
| 464 | Ga0207675_100845835 | 3300026118 | Bacteria | 930 |
| 465 | Ga0207683_10002056 | 3300026121 | Bacteria | 17809 |
| 466 | Ga0207683_10039140 | 3300026121 | Bacteria | 4136 |
| 467 | Ga0207683_10167976 | 3300026121 | Bacteria | 1986 |
| 468 | Ga0207698_10152452 | 3300026142 | Bacteria | 2008 |
| 469 | Ga0209813_10007905 | 3300027866 | Bacteria | 2667 |
| 470 | Ga0209813_10028970 | 3300027866 | Bacteria | 1618 |
| 471 | Ga0268266_10002346 | 3300028379 | Bacteria | 20467 |
| 472 | Ga0268266_10005470 | 3300028379 | Bacteria | 11829 |
| 473 | Ga0268266_10009545 | 3300028379 | Bacteria | 8540 |
| 474 | Ga0268266_10024368 | 3300028379 | Bacteria | 5146 |
| 475 | Ga0268266_10229142 | 3300028379 | Bacteria | 1711 |
| 476 | Ga0268266_10561158 | 3300028379 | Bacteria | 1095 |
| 477 | Ga0268265_10000389 | 3300028380 | Bacteria | 46920 |
| 478 | Ga0268265_10015507 | 3300028380 | Bacteria | 5217 |
| 479 | Ga0268265_10258970 | 3300028380 | Bacteria | 1545 |
| 480 | Ga0268265_10504661 | 3300028380 | Bacteria | 1140 |
| 481 | Ga0268264_10000017 | 3300028381 | Bacteria | 498037 |
| 482 | Ga0268264_10003370 | 3300028381 | Bacteria | 13802 |
| 483 | Ga0268264_10065616 | 3300028381 | Bacteria | 3059 |
| 484 | Ga0268264_10134545 | 3300028381 | Bacteria | 2196 |
| 485 | Ga0268264_10399488 | 3300028381 | Bacteria | 1320 |
| 486 | Ga0268264_10551298 | 3300028381 | Bacteria | 1131 |
| 487 | Ga0268264_10559332 | 3300028381 | Bacteria | 1123 |
| 488 | Ga0265327_10005155 | 3300031251 | Bacteria | 11082 |
| 489 | Ga0307413_10011863 | 3300031824 | Bacteria | 4307 |
| 490 | Ga0307413_10155258 | 3300031824 | Bacteria | 1600 |
| 491 | Ga0307410_10085227 | 3300031852 | Bacteria | 2229 |
| 492 | Ga0307410_10236001 | 3300031852 | Bacteria | 1415 |
| 493 | Ga0307406_10360275 | 3300031901 | Bacteria | 1140 |
| 494 | Ga0307407_10299772 | 3300031903 | Bacteria | 1120 |
| 495 | Ga0307409_100208747 | 3300031995 | Bacteria | 1753 |
| 496 | Ga0307409_100572613 | 3300031995 | Bacteria | 1112 |
| 497 | Ga0307409_100583494 | 3300031995 | Bacteria | 1102 |
| 498 | Ga0307416_100008033 | 3300032002 | Bacteria | 6762 |
| 499 | Ga0307414_10572730 | 3300032004 | Bacteria | 1009 |
| 500 | Ga0307411_10019451 | 3300032005 | Bacteria | 3923 |
| 501 | Ga0307411_10455732 | 3300032005 | Bacteria | 1071 |
| 502 | Ga0307415_100014180 | 3300032126 | Bacteria | 4677 |
| 503 | Ga0307415_100254600 | 3300032126 | Bacteria | 1429 |
| 504 | Ga0373929_0019268 | 3300035085 | Bacteria | 1365 |
| 505 | Ga0373952_0047262 | 3300035092 | Bacteria | 1014 |
| 506 | Ga0373932_0094504 | 3300035112 | Bacteria | 964 |
| 507 | Ga0373939_0110176 | 3300035114 | Bacteria | 958 |
| 508 | Ga0373941_0213206 | 3300035115 | Bacteria | 739 |
| 509 | Ga0373956_0012775 | 3300035119 | Bacteria | 3486 |
| 510 | Ga0373962_0061104 | 3300035242 | Bacteria | 1107 |
| 511 | Ga0373931_0009804 | 3300035691 | Bacteria | 4588 |
| 512 | Ga0373931_0073050 | 3300035691 | Bacteria | 1877 |
| 513 | Ga0373925_0093905 | 3300037068 | Bacteria | 2297 |
| 514 | Ga0436364_0103584 | 3300037853 | Bacteria | 12819 |
| 515 | Ga0436364_0595872 | 3300037853 | Bacteria | 1355 |
| 516 | Ga0436364_0863821 | 3300037853 | Bacteria | 2922 |
| 517 | Ga0436364_0872298 | 3300037853 | Bacteria | 4379 |
| 518 | Ga0436365_0468901 | 3300039437 | Bacteria | 3180 |
| 519 | Ga0436365_0671847 | 3300039437 | Bacteria | 34209 |
| 520 | Ga0436365_1818399 | 3300039437 | Bacteria | 33160 |
| 521 | Ga0436365_1833781 | 3300039437 | Bacteria | 32006 |
| 522 | Ga0436363_0028512 | 3300039450 | Bacteria | 1606 |
| 523 | Ga0436363_0144694 | 3300039450 | Bacteria | 3001 |
| 524 | Ga0436363_1020415 | 3300039450 | Bacteria | 1109 |
| 525 | Ga0436362_0209322 | 3300039453 | Bacteria | 1581 |
| 526 | Ga0436362_1118236 | 3300039453 | Bacteria | 1491 |
| 527 | Ga0439461_0012679 | 3300041410 | Bacteria | 1581 |
| 528 | Ga0439466_0011616 | 3300041411 | Bacteria | 3254 |
| 529 | Ga0439466_0028438 | 3300041411 | Bacteria | 1930 |
| 530 | Ga0439465_0003685 | 3300041413 | Bacteria | 4993 |
| 531 | Ga0439465_0012464 | 3300041413 | Bacteria | 2657 |
| 532 | Ga0451787_712210 | 3300041441 | Bacteria | 1194 |
| 533 | Ga0451793_0046954 | 3300041452 | Bacteria | 3161 |
| 534 | Ga0451795_0047719 | 3300041456 | Bacteria | 978 |
| 535 | Ga0439431_0003085 | 3300041997 | Bacteria | 3659 |
| 536 | Ga0439431_0006682 | 3300041997 | Bacteria | 2557 |
| 537 | Ga0439442_002061 | 3300042002 | Bacteria | 3951 |
| 538 | Ga0439445_0000875 | 3300042004 | Bacteria | 6391 |
| 539 | Ga0439445_0003741 | 3300042004 | Bacteria | 3418 |
| 540 | Ga0439448_0068831 | 3300042005 | Bacteria | 1177 |
| 541 | Ga0439449_0051669 | 3300042007 | Bacteria | 1520 |
| 542 | Ga0439463_073115 | 3300042016 | Bacteria | 879 |
| 543 | Ga0466969_0006911 | 3300044656 | Bacteria | 6041 |
| 544 | Ga0466972_0005077 | 3300044658 | Bacteria | 6595 |
| 545 | Ga0466965_0001978 | 3300044683 | Bacteria | 8568 |
| 546 | Ga0466965_0003274 | 3300044683 | Bacteria | 7085 |
| 547 | Ga0466965_0018626 | 3300044683 | Bacteria | 3330 |
| 548 | Ga0466966_0002923 | 3300044684 | Bacteria | 11260 |
| 549 | Ga0466966_0003280 | 3300044684 | Bacteria | 10665 |
| 550 | Ga0466966_0003757 | 3300044684 | Bacteria | 10005 |
| 551 | Ga0466966_0128433 | 3300044684 | Bacteria | 1553 |
| 552 | Ga0466961_0001548 | 3300044693 | Bacteria | 14230 |
| 553 | Ga0466961_0015228 | 3300044693 | Bacteria | 4938 |
| 554 | Ga0466961_0016908 | 3300044693 | Bacteria | 4687 |
| 555 | Ga0466961_0062760 | 3300044693 | Bacteria | 2361 |
| 556 | Ga0466963_0073901 | 3300044694 | Bacteria | 2299 |
| 557 | Ga0466963_0091657 | 3300044694 | Bacteria | 2070 |
| 558 | Ga0466963_0451980 | 3300044694 | Bacteria | 906 |
| 559 | Ga0466963_0476151 | 3300044694 | Bacteria | 881 |
| 560 | Ga0466964_0488562 | 3300044706 | Bacteria | 659 |
| 561 | Ga0466971_0015984 | 3300044719 | Bacteria | 3307 |
| 562 | Ga0466971_0039555 | 3300044719 | Bacteria | 2116 |
| 563 | Ga0466971_0066561 | 3300044719 | Bacteria | 1633 |
| 564 | Ga0466971_0072365 | 3300044719 | Bacteria | 1566 |
| 565 | Ga0466968_0001149 | 3300044735 | Bacteria | 9375 |
| 566 | Ga0466968_0002680 | 3300044735 | Bacteria | 6556 |
| 567 | Ga0466968_0007618 | 3300044735 | Bacteria | 4122 |
| 568 | Ga0466968_0222288 | 3300044735 | Bacteria | 890 |
| 569 | Ga0466970_0009842 | 3300044765 | Bacteria | 4841 |
| 570 | Ga0466970_0018512 | 3300044765 | Bacteria | 3606 |
| 571 | Ga0466970_0042689 | 3300044765 | Bacteria | 2412 |
| 572 | Ga0466970_0059807 | 3300044765 | Bacteria | 2040 |
| 573 | Ga0466970_0211197 | 3300044765 | Bacteria | 1081 |
| 574 | Ga0466970_0260256 | 3300044765 | Bacteria | 973 |
| 575 | Ga0466957_0029033 | 3300044842 | Bacteria | 3295 |
| 576 | Ga0466957_0031979 | 3300044842 | Bacteria | 3148 |
| 577 | Ga0466957_0151901 | 3300044842 | Bacteria | 1498 |
| 578 | Ga0466957_0339239 | 3300044842 | Bacteria | 1017 |
| 579 | Ga0466957_0354247 | 3300044842 | Bacteria | 996 |
| 580 | Ga0466960_0000284 | 3300044901 | Bacteria | 17649 |
| 581 | Ga0466960_0000771 | 3300044901 | Bacteria | 11234 |
| 582 | Ga0466960_0000936 | 3300044901 | Bacteria | 10325 |
| 583 | Ga0466960_0012184 | 3300044901 | Bacteria | 3621 |
| 584 | Ga0466960_0427324 | 3300044901 | Bacteria | 767 |
| 585 | Ga0466959_0001606 | 3300045049 | Bacteria | 13925 |
| 586 | Ga0466959_0004912 | 3300045049 | Bacteria | 9054 |
| 587 | Ga0466959_0025876 | 3300045049 | Bacteria | 4351 |
| 588 | Ga0466959_0040983 | 3300045049 | Bacteria | 3420 |
| 589 | Ga0466959_0048146 | 3300045049 | Bacteria | 3133 |
| 590 | Ga0466959_0103168 | 3300045049 | Bacteria | 2040 |
| 591 | Ga0466959_0175721 | 3300045049 | Bacteria | 1500 |
| 592 | Ga0466958_0014460 | 3300045836 | Bacteria | 4507 |
| 593 | Ga0466958_0020132 | 3300045836 | Bacteria | 3890 |
| 594 | Ga0466958_0037233 | 3300045836 | Bacteria | 2915 |
| 595 | Ga0466958_0047855 | 3300045836 | Bacteria | 2582 |
| 596 | Ga0466958_0433419 | 3300045836 | Bacteria | 850 |
| 597 | Ga0466967_0013842 | 3300045976 | Bacteria | 6254 |
| 598 | Ga0466967_0065477 | 3300045976 | Bacteria | 3235 |
| 599 | Ga0466967_0081069 | 3300045976 | Bacteria | 2930 |
| 600 | Ga0466967_0110765 | 3300045976 | Bacteria | 2522 |
| 601 | Ga0466967_0221318 | 3300045976 | Bacteria | 1799 |
| 602 | Ga0466967_0605724 | 3300045976 | Bacteria | 1081 |
| 603 | Ga0466967_0672300 | 3300045976 | Bacteria | 1025 |
| 604 | Ga0495638_0009441 | 3300046460 | Bacteria | 6846 |
| 605 | Ga0495638_0019859 | 3300046460 | Bacteria | 4442 |
| 606 | Ga0495641_0066105 | 3300046461 | Bacteria | 1627 |
| 607 | Ga0495582_0012490 | 3300046473 | Bacteria | 4681 |
| 608 | Ga0495605_0014802 | 3300046474 | Bacteria | 4259 |
| 609 | Ga0495662_0059262 | 3300046476 | Bacteria | 1849 |
| 610 | Ga0495584_0232619 | 3300046491 | Bacteria | 937 |
| 611 | Ga0495585_0200028 | 3300046492 | Bacteria | 1018 |
| 612 | Ga0495644_0006873 | 3300046523 | Bacteria | 4404 |
| 613 | Ga0495648_0005202 | 3300046524 | Bacteria | 10883 |
| 614 | Ga0495663_0084931 | 3300046525 | Bacteria | 1024 |
| 615 | Ga0495640_0072326 | 3300046533 | Bacteria | 2311 |
| 616 | Ga0495668_0016771 | 3300046616 | Bacteria | 4257 |
| 617 | Ga0495668_0059088 | 3300046616 | Bacteria | 2116 |
| 618 | Ga0495668_0223583 | 3300046616 | Bacteria | 1031 |
| 619 | Ga0495668_0270441 | 3300046616 | Bacteria | 931 |
| 620 | Ga0495624_0089241 | 3300046690 | Bacteria | 1903 |
| 621 | Ga0495670_0350501 | 3300046691 | Bacteria | 794 |
| 622 | Ga0495671_0160515 | 3300046692 | Bacteria | 1093 |
| 623 | Ga0495649_0116436 | 3300046694 | Bacteria | 1415 |
| 624 | Ga0495649_0116713 | 3300046694 | Bacteria | 1413 |
| 625 | Ga0495649_0335834 | 3300046694 | Bacteria | 765 |
| 626 | Ga0495636_0163073 | 3300047318 | Bacteria | 1005 |
| 627 | Ga0495674_0685573 | 3300047319 | Bacteria | 805 |
| 628 | Ga0495672_0071334 | 3300047320 | Bacteria | 1966 |
| 629 | Ga0495672_0143777 | 3300047320 | Bacteria | 1243 |
| 630 | Ga0495672_0167182 | 3300047320 | Bacteria | 1125 |
| 631 | Ga0495672_0192261 | 3300047320 | Bacteria | 1025 |
| 632 | Ga0495672_0197568 | 3300047320 | Bacteria | 1008 |
| 633 | Ga0495676_0396577 | 3300047321 | Bacteria | 916 |
| 634 | Ga0495673_0000524 | 3300047469 | Bacteria | 40257 |
| 635 | Ga0495686_0002996 | 3300047472 | Bacteria | 15021 |
| 636 | Ga0495593_0001036 | 3300047673 | Bacteria | 16331 |
| 637 | Ga0496100_0000090 | 3300048903 | Bacteria | 51781 |
| 638 | Ga0496100_0000358 | 3300048903 | Bacteria | 22180 |
| 639 | Ga0496100_0000576 | 3300048903 | Bacteria | 17408 |
| 640 | Ga0496100_0000826 | 3300048903 | Bacteria | 14867 |
| 641 | Ga0496100_0034329 | 3300048903 | Bacteria | 3182 |
| 642 | Ga0496100_0056805 | 3300048903 | Bacteria | 2561 |
| 643 | Ga0496100_0152669 | 3300048903 | Bacteria | 1649 |
| 644 | Ga0496100_0430730 | 3300048903 | Bacteria | 1009 |
| 645 | Ga0496101_0000031 | 3300048904 | Bacteria | 195195 |
| 646 | Ga0496101_0000409 | 3300048904 | Bacteria | 27808 |
| 647 | Ga0496101_0001670 | 3300048904 | Bacteria | 13325 |
| 648 | Ga0496101_0022234 | 3300048904 | Bacteria | 4364 |
| 649 | Ga0496101_0056537 | 3300048904 | Bacteria | 2837 |
| 650 | Ga0496101_0063357 | 3300048904 | Bacteria | 2691 |
| 651 | Ga0496101_0223395 | 3300048904 | Bacteria | 1462 |
| 652 | Ga0496101_0300293 | 3300048904 | Bacteria | 1257 |
| 653 | Ga0496101_0573223 | 3300048904 | Bacteria | 892 |
| 654 | Ga0496102_0000065 | 3300048905 | Bacteria | 161370 |
| 655 | Ga0496102_0000187 | 3300048905 | Bacteria | 84207 |
| 656 | Ga0496102_0000387 | 3300048905 | Bacteria | 51915 |
| 657 | Ga0496102_0002397 | 3300048905 | Bacteria | 15999 |
| 658 | Ga0496102_0008246 | 3300048905 | Bacteria | 8922 |
| 659 | Ga0496102_0034168 | 3300048905 | Bacteria | 4573 |
| 660 | Ga0496102_0034723 | 3300048905 | Bacteria | 4537 |
| 661 | Ga0496102_0081212 | 3300048905 | Bacteria | 2988 |
| 662 | Ga0496102_0083933 | 3300048905 | Bacteria | 2939 |
| 663 | Ga0496102_0088422 | 3300048905 | Bacteria | 2864 |
| 664 | Ga0496102_0288122 | 3300048905 | Bacteria | 1548 |
| 665 | Ga0496102_0620779 | 3300048905 | Bacteria | 1004 |
| 666 | Ga0496103_0000048 | 3300048906 | Bacteria | 160911 |
| 667 | Ga0496103_0000126 | 3300048906 | Bacteria | 82291 |
| 668 | Ga0496103_0000292 | 3300048906 | Bacteria | 46843 |
| 669 | Ga0496103_0001655 | 3300048906 | Bacteria | 14592 |
| 670 | Ga0496103_0018603 | 3300048906 | Bacteria | 4168 |
| 671 | Ga0496103_0092143 | 3300048906 | Bacteria | 1913 |
| 672 | Ga0496103_0266908 | 3300048906 | Bacteria | 1101 |
| 673 | Ga0496104_0020189 | 3300048907 | Bacteria | 6104 |
| 674 | Ga0496104_0066406 | 3300048907 | Bacteria | 3425 |
| 675 | Ga0496104_0113942 | 3300048907 | Bacteria | 2593 |
| 676 | Ga0496104_0140081 | 3300048907 | Bacteria | 2324 |
| 677 | Ga0496104_0191465 | 3300048907 | Bacteria | 1957 |
| 678 | Ga0496104_0221750 | 3300048907 | Bacteria | 1803 |
| 679 | Ga0496104_0305233 | 3300048907 | Bacteria | 1504 |
| 680 | Ga0496105_0010809 | 3300048908 | Bacteria | 7189 |
| 681 | Ga0496105_0016595 | 3300048908 | Bacteria | 5880 |
| 682 | Ga0496105_0103573 | 3300048908 | Bacteria | 2350 |
| 683 | Ga0496105_0141796 | 3300048908 | Bacteria | 1978 |
| 684 | Ga0496106_0002589 | 3300048909 | Bacteria | 13464 |
| 685 | Ga0496106_0020022 | 3300048909 | Bacteria | 4962 |
| 686 | Ga0496106_0048358 | 3300048909 | Bacteria | 3203 |
| 687 | Ga0496106_0086429 | 3300048909 | Bacteria | 2415 |
| 688 | Ga0496106_0200285 | 3300048909 | Bacteria | 1589 |
| 689 | Ga0496106_0248215 | 3300048909 | Bacteria | 1423 |
| 690 | Ga0496106_0258005 | 3300048909 | Bacteria | 1394 |
| 691 | Ga0496106_0583215 | 3300048909 | Bacteria | 896 |
| 692 | Ga0496107_0004431 | 3300048910 | Bacteria | 9514 |
| 693 | Ga0496107_0005397 | 3300048910 | Bacteria | 8747 |
| 694 | Ga0496107_0015900 | 3300048910 | Bacteria | 5279 |
| 695 | Ga0496107_0027297 | 3300048910 | Bacteria | 4054 |
| 696 | Ga0496107_0181389 | 3300048910 | Bacteria | 1563 |
| 697 | Ga0496108_0011488 | 3300048911 | Bacteria | 7197 |
| 698 | Ga0496108_0021420 | 3300048911 | Bacteria | 5314 |
| 699 | Ga0496108_0029357 | 3300048911 | Bacteria | 4553 |
| 700 | Ga0496108_0049471 | 3300048911 | Bacteria | 3516 |
| 701 | Ga0496108_0065918 | 3300048911 | Bacteria | 3053 |
| 702 | Ga0496108_0099750 | 3300048911 | Bacteria | 2476 |
| 703 | Ga0496108_0155881 | 3300048911 | Bacteria | 1972 |
| 704 | Ga0496108_0550235 | 3300048911 | Bacteria | 1007 |
| 705 | Ga0496109_0000134 | 3300048912 | Bacteria | 75662 |
| 706 | Ga0496109_0131394 | 3300048912 | Bacteria | 2337 |
| 707 | Ga0496109_0181830 | 3300048912 | Bacteria | 1975 |
| 708 | Ga0496109_0189902 | 3300048912 | Bacteria | 1930 |
| 709 | Ga0496110_0024896 | 3300048913 | Bacteria | 5107 |
| 710 | Ga0496110_0032195 | 3300048913 | Bacteria | 4527 |
| 711 | Ga0496110_0038335 | 3300048913 | Bacteria | 4170 |
| 712 | Ga0496110_0104973 | 3300048913 | Bacteria | 2535 |
| 713 | Ga0496110_0533657 | 3300048913 | Bacteria | 1067 |
| 714 | Ga0496111_0002609 | 3300048914 | Bacteria | 10915 |
| 715 | Ga0496111_0087238 | 3300048914 | Bacteria | 2284 |
| 716 | Ga0496111_0105904 | 3300048914 | Bacteria | 2070 |
| 717 | Ga0496111_0113591 | 3300048914 | Bacteria | 1996 |
| 718 | Ga0496112_0006326 | 3300048915 | Bacteria | 10397 |
| 719 | Ga0496112_0043147 | 3300048915 | Bacteria | 4415 |
| 720 | Ga0496112_0043544 | 3300048915 | Bacteria | 4395 |
| 721 | Ga0496112_0086809 | 3300048915 | Bacteria | 3095 |
| 722 | Ga0496112_0423509 | 3300048915 | Bacteria | 1270 |
| 723 | Ga0496112_0456254 | 3300048915 | Bacteria | 1216 |
| 724 | Ga0496112_0628987 | 3300048915 | Bacteria | 1004 |
| 725 | Ga0496113_0068031 | 3300048916 | Bacteria | 2702 |
| 726 | Ga0496113_0120482 | 3300048916 | Bacteria | 2051 |
| 727 | Ga0496113_0482791 | 3300048916 | Bacteria | 995 |
| 728 | Ga0496114_0000740 | 3300048917 | Bacteria | 24358 |
| 729 | Ga0496114_0001498 | 3300048917 | Bacteria | 17734 |
| 730 | Ga0496114_0016088 | 3300048917 | Bacteria | 6020 |
| 731 | Ga0496114_0030885 | 3300048917 | Bacteria | 4407 |
| 732 | Ga0496114_0227178 | 3300048917 | Bacteria | 1639 |
| 733 | Ga0496114_0263440 | 3300048917 | Bacteria | 1518 |
| 734 | Ga0496114_0446661 | 3300048917 | Bacteria | 1145 |
| 735 | Ga0496115_0002039 | 3300048918 | Bacteria | 14457 |
| 736 | Ga0496115_0081409 | 3300048918 | Bacteria | 2637 |
| 737 | Ga0496115_0119606 | 3300048918 | Bacteria | 2167 |
| 738 | Ga0496115_0336141 | 3300048918 | Bacteria | 1233 |
| 739 | Ga0496116_0000125 | 3300048919 | Bacteria | 160885 |
| 740 | Ga0496116_0000306 | 3300048919 | Bacteria | 82349 |
| 741 | Ga0496116_0019575 | 3300048919 | Bacteria | 5178 |
| 742 | Ga0496116_0023895 | 3300048919 | Bacteria | 4538 |
| 743 | Ga0496117_0000111 | 3300048920 | Bacteria | 184570 |
| 744 | Ga0496117_0000343 | 3300048920 | Bacteria | 82294 |
| 745 | Ga0496117_0001572 | 3300048920 | Bacteria | 32413 |
| 746 | Ga0496117_0112605 | 3300048920 | Bacteria | 1691 |
| 747 | Ga0496118_0000083 | 3300048921 | Bacteria | 184570 |
| 748 | Ga0496118_0000192 | 3300048921 | Bacteria | 107736 |
| 749 | Ga0496118_0000648 | 3300048921 | Bacteria | 56769 |
| 750 | Ga0496118_0001353 | 3300048921 | Bacteria | 36982 |
| 751 | Ga0496118_0009352 | 3300048921 | Bacteria | 9925 |
| 752 | Ga0496119_0002640 | 3300048922 | Bacteria | 19420 |
| 753 | Ga0496119_0003272 | 3300048922 | Bacteria | 16942 |
| 754 | Ga0496119_0011086 | 3300048922 | Bacteria | 7508 |
| 755 | Ga0496120_0002589 | 3300048923 | Bacteria | 17993 |
| 756 | Ga0496120_0010816 | 3300048923 | Bacteria | 6323 |
| 757 | Ga0496120_0041742 | 3300048923 | Bacteria | 2684 |
| 758 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 759 | Ga0496121_0019295 | 3300048924 | Bacteria | 6823 |
| 760 | Ga0496122_0000138 | 3300048925 | Bacteria | 169434 |
| 761 | Ga0496122_0008620 | 3300048925 | Bacteria | 10946 |
| 762 | Ga0496122_0168948 | 3300048925 | Bacteria | 1321 |
| 763 | Ga0496122_0314589 | 3300048925 | Bacteria | 836 |
| 764 | Ga0496123_0002022 | 3300048926 | Bacteria | 26177 |
| 765 | Ga0496123_0002126 | 3300048926 | Bacteria | 25354 |
| 766 | Ga0496123_0008587 | 3300048926 | Bacteria | 9360 |
| 767 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 768 | Ga0496124_0017629 | 3300048927 | Bacteria | 6723 |
| 769 | Ga0496124_0269234 | 3300048927 | Bacteria | 1248 |
| 770 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 771 | Ga0496125_0038840 | 3300048928 | Bacteria | 4110 |
| 772 | Ga0496125_0040927 | 3300048928 | Bacteria | 3967 |
| 773 | Ga0496125_0113555 | 3300048928 | Bacteria | 1954 |
| 774 | Ga0496125_0336277 | 3300048928 | Bacteria | 908 |
| 775 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 776 | Ga0496126_0000220 | 3300048929 | Bacteria | 124547 |
| 777 | Ga0496126_0000433 | 3300048929 | Bacteria | 84020 |
| 778 | Ga0496126_0003794 | 3300048929 | Bacteria | 18761 |
| 779 | Ga0496126_0006077 | 3300048929 | Bacteria | 13547 |
| 780 | Ga0496126_0008463 | 3300048929 | Bacteria | 11094 |
| 781 | Ga0496126_0015093 | 3300048929 | Bacteria | 7782 |
| 782 | Ga0496126_0167002 | 3300048929 | Bacteria | 1877 |
| 783 | Ga0501032_0001198 | 3300049569 | Bacteria | 20738 |
| 784 | Ga0501033_0013056 | 3300049570 | Bacteria | 6332 |
| 785 | Ga0501033_0032246 | 3300049570 | Bacteria | 3935 |
| 786 | Ga0501033_0584369 | 3300049570 | Bacteria | 767 |
| 787 | Ga0501034_0003575 | 3300049571 | Bacteria | 17647 |
| 788 | Ga0501034_0004941 | 3300049571 | Bacteria | 14678 |
| 789 | Ga0501034_0037834 | 3300049571 | Bacteria | 4887 |
| 790 | Ga0501034_0131209 | 3300049571 | Bacteria | 2489 |
| 791 | Ga0501034_0678794 | 3300049571 | Bacteria | 930 |
| 792 | Ga0501036_0035805 | 3300049572 | Bacteria | 4201 |
| 793 | Ga0501036_0064770 | 3300049572 | Bacteria | 3093 |
| 794 | Ga0501037_0002583 | 3300049573 | Bacteria | 13082 |
| 795 | Ga0501037_0007135 | 3300049573 | Bacteria | 8167 |
| 796 | Ga0501037_0184866 | 3300049573 | Bacteria | 1477 |
| 797 | Ga0501038_0000352 | 3300049574 | Bacteria | 39429 |
| 798 | Ga0501039_0002801 | 3300049575 | Bacteria | 13027 |
| 799 | Ga0501043_0002096 | 3300049579 | Bacteria | 17025 |
| 800 | Ga0501043_0029168 | 3300049579 | Bacteria | 4333 |
| 801 | Ga0501046_0000769 | 3300049580 | Bacteria | 31025 |
| 802 | Ga0501047_0005895 | 3300049581 | Bacteria | 11526 |
| 803 | Ga0501047_0010792 | 3300049581 | Bacteria | 8637 |
| 804 | Ga0501068_0238077 | 3300049584 | Bacteria | 1158 |
| 805 | Ga0501069_0045914 | 3300049585 | Bacteria | 2421 |
| 806 | Ga0501070_0006531 | 3300049586 | Bacteria | 9918 |
| 807 | Ga0501070_0010101 | 3300049586 | Bacteria | 7989 |
| 808 | Ga0501070_0143809 | 3300049586 | Bacteria | 1969 |
| 809 | Ga0501073_0016560 | 3300049589 | Bacteria | 5343 |
| 810 | Ga0501075_0306240 | 3300049591 | Bacteria | 1211 |
| 811 | Ga0501077_0325585 | 3300049593 | Bacteria | 980 |
| 812 | Ga0501080_0161831 | 3300049742 | Bacteria | 2067 |
| 813 | Ga0501083_0171294 | 3300049744 | Bacteria | 1419 |
| 814 | Ga0501035_0000886 | 3300049822 | Bacteria | 31764 |
| 815 | Ga0501035_0007162 | 3300049822 | Bacteria | 10434 |
| 816 | Ga0501044_0001635 | 3300049823 | Bacteria | 26275 |
| 817 | Ga0501044_0003142 | 3300049823 | Bacteria | 18681 |
| 818 | Ga0501044_0009219 | 3300049823 | Bacteria | 10779 |
| 819 | nmdc:mga03683_121843_c1 | 3300050489 | Bacteria | 1160 |
| 820 | nmdc:mga03683_200629_c1 | 3300050489 | Bacteria | 915 |
| 821 | nmdc:mga03683_54157_c1 | 3300050489 | Bacteria | 1681 |
| 822 | nmdc:mga03n38_144118_c1 | 3300050490 | Bacteria | 1193 |
| 823 | nmdc:mga03n38_158113_c1 | 3300050490 | Bacteria | 1146 |
| 824 | nmdc:mga03n38_7026_c1 | 3300050490 | Bacteria | 3958 |
| 825 | nmdc:mga00v17_107702_c1 | 3300050491 | Bacteria | 1765 |
| 826 | nmdc:mga00v17_16349_c1 | 3300050491 | Bacteria | 4182 |
| 827 | nmdc:mga00v17_207324_c1 | 3300050491 | Bacteria | 1268 |
| 828 | nmdc:mga00v17_34499_c1 | 3300050491 | Bacteria | 3006 |
| 829 | nmdc:mga00v17_360791_c1 | 3300050491 | Bacteria | 945 |
| 830 | nmdc:mga00v17_43081_c1 | 3300050491 | Bacteria | 2717 |
| 831 | nmdc:mga00v17_63353_c1 | 3300050491 | Bacteria | 2277 |
| 832 | nmdc:mga00v17_71997_c1 | 3300050491 | Bacteria | 2144 |
| 833 | nmdc:mga00v17_77101_c1 | 3300050491 | Bacteria | 2075 |
| 834 | nmdc:mga00v17_8347_c1 | 3300050491 | Bacteria | 5275 |
| 835 | nmdc:mga00v17_94938_c1 | 3300050491 | Bacteria | 1877 |
| 836 | nmdc:mga0yw44_15601_c2 | 3300050492 | Bacteria | 2529 |
| 837 | nmdc:mga0yw44_164212_c1 | 3300050492 | Bacteria | 1455 |
| 838 | nmdc:mga0yw44_19851_c1 | 3300050492 | Bacteria | 3715 |
| 839 | nmdc:mga0yw44_37477_c1 | 3300050492 | Bacteria | 2863 |
| 840 | nmdc:mga0yw44_527685_c1 | 3300050492 | Bacteria | 801 |
| 841 | nmdc:mga0yw44_60015_c1 | 3300050492 | Bacteria | 2329 |
| 842 | nmdc:mga0yw44_61543_c1 | 3300050492 | Bacteria | 2304 |
| 843 | nmdc:mga0yw44_75812_c1 | 3300050492 | Bacteria | 2098 |
| 844 | nmdc:mga0yw44_93711_c1 | 3300050492 | Bacteria | 1902 |
| 845 | nmdc:mga06z11_18177_c1 | 3300050494 | Bacteria | 3206 |
| 846 | nmdc:mga06z11_24314_c1 | 3300050494 | Bacteria | 2856 |
| 847 | nmdc:mga04h51_158250_c1 | 3300050495 | Bacteria | 870 |
| 848 | nmdc:mga04h51_34114_c1 | 3300050495 | Bacteria | 1624 |
| 849 | nmdc:mga07m45_114610_c1 | 3300050496 | Bacteria | 1554 |
| 850 | nmdc:mga07m45_190588_c1 | 3300050496 | Bacteria | 1192 |
| 851 | nmdc:mga07m45_3155_c1 | 3300050496 | Bacteria | 7905 |
| 852 | nmdc:mga07m45_4178_c1 | 3300050496 | Bacteria | 7055 |
| 853 | nmdc:mga07m45_67220_c1 | 3300050496 | Bacteria | 2037 |
| 854 | nmdc:mga07m45_8036_c1 | 3300050496 | Bacteria | 5409 |
| 855 | nmdc:mga07m45_8496_c2 | 3300050496 | Bacteria | 4001 |
| 856 | nmdc:mga05p37_9680_c1 | 3300050507 | Bacteria | 11423 |
| 857 | nmdc:mga0qj67_42343_c1 | 3300050509 | Bacteria | 3584 |
| 858 | nmdc:mga06r32_820_c2 | 3300050510 | Bacteria | 3872 |
| 859 | nmdc:mga0sz30_108537_c2 | 3300050516 | Bacteria | 925 |
| 860 | nmdc:mga0sz30_10998_c1 | 3300050516 | Bacteria | 3481 |
| 861 | nmdc:mga0sz30_20669_c1 | 3300050516 | Bacteria | 2657 |
| 862 | nmdc:mga0sz30_29882_c1 | 3300050516 | Bacteria | 2249 |
| 863 | nmdc:mga0sz30_3067_c2 | 3300050516 | Bacteria | 1191 |
| 864 | nmdc:mga0sz30_43771_c1 | 3300050516 | Bacteria | 1885 |
| 865 | nmdc:mga0sz30_57861_c1 | 3300050516 | Bacteria | 1652 |
| 866 | nmdc:mga0sz30_64232_c1 | 3300050516 | Bacteria | 1572 |
| 867 | nmdc:mga0sz30_681_c1 | 3300050516 | Bacteria | 12548 |
| 868 | nmdc:mga0sz30_75422_c1 | 3300050516 | Bacteria | 1455 |
| 869 | nmdc:mga0sz30_99840_c1 | 3300050516 | Bacteria | 1267 |
| 870 | Ga0500610_0050234 | 3300053079 | Bacteria | 2170 |
| 871 | Ga0500635_0009747 | 3300053080 | Bacteria | 2675 |
| 872 | Ga0500635_0124215 | 3300053080 | Bacteria | 968 |
| 873 | Ga0500643_002089 | 3300053087 | Bacteria | 10632 |
| 874 | Ga0500643_009791 | 3300053087 | Bacteria | 3631 |
| 875 | Ga0500644_0095726 | 3300053088 | Bacteria | 1120 |
| 876 | Ga0500583_0083800 | 3300053092 | Bacteria | 1544 |
| 877 | Ga0500556_0001477 | 3300053104 | Bacteria | 9807 |
| 878 | Ga0500562_010478 | 3300053108 | Bacteria | 2349 |
| 879 | Ga0500608_215978 | 3300053122 | Bacteria | 779 |
| 880 | Ga0500642_0048596 | 3300053130 | Bacteria | 1864 |
| 881 | Ga0500652_211220 | 3300053131 | Bacteria | 784 |
| 882 | Ga0500658_0039142 | 3300053134 | Bacteria | 1893 |
| 883 | Ga0500559_0037586 | 3300053136 | Bacteria | 2099 |
| 884 | Ga0500568_0120570 | 3300053139 | Bacteria | 977 |
| 885 | Ga0500577_0015413 | 3300053142 | Bacteria | 2388 |
| 886 | Ga0500604_0018934 | 3300053151 | Bacteria | 1924 |
| 887 | Ga0500616_0107724 | 3300053153 | Bacteria | 1351 |
| 888 | Ga0500627_0067441 | 3300053158 | Bacteria | 1581 |
| 889 | Ga0500645_005909 | 3300053730 | Bacteria | 4435 |
| 890 | Ga0466962_0025036 | 3300061719 | Bacteria | 2865 |
| 891 | Ga0466962_0110381 | 3300061719 | Bacteria | 1324 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044706 | Ga0466964_0488562 | Ga0466964_0488562_14_601 | 194 |
| 2 | 3300009545 | Ga0105237_10017368 | Ga0105237_100173684 | 211 |
| 3 | 3300010375 | Ga0105239_10004701 | Ga0105239_1000470111 | 211 |
| 4 | 3300005843 | Ga0068860_100104438 | Ga0068860_1001044385 | 213 |
| 5 | 3300028381 | Ga0268264_10134545 | Ga0268264_101345454 | 213 |
| 6 | 3300047320 | Ga0495672_0197568 | Ga0495672_0197568_218_859 | 213 |
| 7 | 3300050491 | nmdc:mga00v17_63353_c1 | nmdc:mga00v17_63353_c1_722_1366 | 213 |
| 8 | 3300050491 | nmdc:mga00v17_8347_c1 | nmdc:mga00v17_8347_c1_1068_1712 | 213 |
| 9 | 3300050492 | nmdc:mga0yw44_164212_c1 | nmdc:mga0yw44_164212_c1_702_1343 | 213 |
| 10 | 3300050492 | nmdc:mga0yw44_60015_c1 | nmdc:mga0yw44_60015_c1_678_1322 | 213 |
| 11 | 3300050494 | nmdc:mga06z11_24314_c1 | nmdc:mga06z11_24314_c1_1504_2148 | 213 |
| 12 | 3300050495 | nmdc:mga04h51_158250_c1 | nmdc:mga04h51_158250_c1_191_835 | 213 |
| 13 | 3300050496 | nmdc:mga07m45_4178_c1 | nmdc:mga07m45_4178_c1_5788_6432 | 213 |
| 14 | 3300050496 | nmdc:mga07m45_8496_c2 | nmdc:mga07m45_8496_c2_990_1634 | 213 |
| 15 | 3300050516 | nmdc:mga0sz30_29882_c1 | nmdc:mga0sz30_29882_c1_1201_1845 | 213 |
| 16 | 3300050516 | nmdc:mga0sz30_57861_c1 | nmdc:mga0sz30_57861_c1_336_980 | 213 |
| 17 | iso_pu_bacteria | 2956939328 | 2956942063 | 213 |
| 18 | iso_pu_bacteria | 3001119090 | 3001119419 | 213 |
| 19 | 3300006847 | Ga0075431_100023715 | Ga0075431_1000237153 | 214 |
| 20 | 3300013308 | Ga0157375_10924939 | Ga0157375_109249392 | 214 |
| 21 | 3300048909 | Ga0496106_0248215 | Ga0496106_0248215_15_710 | 214 |
| 22 | 3300048915 | Ga0496112_0006326 | Ga0496112_0006326_2305_2949 | 214 |
| 23 | 3300050510 | nmdc:mga06r32_820_c2 | nmdc:mga06r32_820_c2_1604_2248 | 214 |
| 24 | iso_pu_bacteria | 2558860112 | 2558911863 | 214 |
| 25 | iso_pu_bacteria | 2751185725 | 2753039017 | 214 |
| 26 | iso_pu_bacteria | 2751185792 | 2753327378 | 214 |
| 27 | iso_pu_bacteria | 2870782633 | 2870787972 | 214 |
| 28 | 3300005617 | Ga0068859_100737090 | Ga0068859_1007370902 | 215 |
| 29 | 3300006173 | Ga0070716_100036133 | Ga0070716_1000361334 | 215 |
| 30 | 3300006931 | Ga0097620_100737079 | Ga0097620_1007370791 | 215 |
| 31 | 3300009094 | Ga0111539_10367163 | Ga0111539_103671632 | 215 |
| 32 | 3300009148 | Ga0105243_10001026 | Ga0105243_1000102614 | 215 |
| 33 | 3300014325 | Ga0163163_10573156 | Ga0163163_105731562 | 215 |
| 34 | 3300025935 | Ga0207709_10001922 | Ga0207709_100019223 | 215 |
| 35 | 3300025939 | Ga0207665_10051740 | Ga0207665_100517401 | 215 |
| 36 | 3300037853 | Ga0436364_0595872 | Ga0436364_0595872_264_911 | 215 |
| 37 | 3300044658 | Ga0466972_0005077 | Ga0466972_0005077_1262_1909 | 215 |
| 38 | 3300044683 | Ga0466965_0003274 | Ga0466965_0003274_882_1529 | 215 |
| 39 | 3300044719 | Ga0466971_0066561 | Ga0466971_0066561_772_1419 | 215 |
| 40 | 3300044735 | Ga0466968_0007618 | Ga0466968_0007618_1134_1781 | 215 |
| 41 | 3300044765 | Ga0466970_0018512 | Ga0466970_0018512_1577_2224 | 215 |
| 42 | 3300044901 | Ga0466960_0012184 | Ga0466960_0012184_783_1430 | 215 |
| 43 | 3300045049 | Ga0466959_0103168 | Ga0466959_0103168_1153_1800 | 215 |
| 44 | 3300045836 | Ga0466958_0020132 | Ga0466958_0020132_2504_3151 | 215 |
| 45 | 3300045976 | Ga0466967_0110765 | Ga0466967_0110765_383_1030 | 215 |
| 46 | 3300045976 | Ga0466967_0605724 | Ga0466967_0605724_297_944 | 215 |
| 47 | 3300048918 | Ga0496115_0336141 | Ga0496115_0336141_349_996 | 215 |
| 48 | 3300048925 | Ga0496122_0168948 | Ga0496122_0168948_539_1186 | 215 |
| 49 | 3300048926 | Ga0496123_0002126 | Ga0496123_0002126_17797_18444 | 215 |
| 50 | 3300048929 | Ga0496126_0003794 | Ga0496126_0003794_7178_7825 | 215 |
| 51 | 3300048929 | Ga0496126_0008463 | Ga0496126_0008463_162_809 | 215 |
| 52 | 3300050489 | nmdc:mga03683_200629_c1 | nmdc:mga03683_200629_c1_10_684 | 215 |
| 53 | iso_pu_bacteria | 2523231044 | 2523384651 | 215 |
| 54 | iso_pu_bacteria | 2751185734 | 2753069695 | 215 |
| 55 | iso_pu_bacteria | 2842888712 | 2842890076 | 215 |
| 56 | iso_pu_bacteria | 2870721527 | 2870727797 | 215 |
| 57 | 3300005338 | Ga0068868_100172888 | Ga0068868_1001728882 | 216 |
| 58 | 3300005843 | Ga0068860_101147698 | Ga0068860_1011476981 | 216 |
| 59 | 3300006175 | Ga0070712_100521707 | Ga0070712_1005217072 | 216 |
| 60 | 3300013297 | Ga0157378_10394674 | Ga0157378_103946741 | 216 |
| 61 | 3300035119 | Ga0373956_0012775 | Ga0373956_0012775_409_1059 | 216 |
| 62 | iso_pu_bacteria | 2558860280 | 2559428312 | 216 |
| 63 | iso_pu_bacteria | 2738543011 | 2739237930 | 216 |
| 64 | iso_pu_bacteria | 2889300758 | 2889303555 | 216 |
| 65 | iso_pu_bacteria | 2939743619 | 2939747340 | 216 |
| 66 | iso_pu_bacteria | 8047710418 | 8047716334 | 216 |
| 67 | 3300005335 | Ga0070666_10607723 | Ga0070666_106077231 | 217 |
| 68 | 3300005356 | Ga0070674_100062303 | Ga0070674_1000623032 | 217 |
| 69 | 3300005841 | Ga0068863_100079433 | Ga0068863_1000794332 | 217 |
| 70 | 3300006881 | Ga0068865_100535958 | Ga0068865_1005359581 | 217 |
| 71 | 3300009177 | Ga0105248_10129111 | Ga0105248_101291116 | 217 |
| 72 | 3300013297 | Ga0157378_10128578 | Ga0157378_101285783 | 217 |
| 73 | 3300013308 | Ga0157375_10846812 | Ga0157375_108468122 | 217 |
| 74 | 3300025937 | Ga0207669_10326606 | Ga0207669_103266062 | 217 |
| 75 | 3300025938 | Ga0207704_10426461 | Ga0207704_104264611 | 217 |
| 76 | 3300025941 | Ga0207711_10083138 | Ga0207711_100831383 | 217 |
| 77 | 3300048903 | Ga0496100_0034329 | Ga0496100_0034329_2010_2663 | 217 |
| 78 | 3300048904 | Ga0496101_0063357 | Ga0496101_0063357_556_1209 | 217 |
| 79 | 3300048907 | Ga0496104_0066406 | Ga0496104_0066406_418_1071 | 217 |
| 80 | 3300048908 | Ga0496105_0016595 | Ga0496105_0016595_797_1450 | 217 |
| 81 | 3300048910 | Ga0496107_0015900 | Ga0496107_0015900_3794_4447 | 217 |
| 82 | 3300048917 | Ga0496114_0000740 | Ga0496114_0000740_5690_6343 | 217 |
| 83 | iso_pu_bacteria | 2738541274 | 2738706311 | 217 |
| 84 | iso_pu_bacteria | 2738543028 | 2739328800 | 217 |
| 85 | iso_pu_bacteria | 2902799365 | 2902804090 | 217 |
| 86 | iso_pu_bacteria | 2904765812 | 2904766740 | 217 |
| 87 | iso_pu_bacteria | 2904770941 | 2904775248 | 217 |
| 88 | iso_pu_bacteria | 2908811453 | 2908814434 | 217 |
| 89 | iso_pu_bacteria | 2919420072 | 2919420824 | 217 |
| 90 | iso_pu_bacteria | 2919432681 | 2919433418 | 217 |
| 91 | 3300005329 | Ga0070683_100052935 | Ga0070683_1000529352 | 218 |
| 92 | 3300005329 | Ga0070683_100769146 | Ga0070683_1007691462 | 218 |
| 93 | 3300005334 | Ga0068869_100203799 | Ga0068869_1002037991 | 218 |
| 94 | 3300005337 | Ga0070682_100022346 | Ga0070682_1000223462 | 218 |
| 95 | 3300005338 | Ga0068868_100022687 | Ga0068868_1000226876 | 218 |
| 96 | 3300005339 | Ga0070660_100094922 | Ga0070660_1000949222 | 218 |
| 97 | 3300005345 | Ga0070692_10232059 | Ga0070692_102320591 | 218 |
| 98 | 3300005347 | Ga0070668_100246804 | Ga0070668_1002468041 | 218 |
| 99 | 3300005354 | Ga0070675_100166812 | Ga0070675_1001668122 | 218 |
| 100 | 3300005441 | Ga0070700_100216376 | Ga0070700_1002163761 | 218 |
| 101 | 3300005455 | Ga0070663_100009948 | Ga0070663_1000099482 | 218 |
| 102 | 3300005456 | Ga0070678_100417356 | Ga0070678_1004173562 | 218 |
| 103 | 3300005466 | Ga0070685_10020338 | Ga0070685_100203384 | 218 |
| 104 | 3300005548 | Ga0070665_100020302 | Ga0070665_1000203028 | 218 |
| 105 | 3300005577 | Ga0068857_100257011 | Ga0068857_1002570111 | 218 |
| 106 | 3300005578 | Ga0068854_100239194 | Ga0068854_1002391942 | 218 |
| 107 | 3300005616 | Ga0068852_100157381 | Ga0068852_1001573812 | 218 |
| 108 | 3300005719 | Ga0068861_100184311 | Ga0068861_1001843112 | 218 |
| 109 | 3300005834 | Ga0068851_10022293 | Ga0068851_100222932 | 218 |
| 110 | 3300005842 | Ga0068858_100070628 | Ga0068858_1000706282 | 218 |
| 111 | 3300005843 | Ga0068860_100008609 | Ga0068860_1000086098 | 218 |
| 112 | 3300005844 | Ga0068862_100104296 | Ga0068862_1001042963 | 218 |
| 113 | 3300005844 | Ga0068862_100229328 | Ga0068862_1002293281 | 218 |
| 114 | 3300009092 | Ga0105250_10278800 | Ga0105250_102788001 | 218 |
| 115 | 3300009098 | Ga0105245_10130798 | Ga0105245_101307983 | 218 |
| 116 | 3300009553 | Ga0105249_10670702 | Ga0105249_106707021 | 218 |
| 117 | 3300009993 | Ga0105028_108579 | Ga0105028_1085792 | 218 |
| 118 | 3300010375 | Ga0105239_10089122 | Ga0105239_100891224 | 218 |
| 119 | 3300011119 | Ga0105246_10193950 | Ga0105246_101939501 | 218 |
| 120 | 3300013105 | Ga0157369_10471834 | Ga0157369_104718341 | 218 |
| 121 | 3300013307 | Ga0157372_10029028 | Ga0157372_100290287 | 218 |
| 122 | 3300013308 | Ga0157375_10174762 | Ga0157375_101747623 | 218 |
| 123 | 3300014968 | Ga0157379_10020737 | Ga0157379_100207374 | 218 |
| 124 | 3300021384 | Ga0213876_10015727 | Ga0213876_100157274 | 218 |
| 125 | 3300025901 | Ga0207688_10003531 | Ga0207688_100035315 | 218 |
| 126 | 3300025901 | Ga0207688_10056506 | Ga0207688_100565062 | 218 |
| 127 | 3300025909 | Ga0207705_10069495 | Ga0207705_100694951 | 218 |
| 128 | 3300025919 | Ga0207657_10185531 | Ga0207657_101855312 | 218 |
| 129 | 3300025926 | Ga0207659_10081641 | Ga0207659_100816412 | 218 |
| 130 | 3300025927 | Ga0207687_10019541 | Ga0207687_100195411 | 218 |
| 131 | 3300025931 | Ga0207644_10166743 | Ga0207644_101667432 | 218 |
| 132 | 3300025944 | Ga0207661_10059162 | Ga0207661_100591623 | 218 |
| 133 | 3300025944 | Ga0207661_10304329 | Ga0207661_103043292 | 218 |
| 134 | 3300025972 | Ga0207668_10227885 | Ga0207668_102278851 | 218 |
| 135 | 3300025981 | Ga0207640_10106297 | Ga0207640_101062971 | 218 |
| 136 | 3300026023 | Ga0207677_10038929 | Ga0207677_100389292 | 218 |
| 137 | 3300026035 | Ga0207703_10063966 | Ga0207703_100639663 | 218 |
| 138 | 3300026067 | Ga0207678_10027382 | Ga0207678_100273822 | 218 |
| 139 | 3300026075 | Ga0207708_10123852 | Ga0207708_101238523 | 218 |
| 140 | 3300026095 | Ga0207676_10043866 | Ga0207676_100438665 | 218 |
| 141 | 3300026116 | Ga0207674_10291548 | Ga0207674_102915481 | 218 |
| 142 | 3300028379 | Ga0268266_10005470 | Ga0268266_100054708 | 218 |
| 143 | 3300028379 | Ga0268266_10024368 | Ga0268266_100243682 | 218 |
| 144 | 3300028380 | Ga0268265_10258970 | Ga0268265_102589701 | 218 |
| 145 | 3300031901 | Ga0307406_10360275 | Ga0307406_103602751 | 218 |
| 146 | 3300039437 | Ga0436365_1833781 | Ga0436365_1833781_9853_10509 | 218 |
| 147 | 3300048903 | Ga0496100_0056805 | Ga0496100_0056805_64_720 | 218 |
| 148 | 3300048904 | Ga0496101_0022234 | Ga0496101_0022234_416_1072 | 218 |
| 149 | 3300048905 | Ga0496102_0000187 | Ga0496102_0000187_27368_28024 | 218 |
| 150 | 3300048906 | Ga0496103_0000126 | Ga0496103_0000126_54268_54924 | 218 |
| 151 | 3300048907 | Ga0496104_0140081 | Ga0496104_0140081_808_1464 | 218 |
| 152 | 3300048907 | Ga0496104_0305233 | Ga0496104_0305233_737_1420 | 218 |
| 153 | 3300048911 | Ga0496108_0021420 | Ga0496108_0021420_3901_4557 | 218 |
| 154 | 3300048911 | Ga0496108_0049471 | Ga0496108_0049471_616_1272 | 218 |
| 155 | 3300048911 | Ga0496108_0065918 | Ga0496108_0065918_563_1246 | 218 |
| 156 | 3300048912 | Ga0496109_0181830 | Ga0496109_0181830_917_1600 | 218 |
| 157 | 3300048913 | Ga0496110_0032195 | Ga0496110_0032195_1491_2147 | 218 |
| 158 | 3300048913 | Ga0496110_0104973 | Ga0496110_0104973_1693_2349 | 218 |
| 159 | 3300048914 | Ga0496111_0113591 | Ga0496111_0113591_1267_1923 | 218 |
| 160 | 3300048917 | Ga0496114_0227178 | Ga0496114_0227178_590_1246 | 218 |
| 161 | 3300048919 | Ga0496116_0000306 | Ga0496116_0000306_54329_54985 | 218 |
| 162 | 3300048920 | Ga0496117_0000343 | Ga0496117_0000343_54131_54787 | 218 |
| 163 | 3300048921 | Ga0496118_0000192 | Ga0496118_0000192_52837_53493 | 218 |
| 164 | 3300048923 | Ga0496120_0010816 | Ga0496120_0010816_2130_2786 | 218 |
| 165 | 3300048927 | Ga0496124_0017629 | Ga0496124_0017629_2419_3075 | 218 |
| 166 | 3300048928 | Ga0496125_0038840 | Ga0496125_0038840_2580_3236 | 218 |
| 167 | 3300048929 | Ga0496126_0000433 | Ga0496126_0000433_55997_56653 | 218 |
| 168 | 3300049571 | Ga0501034_0678794 | Ga0501034_0678794_221_877 | 218 |
| 169 | 3300049591 | Ga0501075_0306240 | Ga0501075_0306240_188_844 | 218 |
| 170 | iso_pu_bacteria | 2643221687 | 2644491231 | 218 |
| 171 | iso_pu_bacteria | 2643221715 | 2644636587 | 218 |
| 172 | iso_pu_bacteria | 2738541264 | 2738667322 | 218 |
| 173 | iso_pu_bacteria | 2738541356 | 2739146165 | 218 |
| 174 | iso_pu_bacteria | 2738543005 | 2739204561 | 218 |
| 175 | iso_pu_bacteria | 2842134933 | 2842139538 | 218 |
| 176 | iso_pu_bacteria | 2902792274 | 2902797237 | 218 |
| 177 | iso_pu_bacteria | 2902810491 | 2902814548 | 218 |
| 178 | iso_pu_bacteria | 2902837492 | 2902842985 | 218 |
| 179 | iso_pu_bacteria | 2928142448 | 2928145400 | 218 |
| 180 | iso_pu_bacteria | 2929212328 | 2929217834 | 218 |
| 181 | iso_pu_bacteria | 2939582691 | 2939585087 | 218 |
| 182 | 3300009551 | Ga0105238_10055930 | Ga0105238_100559303 | 220 |
| 183 | 3300021388 | Ga0213875_10002285 | Ga0213875_1000228512 | 220 |
| 184 | 3300025929 | Ga0207664_10470921 | Ga0207664_104709212 | 220 |
| 185 | 3300026041 | Ga0207639_10018244 | Ga0207639_100182444 | 220 |
| 186 | 3300026142 | Ga0207698_10152452 | Ga0207698_101524521 | 220 |
| 187 | 3300031824 | Ga0307413_10011863 | Ga0307413_100118632 | 220 |
| 188 | 3300032005 | Ga0307411_10019451 | Ga0307411_100194513 | 220 |
| 189 | 3300037068 | Ga0373925_0093905 | Ga0373925_0093905_362_1030 | 220 |
| 190 | 3300037853 | Ga0436364_0103584 | Ga0436364_0103584_10529_11197 | 220 |
| 191 | 3300042007 | Ga0439449_0051669 | Ga0439449_0051669_170_841 | 220 |
| 192 | 3300044656 | Ga0466969_0006911 | Ga0466969_0006911_2616_3284 | 220 |
| 193 | 3300044683 | Ga0466965_0018626 | Ga0466965_0018626_33_698 | 220 |
| 194 | 3300044684 | Ga0466966_0002923 | Ga0466966_0002923_2794_3498 | 220 |
| 195 | 3300044684 | Ga0466966_0003757 | Ga0466966_0003757_5912_6580 | 220 |
| 196 | 3300044693 | Ga0466961_0001548 | Ga0466961_0001548_1892_2560 | 220 |
| 197 | 3300044693 | Ga0466961_0062760 | Ga0466961_0062760_853_1557 | 220 |
| 198 | 3300044719 | Ga0466971_0072365 | Ga0466971_0072365_46_714 | 220 |
| 199 | 3300044735 | Ga0466968_0001149 | Ga0466968_0001149_1853_2518 | 220 |
| 200 | 3300044765 | Ga0466970_0042689 | Ga0466970_0042689_1025_1729 | 220 |
| 201 | 3300044765 | Ga0466970_0059807 | Ga0466970_0059807_1196_1861 | 220 |
| 202 | 3300044765 | Ga0466970_0211197 | Ga0466970_0211197_350_1018 | 220 |
| 203 | 3300044842 | Ga0466957_0029033 | Ga0466957_0029033_150_815 | 220 |
| 204 | 3300044842 | Ga0466957_0031979 | Ga0466957_0031979_1052_1756 | 220 |
| 205 | 3300044901 | Ga0466960_0000771 | Ga0466960_0000771_2173_2838 | 220 |
| 206 | 3300045049 | Ga0466959_0001606 | Ga0466959_0001606_2421_3089 | 220 |
| 207 | 3300045049 | Ga0466959_0025876 | Ga0466959_0025876_3529_4194 | 220 |
| 208 | 3300045049 | Ga0466959_0040983 | Ga0466959_0040983_1640_2344 | 220 |
| 209 | 3300045836 | Ga0466958_0047855 | Ga0466958_0047855_1051_1755 | 220 |
| 210 | 3300045836 | Ga0466958_0433419 | Ga0466958_0433419_108_773 | 220 |
| 211 | 3300048903 | Ga0496100_0430730 | Ga0496100_0430730_166_831 | 220 |
| 212 | 3300048915 | Ga0496112_0086809 | Ga0496112_0086809_1716_2381 | 220 |
| 213 | 3300048916 | Ga0496113_0068031 | Ga0496113_0068031_1787_2452 | 220 |
| 214 | 3300048925 | Ga0496122_0008620 | Ga0496122_0008620_3496_4161 | 220 |
| 215 | 3300048926 | Ga0496123_0002022 | Ga0496123_0002022_17125_17790 | 220 |
| 216 | 3300048928 | Ga0496125_0336277 | Ga0496125_0336277_129_794 | 220 |
| 217 | 3300048929 | Ga0496126_0015093 | Ga0496126_0015093_1124_1789 | 220 |
| 218 | 3300061719 | Ga0466962_0025036 | Ga0466962_0025036_555_1223 | 220 |
| 219 | 3300002073 | JGI24745J21846_1009800 | JGI24745J21846_10098001 | 221 |
| 220 | 3300002244 | JGI24742J22300_10031772 | JGI24742J22300_100317722 | 221 |
| 221 | 3300005337 | Ga0070682_100218610 | Ga0070682_1002186101 | 221 |
| 222 | 3300005337 | Ga0070682_100294638 | Ga0070682_1002946382 | 221 |
| 223 | 3300005338 | Ga0068868_100193918 | Ga0068868_1001939182 | 221 |
| 224 | 3300005341 | Ga0070691_10005587 | Ga0070691_100055872 | 221 |
| 225 | 3300005353 | Ga0070669_100252774 | Ga0070669_1002527742 | 221 |
| 226 | 3300005354 | Ga0070675_100051364 | Ga0070675_1000513643 | 221 |
| 227 | 3300005356 | Ga0070674_100041563 | Ga0070674_1000415635 | 221 |
| 228 | 3300005366 | Ga0070659_100221528 | Ga0070659_1002215281 | 221 |
| 229 | 3300005437 | Ga0070710_10024248 | Ga0070710_100242484 | 221 |
| 230 | 3300005440 | Ga0070705_100247432 | Ga0070705_1002474321 | 221 |
| 231 | 3300005441 | Ga0070700_100031279 | Ga0070700_1000312791 | 221 |
| 232 | 3300005444 | Ga0070694_100018473 | Ga0070694_1000184731 | 221 |
| 233 | 3300005456 | Ga0070678_100141677 | Ga0070678_1001416773 | 221 |
| 234 | 3300005459 | Ga0068867_100182354 | Ga0068867_1001823541 | 221 |
| 235 | 3300005530 | Ga0070679_100289051 | Ga0070679_1002890513 | 221 |
| 236 | 3300005536 | Ga0070697_100478066 | Ga0070697_1004780661 | 221 |
| 237 | 3300005539 | Ga0068853_100412292 | Ga0068853_1004122921 | 221 |
| 238 | 3300005545 | Ga0070695_100085306 | Ga0070695_1000853062 | 221 |
| 239 | 3300005546 | Ga0070696_100026576 | Ga0070696_1000265761 | 221 |
| 240 | 3300005548 | Ga0070665_100151143 | Ga0070665_1001511433 | 221 |
| 241 | 3300005578 | Ga0068854_100122094 | Ga0068854_1001220943 | 221 |
| 242 | 3300005615 | Ga0070702_100006048 | Ga0070702_1000060482 | 221 |
| 243 | 3300005617 | Ga0068859_100486812 | Ga0068859_1004868122 | 221 |
| 244 | 3300005718 | Ga0068866_10278952 | Ga0068866_102789522 | 221 |
| 245 | 3300005842 | Ga0068858_100100194 | Ga0068858_1001001943 | 221 |
| 246 | 3300005843 | Ga0068860_100052533 | Ga0068860_1000525334 | 221 |
| 247 | 3300005844 | Ga0068862_100048732 | Ga0068862_1000487324 | 221 |
| 248 | 3300006038 | Ga0075365_10010402 | Ga0075365_100104024 | 221 |
| 249 | 3300006038 | Ga0075365_10038783 | Ga0075365_100387833 | 221 |
| 250 | 3300006042 | Ga0075368_10008553 | Ga0075368_100085533 | 221 |
| 251 | 3300006042 | Ga0075368_10015687 | Ga0075368_100156872 | 221 |
| 252 | 3300006048 | Ga0075363_100004990 | Ga0075363_1000049903 | 221 |
| 253 | 3300006048 | Ga0075363_100005591 | Ga0075363_1000055914 | 221 |
| 254 | 3300006048 | Ga0075363_100021757 | Ga0075363_1000217572 | 221 |
| 255 | 3300006048 | Ga0075363_100365963 | Ga0075363_1003659631 | 221 |
| 256 | 3300006051 | Ga0075364_10010981 | Ga0075364_100109814 | 221 |
| 257 | 3300006051 | Ga0075364_10043114 | Ga0075364_100431142 | 221 |
| 258 | 3300006175 | Ga0070712_100031547 | Ga0070712_1000315471 | 221 |
| 259 | 3300006175 | Ga0070712_100270041 | Ga0070712_1002700411 | 221 |
| 260 | 3300006177 | Ga0075362_10043805 | Ga0075362_100438052 | 221 |
| 261 | 3300006178 | Ga0075367_10113946 | Ga0075367_101139462 | 221 |
| 262 | 3300006186 | Ga0075369_10045575 | Ga0075369_100455752 | 221 |
| 263 | 3300006186 | Ga0075369_10198616 | Ga0075369_101986161 | 221 |
| 264 | 3300006237 | Ga0097621_100076145 | Ga0097621_1000761453 | 221 |
| 265 | 3300006353 | Ga0075370_10002119 | Ga0075370_100021194 | 221 |
| 266 | 3300006353 | Ga0075370_10004134 | Ga0075370_100041343 | 221 |
| 267 | 3300006353 | Ga0075370_10193855 | Ga0075370_101938552 | 221 |
| 268 | 3300006358 | Ga0068871_100628475 | Ga0068871_1006284752 | 221 |
| 269 | 3300006881 | Ga0068865_100102184 | Ga0068865_1001021843 | 221 |
| 270 | 3300006931 | Ga0097620_100486850 | Ga0097620_1004868502 | 221 |
| 271 | 3300009098 | Ga0105245_10068575 | Ga0105245_100685752 | 221 |
| 272 | 3300009101 | Ga0105247_10034274 | Ga0105247_100342742 | 221 |
| 273 | 3300009553 | Ga0105249_10339793 | Ga0105249_103397932 | 221 |
| 274 | 3300009553 | Ga0105249_10656016 | Ga0105249_106560162 | 221 |
| 275 | 3300013296 | Ga0157374_10153900 | Ga0157374_101539003 | 221 |
| 276 | 3300013307 | Ga0157372_10070189 | Ga0157372_100701892 | 221 |
| 277 | 3300013308 | Ga0157375_10101066 | Ga0157375_101010664 | 221 |
| 278 | 3300014326 | Ga0157380_10049846 | Ga0157380_100498461 | 221 |
| 279 | 3300017792 | Ga0163161_10087639 | Ga0163161_100876395 | 221 |
| 280 | 3300025303 | Ga0209051_1027501 | Ga0209051_10275012 | 221 |
| 281 | 3300025898 | Ga0207692_10252024 | Ga0207692_102520241 | 221 |
| 282 | 3300025901 | Ga0207688_10011680 | Ga0207688_100116804 | 221 |
| 283 | 3300025915 | Ga0207693_10014548 | Ga0207693_100145483 | 221 |
| 284 | 3300025915 | Ga0207693_10513404 | Ga0207693_105134042 | 221 |
| 285 | 3300025932 | Ga0207690_10147931 | Ga0207690_101479311 | 221 |
| 286 | 3300025933 | Ga0207706_10020146 | Ga0207706_100201465 | 221 |
| 287 | 3300025935 | Ga0207709_10190094 | Ga0207709_101900942 | 221 |
| 288 | 3300025938 | Ga0207704_10126937 | Ga0207704_101269373 | 221 |
| 289 | 3300025981 | Ga0207640_10567177 | Ga0207640_105671771 | 221 |
| 290 | 3300026023 | Ga0207677_10254819 | Ga0207677_102548192 | 221 |
| 291 | 3300026041 | Ga0207639_10504229 | Ga0207639_105042292 | 221 |
| 292 | 3300026075 | Ga0207708_10024415 | Ga0207708_100244155 | 221 |
| 293 | 3300026089 | Ga0207648_10380952 | Ga0207648_103809521 | 221 |
| 294 | 3300026118 | Ga0207675_100027002 | Ga0207675_1000270021 | 221 |
| 295 | 3300026121 | Ga0207683_10039140 | Ga0207683_100391404 | 221 |
| 296 | 3300027866 | Ga0209813_10007905 | Ga0209813_100079051 | 221 |
| 297 | 3300028379 | Ga0268266_10229142 | Ga0268266_102291421 | 221 |
| 298 | 3300028381 | Ga0268264_10399488 | Ga0268264_103994881 | 221 |
| 299 | 3300028381 | Ga0268264_10559332 | Ga0268264_105593321 | 221 |
| 300 | 3300031824 | Ga0307413_10155258 | Ga0307413_101552582 | 221 |
| 301 | 3300031852 | Ga0307410_10085227 | Ga0307410_100852272 | 221 |
| 302 | 3300031995 | Ga0307409_100208747 | Ga0307409_1002087471 | 221 |
| 303 | 3300032002 | Ga0307416_100008033 | Ga0307416_1000080332 | 221 |
| 304 | 3300032004 | Ga0307414_10572730 | Ga0307414_105727301 | 221 |
| 305 | 3300032126 | Ga0307415_100014180 | Ga0307415_1000141802 | 221 |
| 306 | 3300044842 | Ga0466957_0354247 | Ga0466957_0354247_169_834 | 221 |
| 307 | 3300046461 | Ga0495641_0066105 | Ga0495641_0066105_538_1203 | 221 |
| 308 | 3300046473 | Ga0495582_0012490 | Ga0495582_0012490_3658_4323 | 221 |
| 309 | 3300046474 | Ga0495605_0014802 | Ga0495605_0014802_2281_2946 | 221 |
| 310 | 3300046476 | Ga0495662_0059262 | Ga0495662_0059262_574_1239 | 221 |
| 311 | 3300046491 | Ga0495584_0232619 | Ga0495584_0232619_93_758 | 221 |
| 312 | 3300046492 | Ga0495585_0200028 | Ga0495585_0200028_106_771 | 221 |
| 313 | 3300046523 | Ga0495644_0006873 | Ga0495644_0006873_1463_2128 | 221 |
| 314 | 3300046525 | Ga0495663_0084931 | Ga0495663_0084931_299_964 | 221 |
| 315 | 3300046533 | Ga0495640_0072326 | Ga0495640_0072326_151_816 | 221 |
| 316 | 3300046616 | Ga0495668_0059088 | Ga0495668_0059088_115_780 | 221 |
| 317 | 3300046690 | Ga0495624_0089241 | Ga0495624_0089241_202_867 | 221 |
| 318 | 3300046691 | Ga0495670_0350501 | Ga0495670_0350501_90_755 | 221 |
| 319 | 3300046692 | Ga0495671_0160515 | Ga0495671_0160515_363_1028 | 221 |
| 320 | 3300046694 | Ga0495649_0116436 | Ga0495649_0116436_523_1188 | 221 |
| 321 | 3300046694 | Ga0495649_0335834 | Ga0495649_0335834_31_696 | 221 |
| 322 | 3300047318 | Ga0495636_0163073 | Ga0495636_0163073_173_838 | 221 |
| 323 | 3300047319 | Ga0495674_0685573 | Ga0495674_0685573_67_732 | 221 |
| 324 | 3300047320 | Ga0495672_0071334 | Ga0495672_0071334_292_957 | 221 |
| 325 | 3300047320 | Ga0495672_0143777 | Ga0495672_0143777_193_858 | 221 |
| 326 | 3300047321 | Ga0495676_0396577 | Ga0495676_0396577_151_816 | 221 |
| 327 | 3300047673 | Ga0495593_0001036 | Ga0495593_0001036_12468_13133 | 221 |
| 328 | 3300048903 | Ga0496100_0152669 | Ga0496100_0152669_418_1083 | 221 |
| 329 | 3300048904 | Ga0496101_0056537 | Ga0496101_0056537_40_705 | 221 |
| 330 | 3300048905 | Ga0496102_0083933 | Ga0496102_0083933_417_1082 | 221 |
| 331 | 3300048905 | Ga0496102_0088422 | Ga0496102_0088422_515_1180 | 221 |
| 332 | 3300048905 | Ga0496102_0620779 | Ga0496102_0620779_237_902 | 221 |
| 333 | 3300048906 | Ga0496103_0266908 | Ga0496103_0266908_224_889 | 221 |
| 334 | 3300048907 | Ga0496104_0191465 | Ga0496104_0191465_1175_1840 | 221 |
| 335 | 3300048908 | Ga0496105_0141796 | Ga0496105_0141796_1109_1903 | 221 |
| 336 | 3300048909 | Ga0496106_0086429 | Ga0496106_0086429_20_685 | 221 |
| 337 | 3300048909 | Ga0496106_0200285 | Ga0496106_0200285_223_888 | 221 |
| 338 | 3300048909 | Ga0496106_0258005 | Ga0496106_0258005_252_917 | 221 |
| 339 | 3300048911 | Ga0496108_0550235 | Ga0496108_0550235_228_893 | 221 |
| 340 | 3300048912 | Ga0496109_0131394 | Ga0496109_0131394_739_1404 | 221 |
| 341 | 3300048913 | Ga0496110_0533657 | Ga0496110_0533657_168_833 | 221 |
| 342 | 3300048915 | Ga0496112_0043147 | Ga0496112_0043147_835_1500 | 221 |
| 343 | 3300048915 | Ga0496112_0456254 | Ga0496112_0456254_235_900 | 221 |
| 344 | 3300048915 | Ga0496112_0628987 | Ga0496112_0628987_241_906 | 221 |
| 345 | 3300048917 | Ga0496114_0263440 | Ga0496114_0263440_374_1039 | 221 |
| 346 | 3300048925 | Ga0496122_0314589 | Ga0496122_0314589_88_753 | 221 |
| 347 | 3300048928 | Ga0496125_0113555 | Ga0496125_0113555_919_1584 | 221 |
| 348 | 3300048929 | Ga0496126_0167002 | Ga0496126_0167002_1173_1838 | 221 |
| 349 | 3300050489 | nmdc:mga03683_121843_c1 | nmdc:mga03683_121843_c1_99_764 | 221 |
| 350 | 3300050490 | nmdc:mga03n38_144118_c1 | nmdc:mga03n38_144118_c1_268_933 | 221 |
| 351 | 3300050490 | nmdc:mga03n38_158113_c1 | nmdc:mga03n38_158113_c1_388_1053 | 221 |
| 352 | 3300050491 | nmdc:mga00v17_16349_c1 | nmdc:mga00v17_16349_c1_547_1212 | 221 |
| 353 | 3300050491 | nmdc:mga00v17_360791_c1 | nmdc:mga00v17_360791_c1_190_864 | 221 |
| 354 | 3300050491 | nmdc:mga00v17_43081_c1 | nmdc:mga00v17_43081_c1_1685_2350 | 221 |
| 355 | 3300050492 | nmdc:mga0yw44_19851_c1 | nmdc:mga0yw44_19851_c1_438_1103 | 221 |
| 356 | 3300050492 | nmdc:mga0yw44_527685_c1 | nmdc:mga0yw44_527685_c1_31_696 | 221 |
| 357 | 3300050492 | nmdc:mga0yw44_75812_c1 | nmdc:mga0yw44_75812_c1_1325_1990 | 221 |
| 358 | 3300050494 | nmdc:mga06z11_18177_c1 | nmdc:mga06z11_18177_c1_1775_2440 | 221 |
| 359 | 3300050495 | nmdc:mga04h51_34114_c1 | nmdc:mga04h51_34114_c1_404_1069 | 221 |
| 360 | 3300050496 | nmdc:mga07m45_3155_c1 | nmdc:mga07m45_3155_c1_4290_4955 | 221 |
| 361 | 3300050496 | nmdc:mga07m45_67220_c1 | nmdc:mga07m45_67220_c1_695_1360 | 221 |
| 362 | 3300050496 | nmdc:mga07m45_8036_c1 | nmdc:mga07m45_8036_c1_97_762 | 221 |
| 363 | 3300050516 | nmdc:mga0sz30_108537_c2 | nmdc:mga0sz30_108537_c2_210_875 | 221 |
| 364 | 3300050516 | nmdc:mga0sz30_64232_c1 | nmdc:mga0sz30_64232_c1_98_763 | 221 |
| 365 | 3300050516 | nmdc:mga0sz30_99840_c1 | nmdc:mga0sz30_99840_c1_112_777 | 221 |
| 366 | 3300053080 | Ga0500635_0124215 | Ga0500635_0124215_254_919 | 221 |
| 367 | 3300053087 | Ga0500643_002089 | Ga0500643_002089_6493_7158 | 221 |
| 368 | 3300053092 | Ga0500583_0083800 | Ga0500583_0083800_749_1414 | 221 |
| 369 | 3300053122 | Ga0500608_215978 | Ga0500608_215978_36_701 | 221 |
| 370 | 3300053134 | Ga0500658_0039142 | Ga0500658_0039142_233_898 | 221 |
| 371 | 3300053136 | Ga0500559_0037586 | Ga0500559_0037586_1389_2054 | 221 |
| 372 | 3300053158 | Ga0500627_0067441 | Ga0500627_0067441_472_1137 | 221 |
| 373 | 3300053730 | Ga0500645_005909 | Ga0500645_005909_1758_2423 | 221 |
| 374 | 3300000546 | LJNas_1012286 | LJNas_10122861 | 222 |
| 375 | 3300001989 | JGI24739J22299_10125974 | JGI24739J22299_101259741 | 222 |
| 376 | 3300001990 | JGI24737J22298_10030599 | JGI24737J22298_100305992 | 222 |
| 377 | 3300002076 | JGI24749J21850_1014234 | JGI24749J21850_10142342 | 222 |
| 378 | 3300002077 | JGI24744J21845_10000136 | JGI24744J21845_1000013610 | 222 |
| 379 | 3300002244 | JGI24742J22300_10011007 | JGI24742J22300_100110072 | 222 |
| 380 | 3300002459 | JGI24751J29686_10015836 | JGI24751J29686_100158362 | 222 |
| 381 | 3300003320 | rootH2_10067513 | rootH2_100675131 | 222 |
| 382 | 3300003792 | Ga0055540_1000071 | Ga0055540_100007134 | 222 |
| 383 | 3300003792 | Ga0055540_1000902 | Ga0055540_100090210 | 222 |
| 384 | 3300005328 | Ga0070676_10024311 | Ga0070676_100243112 | 222 |
| 385 | 3300005328 | Ga0070676_10139279 | Ga0070676_101392792 | 222 |
| 386 | 3300005330 | Ga0070690_100002173 | Ga0070690_1000021736 | 222 |
| 387 | 3300005331 | Ga0070670_100207599 | Ga0070670_1002075992 | 222 |
| 388 | 3300005334 | Ga0068869_100004732 | Ga0068869_1000047326 | 222 |
| 389 | 3300005335 | Ga0070666_10013750 | Ga0070666_100137503 | 222 |
| 390 | 3300005335 | Ga0070666_10126881 | Ga0070666_101268812 | 222 |
| 391 | 3300005336 | Ga0070680_100699713 | Ga0070680_1006997131 | 222 |
| 392 | 3300005337 | Ga0070682_100012353 | Ga0070682_1000123532 | 222 |
| 393 | 3300005337 | Ga0070682_100030315 | Ga0070682_1000303153 | 222 |
| 394 | 3300005337 | Ga0070682_100094097 | Ga0070682_1000940972 | 222 |
| 395 | 3300005338 | Ga0068868_100008527 | Ga0068868_1000085272 | 222 |
| 396 | 3300005338 | Ga0068868_100009899 | Ga0068868_1000098992 | 222 |
| 397 | 3300005339 | Ga0070660_100070107 | Ga0070660_1000701073 | 222 |
| 398 | 3300005339 | Ga0070660_100088769 | Ga0070660_1000887692 | 222 |
| 399 | 3300005340 | Ga0070689_100077266 | Ga0070689_1000772662 | 222 |
| 400 | 3300005340 | Ga0070689_100151445 | Ga0070689_1001514452 | 222 |
| 401 | 3300005341 | Ga0070691_10081574 | Ga0070691_100815742 | 222 |
| 402 | 3300005343 | Ga0070687_100121762 | Ga0070687_1001217621 | 222 |
| 403 | 3300005345 | Ga0070692_10110543 | Ga0070692_101105432 | 222 |
| 404 | 3300005347 | Ga0070668_100005229 | Ga0070668_1000052294 | 222 |
| 405 | 3300005347 | Ga0070668_100052330 | Ga0070668_1000523302 | 222 |
| 406 | 3300005347 | Ga0070668_100191654 | Ga0070668_1001916542 | 222 |
| 407 | 3300005347 | Ga0070668_100226627 | Ga0070668_1002266272 | 222 |
| 408 | 3300005347 | Ga0070668_100243721 | Ga0070668_1002437212 | 222 |
| 409 | 3300005353 | Ga0070669_100010528 | Ga0070669_1000105282 | 222 |
| 410 | 3300005353 | Ga0070669_100044117 | Ga0070669_1000441174 | 222 |
| 411 | 3300005355 | Ga0070671_100009134 | Ga0070671_1000091348 | 222 |
| 412 | 3300005355 | Ga0070671_100093292 | Ga0070671_1000932922 | 222 |
| 413 | 3300005355 | Ga0070671_100257157 | Ga0070671_1002571572 | 222 |
| 414 | 3300005356 | Ga0070674_100000655 | Ga0070674_10000065519 | 222 |
| 415 | 3300005356 | Ga0070674_100307729 | Ga0070674_1003077292 | 222 |
| 416 | 3300005365 | Ga0070688_100060689 | Ga0070688_1000606892 | 222 |
| 417 | 3300005365 | Ga0070688_100115088 | Ga0070688_1001150882 | 222 |
| 418 | 3300005367 | Ga0070667_100000142 | Ga0070667_1000001426 | 222 |
| 419 | 3300005367 | Ga0070667_100000995 | Ga0070667_1000009954 | 222 |
| 420 | 3300005367 | Ga0070667_100014600 | Ga0070667_1000146006 | 222 |
| 421 | 3300005367 | Ga0070667_100069849 | Ga0070667_1000698492 | 222 |
| 422 | 3300005434 | Ga0070709_10172443 | Ga0070709_101724432 | 222 |
| 423 | 3300005434 | Ga0070709_10381444 | Ga0070709_103814442 | 222 |
| 424 | 3300005436 | Ga0070713_100018383 | Ga0070713_1000183832 | 222 |
| 425 | 3300005436 | Ga0070713_100140903 | Ga0070713_1001409032 | 222 |
| 426 | 3300005437 | Ga0070710_10011265 | Ga0070710_100112654 | 222 |
| 427 | 3300005437 | Ga0070710_10026599 | Ga0070710_100265992 | 222 |
| 428 | 3300005438 | Ga0070701_10008728 | Ga0070701_100087282 | 222 |
| 429 | 3300005438 | Ga0070701_10167071 | Ga0070701_101670712 | 222 |
| 430 | 3300005439 | Ga0070711_100002645 | Ga0070711_1000026456 | 222 |
| 431 | 3300005439 | Ga0070711_100002984 | Ga0070711_1000029846 | 222 |
| 432 | 3300005440 | Ga0070705_100005990 | Ga0070705_1000059902 | 222 |
| 433 | 3300005440 | Ga0070705_100007640 | Ga0070705_1000076401 | 222 |
| 434 | 3300005441 | Ga0070700_100011827 | Ga0070700_1000118272 | 222 |
| 435 | 3300005441 | Ga0070700_100197161 | Ga0070700_1001971612 | 222 |
| 436 | 3300005444 | Ga0070694_100322319 | Ga0070694_1003223191 | 222 |
| 437 | 3300005445 | Ga0070708_100238597 | Ga0070708_1002385972 | 222 |
| 438 | 3300005455 | Ga0070663_100014355 | Ga0070663_1000143554 | 222 |
| 439 | 3300005455 | Ga0070663_100095330 | Ga0070663_1000953302 | 222 |
| 440 | 3300005455 | Ga0070663_100198735 | Ga0070663_1001987352 | 222 |
| 441 | 3300005456 | Ga0070678_100001005 | Ga0070678_10000100512 | 222 |
| 442 | 3300005457 | Ga0070662_100006072 | Ga0070662_1000060723 | 222 |
| 443 | 3300005459 | Ga0068867_100007222 | Ga0068867_1000072223 | 222 |
| 444 | 3300005459 | Ga0068867_100366433 | Ga0068867_1003664331 | 222 |
| 445 | 3300005539 | Ga0068853_100001093 | Ga0068853_10000109310 | 222 |
| 446 | 3300005539 | Ga0068853_100004917 | Ga0068853_1000049177 | 222 |
| 447 | 3300005539 | Ga0068853_100166435 | Ga0068853_1001664352 | 222 |
| 448 | 3300005546 | Ga0070696_100124042 | Ga0070696_1001240422 | 222 |
| 449 | 3300005547 | Ga0070693_100071876 | Ga0070693_1000718762 | 222 |
| 450 | 3300005547 | Ga0070693_100379726 | Ga0070693_1003797262 | 222 |
| 451 | 3300005548 | Ga0070665_100004853 | Ga0070665_10000485316 | 222 |
| 452 | 3300005548 | Ga0070665_100035221 | Ga0070665_1000352211 | 222 |
| 453 | 3300005548 | Ga0070665_101148117 | Ga0070665_1011481171 | 222 |
| 454 | 3300005549 | Ga0070704_100002883 | Ga0070704_1000028834 | 222 |
| 455 | 3300005549 | Ga0070704_100178281 | Ga0070704_1001782811 | 222 |
| 456 | 3300005549 | Ga0070704_100374113 | Ga0070704_1003741131 | 222 |
| 457 | 3300005563 | Ga0068855_100422094 | Ga0068855_1004220942 | 222 |
| 458 | 3300005577 | Ga0068857_101056716 | Ga0068857_1010567162 | 222 |
| 459 | 3300005578 | Ga0068854_100003576 | Ga0068854_1000035764 | 222 |
| 460 | 3300005578 | Ga0068854_100115916 | Ga0068854_1001159162 | 222 |
| 461 | 3300005578 | Ga0068854_100231562 | Ga0068854_1002315622 | 222 |
| 462 | 3300005614 | Ga0068856_100113856 | Ga0068856_1001138562 | 222 |
| 463 | 3300005614 | Ga0068856_101118079 | Ga0068856_1011180791 | 222 |
| 464 | 3300005615 | Ga0070702_100105928 | Ga0070702_1001059282 | 222 |
| 465 | 3300005616 | Ga0068852_100034773 | Ga0068852_1000347734 | 222 |
| 466 | 3300005616 | Ga0068852_100071410 | Ga0068852_1000714102 | 222 |
| 467 | 3300005617 | Ga0068859_100004138 | Ga0068859_10000413814 | 222 |
| 468 | 3300005617 | Ga0068859_100010110 | Ga0068859_1000101107 | 222 |
| 469 | 3300005617 | Ga0068859_100078249 | Ga0068859_1000782492 | 222 |
| 470 | 3300005618 | Ga0068864_100402641 | Ga0068864_1004026412 | 222 |
| 471 | 3300005618 | Ga0068864_100717458 | Ga0068864_1007174581 | 222 |
| 472 | 3300005718 | Ga0068866_10004953 | Ga0068866_100049534 | 222 |
| 473 | 3300005718 | Ga0068866_10172284 | Ga0068866_101722842 | 222 |
| 474 | 3300005719 | Ga0068861_100002600 | Ga0068861_1000026006 | 222 |
| 475 | 3300005719 | Ga0068861_100019623 | Ga0068861_1000196232 | 222 |
| 476 | 3300005719 | Ga0068861_100038805 | Ga0068861_1000388052 | 222 |
| 477 | 3300005719 | Ga0068861_100072845 | Ga0068861_1000728452 | 222 |
| 478 | 3300005719 | Ga0068861_100191882 | Ga0068861_1001918822 | 222 |
| 479 | 3300005841 | Ga0068863_100000105 | Ga0068863_10000010538 | 222 |
| 480 | 3300005841 | Ga0068863_100041233 | Ga0068863_1000412333 | 222 |
| 481 | 3300005841 | Ga0068863_100124538 | Ga0068863_1001245382 | 222 |
| 482 | 3300005841 | Ga0068863_100381647 | Ga0068863_1003816472 | 222 |
| 483 | 3300005842 | Ga0068858_100003568 | Ga0068858_1000035682 | 222 |
| 484 | 3300005842 | Ga0068858_100004234 | Ga0068858_10000423411 | 222 |
| 485 | 3300005843 | Ga0068860_100000209 | Ga0068860_10000020937 | 222 |
| 486 | 3300005843 | Ga0068860_100982419 | Ga0068860_1009824191 | 222 |
| 487 | 3300005844 | Ga0068862_100000400 | Ga0068862_10000040038 | 222 |
| 488 | 3300005844 | Ga0068862_100002572 | Ga0068862_1000025727 | 222 |
| 489 | 3300005844 | Ga0068862_100163475 | Ga0068862_1001634752 | 222 |
| 490 | 3300005844 | Ga0068862_100388237 | Ga0068862_1003882372 | 222 |
| 491 | 3300005937 | Ga0081455_10047499 | Ga0081455_100474992 | 222 |
| 492 | 3300005937 | Ga0081455_10094873 | Ga0081455_100948732 | 222 |
| 493 | 3300006038 | Ga0075365_10070006 | Ga0075365_100700062 | 222 |
| 494 | 3300006038 | Ga0075365_10116061 | Ga0075365_101160612 | 222 |
| 495 | 3300006038 | Ga0075365_10171014 | Ga0075365_101710142 | 222 |
| 496 | 3300006042 | Ga0075368_10212463 | Ga0075368_102124631 | 222 |
| 497 | 3300006048 | Ga0075363_100000884 | Ga0075363_1000008848 | 222 |
| 498 | 3300006051 | Ga0075364_10000352 | Ga0075364_100003522 | 222 |
| 499 | 3300006051 | Ga0075364_10004512 | Ga0075364_100045123 | 222 |
| 500 | 3300006051 | Ga0075364_10007606 | Ga0075364_100076064 | 222 |
| 501 | 3300006051 | Ga0075364_10044618 | Ga0075364_100446182 | 222 |
| 502 | 3300006051 | Ga0075364_10068519 | Ga0075364_100685192 | 222 |
| 503 | 3300006051 | Ga0075364_10211240 | Ga0075364_102112402 | 222 |
| 504 | 3300006051 | Ga0075364_10225279 | Ga0075364_102252792 | 222 |
| 505 | 3300006163 | Ga0070715_10007794 | Ga0070715_100077942 | 222 |
| 506 | 3300006173 | Ga0070716_100011007 | Ga0070716_1000110076 | 222 |
| 507 | 3300006173 | Ga0070716_100052433 | Ga0070716_1000524332 | 222 |
| 508 | 3300006175 | Ga0070712_100002129 | Ga0070712_1000021292 | 222 |
| 509 | 3300006175 | Ga0070712_100014884 | Ga0070712_1000148842 | 222 |
| 510 | 3300006177 | Ga0075362_10188957 | Ga0075362_101889572 | 222 |
| 511 | 3300006186 | Ga0075369_10008349 | Ga0075369_100083492 | 222 |
| 512 | 3300006186 | Ga0075369_10017624 | Ga0075369_100176243 | 222 |
| 513 | 3300006186 | Ga0075369_10018475 | Ga0075369_100184753 | 222 |
| 514 | 3300006237 | Ga0097621_100013052 | Ga0097621_1000130522 | 222 |
| 515 | 3300006353 | Ga0075370_10021002 | Ga0075370_100210022 | 222 |
| 516 | 3300006353 | Ga0075370_10027253 | Ga0075370_100272532 | 222 |
| 517 | 3300006353 | Ga0075370_10136709 | Ga0075370_101367092 | 222 |
| 518 | 3300006353 | Ga0075370_10231666 | Ga0075370_102316662 | 222 |
| 519 | 3300006358 | Ga0068871_100110785 | Ga0068871_1001107853 | 222 |
| 520 | 3300006844 | Ga0075428_100004290 | Ga0075428_10000429017 | 222 |
| 521 | 3300006844 | Ga0075428_100552703 | Ga0075428_1005527032 | 222 |
| 522 | 3300006846 | Ga0075430_100175480 | Ga0075430_1001754802 | 222 |
| 523 | 3300006846 | Ga0075430_100661152 | Ga0075430_1006611522 | 222 |
| 524 | 3300006881 | Ga0068865_100003040 | Ga0068865_1000030408 | 222 |
| 525 | 3300006881 | Ga0068865_100167476 | Ga0068865_1001674762 | 222 |
| 526 | 3300006931 | Ga0097620_100004138 | Ga0097620_1000041384 | 222 |
| 527 | 3300006931 | Ga0097620_100010110 | Ga0097620_1000101103 | 222 |
| 528 | 3300006931 | Ga0097620_100078249 | Ga0097620_1000782492 | 222 |
| 529 | 3300007788 | Ga0099795_10005850 | Ga0099795_100058502 | 222 |
| 530 | 3300009093 | Ga0105240_10459681 | Ga0105240_104596813 | 222 |
| 531 | 3300009094 | Ga0111539_11465630 | Ga0111539_114656301 | 222 |
| 532 | 3300009098 | Ga0105245_10002210 | Ga0105245_1000221014 | 222 |
| 533 | 3300009098 | Ga0105245_10692328 | Ga0105245_106923281 | 222 |
| 534 | 3300009101 | Ga0105247_10000141 | Ga0105247_1000014135 | 222 |
| 535 | 3300009101 | Ga0105247_10001401 | Ga0105247_1000140118 | 222 |
| 536 | 3300009101 | Ga0105247_10011479 | Ga0105247_100114792 | 222 |
| 537 | 3300009147 | Ga0114129_10021114 | Ga0114129_100211144 | 222 |
| 538 | 3300009148 | Ga0105243_10000877 | Ga0105243_1000087716 | 222 |
| 539 | 3300009148 | Ga0105243_10030337 | Ga0105243_100303374 | 222 |
| 540 | 3300009148 | Ga0105243_11347761 | Ga0105243_113477611 | 222 |
| 541 | 3300009174 | Ga0105241_10007147 | Ga0105241_100071474 | 222 |
| 542 | 3300009174 | Ga0105241_10228835 | Ga0105241_102288352 | 222 |
| 543 | 3300009176 | Ga0105242_10020529 | Ga0105242_100205293 | 222 |
| 544 | 3300009176 | Ga0105242_10038522 | Ga0105242_100385222 | 222 |
| 545 | 3300009177 | Ga0105248_10000242 | Ga0105248_100002422 | 222 |
| 546 | 3300009177 | Ga0105248_10012476 | Ga0105248_100124767 | 222 |
| 547 | 3300009177 | Ga0105248_10041777 | Ga0105248_100417773 | 222 |
| 548 | 3300009177 | Ga0105248_11096772 | Ga0105248_110967721 | 222 |
| 549 | 3300009545 | Ga0105237_10036231 | Ga0105237_100362315 | 222 |
| 550 | 3300009545 | Ga0105237_10042277 | Ga0105237_100422772 | 222 |
| 551 | 3300009545 | Ga0105237_10048790 | Ga0105237_100487904 | 222 |
| 552 | 3300009553 | Ga0105249_10000031 | Ga0105249_10000031194 | 222 |
| 553 | 3300009553 | Ga0105249_10003161 | Ga0105249_100031616 | 222 |
| 554 | 3300009553 | Ga0105249_10965351 | Ga0105249_109653512 | 222 |
| 555 | 3300010375 | Ga0105239_10004174 | Ga0105239_100041746 | 222 |
| 556 | 3300010375 | Ga0105239_10020858 | Ga0105239_100208586 | 222 |
| 557 | 3300010375 | Ga0105239_10055735 | Ga0105239_100557354 | 222 |
| 558 | 3300011119 | Ga0105246_10017764 | Ga0105246_100177645 | 222 |
| 559 | 3300013102 | Ga0157371_10312418 | Ga0157371_103124182 | 222 |
| 560 | 3300013104 | Ga0157370_10521252 | Ga0157370_105212522 | 222 |
| 561 | 3300013105 | Ga0157369_10284159 | Ga0157369_102841592 | 222 |
| 562 | 3300013105 | Ga0157369_10327051 | Ga0157369_103270512 | 222 |
| 563 | 3300013296 | Ga0157374_10074664 | Ga0157374_100746642 | 222 |
| 564 | 3300013296 | Ga0157374_10454243 | Ga0157374_104542432 | 222 |
| 565 | 3300013297 | Ga0157378_10018228 | Ga0157378_100182284 | 222 |
| 566 | 3300013297 | Ga0157378_10023912 | Ga0157378_100239124 | 222 |
| 567 | 3300013306 | Ga0163162_10008665 | Ga0163162_100086659 | 222 |
| 568 | 3300013306 | Ga0163162_10032962 | Ga0163162_100329623 | 222 |
| 569 | 3300013306 | Ga0163162_10584408 | Ga0163162_105844082 | 222 |
| 570 | 3300013307 | Ga0157372_10009627 | Ga0157372_100096277 | 222 |
| 571 | 3300013308 | Ga0157375_10002285 | Ga0157375_1000228516 | 222 |
| 572 | 3300013308 | Ga0157375_10208432 | Ga0157375_102084322 | 222 |
| 573 | 3300014325 | Ga0163163_10140656 | Ga0163163_101406562 | 222 |
| 574 | 3300014325 | Ga0163163_10424854 | Ga0163163_104248542 | 222 |
| 575 | 3300014325 | Ga0163163_10575686 | Ga0163163_105756861 | 222 |
| 576 | 3300014326 | Ga0157380_10000802 | Ga0157380_1000080212 | 222 |
| 577 | 3300014745 | Ga0157377_10053568 | Ga0157377_100535682 | 222 |
| 578 | 3300014745 | Ga0157377_10261786 | Ga0157377_102617861 | 222 |
| 579 | 3300014968 | Ga0157379_10123822 | Ga0157379_101238222 | 222 |
| 580 | 3300014968 | Ga0157379_10132853 | Ga0157379_101328532 | 222 |
| 581 | 3300014969 | Ga0157376_10178951 | Ga0157376_101789512 | 222 |
| 582 | 3300017792 | Ga0163161_10001861 | Ga0163161_1000186118 | 222 |
| 583 | 3300021388 | Ga0213875_10129179 | Ga0213875_101291792 | 222 |
| 584 | 3300025273 | Ga0209673_1061553 | Ga0209673_10615532 | 222 |
| 585 | 3300025303 | Ga0209051_1000033 | Ga0209051_1000033265 | 222 |
| 586 | 3300025303 | Ga0209051_1001346 | Ga0209051_100134613 | 222 |
| 587 | 3300025303 | Ga0209051_1001746 | Ga0209051_10017468 | 222 |
| 588 | 3300025303 | Ga0209051_1094404 | Ga0209051_10944042 | 222 |
| 589 | 3300025315 | Ga0207697_10168474 | Ga0207697_101684741 | 222 |
| 590 | 3300025711 | Ga0207696_1082045 | Ga0207696_10820452 | 222 |
| 591 | 3300025898 | Ga0207692_10154648 | Ga0207692_101546482 | 222 |
| 592 | 3300025899 | Ga0207642_10020605 | Ga0207642_100206052 | 222 |
| 593 | 3300025899 | Ga0207642_10099353 | Ga0207642_100993532 | 222 |
| 594 | 3300025900 | Ga0207710_10000164 | Ga0207710_1000016435 | 222 |
| 595 | 3300025900 | Ga0207710_10000901 | Ga0207710_1000090119 | 222 |
| 596 | 3300025900 | Ga0207710_10105310 | Ga0207710_101053102 | 222 |
| 597 | 3300025901 | Ga0207688_10000489 | Ga0207688_1000048911 | 222 |
| 598 | 3300025901 | Ga0207688_10003799 | Ga0207688_100037993 | 222 |
| 599 | 3300025901 | Ga0207688_10088507 | Ga0207688_100885072 | 222 |
| 600 | 3300025901 | Ga0207688_10105985 | Ga0207688_101059852 | 222 |
| 601 | 3300025903 | Ga0207680_10160495 | Ga0207680_101604952 | 222 |
| 602 | 3300025904 | Ga0207647_10017184 | Ga0207647_100171842 | 222 |
| 603 | 3300025904 | Ga0207647_10028191 | Ga0207647_100281912 | 222 |
| 604 | 3300025905 | Ga0207685_10004576 | Ga0207685_100045763 | 222 |
| 605 | 3300025906 | Ga0207699_10134742 | Ga0207699_101347422 | 222 |
| 606 | 3300025907 | Ga0207645_10020919 | Ga0207645_100209192 | 222 |
| 607 | 3300025907 | Ga0207645_10048293 | Ga0207645_100482932 | 222 |
| 608 | 3300025911 | Ga0207654_10032174 | Ga0207654_100321742 | 222 |
| 609 | 3300025913 | Ga0207695_10133359 | Ga0207695_101333592 | 222 |
| 610 | 3300025914 | Ga0207671_10043825 | Ga0207671_100438252 | 222 |
| 611 | 3300025915 | Ga0207693_10003251 | Ga0207693_1000325111 | 222 |
| 612 | 3300025915 | Ga0207693_10008923 | Ga0207693_100089234 | 222 |
| 613 | 3300025916 | Ga0207663_10001940 | Ga0207663_100019406 | 222 |
| 614 | 3300025916 | Ga0207663_10037667 | Ga0207663_100376672 | 222 |
| 615 | 3300025923 | Ga0207681_10003879 | Ga0207681_100038799 | 222 |
| 616 | 3300025923 | Ga0207681_10196019 | Ga0207681_101960192 | 222 |
| 617 | 3300025927 | Ga0207687_10001856 | Ga0207687_1000185614 | 222 |
| 618 | 3300025927 | Ga0207687_10430869 | Ga0207687_104308691 | 222 |
| 619 | 3300025928 | Ga0207700_10449531 | Ga0207700_104495311 | 222 |
| 620 | 3300025928 | Ga0207700_10652159 | Ga0207700_106521591 | 222 |
| 621 | 3300025929 | Ga0207664_10162629 | Ga0207664_101626292 | 222 |
| 622 | 3300025931 | Ga0207644_10007265 | Ga0207644_100072657 | 222 |
| 623 | 3300025931 | Ga0207644_10190872 | Ga0207644_101908722 | 222 |
| 624 | 3300025932 | Ga0207690_10104632 | Ga0207690_101046322 | 222 |
| 625 | 3300025933 | Ga0207706_10001630 | Ga0207706_1000163016 | 222 |
| 626 | 3300025933 | Ga0207706_10009481 | Ga0207706_100094814 | 222 |
| 627 | 3300025935 | Ga0207709_10001857 | Ga0207709_1000185714 | 222 |
| 628 | 3300025936 | Ga0207670_10246650 | Ga0207670_102466502 | 222 |
| 629 | 3300025937 | Ga0207669_10000247 | Ga0207669_1000024714 | 222 |
| 630 | 3300025937 | Ga0207669_10075825 | Ga0207669_100758252 | 222 |
| 631 | 3300025938 | Ga0207704_10302328 | Ga0207704_103023282 | 222 |
| 632 | 3300025938 | Ga0207704_10879959 | Ga0207704_108799591 | 222 |
| 633 | 3300025939 | Ga0207665_10006954 | Ga0207665_100069547 | 222 |
| 634 | 3300025939 | Ga0207665_10033565 | Ga0207665_100335651 | 222 |
| 635 | 3300025941 | Ga0207711_10000196 | Ga0207711_1000019632 | 222 |
| 636 | 3300025941 | Ga0207711_10007688 | Ga0207711_100076882 | 222 |
| 637 | 3300025941 | Ga0207711_10014846 | Ga0207711_100148463 | 222 |
| 638 | 3300025942 | Ga0207689_10010685 | Ga0207689_100106857 | 222 |
| 639 | 3300025942 | Ga0207689_10350740 | Ga0207689_103507402 | 222 |
| 640 | 3300025942 | Ga0207689_10363271 | Ga0207689_103632712 | 222 |
| 641 | 3300025942 | Ga0207689_10606462 | Ga0207689_106064621 | 222 |
| 642 | 3300025960 | Ga0207651_10072512 | Ga0207651_100725123 | 222 |
| 643 | 3300025961 | Ga0207712_10000029 | Ga0207712_10000029194 | 222 |
| 644 | 3300025961 | Ga0207712_10006529 | Ga0207712_100065296 | 222 |
| 645 | 3300025961 | Ga0207712_10037734 | Ga0207712_100377342 | 222 |
| 646 | 3300025961 | Ga0207712_10495532 | Ga0207712_104955321 | 222 |
| 647 | 3300025972 | Ga0207668_10004559 | Ga0207668_100045592 | 222 |
| 648 | 3300025972 | Ga0207668_10159708 | Ga0207668_101597082 | 222 |
| 649 | 3300025972 | Ga0207668_10244930 | Ga0207668_102449302 | 222 |
| 650 | 3300025981 | Ga0207640_10182661 | Ga0207640_101826612 | 222 |
| 651 | 3300025986 | Ga0207658_10000113 | Ga0207658_100001134 | 222 |
| 652 | 3300025986 | Ga0207658_10000850 | Ga0207658_100008502 | 222 |
| 653 | 3300025986 | Ga0207658_10061665 | Ga0207658_100616653 | 222 |
| 654 | 3300025986 | Ga0207658_10076005 | Ga0207658_100760052 | 222 |
| 655 | 3300026023 | Ga0207677_10062822 | Ga0207677_100628222 | 222 |
| 656 | 3300026023 | Ga0207677_10468159 | Ga0207677_104681592 | 222 |
| 657 | 3300026035 | Ga0207703_10009286 | Ga0207703_100092864 | 222 |
| 658 | 3300026035 | Ga0207703_10042166 | Ga0207703_100421664 | 222 |
| 659 | 3300026041 | Ga0207639_10017851 | Ga0207639_100178513 | 222 |
| 660 | 3300026041 | Ga0207639_10041000 | Ga0207639_100410003 | 222 |
| 661 | 3300026041 | Ga0207639_10185436 | Ga0207639_101854362 | 222 |
| 662 | 3300026067 | Ga0207678_10007288 | Ga0207678_100072885 | 222 |
| 663 | 3300026067 | Ga0207678_10013099 | Ga0207678_100130994 | 222 |
| 664 | 3300026067 | Ga0207678_10048063 | Ga0207678_100480632 | 222 |
| 665 | 3300026075 | Ga0207708_10017230 | Ga0207708_100172302 | 222 |
| 666 | 3300026075 | Ga0207708_10095231 | Ga0207708_100952312 | 222 |
| 667 | 3300026078 | Ga0207702_10178536 | Ga0207702_101785362 | 222 |
| 668 | 3300026078 | Ga0207702_10925332 | Ga0207702_109253321 | 222 |
| 669 | 3300026088 | Ga0207641_10000581 | Ga0207641_1000058123 | 222 |
| 670 | 3300026088 | Ga0207641_10009336 | Ga0207641_100093366 | 222 |
| 671 | 3300026088 | Ga0207641_10254862 | Ga0207641_102548622 | 222 |
| 672 | 3300026088 | Ga0207641_10375487 | Ga0207641_103754872 | 222 |
| 673 | 3300026089 | Ga0207648_10003694 | Ga0207648_100036943 | 222 |
| 674 | 3300026089 | Ga0207648_10025471 | Ga0207648_100254714 | 222 |
| 675 | 3300026095 | Ga0207676_10331923 | Ga0207676_103319231 | 222 |
| 676 | 3300026118 | Ga0207675_100002945 | Ga0207675_1000029455 | 222 |
| 677 | 3300026118 | Ga0207675_100141399 | Ga0207675_1001413992 | 222 |
| 678 | 3300026118 | Ga0207675_100213073 | Ga0207675_1002130732 | 222 |
| 679 | 3300026118 | Ga0207675_100845835 | Ga0207675_1008458351 | 222 |
| 680 | 3300026121 | Ga0207683_10002056 | Ga0207683_1000205620 | 222 |
| 681 | 3300026121 | Ga0207683_10167976 | Ga0207683_101679763 | 222 |
| 682 | 3300027866 | Ga0209813_10028970 | Ga0209813_100289702 | 222 |
| 683 | 3300028379 | Ga0268266_10002346 | Ga0268266_1000234612 | 222 |
| 684 | 3300028379 | Ga0268266_10009545 | Ga0268266_100095452 | 222 |
| 685 | 3300028379 | Ga0268266_10561158 | Ga0268266_105611581 | 222 |
| 686 | 3300028380 | Ga0268265_10000389 | Ga0268265_1000038937 | 222 |
| 687 | 3300028380 | Ga0268265_10015507 | Ga0268265_100155073 | 222 |
| 688 | 3300028380 | Ga0268265_10504661 | Ga0268265_105046612 | 222 |
| 689 | 3300028381 | Ga0268264_10000017 | Ga0268264_10000017182 | 222 |
| 690 | 3300028381 | Ga0268264_10003370 | Ga0268264_100033702 | 222 |
| 691 | 3300028381 | Ga0268264_10065616 | Ga0268264_100656163 | 222 |
| 692 | 3300028381 | Ga0268264_10551298 | Ga0268264_105512982 | 222 |
| 693 | 3300031251 | Ga0265327_10005155 | Ga0265327_100051559 | 222 |
| 694 | 3300031852 | Ga0307410_10236001 | Ga0307410_102360011 | 222 |
| 695 | 3300031903 | Ga0307407_10299772 | Ga0307407_102997722 | 222 |
| 696 | 3300031995 | Ga0307409_100572613 | Ga0307409_1005726132 | 222 |
| 697 | 3300031995 | Ga0307409_100583494 | Ga0307409_1005834941 | 222 |
| 698 | 3300032005 | Ga0307411_10455732 | Ga0307411_104557322 | 222 |
| 699 | 3300032126 | Ga0307415_100254600 | Ga0307415_1002546001 | 222 |
| 700 | 3300035085 | Ga0373929_0019268 | Ga0373929_0019268_419_1087 | 222 |
| 701 | 3300035092 | Ga0373952_0047262 | Ga0373952_0047262_212_880 | 222 |
| 702 | 3300035112 | Ga0373932_0094504 | Ga0373932_0094504_276_944 | 222 |
| 703 | 3300035114 | Ga0373939_0110176 | Ga0373939_0110176_270_938 | 222 |
| 704 | 3300035115 | Ga0373941_0213206 | Ga0373941_0213206_54_722 | 222 |
| 705 | 3300035242 | Ga0373962_0061104 | Ga0373962_0061104_106_774 | 222 |
| 706 | 3300035691 | Ga0373931_0009804 | Ga0373931_0009804_1799_2467 | 222 |
| 707 | 3300035691 | Ga0373931_0073050 | Ga0373931_0073050_748_1416 | 222 |
| 708 | 3300037853 | Ga0436364_0863821 | Ga0436364_0863821_142_813 | 222 |
| 709 | 3300037853 | Ga0436364_0872298 | Ga0436364_0872298_2138_2812 | 222 |
| 710 | 3300039437 | Ga0436365_0468901 | Ga0436365_0468901_974_1660 | 222 |
| 711 | 3300039437 | Ga0436365_0671847 | Ga0436365_0671847_30617_31285 | 222 |
| 712 | 3300039437 | Ga0436365_1818399 | Ga0436365_1818399_16991_17659 | 222 |
| 713 | 3300039450 | Ga0436363_0028512 | Ga0436363_0028512_356_1024 | 222 |
| 714 | 3300039450 | Ga0436363_0144694 | Ga0436363_0144694_2198_2866 | 222 |
| 715 | 3300039450 | Ga0436363_1020415 | Ga0436363_1020415_384_1052 | 222 |
| 716 | 3300039453 | Ga0436362_0209322 | Ga0436362_0209322_395_1132 | 222 |
| 717 | 3300039453 | Ga0436362_1118236 | Ga0436362_1118236_503_1171 | 222 |
| 718 | 3300041410 | Ga0439461_0012679 | Ga0439461_0012679_276_944 | 222 |
| 719 | 3300041411 | Ga0439466_0011616 | Ga0439466_0011616_589_1257 | 222 |
| 720 | 3300041411 | Ga0439466_0028438 | Ga0439466_0028438_754_1422 | 222 |
| 721 | 3300041413 | Ga0439465_0003685 | Ga0439465_0003685_2177_2845 | 222 |
| 722 | 3300041413 | Ga0439465_0012464 | Ga0439465_0012464_182_850 | 222 |
| 723 | 3300041441 | Ga0451787_712210 | Ga0451787_712210_15_683 | 222 |
| 724 | 3300041452 | Ga0451793_0046954 | Ga0451793_0046954_802_1470 | 222 |
| 725 | 3300041456 | Ga0451795_0047719 | Ga0451795_0047719_158_826 | 222 |
| 726 | 3300041997 | Ga0439431_0003085 | Ga0439431_0003085_2835_3503 | 222 |
| 727 | 3300041997 | Ga0439431_0006682 | Ga0439431_0006682_1136_1804 | 222 |
| 728 | 3300042002 | Ga0439442_002061 | Ga0439442_002061_290_958 | 222 |
| 729 | 3300042004 | Ga0439445_0000875 | Ga0439445_0000875_2929_3597 | 222 |
| 730 | 3300042004 | Ga0439445_0003741 | Ga0439445_0003741_389_1057 | 222 |
| 731 | 3300042005 | Ga0439448_0068831 | Ga0439448_0068831_150_818 | 222 |
| 732 | 3300042016 | Ga0439463_073115 | Ga0439463_073115_179_847 | 222 |
| 733 | 3300044683 | Ga0466965_0001978 | Ga0466965_0001978_568_1236 | 222 |
| 734 | 3300044684 | Ga0466966_0003280 | Ga0466966_0003280_8505_9173 | 222 |
| 735 | 3300044684 | Ga0466966_0128433 | Ga0466966_0128433_414_1082 | 222 |
| 736 | 3300044693 | Ga0466961_0015228 | Ga0466961_0015228_2709_3377 | 222 |
| 737 | 3300044693 | Ga0466961_0016908 | Ga0466961_0016908_3326_3994 | 222 |
| 738 | 3300044694 | Ga0466963_0073901 | Ga0466963_0073901_643_1311 | 222 |
| 739 | 3300044694 | Ga0466963_0091657 | Ga0466963_0091657_144_812 | 222 |
| 740 | 3300044694 | Ga0466963_0451980 | Ga0466963_0451980_150_818 | 222 |
| 741 | 3300044694 | Ga0466963_0476151 | Ga0466963_0476151_109_792 | 222 |
| 742 | 3300044719 | Ga0466971_0015984 | Ga0466971_0015984_1470_2138 | 222 |
| 743 | 3300044719 | Ga0466971_0039555 | Ga0466971_0039555_1222_1890 | 222 |
| 744 | 3300044735 | Ga0466968_0002680 | Ga0466968_0002680_2574_3242 | 222 |
| 745 | 3300044735 | Ga0466968_0222288 | Ga0466968_0222288_64_732 | 222 |
| 746 | 3300044765 | Ga0466970_0009842 | Ga0466970_0009842_893_1561 | 222 |
| 747 | 3300044765 | Ga0466970_0260256 | Ga0466970_0260256_205_873 | 222 |
| 748 | 3300044842 | Ga0466957_0151901 | Ga0466957_0151901_311_979 | 222 |
| 749 | 3300044842 | Ga0466957_0339239 | Ga0466957_0339239_285_953 | 222 |
| 750 | 3300044901 | Ga0466960_0000284 | Ga0466960_0000284_13994_14662 | 222 |
| 751 | 3300044901 | Ga0466960_0000936 | Ga0466960_0000936_957_1625 | 222 |
| 752 | 3300044901 | Ga0466960_0427324 | Ga0466960_0427324_22_690 | 222 |
| 753 | 3300045049 | Ga0466959_0004912 | Ga0466959_0004912_6976_7644 | 222 |
| 754 | 3300045049 | Ga0466959_0048146 | Ga0466959_0048146_777_1445 | 222 |
| 755 | 3300045049 | Ga0466959_0175721 | Ga0466959_0175721_354_1022 | 222 |
| 756 | 3300045836 | Ga0466958_0014460 | Ga0466958_0014460_822_1490 | 222 |
| 757 | 3300045836 | Ga0466958_0037233 | Ga0466958_0037233_370_1038 | 222 |
| 758 | 3300045976 | Ga0466967_0013842 | Ga0466967_0013842_615_1283 | 222 |
| 759 | 3300045976 | Ga0466967_0065477 | Ga0466967_0065477_392_1060 | 222 |
| 760 | 3300045976 | Ga0466967_0081069 | Ga0466967_0081069_675_1343 | 222 |
| 761 | 3300045976 | Ga0466967_0221318 | Ga0466967_0221318_680_1348 | 222 |
| 762 | 3300045976 | Ga0466967_0672300 | Ga0466967_0672300_227_907 | 222 |
| 763 | 3300046460 | Ga0495638_0009441 | Ga0495638_0009441_2980_3648 | 222 |
| 764 | 3300046460 | Ga0495638_0019859 | Ga0495638_0019859_1472_2140 | 222 |
| 765 | 3300046524 | Ga0495648_0005202 | Ga0495648_0005202_5358_6026 | 222 |
| 766 | 3300046616 | Ga0495668_0016771 | Ga0495668_0016771_2224_2892 | 222 |
| 767 | 3300046616 | Ga0495668_0223583 | Ga0495668_0223583_295_963 | 222 |
| 768 | 3300046616 | Ga0495668_0270441 | Ga0495668_0270441_204_872 | 222 |
| 769 | 3300046694 | Ga0495649_0116713 | Ga0495649_0116713_691_1359 | 222 |
| 770 | 3300047320 | Ga0495672_0167182 | Ga0495672_0167182_425_1093 | 222 |
| 771 | 3300047320 | Ga0495672_0192261 | Ga0495672_0192261_71_739 | 222 |
| 772 | 3300047469 | Ga0495673_0000524 | Ga0495673_0000524_34060_34728 | 222 |
| 773 | 3300047472 | Ga0495686_0002996 | Ga0495686_0002996_3142_3810 | 222 |
| 774 | 3300048903 | Ga0496100_0000090 | Ga0496100_0000090_24386_25054 | 222 |
| 775 | 3300048903 | Ga0496100_0000358 | Ga0496100_0000358_12445_13113 | 222 |
| 776 | 3300048903 | Ga0496100_0000576 | Ga0496100_0000576_10511_11179 | 222 |
| 777 | 3300048903 | Ga0496100_0000826 | Ga0496100_0000826_5677_6345 | 222 |
| 778 | 3300048904 | Ga0496101_0000031 | Ga0496101_0000031_86137_86805 | 222 |
| 779 | 3300048904 | Ga0496101_0000409 | Ga0496101_0000409_2729_3397 | 222 |
| 780 | 3300048904 | Ga0496101_0001670 | Ga0496101_0001670_6141_6809 | 222 |
| 781 | 3300048904 | Ga0496101_0223395 | Ga0496101_0223395_75_743 | 222 |
| 782 | 3300048904 | Ga0496101_0300293 | Ga0496101_0300293_495_1163 | 222 |
| 783 | 3300048904 | Ga0496101_0573223 | Ga0496101_0573223_149_817 | 222 |
| 784 | 3300048905 | Ga0496102_0000065 | Ga0496102_0000065_132576_133244 | 222 |
| 785 | 3300048905 | Ga0496102_0000387 | Ga0496102_0000387_21295_21963 | 222 |
| 786 | 3300048905 | Ga0496102_0002397 | Ga0496102_0002397_6009_6677 | 222 |
| 787 | 3300048905 | Ga0496102_0008246 | Ga0496102_0008246_882_1550 | 222 |
| 788 | 3300048905 | Ga0496102_0034168 | Ga0496102_0034168_3088_3756 | 222 |
| 789 | 3300048905 | Ga0496102_0034723 | Ga0496102_0034723_1959_2627 | 222 |
| 790 | 3300048905 | Ga0496102_0081212 | Ga0496102_0081212_999_1667 | 222 |
| 791 | 3300048905 | Ga0496102_0288122 | Ga0496102_0288122_821_1489 | 222 |
| 792 | 3300048906 | Ga0496103_0000048 | Ga0496103_0000048_132117_132785 | 222 |
| 793 | 3300048906 | Ga0496103_0000292 | Ga0496103_0000292_15621_16289 | 222 |
| 794 | 3300048906 | Ga0496103_0001655 | Ga0496103_0001655_13232_13900 | 222 |
| 795 | 3300048906 | Ga0496103_0018603 | Ga0496103_0018603_1430_2098 | 222 |
| 796 | 3300048906 | Ga0496103_0092143 | Ga0496103_0092143_260_928 | 222 |
| 797 | 3300048907 | Ga0496104_0020189 | Ga0496104_0020189_5146_5814 | 222 |
| 798 | 3300048907 | Ga0496104_0113942 | Ga0496104_0113942_845_1513 | 222 |
| 799 | 3300048907 | Ga0496104_0221750 | Ga0496104_0221750_111_779 | 222 |
| 800 | 3300048908 | Ga0496105_0010809 | Ga0496105_0010809_1222_1890 | 222 |
| 801 | 3300048908 | Ga0496105_0103573 | Ga0496105_0103573_1080_1748 | 222 |
| 802 | 3300048909 | Ga0496106_0002589 | Ga0496106_0002589_2766_3434 | 222 |
| 803 | 3300048909 | Ga0496106_0020022 | Ga0496106_0020022_960_1628 | 222 |
| 804 | 3300048909 | Ga0496106_0048358 | Ga0496106_0048358_2113_2781 | 222 |
| 805 | 3300048909 | Ga0496106_0583215 | Ga0496106_0583215_211_879 | 222 |
| 806 | 3300048910 | Ga0496107_0004431 | Ga0496107_0004431_6658_7326 | 222 |
| 807 | 3300048910 | Ga0496107_0005397 | Ga0496107_0005397_6855_7523 | 222 |
| 808 | 3300048910 | Ga0496107_0027297 | Ga0496107_0027297_1009_1677 | 222 |
| 809 | 3300048910 | Ga0496107_0181389 | Ga0496107_0181389_685_1353 | 222 |
| 810 | 3300048911 | Ga0496108_0011488 | Ga0496108_0011488_3293_3961 | 222 |
| 811 | 3300048911 | Ga0496108_0029357 | Ga0496108_0029357_2948_3616 | 222 |
| 812 | 3300048911 | Ga0496108_0099750 | Ga0496108_0099750_441_1109 | 222 |
| 813 | 3300048911 | Ga0496108_0155881 | Ga0496108_0155881_358_1026 | 222 |
| 814 | 3300048912 | Ga0496109_0000134 | Ga0496109_0000134_50583_51251 | 222 |
| 815 | 3300048912 | Ga0496109_0189902 | Ga0496109_0189902_1185_1853 | 222 |
| 816 | 3300048913 | Ga0496110_0024896 | Ga0496110_0024896_634_1302 | 222 |
| 817 | 3300048913 | Ga0496110_0038335 | Ga0496110_0038335_340_1008 | 222 |
| 818 | 3300048914 | Ga0496111_0002609 | Ga0496111_0002609_279_947 | 222 |
| 819 | 3300048914 | Ga0496111_0087238 | Ga0496111_0087238_1330_1998 | 222 |
| 820 | 3300048914 | Ga0496111_0105904 | Ga0496111_0105904_80_748 | 222 |
| 821 | 3300048915 | Ga0496112_0043544 | Ga0496112_0043544_3502_4170 | 222 |
| 822 | 3300048915 | Ga0496112_0423509 | Ga0496112_0423509_236_904 | 222 |
| 823 | 3300048916 | Ga0496113_0120482 | Ga0496113_0120482_55_723 | 222 |
| 824 | 3300048916 | Ga0496113_0482791 | Ga0496113_0482791_217_885 | 222 |
| 825 | 3300048917 | Ga0496114_0001498 | Ga0496114_0001498_2892_3560 | 222 |
| 826 | 3300048917 | Ga0496114_0016088 | Ga0496114_0016088_80_748 | 222 |
| 827 | 3300048917 | Ga0496114_0030885 | Ga0496114_0030885_2398_3066 | 222 |
| 828 | 3300048917 | Ga0496114_0446661 | Ga0496114_0446661_26_694 | 222 |
| 829 | 3300048918 | Ga0496115_0002039 | Ga0496115_0002039_1472_2140 | 222 |
| 830 | 3300048918 | Ga0496115_0081409 | Ga0496115_0081409_1894_2562 | 222 |
| 831 | 3300048918 | Ga0496115_0119606 | Ga0496115_0119606_678_1346 | 222 |
| 832 | 3300048919 | Ga0496116_0000125 | Ga0496116_0000125_28127_28795 | 222 |
| 833 | 3300048919 | Ga0496116_0019575 | Ga0496116_0019575_1705_2373 | 222 |
| 834 | 3300048919 | Ga0496116_0023895 | Ga0496116_0023895_2465_3133 | 222 |
| 835 | 3300048920 | Ga0496117_0000111 | Ga0496117_0000111_28127_28795 | 222 |
| 836 | 3300048920 | Ga0496117_0001572 | Ga0496117_0001572_1793_2461 | 222 |
| 837 | 3300048920 | Ga0496117_0112605 | Ga0496117_0112605_178_846 | 222 |
| 838 | 3300048921 | Ga0496118_0000083 | Ga0496118_0000083_28127_28795 | 222 |
| 839 | 3300048921 | Ga0496118_0000648 | Ga0496118_0000648_44860_45528 | 222 |
| 840 | 3300048921 | Ga0496118_0001353 | Ga0496118_0001353_15502_16170 | 222 |
| 841 | 3300048921 | Ga0496118_0009352 | Ga0496118_0009352_7683_8351 | 222 |
| 842 | 3300048922 | Ga0496119_0002640 | Ga0496119_0002640_371_1039 | 222 |
| 843 | 3300048922 | Ga0496119_0003272 | Ga0496119_0003272_2247_2915 | 222 |
| 844 | 3300048922 | Ga0496119_0011086 | Ga0496119_0011086_2101_2769 | 222 |
| 845 | 3300048923 | Ga0496120_0002589 | Ga0496120_0002589_2375_3043 | 222 |
| 846 | 3300048923 | Ga0496120_0041742 | Ga0496120_0041742_1342_2010 | 222 |
| 847 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_531738_532406 | 222 |
| 848 | 3300048924 | Ga0496121_0019295 | Ga0496121_0019295_2551_3219 | 222 |
| 849 | 3300048925 | Ga0496122_0000138 | Ga0496122_0000138_33721_34389 | 222 |
| 850 | 3300048926 | Ga0496123_0008587 | Ga0496123_0008587_3408_4076 | 222 |
| 851 | 3300048927 | Ga0496124_0000012 | Ga0496124_0000012_256531_257199 | 222 |
| 852 | 3300048927 | Ga0496124_0269234 | Ga0496124_0269234_559_1227 | 222 |
| 853 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_657362_658030 | 222 |
| 854 | 3300048928 | Ga0496125_0040927 | Ga0496125_0040927_1552_2220 | 222 |
| 855 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_531738_532406 | 222 |
| 856 | 3300048929 | Ga0496126_0000220 | Ga0496126_0000220_90047_90715 | 222 |
| 857 | 3300048929 | Ga0496126_0006077 | Ga0496126_0006077_3966_4634 | 222 |
| 858 | 3300049569 | Ga0501032_0001198 | Ga0501032_0001198_11641_12309 | 222 |
| 859 | 3300049570 | Ga0501033_0013056 | Ga0501033_0013056_1324_1992 | 222 |
| 860 | 3300049570 | Ga0501033_0032246 | Ga0501033_0032246_1734_2402 | 222 |
| 861 | 3300049570 | Ga0501033_0584369 | Ga0501033_0584369_33_701 | 222 |
| 862 | 3300049571 | Ga0501034_0003575 | Ga0501034_0003575_15279_15947 | 222 |
| 863 | 3300049571 | Ga0501034_0004941 | Ga0501034_0004941_7583_8251 | 222 |
| 864 | 3300049571 | Ga0501034_0037834 | Ga0501034_0037834_1442_2110 | 222 |
| 865 | 3300049571 | Ga0501034_0131209 | Ga0501034_0131209_1489_2157 | 222 |
| 866 | 3300049572 | Ga0501036_0035805 | Ga0501036_0035805_2015_2683 | 222 |
| 867 | 3300049572 | Ga0501036_0064770 | Ga0501036_0064770_1914_2582 | 222 |
| 868 | 3300049573 | Ga0501037_0002583 | Ga0501037_0002583_11362_12030 | 222 |
| 869 | 3300049573 | Ga0501037_0007135 | Ga0501037_0007135_5943_6611 | 222 |
| 870 | 3300049573 | Ga0501037_0184866 | Ga0501037_0184866_464_1132 | 222 |
| 871 | 3300049574 | Ga0501038_0000352 | Ga0501038_0000352_1358_2026 | 222 |
| 872 | 3300049575 | Ga0501039_0002801 | Ga0501039_0002801_551_1219 | 222 |
| 873 | 3300049579 | Ga0501043_0002096 | Ga0501043_0002096_15476_16144 | 222 |
| 874 | 3300049579 | Ga0501043_0029168 | Ga0501043_0029168_2668_3336 | 222 |
| 875 | 3300049580 | Ga0501046_0000769 | Ga0501046_0000769_6650_7318 | 222 |
| 876 | 3300049581 | Ga0501047_0005895 | Ga0501047_0005895_6299_6967 | 222 |
| 877 | 3300049581 | Ga0501047_0010792 | Ga0501047_0010792_6631_7299 | 222 |
| 878 | 3300049584 | Ga0501068_0238077 | Ga0501068_0238077_329_997 | 222 |
| 879 | 3300049585 | Ga0501069_0045914 | Ga0501069_0045914_1313_1981 | 222 |
| 880 | 3300049586 | Ga0501070_0006531 | Ga0501070_0006531_9180_9848 | 222 |
| 881 | 3300049586 | Ga0501070_0010101 | Ga0501070_0010101_6091_6759 | 222 |
| 882 | 3300049586 | Ga0501070_0143809 | Ga0501070_0143809_116_784 | 222 |
| 883 | 3300049589 | Ga0501073_0016560 | Ga0501073_0016560_942_1610 | 222 |
| 884 | 3300049593 | Ga0501077_0325585 | Ga0501077_0325585_246_914 | 222 |
| 885 | 3300049742 | Ga0501080_0161831 | Ga0501080_0161831_1089_1757 | 222 |
| 886 | 3300049744 | Ga0501083_0171294 | Ga0501083_0171294_206_874 | 222 |
| 887 | 3300049822 | Ga0501035_0000886 | Ga0501035_0000886_5797_6465 | 222 |
| 888 | 3300049822 | Ga0501035_0007162 | Ga0501035_0007162_5012_5680 | 222 |
| 889 | 3300049823 | Ga0501044_0001635 | Ga0501044_0001635_11877_12545 | 222 |
| 890 | 3300049823 | Ga0501044_0003142 | Ga0501044_0003142_8139_8807 | 222 |
| 891 | 3300049823 | Ga0501044_0009219 | Ga0501044_0009219_583_1251 | 222 |
| 892 | 3300050489 | nmdc:mga03683_54157_c1 | nmdc:mga03683_54157_c1_875_1543 | 222 |
| 893 | 3300050490 | nmdc:mga03n38_7026_c1 | nmdc:mga03n38_7026_c1_2547_3215 | 222 |
| 894 | 3300050491 | nmdc:mga00v17_107702_c1 | nmdc:mga00v17_107702_c1_316_984 | 222 |
| 895 | 3300050491 | nmdc:mga00v17_207324_c1 | nmdc:mga00v17_207324_c1_44_712 | 222 |
| 896 | 3300050491 | nmdc:mga00v17_34499_c1 | nmdc:mga00v17_34499_c1_1162_1830 | 222 |
| 897 | 3300050491 | nmdc:mga00v17_71997_c1 | nmdc:mga00v17_71997_c1_1243_1911 | 222 |
| 898 | 3300050491 | nmdc:mga00v17_77101_c1 | nmdc:mga00v17_77101_c1_404_1072 | 222 |
| 899 | 3300050491 | nmdc:mga00v17_94938_c1 | nmdc:mga00v17_94938_c1_963_1631 | 222 |
| 900 | 3300050492 | nmdc:mga0yw44_15601_c2 | nmdc:mga0yw44_15601_c2_1698_2366 | 222 |
| 901 | 3300050492 | nmdc:mga0yw44_37477_c1 | nmdc:mga0yw44_37477_c1_338_1006 | 222 |
| 902 | 3300050492 | nmdc:mga0yw44_61543_c1 | nmdc:mga0yw44_61543_c1_1518_2186 | 222 |
| 903 | 3300050492 | nmdc:mga0yw44_93711_c1 | nmdc:mga0yw44_93711_c1_177_845 | 222 |
| 904 | 3300050496 | nmdc:mga07m45_114610_c1 | nmdc:mga07m45_114610_c1_866_1534 | 222 |
| 905 | 3300050496 | nmdc:mga07m45_190588_c1 | nmdc:mga07m45_190588_c1_304_972 | 222 |
| 906 | 3300050507 | nmdc:mga05p37_9680_c1 | nmdc:mga05p37_9680_c1_4173_4841 | 222 |
| 907 | 3300050509 | nmdc:mga0qj67_42343_c1 | nmdc:mga0qj67_42343_c1_2345_3013 | 222 |
| 908 | 3300050516 | nmdc:mga0sz30_10998_c1 | nmdc:mga0sz30_10998_c1_1839_2507 | 222 |
| 909 | 3300050516 | nmdc:mga0sz30_20669_c1 | nmdc:mga0sz30_20669_c1_1782_2450 | 222 |
| 910 | 3300050516 | nmdc:mga0sz30_3067_c2 | nmdc:mga0sz30_3067_c2_381_1052 | 222 |
| 911 | 3300050516 | nmdc:mga0sz30_43771_c1 | nmdc:mga0sz30_43771_c1_248_916 | 222 |
| 912 | 3300050516 | nmdc:mga0sz30_681_c1 | nmdc:mga0sz30_681_c1_6444_7112 | 222 |
| 913 | 3300050516 | nmdc:mga0sz30_75422_c1 | nmdc:mga0sz30_75422_c1_309_977 | 222 |
| 914 | 3300053079 | Ga0500610_0050234 | Ga0500610_0050234_1432_2100 | 222 |
| 915 | 3300053080 | Ga0500635_0009747 | Ga0500635_0009747_201_869 | 222 |
| 916 | 3300053087 | Ga0500643_009791 | Ga0500643_009791_941_1609 | 222 |
| 917 | 3300053088 | Ga0500644_0095726 | Ga0500644_0095726_104_772 | 222 |
| 918 | 3300053104 | Ga0500556_0001477 | Ga0500556_0001477_7664_8332 | 222 |
| 919 | 3300053108 | Ga0500562_010478 | Ga0500562_010478_1227_1895 | 222 |
| 920 | 3300053130 | Ga0500642_0048596 | Ga0500642_0048596_236_904 | 222 |
| 921 | 3300053131 | Ga0500652_211220 | Ga0500652_211220_26_694 | 222 |
| 922 | 3300053139 | Ga0500568_0120570 | Ga0500568_0120570_64_732 | 222 |
| 923 | 3300053142 | Ga0500577_0015413 | Ga0500577_0015413_829_1497 | 222 |
| 924 | 3300053151 | Ga0500604_0018934 | Ga0500604_0018934_962_1630 | 222 |
| 925 | 3300053153 | Ga0500616_0107724 | Ga0500616_0107724_68_736 | 222 |
| 926 | 3300061719 | Ga0466962_0110381 | Ga0466962_0110381_148_816 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t72-assembly1.cif.gz_A | crystal structure of phosphate transport system protein phou from aquifex aeolicus | 0.9123 | 3 | 211 |
| 1xwm-assembly1.cif.gz_A-2 | the crystal structure of phou (phosphate uptake regulator), structural genomics | 0.8978 | 5 | 215 |
| 2i0m-assembly1.cif.gz_A | crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae | 0.897 | 5 | 215 |
| 1xwm-assembly1.cif.gz_A-2 | the crystal structure of phou (phosphate uptake regulator), structural genomics | 0.8899 | 5 | 215 |
| 2i0m-assembly1.cif.gz_A | crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae | 0.8889 | 5 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WI97_1_212_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9871 | 1 | 212 | 1.20.58.220 |
| af_P9WI97_1_212_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9825 | 1 | 212 | 1.20.58.220 |
| af_P0A9K7_1_117_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9698 | 2 | 104 | 1.20.58.220 |
| 1t8bA01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9655 | 4 | 106 | 1.20.58.220 |
| 1t8bB01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9648 | 4 | 106 | 1.20.58.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A222TNG5-F1-model_v4 | deleted | 0.9952 | 1 | 213 |
|
| AF-P9WI94-F1-model_v4 | Phosphate-specific transport system accessory protein PhoU homolog 2 (Pst system accessory protein PhoU homolog 2) | 0.9924 | 1 | 213 |
GO:0005737
GO:0006817 GO:0030643 GO:0042803 GO:0045936 GO:2000186 |
| AF-V8D0E9-F1-model_v4 | PhoU family transcriptional regulator | 0.9922 | 20 | 213 |
GO:0006817
GO:0030643 GO:0045936 |
| AF-A0A7U8UDA9-F1-model_v4 | deleted | 0.9912 | 1 | 163 |
|
| AF-H5TYA6-F1-model_v4 | Phosphate-specific transport system accessory protein PhoU | 0.9889 | 1 | 213 |
GO:0005737
GO:0006817 GO:0030643 GO:0045936 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar