F485879

General Info

Members Datasets Scaffolds Average Seq Length
925 384 1850 168

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100617302|Ga0070663_1006173022
Length 187
Sequence MRVRRLKKTPAHLEITAFINLIVVLVPFLLSTAVFTRLSVIDLALPAQSSDAIAKLDADKPLKLEVVIRRDSLQVQDRHGGSLTPIGDGIPNVASGPDTKSLAVLVQAIKAKFPQHDDATVLAETNTSYETLVRVMDAVRGGHQAQNGKAVHVDYFPNISIGDAPIVNNATAAVPAGPVALAAPRKP

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
109 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
243 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
244 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
245 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
246 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
247 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
248 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
249 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
252 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
253 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
254 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
255 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
331 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
332 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
352 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
353 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
354 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
355 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
356 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
357 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
358 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
359 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
362 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
363 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
364 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
365 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
366 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
367 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
371 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
372 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
373 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
374 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
377 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
383 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
384 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.22
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.38
Nodule 0
Rhizoplane 3.57
Rhizosphere 81.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100617302 3300005455 Bacteria 914
2 JGI25156J39149_1000143 3300002705 Bacteria 52740
3 JGI25154J39366_1000882 3300002738 Bacteria 12840
4 JGI25157J39369_1000045 3300002741 Bacteria 122406
5 JGI25164J39214_1002615 3300002772 Bacteria 2646
6 JGI25152J39213_1006704 3300002773 Bacteria 3077
7 JGI25153J46596_10006298 3300003215 Bacteria 6045
8 JGI25153J46596_10012400 3300003215 Bacteria 3679
9 rootH1_10026938 3300003316 Bacteria 1546
10 rootH2_10135664 3300003320 Bacteria 2218
11 rootL2_10033230 3300003322 Bacteria 9655
12 Ga0055539_1000277 3300003752 Bacteria 29675
13 Ga0055539_1001230 3300003752 Bacteria 5146
14 Ga0055539_1003464 3300003752 Bacteria 2205
15 Ga0055533_1000026 3300003756 Bacteria 323407
16 Ga0055525_1000870 3300003759 Bacteria 8792
17 Ga0055535_1000056 3300003761 Bacteria 128204
18 Ga0055529_1000165 3300003763 Bacteria 91442
19 Ga0055526_1005584 3300003771 Bacteria 7174
20 Ga0065712_10035351 3300005290 Bacteria 1742
21 Ga0065715_10197896 3300005293 Bacteria 1377
22 Ga0065715_10238186 3300005293 Bacteria 1191
23 Ga0070658_10128741 3300005327 Bacteria 2108
24 Ga0070658_10271832 3300005327 Bacteria 1441
25 Ga0070658_10286247 3300005327 Bacteria 1403
26 Ga0070658_10439942 3300005327 Bacteria 1123
27 Ga0070658_10579753 3300005327 Bacteria 972
28 Ga0070658_10805944 3300005327 Bacteria 816
29 Ga0070676_10044160 3300005328 Bacteria 2593
30 Ga0070676_10050093 3300005328 Bacteria 2447
31 Ga0070676_10183013 3300005328 Bacteria 1364
32 Ga0070676_10189246 3300005328 Bacteria 1343
33 Ga0070676_10888932 3300005328 Bacteria 663
34 Ga0070683_100018612 3300005329 Bacteria 6156
35 Ga0070683_100691777 3300005329 Bacteria 976
36 Ga0070683_101049295 3300005329 Bacteria 783
37 Ga0070683_101239957 3300005329 Bacteria 717
38 Ga0070690_100023962 3300005330 Bacteria 3750
39 Ga0070690_100112963 3300005330 Bacteria 1815
40 Ga0070690_100138810 3300005330 Bacteria 1648
41 Ga0070670_100000506 3300005331 Bacteria 31200
42 Ga0070670_100111875 3300005331 Bacteria 2353
43 Ga0070670_100184729 3300005331 Bacteria 1810
44 Ga0070670_100259556 3300005331 Bacteria 1514
45 Ga0070670_100337967 3300005331 Bacteria 1321
46 Ga0070670_100634673 3300005331 Bacteria 957
47 Ga0070670_100733333 3300005331 Bacteria 890
48 Ga0070670_100912894 3300005331 Bacteria 796
49 Ga0070670_101858861 3300005331 Bacteria 554
50 Ga0070677_10024988 3300005333 Bacteria 2226
51 Ga0070677_10057198 3300005333 Bacteria 1597
52 Ga0070677_10062268 3300005333 Bacteria 1543
53 Ga0070677_10081761 3300005333 Bacteria 1384
54 Ga0070677_10092432 3300005333 Bacteria 1318
55 Ga0068869_100008613 3300005334 Bacteria 6587
56 Ga0068869_100009866 3300005334 Bacteria 6201
57 Ga0068869_100022179 3300005334 Bacteria 4372
58 Ga0068869_100566784 3300005334 Bacteria 956
59 Ga0068869_100726562 3300005334 Bacteria 849
60 Ga0070666_10131502 3300005335 Bacteria 1739
61 Ga0070666_10282663 3300005335 Bacteria 1180
62 Ga0070666_10365879 3300005335 Bacteria 1034
63 Ga0070680_100042120 3300005336 Bacteria 3704
64 Ga0068868_100214187 3300005338 Bacteria 1611
65 Ga0068868_100374013 3300005338 Bacteria 1225
66 Ga0068868_100488527 3300005338 Bacteria 1076
67 Ga0070660_100021141 3300005339 Bacteria 4794
68 Ga0070660_100238537 3300005339 Bacteria 1480
69 Ga0070660_100379087 3300005339 Bacteria 1167
70 Ga0070660_100441006 3300005339 Bacteria 1080
71 Ga0070660_100450571 3300005339 Bacteria 1068
72 Ga0070660_100513409 3300005339 Bacteria 997
73 Ga0070689_100004125 3300005340 Bacteria 9785
74 Ga0070689_100281421 3300005340 Bacteria 1380
75 Ga0070687_100065915 3300005343 Bacteria 1928
76 Ga0070687_100315702 3300005343 Bacteria 997
77 Ga0070661_100045893 3300005344 Bacteria 3195
78 Ga0070661_100063562 3300005344 Bacteria 2711
79 Ga0070661_100151597 3300005344 Bacteria 1752
80 Ga0070661_100323164 3300005344 Bacteria 1205
81 Ga0070668_100102664 3300005347 Bacteria 2267
82 Ga0070668_100159688 3300005347 Bacteria 1828
83 Ga0070668_100188916 3300005347 Bacteria 1686
84 Ga0070668_100559108 3300005347 Bacteria 997
85 Ga0070669_100029707 3300005353 Bacteria 3942
86 Ga0070669_100054781 3300005353 Bacteria 2922
87 Ga0070669_100125129 3300005353 Bacteria 1966
88 Ga0070669_100145352 3300005353 Bacteria 1832
89 Ga0070669_100335123 3300005353 Bacteria 1225
90 Ga0070669_100374285 3300005353 Bacteria 1160
91 Ga0070669_100410679 3300005353 Bacteria 1109
92 Ga0070675_100001437 3300005354 Bacteria 17495
93 Ga0070675_100002003 3300005354 Bacteria 15116
94 Ga0070675_100022442 3300005354 Bacteria 5044
95 Ga0070675_100076327 3300005354 Bacteria 2787
96 Ga0070675_100285897 3300005354 Bacteria 1450
97 Ga0070675_100623001 3300005354 Bacteria 979
98 Ga0070675_100678190 3300005354 Bacteria 938
99 Ga0070671_100025175 3300005355 Bacteria 4880
100 Ga0070671_100047446 3300005355 Bacteria 3572
101 Ga0070671_100056605 3300005355 Bacteria 3262
102 Ga0070671_100099161 3300005355 Bacteria 2443
103 Ga0070671_100129472 3300005355 Bacteria 2125
104 Ga0070671_100141189 3300005355 Bacteria 2032
105 Ga0070671_100166581 3300005355 Bacteria 1863
106 Ga0070671_100407556 3300005355 Bacteria 1163
107 Ga0070674_100080470 3300005356 Bacteria 2326
108 Ga0070674_100092026 3300005356 Bacteria 2191
109 Ga0070674_100258635 3300005356 Bacteria 1370
110 Ga0070674_100506330 3300005356 Bacteria 1006
111 Ga0070673_100001463 3300005364 Bacteria 13814
112 Ga0070673_100002753 3300005364 Bacteria 10798
113 Ga0070673_100023056 3300005364 Bacteria 4543
114 Ga0070673_100134064 3300005364 Bacteria 2082
115 Ga0070673_100135153 3300005364 Bacteria 2074
116 Ga0070673_100135620 3300005364 Bacteria 2071
117 Ga0070688_100322604 3300005365 Bacteria 1123
118 Ga0070659_100103923 3300005366 Bacteria 2288
119 Ga0070659_100107404 3300005366 Bacteria 2250
120 Ga0070659_100112113 3300005366 Bacteria 2202
121 Ga0070659_100141687 3300005366 Bacteria 1957
122 Ga0070667_100013312 3300005367 Bacteria 6794
123 Ga0070667_100017201 3300005367 Bacteria 5989
124 Ga0070667_100020457 3300005367 Bacteria 5493
125 Ga0070667_100083492 3300005367 Bacteria 2736
126 Ga0070667_100164159 3300005367 Bacteria 1958
127 Ga0070667_100703023 3300005367 Bacteria 935
128 Ga0070667_101050645 3300005367 Bacteria 761
129 Ga0070701_10028223 3300005438 Bacteria 2757
130 Ga0070700_100113021 3300005441 Bacteria 1809
131 Ga0070663_100065983 3300005455 Bacteria 2621
132 Ga0070663_100096266 3300005455 Bacteria 2201
133 Ga0070663_100183585 3300005455 Bacteria 1624
134 Ga0070663_100221880 3300005455 Bacteria 1484
135 Ga0070678_100058352 3300005456 Bacteria 2832
136 Ga0070678_100072661 3300005456 Bacteria 2579
137 Ga0070678_100272675 3300005456 Bacteria 1427
138 Ga0070678_101204947 3300005456 Bacteria 702
139 Ga0070662_100004846 3300005457 Bacteria 8531
140 Ga0070662_100056653 3300005457 Bacteria 2846
141 Ga0070662_100059194 3300005457 Bacteria 2790
142 Ga0070662_100076911 3300005457 Bacteria 2475
143 Ga0070662_100080253 3300005457 Bacteria 2428
144 Ga0070662_100366761 3300005457 Bacteria 1183
145 Ga0070681_10256772 3300005458 Bacteria 1660
146 Ga0068867_100000075 3300005459 Bacteria 60780
147 Ga0068867_100002503 3300005459 Bacteria 12920
148 Ga0068867_100019399 3300005459 Bacteria 4846
149 Ga0068867_100199391 3300005459 Bacteria 1601
150 Ga0068867_100215775 3300005459 Bacteria 1543
151 Ga0068867_100422408 3300005459 Bacteria 1129
152 Ga0068867_100672372 3300005459 Bacteria 911
153 Ga0068867_100928773 3300005459 Bacteria 785
154 Ga0070685_10007716 3300005466 Bacteria 5508
155 Ga0070706_100009088 3300005467 Bacteria 9254
156 Ga0070706_100173120 3300005467 Bacteria 2016
157 Ga0070679_100036698 3300005530 Bacteria 4864
158 Ga0070684_100046941 3300005535 Bacteria 3743
159 Ga0070684_100179903 3300005535 Bacteria 1922
160 Ga0070684_100777246 3300005535 Bacteria 895
161 Ga0068853_100108712 3300005539 Bacteria 2460
162 Ga0068853_100187401 3300005539 Bacteria 1878
163 Ga0068853_100241874 3300005539 Bacteria 1654
164 Ga0068853_100335035 3300005539 Bacteria 1405
165 Ga0068853_100485878 3300005539 Bacteria 1164
166 Ga0068853_100529576 3300005539 Bacteria 1115
167 Ga0070672_100040733 3300005543 Bacteria 3566
168 Ga0070672_100231242 3300005543 Bacteria 1553
169 Ga0070672_100466182 3300005543 Bacteria 1089
170 Ga0070672_100746947 3300005543 Bacteria 858
171 Ga0070686_100066867 3300005544 Bacteria 2340
172 Ga0070686_100613595 3300005544 Bacteria 858
173 Ga0070695_100179593 3300005545 Bacteria 1499
174 Ga0070693_100045225 3300005547 Bacteria 2494
175 Ga0070693_100077080 3300005547 Bacteria 1977
176 Ga0070693_100105191 3300005547 Bacteria 1726
177 Ga0070665_100022123 3300005548 Bacteria 6395
178 Ga0070665_100346878 3300005548 Bacteria 1490
179 Ga0068855_100004303 3300005563 Bacteria 17405
180 Ga0068855_100217474 3300005563 Bacteria 2144
181 Ga0068855_100519102 3300005563 Bacteria 1292
182 Ga0068855_100687702 3300005563 Bacteria 1096
183 Ga0070664_100119793 3300005564 Bacteria 2303
184 Ga0070664_100673385 3300005564 Bacteria 962
185 Ga0070664_100842209 3300005564 Bacteria 858
186 Ga0070664_101131894 3300005564 Bacteria 738
187 Ga0068857_100003768 3300005577 Bacteria 12751
188 Ga0068857_100098370 3300005577 Bacteria 2624
189 Ga0068857_100497801 3300005577 Bacteria 1143
190 Ga0068854_100002382 3300005578 Bacteria 11606
191 Ga0068854_100021968 3300005578 Bacteria 4338
192 Ga0068854_100154394 3300005578 Bacteria 1773
193 Ga0068854_100158041 3300005578 Bacteria 1753
194 Ga0068854_100445437 3300005578 Bacteria 1080
195 Ga0068854_100469492 3300005578 Bacteria 1054
196 Ga0068854_100694815 3300005578 Bacteria 877
197 Ga0068856_100000820 3300005614 Bacteria 33500
198 Ga0068856_100027110 3300005614 Bacteria 5589
199 Ga0068856_100117964 3300005614 Bacteria 2655
200 Ga0070702_100248391 3300005615 Bacteria 1205
201 Ga0070702_100386723 3300005615 Bacteria 996
202 Ga0068852_100042769 3300005616 Bacteria 3838
203 Ga0068852_100049130 3300005616 Bacteria 3607
204 Ga0068852_100138813 3300005616 Bacteria 2247
205 Ga0068852_100148458 3300005616 Bacteria 2177
206 Ga0068852_100149807 3300005616 Bacteria 2168
207 Ga0068852_100161076 3300005616 Bacteria 2095
208 Ga0068852_100304983 3300005616 Bacteria 1542
209 Ga0068852_100646756 3300005616 Bacteria 1064
210 Ga0068852_100703703 3300005616 Bacteria 1020
211 Ga0068852_101210005 3300005616 Bacteria 776
212 Ga0068859_100002207 3300005617 Bacteria 19743
213 Ga0068859_100236291 3300005617 Bacteria 1916
214 Ga0068859_100666688 3300005617 Bacteria 1132
215 Ga0068859_101016807 3300005617 Bacteria 910
216 Ga0068859_101309178 3300005617 Bacteria 799
217 Ga0068864_100005299 3300005618 Bacteria 10555
218 Ga0068864_100026938 3300005618 Bacteria 4849
219 Ga0068864_100158413 3300005618 Bacteria 2056
220 Ga0068864_100164240 3300005618 Bacteria 2020
221 Ga0068864_100458145 3300005618 Bacteria 1220
222 Ga0068864_100551083 3300005618 Bacteria 1114
223 Ga0068861_100009238 3300005719 Bacteria 6802
224 Ga0068861_100040052 3300005719 Bacteria 3501
225 Ga0068861_100233410 3300005719 Bacteria 1561
226 Ga0068861_100758968 3300005719 Bacteria 907
227 Ga0068851_10025891 3300005834 Bacteria 2879
228 Ga0068851_10035741 3300005834 Bacteria 2485
229 Ga0068851_10115670 3300005834 Bacteria 1437
230 Ga0068851_10131769 3300005834 Bacteria 1352
231 Ga0068851_10145284 3300005834 Bacteria 1293
232 Ga0068851_10490033 3300005834 Bacteria 736
233 Ga0068870_10413704 3300005840 Bacteria 880
234 Ga0068863_100003985 3300005841 Bacteria 14575
235 Ga0068863_100029360 3300005841 Bacteria 5249
236 Ga0068863_100038053 3300005841 Bacteria 4578
237 Ga0068863_100510419 3300005841 Bacteria 1184
238 Ga0068863_100599170 3300005841 Bacteria 1090
239 Ga0068863_101421670 3300005841 Bacteria 701
240 Ga0068863_101454240 3300005841 Bacteria 693
241 Ga0068858_100002725 3300005842 Bacteria 17778
242 Ga0068858_100053906 3300005842 Bacteria 3719
243 Ga0068858_100090765 3300005842 Bacteria 2843
244 Ga0068858_100137004 3300005842 Bacteria 2297
245 Ga0068858_100658188 3300005842 Bacteria 1018
246 Ga0068860_100002268 3300005843 Bacteria 20215
247 Ga0068860_100106561 3300005843 Bacteria 2677
248 Ga0068860_100115807 3300005843 Bacteria 2564
249 Ga0068860_100145716 3300005843 Bacteria 2278
250 Ga0068860_100344479 3300005843 Bacteria 1466
251 Ga0068862_100006901 3300005844 Bacteria 9417
252 Ga0081455_10078438 3300005937 Bacteria 2714
253 Ga0075365_10165639 3300006038 Bacteria 1542
254 Ga0075368_10064069 3300006042 Bacteria 1475
255 Ga0075368_10188802 3300006042 Bacteria 870
256 Ga0075363_100135316 3300006048 Bacteria 1384
257 Ga0075364_10481175 3300006051 Bacteria 849
258 Ga0075432_10127587 3300006058 Bacteria 961
259 Ga0070715_10058853 3300006163 Bacteria 1679
260 Ga0075362_10029318 3300006177 Bacteria 2371
261 Ga0075367_10114562 3300006178 Bacteria 1657
262 Ga0075369_10045590 3300006186 Bacteria 1885
263 Ga0075366_10066058 3300006195 Bacteria 2151
264 Ga0075366_10491253 3300006195 Bacteria 759
265 Ga0097621_100018246 3300006237 Bacteria 5353
266 Ga0097621_100038571 3300006237 Bacteria 3834
267 Ga0097621_100222907 3300006237 Bacteria 1644
268 Ga0097621_100257998 3300006237 Bacteria 1528
269 Ga0097621_100652739 3300006237 Bacteria 965
270 Ga0075370_10001892 3300006353 Bacteria 9406
271 Ga0075370_10023556 3300006353 Bacteria 3392
272 Ga0075370_10531641 3300006353 Bacteria 711
273 Ga0068871_100072266 3300006358 Bacteria 2840
274 Ga0068871_100138835 3300006358 Bacteria 2065
275 Ga0068871_100153576 3300006358 Bacteria 1964
276 Ga0068871_100230755 3300006358 Bacteria 1606
277 Ga0068871_100306760 3300006358 Bacteria 1395
278 Ga0075430_100205001 3300006846 Bacteria 1637
279 Ga0075434_100238601 3300006871 Bacteria 1838
280 Ga0075429_100708624 3300006880 Bacteria 882
281 Ga0068865_100052104 3300006881 Bacteria 2835
282 Ga0068865_100079888 3300006881 Bacteria 2344
283 Ga0068865_100279966 3300006881 Bacteria 1327
284 Ga0068865_101330460 3300006881 Bacteria 640
285 Ga0075436_100279189 3300006914 Bacteria 1194
286 Ga0097620_100002207 3300006931 Bacteria 19743
287 Ga0097620_100236270 3300006931 Bacteria 1916
288 Ga0097620_100666674 3300006931 Bacteria 1132
289 Ga0097620_101016825 3300006931 Bacteria 910
290 Ga0097620_101309106 3300006931 Bacteria 799
291 Ga0075435_100168903 3300007076 Bacteria 1845
292 Ga0105240_10140581 3300009093 Bacteria 2887
293 Ga0105240_10206322 3300009093 Bacteria 2300
294 Ga0105240_10228040 3300009093 Bacteria 2166
295 Ga0105240_10564574 3300009093 Bacteria 1257
296 Ga0105240_10840181 3300009093 Bacteria 992
297 Ga0105240_11050661 3300009093 Bacteria 869
298 Ga0111539_10560958 3300009094 Bacteria 1330
299 Ga0111539_10605101 3300009094 Bacteria 1276
300 Ga0105245_10131399 3300009098 Bacteria 2349
301 Ga0105245_10300958 3300009098 Bacteria 1574
302 Ga0105245_10885345 3300009098 Bacteria 934
303 Ga0105245_11310860 3300009098 Bacteria 773
304 Ga0105247_10317667 3300009101 Bacteria 1086
305 Ga0105247_10393559 3300009101 Bacteria 985
306 Ga0105243_10002844 3300009148 Bacteria 14366
307 Ga0105243_10119631 3300009148 Bacteria 2218
308 Ga0105243_10234462 3300009148 Bacteria 1630
309 Ga0105241_11026716 3300009174 Bacteria 773
310 Ga0105241_11316717 3300009174 Bacteria 689
311 Ga0105242_10225445 3300009176 Bacteria 1677
312 Ga0105242_10491308 3300009176 Bacteria 1165
313 Ga0105248_10160265 3300009177 Bacteria 2538
314 Ga0105248_10255980 3300009177 Bacteria 1971
315 Ga0105248_10260315 3300009177 Bacteria 1953
316 Ga0105248_10308733 3300009177 Bacteria 1781
317 Ga0105248_10953022 3300009177 Bacteria 969
318 Ga0105248_10976760 3300009177 Bacteria 957
319 Ga0105248_11060467 3300009177 Bacteria 916
320 Ga0105237_10012582 3300009545 Bacteria 8913
321 Ga0105237_10103288 3300009545 Bacteria 2842
322 Ga0105237_10301022 3300009545 Bacteria 1607
323 Ga0105238_10051981 3300009551 Bacteria 4120
324 Ga0105238_10703193 3300009551 Bacteria 1023
325 Ga0105238_10816940 3300009551 Bacteria 948
326 Ga0105249_10017191 3300009553 Bacteria 6421
327 Ga0105249_10074559 3300009553 Bacteria 3141
328 Ga0105249_10151591 3300009553 Bacteria 2232
329 Ga0105249_10448045 3300009553 Bacteria 1329
330 Ga0105249_12195628 3300009553 Bacteria 625
331 Ga0105239_10112014 3300010375 Bacteria 3025
332 Ga0105239_10184765 3300010375 Bacteria 2333
333 Ga0105239_10274282 3300010375 Bacteria 1897
334 Ga0105239_10871991 3300010375 Bacteria 1033
335 Ga0105239_11115494 3300010375 Bacteria 908
336 Ga0105246_10028020 3300011119 Bacteria 3697
337 Ga0105246_10355605 3300011119 Bacteria 1202
338 Ga0157321_1006151 3300012487 Bacteria 809
339 Ga0157315_1036803 3300012508 Bacteria 602
340 Ga0157373_10358881 3300013100 Bacteria 1040
341 Ga0157371_10024191 3300013102 Bacteria 4437
342 Ga0157371_10286593 3300013102 Bacteria 1190
343 Ga0157370_10132643 3300013104 Bacteria 2323
344 Ga0157370_10221046 3300013104 Bacteria 1754
345 Ga0157370_10429723 3300013104 Bacteria 1215
346 Ga0157369_10036614 3300013105 Bacteria 5374
347 Ga0157369_10103501 3300013105 Bacteria 3033
348 Ga0157369_10299713 3300013105 Bacteria 1672
349 Ga0157374_10033819 3300013296 Bacteria 4666
350 Ga0157374_10257341 3300013296 Bacteria 1719
351 Ga0157374_10506826 3300013296 Bacteria 1212
352 Ga0157374_10524326 3300013296 Bacteria 1191
353 Ga0157374_10608031 3300013296 Bacteria 1103
354 Ga0157374_11310561 3300013296 Bacteria 746
355 Ga0157378_10189630 3300013297 Bacteria 1938
356 Ga0157378_10262866 3300013297 Bacteria 1657
357 Ga0157378_10462638 3300013297 Bacteria 1261
358 Ga0157378_10711382 3300013297 Bacteria 1025
359 Ga0157378_11199945 3300013297 Bacteria 798
360 Ga0157378_12199422 3300013297 Bacteria 603
361 Ga0163162_10008673 3300013306 Bacteria 9893
362 Ga0163162_10194337 3300013306 Bacteria 2157
363 Ga0163162_11197628 3300013306 Bacteria 862
364 Ga0157372_10215211 3300013307 Bacteria 2227
365 Ga0157372_10484893 3300013307 Bacteria 1441
366 Ga0157372_10626408 3300013307 Bacteria 1253
367 Ga0157375_10067415 3300013308 Bacteria 3576
368 Ga0157375_10158968 3300013308 Bacteria 2401
369 Ga0157375_10191137 3300013308 Bacteria 2202
370 Ga0157375_10283425 3300013308 Bacteria 1820
371 Ga0157375_10621839 3300013308 Bacteria 1238
372 Ga0157375_10919780 3300013308 Bacteria 1018
373 Ga0157375_10936158 3300013308 Bacteria 1009
374 Ga0157375_11053466 3300013308 Bacteria 951
375 Ga0163163_10005387 3300014325 Bacteria 11059
376 Ga0163163_11009463 3300014325 Bacteria 895
377 Ga0163163_11506636 3300014325 Bacteria 734
378 Ga0163163_11542704 3300014325 Bacteria 725
379 Ga0157380_10074297 3300014326 Bacteria 2759
380 Ga0157380_10125794 3300014326 Bacteria 2179
381 Ga0157380_10354765 3300014326 Bacteria 1374
382 Ga0157380_10728033 3300014326 Bacteria 1000
383 Ga0157380_10758657 3300014326 Bacteria 982
384 Ga0157380_10914351 3300014326 Bacteria 905
385 Ga0157377_10000047 3300014745 Bacteria 94451
386 Ga0157377_10011405 3300014745 Bacteria 4435
387 Ga0157377_10351504 3300014745 Bacteria 989
388 Ga0157377_10357324 3300014745 Bacteria 982
389 Ga0157379_10011806 3300014968 Bacteria 7630
390 Ga0157379_10034555 3300014968 Bacteria 4508
391 Ga0157379_10071709 3300014968 Bacteria 3098
392 Ga0157379_10071851 3300014968 Bacteria 3096
393 Ga0157379_10091280 3300014968 Bacteria 2732
394 Ga0157379_10362900 3300014968 Bacteria 1328
395 Ga0157379_10620065 3300014968 Bacteria 1011
396 Ga0157376_10041684 3300014969 Bacteria 3760
397 Ga0157376_10209982 3300014969 Bacteria 1797
398 Ga0157376_10354490 3300014969 Bacteria 1405
399 Ga0157376_10544754 3300014969 Bacteria 1147
400 Ga0157376_10809413 3300014969 Bacteria 950
401 Ga0182007_10110689 3300015262 Bacteria 914
402 Ga0182005_1014456 3300015265 Bacteria 2208
403 Ga0163161_10060591 3300017792 Bacteria 2755
404 Ga0163161_10091950 3300017792 Bacteria 2246
405 Ga0163161_10217096 3300017792 Bacteria 1480
406 Ga0163161_10599310 3300017792 Bacteria 908
407 Ga0209674_100024 3300025226 Bacteria 535481
408 Ga0209672_109938 3300025228 Bacteria 1311
409 Ga0209563_100069 3300025230 Bacteria 253154
410 Ga0207427_100214 3300025231 Bacteria 51319
411 Ga0209258_100071 3300025242 Bacteria 278319
412 Ga0209258_100652 3300025242 Bacteria 25431
413 Ga0207425_1003582 3300025245 Bacteria 4921
414 Ga0209646_1000012 3300025246 Bacteria 573300
415 Ga0209026_1000004 3300025250 Bacteria 949012
416 Ga0209677_100092 3300025253 Bacteria 102482
417 Ga0209677_100983 3300025253 Bacteria 13758
418 Ga0209759_1000003 3300025256 Bacteria 792130
419 Ga0209759_1000936 3300025256 Bacteria 21031
420 Ga0209759_1001809 3300025256 Bacteria 10802
421 Ga0209759_1046825 3300025256 Bacteria 696
422 Ga0209129_1000207 3300025258 Bacteria 68885
423 Ga0209565_1028340 3300025263 Bacteria 1107
424 Ga0209455_1000030 3300025272 Bacteria 533479
425 Ga0209564_1000196 3300025295 Bacteria 141368
426 Ga0209758_1000181 3300025297 Bacteria 140847
427 Ga0209758_1000439 3300025297 Bacteria 69980
428 Ga0209256_1022066 3300025299 Bacteria 1937
429 Ga0209257_1029746 3300025304 Bacteria 1774
430 Ga0207656_10073535 3300025321 Bacteria 1524
431 Ga0207656_10129777 3300025321 Bacteria 1180
432 Ga0207656_10190016 3300025321 Bacteria 988
433 Ga0207656_10192093 3300025321 Bacteria 983
434 Ga0207656_10214885 3300025321 Bacteria 933
435 Ga0207656_10224229 3300025321 Bacteria 914
436 Ga0207656_10423024 3300025321 Bacteria 671
437 Ga0207682_10019295 3300025893 Bacteria 2669
438 Ga0207682_10032489 3300025893 Bacteria 2098
439 Ga0207682_10069168 3300025893 Bacteria 1493
440 Ga0207682_10140069 3300025893 Bacteria 1085
441 Ga0207682_10166323 3300025893 Bacteria 1002
442 Ga0207642_10038048 3300025899 Bacteria 2078
443 Ga0207642_10059741 3300025899 Bacteria 1764
444 Ga0207688_10016680 3300025901 Bacteria 3987
445 Ga0207680_10013409 3300025903 Bacteria 4209
446 Ga0207680_10428312 3300025903 Bacteria 937
447 Ga0207680_10434991 3300025903 Bacteria 930
448 Ga0207680_10516971 3300025903 Bacteria 851
449 Ga0207685_10146507 3300025905 Bacteria 1064
450 Ga0207645_10009997 3300025907 Bacteria 6534
451 Ga0207645_10074943 3300025907 Bacteria 2166
452 Ga0207645_10107755 3300025907 Bacteria 1802
453 Ga0207645_10164752 3300025907 Bacteria 1451
454 Ga0207645_10529469 3300025907 Bacteria 799
455 Ga0207643_10030578 3300025908 Bacteria 2998
456 Ga0207643_10149796 3300025908 Bacteria 1398
457 Ga0207705_10089346 3300025909 Bacteria 2255
458 Ga0207705_10206434 3300025909 Bacteria 1489
459 Ga0207705_10566285 3300025909 Bacteria 883
460 Ga0207705_10575144 3300025909 Bacteria 876
461 Ga0207705_10917329 3300025909 Bacteria 678
462 Ga0207684_10023382 3300025910 Bacteria 5277
463 Ga0207707_10233207 3300025912 Bacteria 1601
464 Ga0207695_10004982 3300025913 Bacteria 17873
465 Ga0207695_10503265 3300025913 Bacteria 1093
466 Ga0207695_10620883 3300025913 Bacteria 962
467 Ga0207695_11400574 3300025913 Bacteria 579
468 Ga0207671_10212137 3300025914 Bacteria 1515
469 Ga0207671_10379831 3300025914 Bacteria 1122
470 Ga0207671_11148498 3300025914 Bacteria 609
471 Ga0207660_10111964 3300025917 Bacteria 2055
472 Ga0207662_10139244 3300025918 Bacteria 1536
473 Ga0207657_10040663 3300025919 Bacteria 4118
474 Ga0207657_10108323 3300025919 Bacteria 2297
475 Ga0207657_10132442 3300025919 Bacteria 2043
476 Ga0207657_10219622 3300025919 Bacteria 1523
477 Ga0207657_10244588 3300025919 Bacteria 1431
478 Ga0207657_10361464 3300025919 Bacteria 1144
479 Ga0207657_10363102 3300025919 Bacteria 1141
480 Ga0207649_10085952 3300025920 Bacteria 2048
481 Ga0207649_10257724 3300025920 Bacteria 1259
482 Ga0207649_10281552 3300025920 Bacteria 1209
483 Ga0207649_10344527 3300025920 Bacteria 1101
484 Ga0207652_10717790 3300025921 Bacteria 891
485 Ga0207681_10029178 3300025923 Bacteria 3579
486 Ga0207681_10067663 3300025923 Bacteria 2477
487 Ga0207681_10345710 3300025923 Bacteria 1189
488 Ga0207681_10366814 3300025923 Bacteria 1156
489 Ga0207681_10737808 3300025923 Bacteria 820
490 Ga0207694_10026064 3300025924 Bacteria 4445
491 Ga0207694_10075212 3300025924 Bacteria 2644
492 Ga0207694_10120861 3300025924 Bacteria 2091
493 Ga0207694_10573485 3300025924 Bacteria 948
494 Ga0207694_10811924 3300025924 Bacteria 790
495 Ga0207694_10865248 3300025924 Bacteria 764
496 Ga0207694_10909933 3300025924 Bacteria 744
497 Ga0207650_10004478 3300025925 Bacteria 9548
498 Ga0207650_10041366 3300025925 Bacteria 3376
499 Ga0207650_10071086 3300025925 Bacteria 2617
500 Ga0207650_10143807 3300025925 Bacteria 1877
501 Ga0207650_10214629 3300025925 Bacteria 1546
502 Ga0207650_10449402 3300025925 Bacteria 1072
503 Ga0207650_10550675 3300025925 Bacteria 967
504 Ga0207659_10000367 3300025926 Bacteria 27090
505 Ga0207659_10009099 3300025926 Bacteria 6198
506 Ga0207659_10028725 3300025926 Bacteria 3782
507 Ga0207659_10210115 3300025926 Bacteria 1559
508 Ga0207687_10013633 3300025927 Bacteria 5306
509 Ga0207687_10035555 3300025927 Bacteria 3389
510 Ga0207644_10001041 3300025931 Bacteria 17787
511 Ga0207644_10088680 3300025931 Bacteria 2301
512 Ga0207644_10208953 3300025931 Bacteria 1542
513 Ga0207644_10361205 3300025931 Bacteria 1181
514 Ga0207644_10372483 3300025931 Bacteria 1163
515 Ga0207690_10299799 3300025932 Bacteria 1257
516 Ga0207690_11078469 3300025932 Bacteria 669
517 Ga0207706_10001471 3300025933 Bacteria 23541
518 Ga0207706_10017114 3300025933 Bacteria 6537
519 Ga0207706_10023744 3300025933 Bacteria 5502
520 Ga0207706_10058921 3300025933 Bacteria 3382
521 Ga0207706_10070300 3300025933 Bacteria 3079
522 Ga0207706_10425964 3300025933 Bacteria 1149
523 Ga0207706_10718824 3300025933 Bacteria 852
524 Ga0207706_10798732 3300025933 Bacteria 802
525 Ga0207686_10009639 3300025934 Bacteria 5243
526 Ga0207686_10039436 3300025934 Bacteria 2866
527 Ga0207686_10094170 3300025934 Bacteria 1985
528 Ga0207709_10003154 3300025935 Bacteria 9904
529 Ga0207709_10103689 3300025935 Bacteria 1886
530 Ga0207709_10234315 3300025935 Bacteria 1332
531 Ga0207670_10004677 3300025936 Bacteria 7420
532 Ga0207670_10139142 3300025936 Bacteria 1788
533 Ga0207670_10236282 3300025936 Bacteria 1406
534 Ga0207669_10062389 3300025937 Bacteria 2295
535 Ga0207669_10633827 3300025937 Bacteria 872
536 Ga0207704_10056457 3300025938 Bacteria 2406
537 Ga0207704_10103007 3300025938 Bacteria 1908
538 Ga0207704_10466845 3300025938 Bacteria 1010
539 Ga0207665_10022549 3300025939 Bacteria 4143
540 Ga0207691_10002591 3300025940 Bacteria 17675
541 Ga0207691_10011521 3300025940 Bacteria 8486
542 Ga0207691_10014850 3300025940 Bacteria 7422
543 Ga0207691_10123660 3300025940 Bacteria 2290
544 Ga0207691_10124454 3300025940 Bacteria 2282
545 Ga0207691_10393343 3300025940 Bacteria 1182
546 Ga0207691_10568465 3300025940 Bacteria 961
547 Ga0207711_10020968 3300025941 Bacteria 5456
548 Ga0207711_10050386 3300025941 Bacteria 3564
549 Ga0207711_10135040 3300025941 Bacteria 2215
550 Ga0207711_10347056 3300025941 Bacteria 1374
551 Ga0207711_10688821 3300025941 Bacteria 953
552 Ga0207689_10000880 3300025942 Bacteria 28864
553 Ga0207689_10128123 3300025942 Bacteria 2088
554 Ga0207689_10187748 3300025942 Bacteria 1705
555 Ga0207689_10413046 3300025942 Bacteria 1126
556 Ga0207689_10537183 3300025942 Bacteria 981
557 Ga0207679_10610685 3300025945 Bacteria 984
558 Ga0207679_10992428 3300025945 Bacteria 769
559 Ga0207679_11529231 3300025945 Bacteria 612
560 Ga0207667_10007780 3300025949 Bacteria 12814
561 Ga0207667_10343779 3300025949 Bacteria 1522
562 Ga0207667_10854889 3300025949 Bacteria 904
563 Ga0207667_10861745 3300025949 Bacteria 900
564 Ga0207667_11555316 3300025949 Bacteria 631
565 Ga0207651_10000217 3300025960 Bacteria 24753
566 Ga0207651_10002599 3300025960 Bacteria 8636
567 Ga0207651_10011732 3300025960 Bacteria 4918
568 Ga0207651_10149779 3300025960 Bacteria 1814
569 Ga0207651_10174528 3300025960 Bacteria 1698
570 Ga0207651_10282201 3300025960 Bacteria 1373
571 Ga0207651_10455654 3300025960 Bacteria 1098
572 Ga0207712_10035188 3300025961 Bacteria 3400
573 Ga0207712_10086158 3300025961 Bacteria 2301
574 Ga0207668_10147817 3300025972 Bacteria 1815
575 Ga0207668_10160027 3300025972 Bacteria 1753
576 Ga0207668_10581994 3300025972 Bacteria 973
577 Ga0207640_10043424 3300025981 Bacteria 2873
578 Ga0207640_10049240 3300025981 Bacteria 2727
579 Ga0207640_10116347 3300025981 Bacteria 1906
580 Ga0207640_10382895 3300025981 Bacteria 1140
581 Ga0207640_11157656 3300025981 Bacteria 686
582 Ga0207640_11508270 3300025981 Bacteria 604
583 Ga0207658_10001015 3300025986 Bacteria 22905
584 Ga0207658_10001513 3300025986 Bacteria 18067
585 Ga0207658_10014621 3300025986 Bacteria 5376
586 Ga0207658_10111151 3300025986 Bacteria 2167
587 Ga0207658_10188113 3300025986 Bacteria 1714
588 Ga0207658_10646690 3300025986 Bacteria 953
589 Ga0207677_10012140 3300026023 Bacteria 4939
590 Ga0207677_10177378 3300026023 Bacteria 1673
591 Ga0207677_10230096 3300026023 Bacteria 1493
592 Ga0207677_10497403 3300026023 Bacteria 1053
593 Ga0207677_11954857 3300026023 Bacteria 545
594 Ga0207703_10001393 3300026035 Bacteria 22069
595 Ga0207703_10035128 3300026035 Bacteria 3983
596 Ga0207703_10163141 3300026035 Bacteria 1953
597 Ga0207639_10084007 3300026041 Bacteria 2528
598 Ga0207639_10341913 3300026041 Bacteria 1334
599 Ga0207639_10393069 3300026041 Bacteria 1248
600 Ga0207639_10473707 3300026041 Bacteria 1140
601 Ga0207639_10544582 3300026041 Bacteria 1065
602 Ga0207639_10814499 3300026041 Bacteria 870
603 Ga0207639_11155887 3300026041 Bacteria 726
604 Ga0207678_10035137 3300026067 Bacteria 4364
605 Ga0207678_10318233 3300026067 Bacteria 1338
606 Ga0207678_10651680 3300026067 Bacteria 925
607 Ga0207678_11177898 3300026067 Bacteria 679
608 Ga0207708_10005539 3300026075 Bacteria 9316
609 Ga0207702_10000189 3300026078 Bacteria 74204
610 Ga0207702_10086551 3300026078 Bacteria 2733
611 Ga0207702_10164140 3300026078 Bacteria 2030
612 Ga0207702_10598518 3300026078 Bacteria 1082
613 Ga0207641_10014014 3300026088 Bacteria 6572
614 Ga0207641_10079342 3300026088 Bacteria 2845
615 Ga0207641_10286031 3300026088 Bacteria 1552
616 Ga0207641_10387489 3300026088 Bacteria 1340
617 Ga0207641_10400021 3300026088 Bacteria 1318
618 Ga0207641_11024860 3300026088 Bacteria 822
619 Ga0207648_10000019 3300026089 Bacteria 144209
620 Ga0207648_10001067 3300026089 Bacteria 30723
621 Ga0207648_10025212 3300026089 Bacteria 5300
622 Ga0207648_10106072 3300026089 Bacteria 2465
623 Ga0207648_10116312 3300026089 Bacteria 2350
624 Ga0207648_10147062 3300026089 Bacteria 2079
625 Ga0207648_10235585 3300026089 Bacteria 1629
626 Ga0207648_10572395 3300026089 Bacteria 1039
627 Ga0207648_10642661 3300026089 Bacteria 980
628 Ga0207648_11122011 3300026089 Bacteria 738
629 Ga0207676_10030206 3300026095 Bacteria 4065
630 Ga0207676_10066767 3300026095 Bacteria 2870
631 Ga0207676_10099092 3300026095 Bacteria 2411
632 Ga0207676_10197821 3300026095 Bacteria 1773
633 Ga0207676_10292225 3300026095 Bacteria 1484
634 Ga0207676_11049013 3300026095 Bacteria 804
635 Ga0207674_10029107 3300026116 Bacteria 5822
636 Ga0207674_10050227 3300026116 Bacteria 4262
637 Ga0207674_10102817 3300026116 Bacteria 2837
638 Ga0207674_10184514 3300026116 Bacteria 2037
639 Ga0207675_100000393 3300026118 Bacteria 41975
640 Ga0207675_100000697 3300026118 Bacteria 33220
641 Ga0207675_100039782 3300026118 Bacteria 4388
642 Ga0207675_100066086 3300026118 Bacteria 3379
643 Ga0207675_100354320 3300026118 Bacteria 1439
644 Ga0207675_101361119 3300026118 Bacteria 730
645 Ga0207683_10086018 3300026121 Bacteria 2795
646 Ga0207683_10155761 3300026121 Bacteria 2063
647 Ga0207683_10168177 3300026121 Bacteria 1985
648 Ga0207698_10026138 3300026142 Bacteria 4126
649 Ga0207698_10105795 3300026142 Bacteria 2345
650 Ga0207698_10129795 3300026142 Bacteria 2151
651 Ga0207698_10402586 3300026142 Bacteria 1308
652 Ga0207698_10413766 3300026142 Bacteria 1292
653 Ga0207698_10489750 3300026142 Bacteria 1194
654 Ga0207698_10609833 3300026142 Bacteria 1077
655 Ga0207698_10770314 3300026142 Bacteria 962
656 Ga0207698_11149511 3300026142 Bacteria 790
657 Ga0207698_11174053 3300026142 Bacteria 781
658 Ga0209813_10210918 3300027866 Bacteria 723
659 Ga0268266_10188812 3300028379 Bacteria 1880
660 Ga0268265_10116674 3300028380 Bacteria 2191
661 Ga0268265_10971330 3300028380 Bacteria 838
662 Ga0268265_11729053 3300028380 Bacteria 631
663 Ga0268264_10063195 3300028381 Bacteria 3111
664 Ga0268264_10096604 3300028381 Bacteria 2559
665 Ga0268264_10187934 3300028381 Bacteria 1881
666 Ga0268264_11215432 3300028381 Bacteria 763
667 Ga0307517_10020975 3300028786 Bacteria 8286
668 Ga0307517_10151756 3300028786 Bacteria 1587
669 Ga0307517_10204030 3300028786 Bacteria 1230
670 Ga0307515_10000037 3300028794 Bacteria 331970
671 Ga0307515_10021577 3300028794 Bacteria 11408
672 Ga0307515_10031624 3300028794 Bacteria 8813
673 Ga0307515_10034932 3300028794 Bacteria 8202
674 Ga0265324_10053862 3300029957 Bacteria 1381
675 Ga0307511_10181607 3300030521 Bacteria 1132
676 Ga0265328_10013144 3300031239 Bacteria 3282
677 Ga0265327_10000147 3300031251 Bacteria 153254
678 Ga0307513_10213284 3300031456 Bacteria 1760
679 Ga0307513_10353107 3300031456 Bacteria 1217
680 Ga0307509_10100047 3300031507 Bacteria 2939
681 Ga0307509_10177669 3300031507 Bacteria 1999
682 Ga0307509_10397189 3300031507 Bacteria 1087
683 Ga0307408_100060061 3300031548 Bacteria 2770
684 Ga0307408_100210781 3300031548 Bacteria 1579
685 Ga0307508_10005978 3300031616 Bacteria 11479
686 Ga0307508_10341533 3300031616 Bacteria 1089
687 Ga0307516_10000065 3300031730 Bacteria 113187
688 Ga0307516_10001232 3300031730 Bacteria 35633
689 Ga0307516_10180157 3300031730 Bacteria 1847
690 Ga0307516_10229395 3300031730 Bacteria 1561
691 Ga0307516_10247866 3300031730 Bacteria 1477
692 Ga0307516_10558223 3300031730 Bacteria 799
693 Ga0307405_10050723 3300031731 Bacteria 2571
694 Ga0307405_10224682 3300031731 Bacteria 1380
695 Ga0307412_11025762 3300031911 Bacteria 730
696 Ga0307409_100073222 3300031995 Bacteria 2731
697 Ga0307409_100380310 3300031995 Bacteria 1342
698 Ga0307416_100023885 3300032002 Bacteria 4448
699 Ga0307416_100556886 3300032002 Bacteria 1221
700 Ga0307416_100610733 3300032002 Bacteria 1171
701 Ga0307510_10310858 3300033180 Bacteria 1035
702 Ga0373938_0008171 3300034957 Bacteria 1862
703 Ga0373940_0055343 3300035088 Bacteria 1123
704 Ga0373944_0045150 3300035089 Bacteria 1374
705 Ga0373944_0045697 3300035089 Bacteria 1367
706 Ga0373936_0152391 3300035113 Bacteria 1003
707 Ga0373941_0111456 3300035115 Bacteria 965
708 Ga0373953_0417107 3300035117 Bacteria 592
709 Ga0373943_0319159 3300035170 Bacteria 885
710 Ga0373946_0079346 3300035171 Bacteria 1434
711 Ga0373961_0023850 3300035241 Bacteria 1650
712 Ga0373924_0030959 3300035410 Bacteria 2148
713 Ga0373931_0005507 3300035691 Bacteria 5865
714 Ga0373931_0644714 3300035691 Bacteria 696
715 Ga0373927_0742993 3300035695 Bacteria 648
716 Ga0373947_0132800 3300035725 Bacteria 1591
717 Ga0373937_0052987 3300036401 Bacteria 3721
718 Ga0373925_0012046 3300037068 Bacteria 6262
719 Ga0373925_0717064 3300037068 Bacteria 824
720 Ga0395899_0623127 3300037312 Bacteria 685
721 Ga0395900_0772483 3300037418 Bacteria 890
722 Ga0395898_0675143 3300037466 Bacteria 975
723 Ga0395905_0089589 3300037471 Bacteria 2883
724 Ga0395905_0502380 3300037471 Bacteria 1113
725 Ga0395901_0001122 3300038443 Bacteria 28429
726 Ga0436365_1374569 3300039437 Bacteria 4643
727 Ga0436360_0130247 3300039438 Bacteria 835
728 Ga0436361_0940585 3300039447 Bacteria 1177
729 Ga0451793_1350852 3300041452 Bacteria 2056
730 Ga0451795_1489369 3300041456 Bacteria 2298
731 Ga0451798_0138619 3300041458 Bacteria 2408
732 Ga0451800_0442965 3300041459 Bacteria 1551
733 Ga0451807_0427023 3300041486 Bacteria 698
734 Ga0451833_1117297 3300041491 Bacteria 750
735 Ga0451835_0819255 3300041492 Bacteria 847
736 Ga0451839_0795767 3300041496 Bacteria 712
737 Ga0451853_3143231 3300041512 Bacteria 1033
738 Ga0451853_3344363 3300041512 Bacteria 1575
739 Ga0439437_009122 3300042000 Bacteria 1123
740 Ga0439459_0142464 3300042438 Bacteria 621
741 Ga0439464_0001396 3300042439 Bacteria 5670
742 Ga0439460_0007883 3300042461 Bacteria 2676
743 Ga0450893_0097480 3300042532 Bacteria 596
744 Ga0451577_0301642 3300042876 Bacteria 1451
745 Ga0466969_0020677 3300044656 Bacteria 3406
746 Ga0466969_0065184 3300044656 Bacteria 1761
747 Ga0466972_0000793 3300044658 Bacteria 15003
748 Ga0453683_0197066 3300044673 Bacteria 1279
749 Ga0453683_0659540 3300044673 Bacteria 684
750 Ga0466965_0161141 3300044683 Bacteria 1176
751 Ga0466966_0023137 3300044684 Bacteria 4069
752 Ga0466961_0006782 3300044693 Bacteria 7288
753 Ga0466963_0029018 3300044694 Bacteria 3557
754 Ga0466964_0002088 3300044706 Bacteria 7028
755 Ga0453684_0265282 3300044712 Bacteria 1965
756 Ga0466971_0018706 3300044719 Bacteria 3071
757 Ga0466970_0080644 3300044765 Bacteria 1758
758 Ga0466959_0000395 3300045049 Bacteria 25570
759 Ga0466959_0133070 3300045049 Bacteria 1761
760 Ga0451576_0400391 3300045051 Bacteria 1439
761 Ga0466958_0055289 3300045836 Bacteria 2408
762 Ga0466967_0026999 3300045976 Bacteria 4767
763 Ga0495629_0304239 3300046459 Bacteria 1092
764 Ga0495629_0353703 3300046459 Bacteria 1002
765 Ga0495638_0059347 3300046460 Bacteria 2369
766 Ga0495638_0259640 3300046460 Bacteria 953
767 Ga0495638_0489617 3300046460 Bacteria 621
768 Ga0495605_0049103 3300046474 Bacteria 2063
769 Ga0495639_0050159 3300046475 Bacteria 1895
770 Ga0495639_0262900 3300046475 Bacteria 855
771 Ga0495639_0509686 3300046475 Bacteria 615
772 Ga0495583_0000018 3300046506 Bacteria 306541
773 Ga0495583_0156078 3300046506 Bacteria 944
774 Ga0495606_0000615 3300046507 Bacteria 56055
775 Ga0495606_0218984 3300046507 Bacteria 1074
776 Ga0495616_0120351 3300046513 Bacteria 1213
777 Ga0495620_0037445 3300046515 Bacteria 2161
778 Ga0495620_0065520 3300046515 Bacteria 1499
779 Ga0495630_0494303 3300046517 Bacteria 938
780 Ga0495632_0002141 3300046519 Bacteria 15327
781 Ga0495632_0017016 3300046519 Bacteria 4026
782 Ga0495632_0027056 3300046519 Bacteria 3009
783 Ga0495642_0041617 3300046528 Bacteria 1869
784 Ga0495587_0191523 3300046536 Bacteria 1158
785 Ga0495598_0026188 3300046537 Bacteria 1597
786 Ga0495598_0057957 3300046537 Bacteria 1187
787 Ga0495609_0120001 3300046538 Bacteria 1131
788 Ga0495621_0214229 3300046539 Bacteria 778
789 Ga0495645_0221499 3300046543 Bacteria 1272
790 Ga0495668_0010316 3300046616 Bacteria 5660
791 Ga0495668_0077484 3300046616 Bacteria 1825
792 Ga0495634_0284228 3300046642 Bacteria 1004
793 Ga0495625_0004691 3300046660 Bacteria 12815
794 Ga0495625_0026499 3300046660 Bacteria 4381
795 Ga0495635_0156006 3300046663 Bacteria 1554
796 Ga0495599_0192577 3300046678 Bacteria 1254
797 Ga0495623_0445707 3300046679 Bacteria 690
798 Ga0495647_0233191 3300046681 Bacteria 815
799 Ga0495658_0160644 3300046683 Bacteria 1385
800 Ga0495658_0666322 3300046683 Bacteria 666
801 Ga0495669_0159344 3300046684 Bacteria 1071
802 Ga0495624_0010618 3300046690 Bacteria 6343
803 Ga0495670_0224337 3300046691 Bacteria 999
804 Ga0495671_0036257 3300046692 Bacteria 2499
805 Ga0495671_0147154 3300046692 Bacteria 1147
806 Ga0495671_0430959 3300046692 Bacteria 631
807 Ga0495649_0000051 3300046694 Bacteria 109180
808 Ga0495649_0008591 3300046694 Bacteria 6133
809 Ga0495589_0324112 3300046794 Bacteria 712
810 Ga0495600_0773439 3300046809 Bacteria 573
811 Ga0495660_0065014 3300046810 Bacteria 1948
812 Ga0495676_0072727 3300047321 Bacteria 2639
813 Ga0495680_0202677 3300047322 Bacteria 1423
814 Ga0495683_0049114 3300047323 Bacteria 2114
815 Ga0495687_000364 3300047443 Bacteria 56454
816 Ga0495687_024357 3300047443 Bacteria 2877
817 Ga0495679_090828 3300047446 Bacteria 857
818 Ga0495684_0088561 3300047471 Bacteria 2346
819 Ga0495686_0069963 3300047472 Bacteria 2162
820 Ga0495686_0079269 3300047472 Bacteria 2008
821 Ga0495593_0018830 3300047673 Bacteria 3876
822 Ga0495602_0137474 3300048088 Bacteria 1939
823 Ga0495602_0465586 3300048088 Bacteria 890
824 Ga0495614_0082113 3300048089 Bacteria 1397
825 Ga0495626_0219924 3300048091 Bacteria 772
826 Ga0496100_0148594 3300048903 Bacteria 1669
827 Ga0496100_0433268 3300048903 Bacteria 1006
828 Ga0496100_0747373 3300048903 Bacteria 765
829 Ga0496101_0071632 3300048904 Bacteria 2541
830 Ga0496101_0275663 3300048904 Bacteria 1314
831 Ga0496102_0009647 3300048905 Bacteria 8303
832 Ga0496102_0161858 3300048905 Bacteria 2105
833 Ga0496104_0218441 3300048907 Bacteria 1818
834 Ga0496104_0717666 3300048907 Bacteria 907
835 Ga0496105_0038849 3300048908 Bacteria 3922
836 Ga0496106_0053790 3300048909 Bacteria 3041
837 Ga0496106_0653782 3300048909 Bacteria 840
838 Ga0496107_0075831 3300048910 Bacteria 2448
839 Ga0496108_0068081 3300048911 Bacteria 3003
840 Ga0496108_0514318 3300048911 Bacteria 1045
841 Ga0496108_0627424 3300048911 Bacteria 935
842 Ga0496109_0113935 3300048912 Bacteria 2515
843 Ga0496109_0530710 3300048912 Bacteria 1111
844 Ga0496109_0694832 3300048912 Bacteria 955
845 Ga0496110_0067900 3300048913 Bacteria 3155
846 Ga0496111_0035798 3300048914 Bacteria 3549
847 Ga0496112_0381015 3300048915 Bacteria 1351
848 Ga0496113_0088346 3300048916 Bacteria 2384
849 Ga0496113_0299557 3300048916 Bacteria 1287
850 Ga0496114_0093654 3300048917 Bacteria 2554
851 Ga0496114_0152482 3300048917 Bacteria 2005
852 Ga0496114_0498453 3300048917 Bacteria 1077
853 Ga0496115_0069754 3300048918 Bacteria 2848
854 Ga0501292_004818 3300049515 Bacteria 1862
855 Ga0501294_002733 3300049517 Bacteria 1670
856 Ga0501248_001686 3300049678 Bacteria 1431
857 Ga0501035_0176493 3300049822 Bacteria 1843
858 nmdc:mga03683_32909_c1 3300050489 Bacteria 2088
859 nmdc:mga03n38_112295_c1 3300050490 Bacteria 1329
860 nmdc:mga03n38_258842_c1 3300050490 Bacteria 922
861 nmdc:mga00v17_100963_c1 3300050491 Bacteria 1821
862 nmdc:mga0yw44_114311_c1 3300050492 Bacteria 1732
863 nmdc:mga0yw44_616854_c1 3300050492 Bacteria 737
864 nmdc:mga0k408_10855_c1 3300050493 Bacteria 4940
865 nmdc:mga0k408_19006_c1 3300050493 Bacteria 3836
866 nmdc:mga0k408_20258_c1 3300050493 Bacteria 3725
867 nmdc:mga0k408_25325_c1 3300050493 Bacteria 3360
868 nmdc:mga0k408_296126_c1 3300050493 Bacteria 966
869 nmdc:mga0k408_305390_c1 3300050493 Bacteria 950
870 nmdc:mga0k408_468768_c1 3300050493 Bacteria 747
871 nmdc:mga06z11_310047_c1 3300050494 Bacteria 940
872 nmdc:mga06z11_59212_c1 3300050494 Bacteria 1990
873 nmdc:mga04h51_218153_c1 3300050495 Bacteria 755
874 nmdc:mga07m45_126363_c1 3300050496 Bacteria 1479
875 nmdc:mga07m45_1817_c1 3300050496 Bacteria 9840
876 nmdc:mga07m45_2560_c1 3300050496 Bacteria 8554
877 nmdc:mga07m45_30715_c1 3300050496 Bacteria 2977
878 nmdc:mga07m45_45383_c1 3300050496 Bacteria 2468
879 nmdc:mga07m45_972_c1 3300050496 Bacteria 8487
880 nmdc:mga0qj67_248117_c1 3300050509 Bacteria 1444
881 nmdc:mga08y16_260402_c1 3300050511 Bacteria 1791
882 nmdc:mga0n895_258253_c1 3300050512 Bacteria 1768
883 nmdc:mga0rr50_147281_c1 3300050513 Bacteria 1899
884 nmdc:mga0sz30_46137_c1 3300050516 Bacteria 1839
885 nmdc:mga0sz30_90963_c1 3300050516 Bacteria 1328
886 Ga0495601_0365722 3300053077 Bacteria 937
887 Ga0495612_0335898 3300053078 Bacteria 681
888 Ga0500635_0010754 3300053080 Bacteria 2581
889 Ga0495619_0120347 3300053085 Bacteria 1800
890 Ga0500578_0230603 3300053086 Bacteria 1122
891 Ga0500644_0032229 3300053088 Bacteria 1673
892 Ga0500583_0006471 3300053092 Bacteria 4036
893 Ga0500583_0058260 3300053092 Bacteria 1816
894 Ga0500651_0054860 3300053093 Bacteria 2496
895 Ga0500641_0187807 3300053096 Bacteria 886
896 Ga0500650_0112854 3300053098 Bacteria 1268
897 Ga0500556_0260397 3300053104 Bacteria 682
898 Ga0500557_047647 3300053105 Bacteria 1365
899 Ga0500569_005455 3300053109 Bacteria 2733
900 Ga0500593_000112 3300053117 Bacteria 31359
901 Ga0500594_0056567 3300053118 Bacteria 1119
902 Ga0500623_047586 3300053127 Bacteria 2172
903 Ga0500628_001828 3300053129 Bacteria 3591
904 Ga0500642_0009974 3300053130 Bacteria 3327
905 Ga0500652_000197 3300053131 Bacteria 23298
906 Ga0500655_001493 3300053133 Bacteria 4425
907 Ga0500658_0009691 3300053134 Bacteria 3552
908 Ga0500568_0188848 3300053139 Bacteria 756
909 Ga0500577_0028735 3300053142 Bacteria 1918
910 Ga0500579_138216 3300053143 Bacteria 1111
911 Ga0500588_0041010 3300053146 Bacteria 1395
912 Ga0500604_0017917 3300053151 Bacteria 1967
913 Ga0500604_0021091 3300053151 Bacteria 1839
914 Ga0500619_000063 3300053154 Bacteria 32493
915 Ga0500622_0000818 3300053156 Bacteria 26610
916 Ga0500636_0007754 3300053177 Bacteria 6207
917 Ga0500661_005972 3300055283 Bacteria 2271
918 Ga0590071_004268 3300059421 Bacteria 3476
919 Ga0590074_011351 3300059423 Bacteria 1493
920 Ga0587083_0019017 3300059505 Bacteria 1250
921 Ga0587076_019017 3300059645 Bacteria 1113
922 Ga0466962_0015457 3300061719 Bacteria 3679
923 2587726895 2585428057 Bacteria 6737412
924 2587732174 2585428058 Bacteria 6853932
925 2588291263 2588253510 Bacteria 6901809
926 Ga0070663_100617302
927 JGI25156J39149_1000143
928 JGI25154J39366_1000882
929 JGI25157J39369_1000045
930 JGI25164J39214_1002615
931 JGI25152J39213_1006704
932 JGI25153J46596_10006298
933 JGI25153J46596_10012400
934 rootH1_10026938
935 rootH2_10135664
936 rootL2_10033230
937 Ga0055539_1000277
938 Ga0055539_1001230
939 Ga0055539_1003464
940 Ga0055533_1000026
941 Ga0055525_1000870
942 Ga0055535_1000056
943 Ga0055529_1000165
944 Ga0055526_1005584
945 Ga0065712_10035351
946 Ga0065715_10197896
947 Ga0065715_10238186
948 Ga0070658_10128741
949 Ga0070658_10271832
950 Ga0070658_10286247
951 Ga0070658_10439942
952 Ga0070658_10579753
953 Ga0070658_10805944
954 Ga0070676_10044160
955 Ga0070676_10050093
956 Ga0070676_10183013
957 Ga0070676_10189246
958 Ga0070676_10888932
959 Ga0070683_100018612
960 Ga0070683_100691777
961 Ga0070683_101049295
962 Ga0070683_101239957
963 Ga0070690_100023962
964 Ga0070690_100112963
965 Ga0070690_100138810
966 Ga0070670_100000506
967 Ga0070670_100111875
968 Ga0070670_100184729
969 Ga0070670_100259556
970 Ga0070670_100337967
971 Ga0070670_100634673
972 Ga0070670_100733333
973 Ga0070670_100912894
974 Ga0070670_101858861
975 Ga0070677_10024988
976 Ga0070677_10057198
977 Ga0070677_10062268
978 Ga0070677_10081761
979 Ga0070677_10092432
980 Ga0068869_100008613
981 Ga0068869_100009866
982 Ga0068869_100022179
983 Ga0068869_100566784
984 Ga0068869_100726562
985 Ga0070666_10131502
986 Ga0070666_10282663
987 Ga0070666_10365879
988 Ga0070680_100042120
989 Ga0068868_100214187
990 Ga0068868_100374013
991 Ga0068868_100488527
992 Ga0070660_100021141
993 Ga0070660_100238537
994 Ga0070660_100379087
995 Ga0070660_100441006
996 Ga0070660_100450571
997 Ga0070660_100513409
998 Ga0070689_100004125
999 Ga0070689_100281421
1000 Ga0070687_100065915
1001 Ga0070687_100315702
1002 Ga0070661_100045893
1003 Ga0070661_100063562
1004 Ga0070661_100151597
1005 Ga0070661_100323164
1006 Ga0070668_100102664
1007 Ga0070668_100159688
1008 Ga0070668_100188916
1009 Ga0070668_100559108
1010 Ga0070669_100029707
1011 Ga0070669_100054781
1012 Ga0070669_100125129
1013 Ga0070669_100145352
1014 Ga0070669_100335123
1015 Ga0070669_100374285
1016 Ga0070669_100410679
1017 Ga0070675_100001437
1018 Ga0070675_100002003
1019 Ga0070675_100022442
1020 Ga0070675_100076327
1021 Ga0070675_100285897
1022 Ga0070675_100623001
1023 Ga0070675_100678190
1024 Ga0070671_100025175
1025 Ga0070671_100047446
1026 Ga0070671_100056605
1027 Ga0070671_100099161
1028 Ga0070671_100129472
1029 Ga0070671_100141189
1030 Ga0070671_100166581
1031 Ga0070671_100407556
1032 Ga0070674_100080470
1033 Ga0070674_100092026
1034 Ga0070674_100258635
1035 Ga0070674_100506330
1036 Ga0070673_100001463
1037 Ga0070673_100002753
1038 Ga0070673_100023056
1039 Ga0070673_100134064
1040 Ga0070673_100135153
1041 Ga0070673_100135620
1042 Ga0070688_100322604
1043 Ga0070659_100103923
1044 Ga0070659_100107404
1045 Ga0070659_100112113
1046 Ga0070659_100141687
1047 Ga0070667_100013312
1048 Ga0070667_100017201
1049 Ga0070667_100020457
1050 Ga0070667_100083492
1051 Ga0070667_100164159
1052 Ga0070667_100703023
1053 Ga0070667_101050645
1054 Ga0070701_10028223
1055 Ga0070700_100113021
1056 Ga0070663_100065983
1057 Ga0070663_100096266
1058 Ga0070663_100183585
1059 Ga0070663_100221880
1060 Ga0070678_100058352
1061 Ga0070678_100072661
1062 Ga0070678_100272675
1063 Ga0070678_101204947
1064 Ga0070662_100004846
1065 Ga0070662_100056653
1066 Ga0070662_100059194
1067 Ga0070662_100076911
1068 Ga0070662_100080253
1069 Ga0070662_100366761
1070 Ga0070681_10256772
1071 Ga0068867_100000075
1072 Ga0068867_100002503
1073 Ga0068867_100019399
1074 Ga0068867_100199391
1075 Ga0068867_100215775
1076 Ga0068867_100422408
1077 Ga0068867_100672372
1078 Ga0068867_100928773
1079 Ga0070685_10007716
1080 Ga0070706_100009088
1081 Ga0070706_100173120
1082 Ga0070679_100036698
1083 Ga0070684_100046941
1084 Ga0070684_100179903
1085 Ga0070684_100777246
1086 Ga0068853_100108712
1087 Ga0068853_100187401
1088 Ga0068853_100241874
1089 Ga0068853_100335035
1090 Ga0068853_100485878
1091 Ga0068853_100529576
1092 Ga0070672_100040733
1093 Ga0070672_100231242
1094 Ga0070672_100466182
1095 Ga0070672_100746947
1096 Ga0070686_100066867
1097 Ga0070686_100613595
1098 Ga0070695_100179593
1099 Ga0070693_100045225
1100 Ga0070693_100077080
1101 Ga0070693_100105191
1102 Ga0070665_100022123
1103 Ga0070665_100346878
1104 Ga0068855_100004303
1105 Ga0068855_100217474
1106 Ga0068855_100519102
1107 Ga0068855_100687702
1108 Ga0070664_100119793
1109 Ga0070664_100673385
1110 Ga0070664_100842209
1111 Ga0070664_101131894
1112 Ga0068857_100003768
1113 Ga0068857_100098370
1114 Ga0068857_100497801
1115 Ga0068854_100002382
1116 Ga0068854_100021968
1117 Ga0068854_100154394
1118 Ga0068854_100158041
1119 Ga0068854_100445437
1120 Ga0068854_100469492
1121 Ga0068854_100694815
1122 Ga0068856_100000820
1123 Ga0068856_100027110
1124 Ga0068856_100117964
1125 Ga0070702_100248391
1126 Ga0070702_100386723
1127 Ga0068852_100042769
1128 Ga0068852_100049130
1129 Ga0068852_100138813
1130 Ga0068852_100148458
1131 Ga0068852_100149807
1132 Ga0068852_100161076
1133 Ga0068852_100304983
1134 Ga0068852_100646756
1135 Ga0068852_100703703
1136 Ga0068852_101210005
1137 Ga0068859_100002207
1138 Ga0068859_100236291
1139 Ga0068859_100666688
1140 Ga0068859_101016807
1141 Ga0068859_101309178
1142 Ga0068864_100005299
1143 Ga0068864_100026938
1144 Ga0068864_100158413
1145 Ga0068864_100164240
1146 Ga0068864_100458145
1147 Ga0068864_100551083
1148 Ga0068861_100009238
1149 Ga0068861_100040052
1150 Ga0068861_100233410
1151 Ga0068861_100758968
1152 Ga0068851_10025891
1153 Ga0068851_10035741
1154 Ga0068851_10115670
1155 Ga0068851_10131769
1156 Ga0068851_10145284
1157 Ga0068851_10490033
1158 Ga0068870_10413704
1159 Ga0068863_100003985
1160 Ga0068863_100029360
1161 Ga0068863_100038053
1162 Ga0068863_100510419
1163 Ga0068863_100599170
1164 Ga0068863_101421670
1165 Ga0068863_101454240
1166 Ga0068858_100002725
1167 Ga0068858_100053906
1168 Ga0068858_100090765
1169 Ga0068858_100137004
1170 Ga0068858_100658188
1171 Ga0068860_100002268
1172 Ga0068860_100106561
1173 Ga0068860_100115807
1174 Ga0068860_100145716
1175 Ga0068860_100344479
1176 Ga0068862_100006901
1177 Ga0081455_10078438
1178 Ga0075365_10165639
1179 Ga0075368_10064069
1180 Ga0075368_10188802
1181 Ga0075363_100135316
1182 Ga0075364_10481175
1183 Ga0075432_10127587
1184 Ga0070715_10058853
1185 Ga0075362_10029318
1186 Ga0075367_10114562
1187 Ga0075369_10045590
1188 Ga0075366_10066058
1189 Ga0075366_10491253
1190 Ga0097621_100018246
1191 Ga0097621_100038571
1192 Ga0097621_100222907
1193 Ga0097621_100257998
1194 Ga0097621_100652739
1195 Ga0075370_10001892
1196 Ga0075370_10023556
1197 Ga0075370_10531641
1198 Ga0068871_100072266
1199 Ga0068871_100138835
1200 Ga0068871_100153576
1201 Ga0068871_100230755
1202 Ga0068871_100306760
1203 Ga0075430_100205001
1204 Ga0075434_100238601
1205 Ga0075429_100708624
1206 Ga0068865_100052104
1207 Ga0068865_100079888
1208 Ga0068865_100279966
1209 Ga0068865_101330460
1210 Ga0075436_100279189
1211 Ga0097620_100002207
1212 Ga0097620_100236270
1213 Ga0097620_100666674
1214 Ga0097620_101016825
1215 Ga0097620_101309106
1216 Ga0075435_100168903
1217 Ga0105240_10140581
1218 Ga0105240_10206322
1219 Ga0105240_10228040
1220 Ga0105240_10564574
1221 Ga0105240_10840181
1222 Ga0105240_11050661
1223 Ga0111539_10560958
1224 Ga0111539_10605101
1225 Ga0105245_10131399
1226 Ga0105245_10300958
1227 Ga0105245_10885345
1228 Ga0105245_11310860
1229 Ga0105247_10317667
1230 Ga0105247_10393559
1231 Ga0105243_10002844
1232 Ga0105243_10119631
1233 Ga0105243_10234462
1234 Ga0105241_11026716
1235 Ga0105241_11316717
1236 Ga0105242_10225445
1237 Ga0105242_10491308
1238 Ga0105248_10160265
1239 Ga0105248_10255980
1240 Ga0105248_10260315
1241 Ga0105248_10308733
1242 Ga0105248_10953022
1243 Ga0105248_10976760
1244 Ga0105248_11060467
1245 Ga0105237_10012582
1246 Ga0105237_10103288
1247 Ga0105237_10301022
1248 Ga0105238_10051981
1249 Ga0105238_10703193
1250 Ga0105238_10816940
1251 Ga0105249_10017191
1252 Ga0105249_10074559
1253 Ga0105249_10151591
1254 Ga0105249_10448045
1255 Ga0105249_12195628
1256 Ga0105239_10112014
1257 Ga0105239_10184765
1258 Ga0105239_10274282
1259 Ga0105239_10871991
1260 Ga0105239_11115494
1261 Ga0105246_10028020
1262 Ga0105246_10355605
1263 Ga0157321_1006151
1264 Ga0157315_1036803
1265 Ga0157373_10358881
1266 Ga0157371_10024191
1267 Ga0157371_10286593
1268 Ga0157370_10132643
1269 Ga0157370_10221046
1270 Ga0157370_10429723
1271 Ga0157369_10036614
1272 Ga0157369_10103501
1273 Ga0157369_10299713
1274 Ga0157374_10033819
1275 Ga0157374_10257341
1276 Ga0157374_10506826
1277 Ga0157374_10524326
1278 Ga0157374_10608031
1279 Ga0157374_11310561
1280 Ga0157378_10189630
1281 Ga0157378_10262866
1282 Ga0157378_10462638
1283 Ga0157378_10711382
1284 Ga0157378_11199945
1285 Ga0157378_12199422
1286 Ga0163162_10008673
1287 Ga0163162_10194337
1288 Ga0163162_11197628
1289 Ga0157372_10215211
1290 Ga0157372_10484893
1291 Ga0157372_10626408
1292 Ga0157375_10067415
1293 Ga0157375_10158968
1294 Ga0157375_10191137
1295 Ga0157375_10283425
1296 Ga0157375_10621839
1297 Ga0157375_10919780
1298 Ga0157375_10936158
1299 Ga0157375_11053466
1300 Ga0163163_10005387
1301 Ga0163163_11009463
1302 Ga0163163_11506636
1303 Ga0163163_11542704
1304 Ga0157380_10074297
1305 Ga0157380_10125794
1306 Ga0157380_10354765
1307 Ga0157380_10728033
1308 Ga0157380_10758657
1309 Ga0157380_10914351
1310 Ga0157377_10000047
1311 Ga0157377_10011405
1312 Ga0157377_10351504
1313 Ga0157377_10357324
1314 Ga0157379_10011806
1315 Ga0157379_10034555
1316 Ga0157379_10071709
1317 Ga0157379_10071851
1318 Ga0157379_10091280
1319 Ga0157379_10362900
1320 Ga0157379_10620065
1321 Ga0157376_10041684
1322 Ga0157376_10209982
1323 Ga0157376_10354490
1324 Ga0157376_10544754
1325 Ga0157376_10809413
1326 Ga0182007_10110689
1327 Ga0182005_1014456
1328 Ga0163161_10060591
1329 Ga0163161_10091950
1330 Ga0163161_10217096
1331 Ga0163161_10599310
1332 Ga0209674_100024
1333 Ga0209672_109938
1334 Ga0209563_100069
1335 Ga0207427_100214
1336 Ga0209258_100071
1337 Ga0209258_100652
1338 Ga0207425_1003582
1339 Ga0209646_1000012
1340 Ga0209026_1000004
1341 Ga0209677_100092
1342 Ga0209677_100983
1343 Ga0209759_1000003
1344 Ga0209759_1000936
1345 Ga0209759_1001809
1346 Ga0209759_1046825
1347 Ga0209129_1000207
1348 Ga0209565_1028340
1349 Ga0209455_1000030
1350 Ga0209564_1000196
1351 Ga0209758_1000181
1352 Ga0209758_1000439
1353 Ga0209256_1022066
1354 Ga0209257_1029746
1355 Ga0207656_10073535
1356 Ga0207656_10129777
1357 Ga0207656_10190016
1358 Ga0207656_10192093
1359 Ga0207656_10214885
1360 Ga0207656_10224229
1361 Ga0207656_10423024
1362 Ga0207682_10019295
1363 Ga0207682_10032489
1364 Ga0207682_10069168
1365 Ga0207682_10140069
1366 Ga0207682_10166323
1367 Ga0207642_10038048
1368 Ga0207642_10059741
1369 Ga0207688_10016680
1370 Ga0207680_10013409
1371 Ga0207680_10428312
1372 Ga0207680_10434991
1373 Ga0207680_10516971
1374 Ga0207685_10146507
1375 Ga0207645_10009997
1376 Ga0207645_10074943
1377 Ga0207645_10107755
1378 Ga0207645_10164752
1379 Ga0207645_10529469
1380 Ga0207643_10030578
1381 Ga0207643_10149796
1382 Ga0207705_10089346
1383 Ga0207705_10206434
1384 Ga0207705_10566285
1385 Ga0207705_10575144
1386 Ga0207705_10917329
1387 Ga0207684_10023382
1388 Ga0207707_10233207
1389 Ga0207695_10004982
1390 Ga0207695_10503265
1391 Ga0207695_10620883
1392 Ga0207695_11400574
1393 Ga0207671_10212137
1394 Ga0207671_10379831
1395 Ga0207671_11148498
1396 Ga0207660_10111964
1397 Ga0207662_10139244
1398 Ga0207657_10040663
1399 Ga0207657_10108323
1400 Ga0207657_10132442
1401 Ga0207657_10219622
1402 Ga0207657_10244588
1403 Ga0207657_10361464
1404 Ga0207657_10363102
1405 Ga0207649_10085952
1406 Ga0207649_10257724
1407 Ga0207649_10281552
1408 Ga0207649_10344527
1409 Ga0207652_10717790
1410 Ga0207681_10029178
1411 Ga0207681_10067663
1412 Ga0207681_10345710
1413 Ga0207681_10366814
1414 Ga0207681_10737808
1415 Ga0207694_10026064
1416 Ga0207694_10075212
1417 Ga0207694_10120861
1418 Ga0207694_10573485
1419 Ga0207694_10811924
1420 Ga0207694_10865248
1421 Ga0207694_10909933
1422 Ga0207650_10004478
1423 Ga0207650_10041366
1424 Ga0207650_10071086
1425 Ga0207650_10143807
1426 Ga0207650_10214629
1427 Ga0207650_10449402
1428 Ga0207650_10550675
1429 Ga0207659_10000367
1430 Ga0207659_10009099
1431 Ga0207659_10028725
1432 Ga0207659_10210115
1433 Ga0207687_10013633
1434 Ga0207687_10035555
1435 Ga0207644_10001041
1436 Ga0207644_10088680
1437 Ga0207644_10208953
1438 Ga0207644_10361205
1439 Ga0207644_10372483
1440 Ga0207690_10299799
1441 Ga0207690_11078469
1442 Ga0207706_10001471
1443 Ga0207706_10017114
1444 Ga0207706_10023744
1445 Ga0207706_10058921
1446 Ga0207706_10070300
1447 Ga0207706_10425964
1448 Ga0207706_10718824
1449 Ga0207706_10798732
1450 Ga0207686_10009639
1451 Ga0207686_10039436
1452 Ga0207686_10094170
1453 Ga0207709_10003154
1454 Ga0207709_10103689
1455 Ga0207709_10234315
1456 Ga0207670_10004677
1457 Ga0207670_10139142
1458 Ga0207670_10236282
1459 Ga0207669_10062389
1460 Ga0207669_10633827
1461 Ga0207704_10056457
1462 Ga0207704_10103007
1463 Ga0207704_10466845
1464 Ga0207665_10022549
1465 Ga0207691_10002591
1466 Ga0207691_10011521
1467 Ga0207691_10014850
1468 Ga0207691_10123660
1469 Ga0207691_10124454
1470 Ga0207691_10393343
1471 Ga0207691_10568465
1472 Ga0207711_10020968
1473 Ga0207711_10050386
1474 Ga0207711_10135040
1475 Ga0207711_10347056
1476 Ga0207711_10688821
1477 Ga0207689_10000880
1478 Ga0207689_10128123
1479 Ga0207689_10187748
1480 Ga0207689_10413046
1481 Ga0207689_10537183
1482 Ga0207679_10610685
1483 Ga0207679_10992428
1484 Ga0207679_11529231
1485 Ga0207667_10007780
1486 Ga0207667_10343779
1487 Ga0207667_10854889
1488 Ga0207667_10861745
1489 Ga0207667_11555316
1490 Ga0207651_10000217
1491 Ga0207651_10002599
1492 Ga0207651_10011732
1493 Ga0207651_10149779
1494 Ga0207651_10174528
1495 Ga0207651_10282201
1496 Ga0207651_10455654
1497 Ga0207712_10035188
1498 Ga0207712_10086158
1499 Ga0207668_10147817
1500 Ga0207668_10160027
1501 Ga0207668_10581994
1502 Ga0207640_10043424
1503 Ga0207640_10049240
1504 Ga0207640_10116347
1505 Ga0207640_10382895
1506 Ga0207640_11157656
1507 Ga0207640_11508270
1508 Ga0207658_10001015
1509 Ga0207658_10001513
1510 Ga0207658_10014621
1511 Ga0207658_10111151
1512 Ga0207658_10188113
1513 Ga0207658_10646690
1514 Ga0207677_10012140
1515 Ga0207677_10177378
1516 Ga0207677_10230096
1517 Ga0207677_10497403
1518 Ga0207677_11954857
1519 Ga0207703_10001393
1520 Ga0207703_10035128
1521 Ga0207703_10163141
1522 Ga0207639_10084007
1523 Ga0207639_10341913
1524 Ga0207639_10393069
1525 Ga0207639_10473707
1526 Ga0207639_10544582
1527 Ga0207639_10814499
1528 Ga0207639_11155887
1529 Ga0207678_10035137
1530 Ga0207678_10318233
1531 Ga0207678_10651680
1532 Ga0207678_11177898
1533 Ga0207708_10005539
1534 Ga0207702_10000189
1535 Ga0207702_10086551
1536 Ga0207702_10164140
1537 Ga0207702_10598518
1538 Ga0207641_10014014
1539 Ga0207641_10079342
1540 Ga0207641_10286031
1541 Ga0207641_10387489
1542 Ga0207641_10400021
1543 Ga0207641_11024860
1544 Ga0207648_10000019
1545 Ga0207648_10001067
1546 Ga0207648_10025212
1547 Ga0207648_10106072
1548 Ga0207648_10116312
1549 Ga0207648_10147062
1550 Ga0207648_10235585
1551 Ga0207648_10572395
1552 Ga0207648_10642661
1553 Ga0207648_11122011
1554 Ga0207676_10030206
1555 Ga0207676_10066767
1556 Ga0207676_10099092
1557 Ga0207676_10197821
1558 Ga0207676_10292225
1559 Ga0207676_11049013
1560 Ga0207674_10029107
1561 Ga0207674_10050227
1562 Ga0207674_10102817
1563 Ga0207674_10184514
1564 Ga0207675_100000393
1565 Ga0207675_100000697
1566 Ga0207675_100039782
1567 Ga0207675_100066086
1568 Ga0207675_100354320
1569 Ga0207675_101361119
1570 Ga0207683_10086018
1571 Ga0207683_10155761
1572 Ga0207683_10168177
1573 Ga0207698_10026138
1574 Ga0207698_10105795
1575 Ga0207698_10129795
1576 Ga0207698_10402586
1577 Ga0207698_10413766
1578 Ga0207698_10489750
1579 Ga0207698_10609833
1580 Ga0207698_10770314
1581 Ga0207698_11149511
1582 Ga0207698_11174053
1583 Ga0209813_10210918
1584 Ga0268266_10188812
1585 Ga0268265_10116674
1586 Ga0268265_10971330
1587 Ga0268265_11729053
1588 Ga0268264_10063195
1589 Ga0268264_10096604
1590 Ga0268264_10187934
1591 Ga0268264_11215432
1592 Ga0307517_10020975
1593 Ga0307517_10151756
1594 Ga0307517_10204030
1595 Ga0307515_10000037
1596 Ga0307515_10021577
1597 Ga0307515_10031624
1598 Ga0307515_10034932
1599 Ga0265324_10053862
1600 Ga0307511_10181607
1601 Ga0265328_10013144
1602 Ga0265327_10000147
1603 Ga0307513_10213284
1604 Ga0307513_10353107
1605 Ga0307509_10100047
1606 Ga0307509_10177669
1607 Ga0307509_10397189
1608 Ga0307408_100060061
1609 Ga0307408_100210781
1610 Ga0307508_10005978
1611 Ga0307508_10341533
1612 Ga0307516_10000065
1613 Ga0307516_10001232
1614 Ga0307516_10180157
1615 Ga0307516_10229395
1616 Ga0307516_10247866
1617 Ga0307516_10558223
1618 Ga0307405_10050723
1619 Ga0307405_10224682
1620 Ga0307412_11025762
1621 Ga0307409_100073222
1622 Ga0307409_100380310
1623 Ga0307416_100023885
1624 Ga0307416_100556886
1625 Ga0307416_100610733
1626 Ga0307510_10310858
1627 Ga0373938_0008171
1628 Ga0373940_0055343
1629 Ga0373944_0045150
1630 Ga0373944_0045697
1631 Ga0373936_0152391
1632 Ga0373941_0111456
1633 Ga0373953_0417107
1634 Ga0373943_0319159
1635 Ga0373946_0079346
1636 Ga0373961_0023850
1637 Ga0373924_0030959
1638 Ga0373931_0005507
1639 Ga0373931_0644714
1640 Ga0373927_0742993
1641 Ga0373947_0132800
1642 Ga0373937_0052987
1643 Ga0373925_0012046
1644 Ga0373925_0717064
1645 Ga0395899_0623127
1646 Ga0395900_0772483
1647 Ga0395898_0675143
1648 Ga0395905_0089589
1649 Ga0395905_0502380
1650 Ga0395901_0001122
1651 Ga0436365_1374569
1652 Ga0436360_0130247
1653 Ga0436361_0940585
1654 Ga0451793_1350852
1655 Ga0451795_1489369
1656 Ga0451798_0138619
1657 Ga0451800_0442965
1658 Ga0451807_0427023
1659 Ga0451833_1117297
1660 Ga0451835_0819255
1661 Ga0451839_0795767
1662 Ga0451853_3143231
1663 Ga0451853_3344363
1664 Ga0439437_009122
1665 Ga0439459_0142464
1666 Ga0439464_0001396
1667 Ga0439460_0007883
1668 Ga0450893_0097480
1669 Ga0451577_0301642
1670 Ga0466969_0020677
1671 Ga0466969_0065184
1672 Ga0466972_0000793
1673 Ga0453683_0197066
1674 Ga0453683_0659540
1675 Ga0466965_0161141
1676 Ga0466966_0023137
1677 Ga0466961_0006782
1678 Ga0466963_0029018
1679 Ga0466964_0002088
1680 Ga0453684_0265282
1681 Ga0466971_0018706
1682 Ga0466970_0080644
1683 Ga0466959_0000395
1684 Ga0466959_0133070
1685 Ga0451576_0400391
1686 Ga0466958_0055289
1687 Ga0466967_0026999
1688 Ga0495629_0304239
1689 Ga0495629_0353703
1690 Ga0495638_0059347
1691 Ga0495638_0259640
1692 Ga0495638_0489617
1693 Ga0495605_0049103
1694 Ga0495639_0050159
1695 Ga0495639_0262900
1696 Ga0495639_0509686
1697 Ga0495583_0000018
1698 Ga0495583_0156078
1699 Ga0495606_0000615
1700 Ga0495606_0218984
1701 Ga0495616_0120351
1702 Ga0495620_0037445
1703 Ga0495620_0065520
1704 Ga0495630_0494303
1705 Ga0495632_0002141
1706 Ga0495632_0017016
1707 Ga0495632_0027056
1708 Ga0495642_0041617
1709 Ga0495587_0191523
1710 Ga0495598_0026188
1711 Ga0495598_0057957
1712 Ga0495609_0120001
1713 Ga0495621_0214229
1714 Ga0495645_0221499
1715 Ga0495668_0010316
1716 Ga0495668_0077484
1717 Ga0495634_0284228
1718 Ga0495625_0004691
1719 Ga0495625_0026499
1720 Ga0495635_0156006
1721 Ga0495599_0192577
1722 Ga0495623_0445707
1723 Ga0495647_0233191
1724 Ga0495658_0160644
1725 Ga0495658_0666322
1726 Ga0495669_0159344
1727 Ga0495624_0010618
1728 Ga0495670_0224337
1729 Ga0495671_0036257
1730 Ga0495671_0147154
1731 Ga0495671_0430959
1732 Ga0495649_0000051
1733 Ga0495649_0008591
1734 Ga0495589_0324112
1735 Ga0495600_0773439
1736 Ga0495660_0065014
1737 Ga0495676_0072727
1738 Ga0495680_0202677
1739 Ga0495683_0049114
1740 Ga0495687_000364
1741 Ga0495687_024357
1742 Ga0495679_090828
1743 Ga0495684_0088561
1744 Ga0495686_0069963
1745 Ga0495686_0079269
1746 Ga0495593_0018830
1747 Ga0495602_0137474
1748 Ga0495602_0465586
1749 Ga0495614_0082113
1750 Ga0495626_0219924
1751 Ga0496100_0148594
1752 Ga0496100_0433268
1753 Ga0496100_0747373
1754 Ga0496101_0071632
1755 Ga0496101_0275663
1756 Ga0496102_0009647
1757 Ga0496102_0161858
1758 Ga0496104_0218441
1759 Ga0496104_0717666
1760 Ga0496105_0038849
1761 Ga0496106_0053790
1762 Ga0496106_0653782
1763 Ga0496107_0075831
1764 Ga0496108_0068081
1765 Ga0496108_0514318
1766 Ga0496108_0627424
1767 Ga0496109_0113935
1768 Ga0496109_0530710
1769 Ga0496109_0694832
1770 Ga0496110_0067900
1771 Ga0496111_0035798
1772 Ga0496112_0381015
1773 Ga0496113_0088346
1774 Ga0496113_0299557
1775 Ga0496114_0093654
1776 Ga0496114_0152482
1777 Ga0496114_0498453
1778 Ga0496115_0069754
1779 Ga0501292_004818
1780 Ga0501294_002733
1781 Ga0501248_001686
1782 Ga0501035_0176493
1783 nmdc:mga03683_32909_c1
1784 nmdc:mga03n38_112295_c1
1785 nmdc:mga03n38_258842_c1
1786 nmdc:mga00v17_100963_c1
1787 nmdc:mga0yw44_114311_c1
1788 nmdc:mga0yw44_616854_c1
1789 nmdc:mga0k408_10855_c1
1790 nmdc:mga0k408_19006_c1
1791 nmdc:mga0k408_20258_c1
1792 nmdc:mga0k408_25325_c1
1793 nmdc:mga0k408_296126_c1
1794 nmdc:mga0k408_305390_c1
1795 nmdc:mga0k408_468768_c1
1796 nmdc:mga06z11_310047_c1
1797 nmdc:mga06z11_59212_c1
1798 nmdc:mga04h51_218153_c1
1799 nmdc:mga07m45_126363_c1
1800 nmdc:mga07m45_1817_c1
1801 nmdc:mga07m45_2560_c1
1802 nmdc:mga07m45_30715_c1
1803 nmdc:mga07m45_45383_c1
1804 nmdc:mga07m45_972_c1
1805 nmdc:mga0qj67_248117_c1
1806 nmdc:mga08y16_260402_c1
1807 nmdc:mga0n895_258253_c1
1808 nmdc:mga0rr50_147281_c1
1809 nmdc:mga0sz30_46137_c1
1810 nmdc:mga0sz30_90963_c1
1811 Ga0495601_0365722
1812 Ga0495612_0335898
1813 Ga0500635_0010754
1814 Ga0495619_0120347
1815 Ga0500578_0230603
1816 Ga0500644_0032229
1817 Ga0500583_0006471
1818 Ga0500583_0058260
1819 Ga0500651_0054860
1820 Ga0500641_0187807
1821 Ga0500650_0112854
1822 Ga0500556_0260397
1823 Ga0500557_047647
1824 Ga0500569_005455
1825 Ga0500593_000112
1826 Ga0500594_0056567
1827 Ga0500623_047586
1828 Ga0500628_001828
1829 Ga0500642_0009974
1830 Ga0500652_000197
1831 Ga0500655_001493
1832 Ga0500658_0009691
1833 Ga0500568_0188848
1834 Ga0500577_0028735
1835 Ga0500579_138216
1836 Ga0500588_0041010
1837 Ga0500604_0017917
1838 Ga0500604_0021091
1839 Ga0500619_000063
1840 Ga0500622_0000818
1841 Ga0500636_0007754
1842 Ga0500661_005972
1843 Ga0590071_004268
1844 Ga0590074_011351
1845 Ga0587083_0019017
1846 Ga0587076_019017
1847 Ga0466962_0015457
1848 2587726895
1849 2587732174
1850 2588291263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

7

148

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pz0-assembly1.cif.gz_A the crystal structure of a solute binding protein from bacillus anthracis str. ames in complex with quorum-sensing signal autoinducer-2 (ai-2) 0.7557 93 135
7d3e-assembly1.cif.gz_C cryo-em structure of human duox1-duoxa1 in low-calcium state 0.7119 56 87
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.6544 61 158
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.6319 61 158
5zj0-assembly1.cif.gz_A crystal structure of xanthomonas campestris flgl (space group c2) 0.6252 64 87
ID Description Score Start End Superfamily
af_Q9Y485_26_270_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.766 61 85 2.130.10.10
af_Q54J98_246_425_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7575 66 86 2.130.10.10
af_Q9U2F8_56_193_3.30.420.60 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;eRF1 domain 2 0.7493 56 134 3.30.420.60
af_Q2G1X1_1_77_3.10.320.10 Alpha Beta;Roll;Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1;Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 0.7488 59 88 3.10.320.10
af_Q55DD5_152_464_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7396 66 88 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A3M2C247-F1-model_v4 Biopolymer transporter ExbD 0.9401 95 162
AF-A0A3B8WJR7-F1-model_v4 Biopolymer transporter ExbD 0.9349 69 161
AF-A0A363TVL6-F1-model_v4 Biopolymer transporter ExbD 0.9071 54 161
AF-A0A363TVL6-F1-model_v4 Biopolymer transporter ExbD 0.8913 54 161
AF-A0A1M5PEJ9-F1-model_v4 Uncharacterized protein 0.8494 93 164

Map