F485831

General Info

Members Datasets Scaffolds Average Seq Length
923 322 1846 329

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0365656|Ga0453684_0365656_673_1611
Length 312
Sequence VTSIVAFAIIQLPPGDFATTYVASQAAQGDSANAQEVLAQLRASYGLDQPLPVQYLKWIWGIVTRGDFGIAFEFHQPVASLMWERVWLTLLLSLASVLITWIIAFPIGILSAVKQYSVSDYVFTFLGFIGISVPSFLLALVIMYIEFKYFSTTLGGLFSSEMENAAWGWPKIVDLFAHIWLPVLILAFGGTAELIRIMRANLLDELRKPYVTTARSKGLPEWQVLLKYPVRLAMNPFISTIGWTLPYLISGSIIISVVLSLPTTGPMLLRSLQSQDMYLAGSIILILSILTIIGTLVSDVLLAWLDPRIRLQ

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
190 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
222 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
223 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
224 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
295 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
310 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
313 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
321 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
322 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 0
Rhizoplane 3.14
Rhizosphere 90.9
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0365656 3300044712 Bacteria 1623
2 JGI25406J46586_10009819 3300003203 Bacteria 4273
3 Ga0065715_10097211 3300005293 Bacteria 3744
4 Ga0065707_10015147 3300005295 Bacteria 1952
5 Ga0070676_10148340 3300005328 Bacteria 1499
6 Ga0070676_10225572 3300005328 Bacteria 1240
7 Ga0070683_100122886 3300005329 Bacteria 2453
8 Ga0070670_100001317 3300005331 Bacteria 19823
9 Ga0070670_100007583 3300005331 Bacteria 9212
10 Ga0070670_100037176 3300005331 Bacteria 4188
11 Ga0070670_100119949 3300005331 Bacteria 2268
12 Ga0068869_100000363 3300005334 Bacteria 24419
13 Ga0068869_100014493 3300005334 Bacteria 5266
14 Ga0068869_100017369 3300005334 Bacteria 4874
15 Ga0068869_100328003 3300005334 Bacteria 1243
16 Ga0070666_10004632 3300005335 Bacteria 8394
17 Ga0070666_10163627 3300005335 Unclassified 1555
18 Ga0070680_100035870 3300005336 Bacteria 4005
19 Ga0068868_100013049 3300005338 Bacteria 6083
20 Ga0070660_100268418 3300005339 Bacteria 1394
21 Ga0070689_100002678 3300005340 Bacteria 11677
22 Ga0070689_100062095 3300005340 Bacteria 2907
23 Ga0070689_100098591 3300005340 Bacteria 2312
24 Ga0070689_100399016 3300005340 Bacteria 1162
25 Ga0070691_10014945 3300005341 Bacteria 3564
26 Ga0070687_100032287 3300005343 Bacteria 2575
27 Ga0070687_100156794 3300005343 Bacteria 1342
28 Ga0070668_100005373 3300005347 Bacteria 9505
29 Ga0070668_100031143 3300005347 Bacteria 4058
30 Ga0070668_100053334 3300005347 Bacteria 3118
31 Ga0070668_100054571 3300005347 Bacteria 3082
32 Ga0070668_100076449 3300005347 Bacteria 2615
33 Ga0070668_100287482 3300005347 Bacteria 1375
34 Ga0070669_100050367 3300005353 Bacteria 3042
35 Ga0070669_100251450 3300005353 Bacteria 1407
36 Ga0070675_100004300 3300005354 Bacteria 10854
37 Ga0070675_100010178 3300005354 Bacteria 7335
38 Ga0070675_100012037 3300005354 Bacteria 6781
39 Ga0070675_100327143 3300005354 Bacteria 1355
40 Ga0070671_100029228 3300005355 Bacteria 4544
41 Ga0070671_100219861 3300005355 Bacteria 1611
42 Ga0070674_100044854 3300005356 Unclassified 3018
43 Ga0070674_100061537 3300005356 Bacteria 2620
44 Ga0070674_100112435 3300005356 Bacteria 2002
45 Ga0070673_100059167 3300005364 Bacteria 3032
46 Ga0070673_100125773 3300005364 Bacteria 2145
47 Ga0070688_100010856 3300005365 Bacteria 5039
48 Ga0070667_100001652 3300005367 Bacteria 19934
49 Ga0070667_100052660 3300005367 Bacteria 3435
50 Ga0070667_100069556 3300005367 Bacteria 2996
51 Ga0070667_100148596 3300005367 Bacteria 2057
52 Ga0070667_100187308 3300005367 Bacteria 1832
53 Ga0070709_10227703 3300005434 Bacteria 1332
54 Ga0070714_100016619 3300005435 Bacteria 5947
55 Ga0070713_100000129 3300005436 Bacteria 49577
56 Ga0070713_100016854 3300005436 Bacteria 5505
57 Ga0070713_100026206 3300005436 Bacteria 4573
58 Ga0070710_10023747 3300005437 Bacteria 3226
59 Ga0070701_10011779 3300005438 Bacteria 3925
60 Ga0070701_10115486 3300005438 Bacteria 1505
61 Ga0070711_100000301 3300005439 Bacteria 25546
62 Ga0070711_100169736 3300005439 Bacteria 1662
63 Ga0070705_100069330 3300005440 Bacteria 2125
64 Ga0070705_100169896 3300005440 Bacteria 1466
65 Ga0070700_100061652 3300005441 Bacteria 2367
66 Ga0070700_100069719 3300005441 Bacteria 2239
67 Ga0070694_100233925 3300005444 Bacteria 1383
68 Ga0070708_100009942 3300005445 Bacteria 7690
69 Ga0070708_100015637 3300005445 Bacteria 6272
70 Ga0070708_100033701 3300005445 Bacteria 4450
71 Ga0070708_100037459 3300005445 Bacteria 4231
72 Ga0070708_100042283 3300005445 Bacteria 3999
73 Ga0070708_100045638 3300005445 Bacteria 3862
74 Ga0070708_100099493 3300005445 Bacteria 2660
75 Ga0070708_100170529 3300005445 Bacteria 2031
76 Ga0070708_100291474 3300005445 Bacteria 1536
77 Ga0070663_100012079 3300005455 Bacteria 5450
78 Ga0070678_100039997 3300005456 Bacteria 3314
79 Ga0070678_100042827 3300005456 Bacteria 3220
80 Ga0070678_100089752 3300005456 Bacteria 2353
81 Ga0070678_100477165 3300005456 Unclassified 1097
82 Ga0070662_100059750 3300005457 Bacteria 2778
83 Ga0068867_100002218 3300005459 Bacteria 13634
84 Ga0068867_100123444 3300005459 Bacteria 2004
85 Ga0068867_100126149 3300005459 Bacteria 1984
86 Ga0070685_10001030 3300005466 Bacteria 14972
87 Ga0070706_100009454 3300005467 Bacteria 9070
88 Ga0070706_100011186 3300005467 Bacteria 8332
89 Ga0070706_100015368 3300005467 Bacteria 7069
90 Ga0070706_100025893 3300005467 Bacteria 5398
91 Ga0070706_100036531 3300005467 Bacteria 4537
92 Ga0070706_100063941 3300005467 Bacteria 3400
93 Ga0070706_100256725 3300005467 Bacteria 1632
94 Ga0070707_100011580 3300005468 Bacteria 8228
95 Ga0070707_100013073 3300005468 Bacteria 7756
96 Ga0070707_100020575 3300005468 Bacteria 6227
97 Ga0070707_100044273 3300005468 Bacteria 4261
98 Ga0070707_100077569 3300005468 Bacteria 3206
99 Ga0070707_100083231 3300005468 Bacteria 3091
100 Ga0070698_100014048 3300005471 Bacteria 8468
101 Ga0070698_100017798 3300005471 Bacteria 7486
102 Ga0070698_100024700 3300005471 Bacteria 6268
103 Ga0070698_100048588 3300005471 Bacteria 4335
104 Ga0070698_100059148 3300005471 Bacteria 3871
105 Ga0070698_100094096 3300005471 Bacteria 2976
106 Ga0070698_100275591 3300005471 Bacteria 1614
107 Ga0070698_100455700 3300005471 Bacteria 1215
108 Ga0070699_100005003 3300005518 Bacteria 11687
109 Ga0070699_100009997 3300005518 Bacteria 8211
110 Ga0070699_100010788 3300005518 Bacteria 7908
111 Ga0070699_100018656 3300005518 Bacteria 5957
112 Ga0070699_100021925 3300005518 Bacteria 5505
113 Ga0070699_100055952 3300005518 Bacteria 3416
114 Ga0070699_100126744 3300005518 Bacteria 2248
115 Ga0070699_100166165 3300005518 Bacteria 1954
116 Ga0070699_100221115 3300005518 Bacteria 1687
117 Ga0070699_100246288 3300005518 Bacteria 1596
118 Ga0070699_100327758 3300005518 Bacteria 1377
119 Ga0070697_100005322 3300005536 Bacteria 9889
120 Ga0070697_100033553 3300005536 Bacteria 4134
121 Ga0070697_100035015 3300005536 Bacteria 4050
122 Ga0070697_100053946 3300005536 Bacteria 3267
123 Ga0070697_100084432 3300005536 Bacteria 2619
124 Ga0070697_100166404 3300005536 Bacteria 1864
125 Ga0070697_100333274 3300005536 Bacteria 1308
126 Ga0070697_100343892 3300005536 Bacteria 1287
127 Ga0070672_100002126 3300005543 Bacteria 12502
128 Ga0070672_100108502 3300005543 Unclassified 2260
129 Ga0070672_100339085 3300005543 Bacteria 1280
130 Ga0070686_100206727 3300005544 Bacteria 1411
131 Ga0070695_100019867 3300005545 Bacteria 4097
132 Ga0070695_100204683 3300005545 Bacteria 1413
133 Ga0070696_100052578 3300005546 Bacteria 2834
134 Ga0070696_100090724 3300005546 Bacteria 2175
135 Ga0070693_100010443 3300005547 Bacteria 4654
136 Ga0070665_100065828 3300005548 Bacteria 3634
137 Ga0070704_100026253 3300005549 Bacteria 3846
138 Ga0070704_100053413 3300005549 Bacteria 2855
139 Ga0070704_100071130 3300005549 Bacteria 2526
140 Ga0070704_100256876 3300005549 Bacteria 1437
141 Ga0068857_100005400 3300005577 Bacteria 10895
142 Ga0068857_100038058 3300005577 Bacteria 4260
143 Ga0068857_100098892 3300005577 Bacteria 2617
144 Ga0068857_100180566 3300005577 Bacteria 1921
145 Ga0068854_100016202 3300005578 Bacteria 4962
146 Ga0068856_100364395 3300005614 Bacteria 1464
147 Ga0070702_100063787 3300005615 Bacteria 2153
148 Ga0070702_100134216 3300005615 Bacteria 1568
149 Ga0070702_100237247 3300005615 Bacteria 1229
150 Ga0068852_100188494 3300005616 Bacteria 1944
151 Ga0068852_100338136 3300005616 Bacteria 1466
152 Ga0068852_100360619 3300005616 Bacteria 1422
153 Ga0068859_100003564 3300005617 Bacteria 15858
154 Ga0068859_100007223 3300005617 Bacteria 11274
155 Ga0068859_100136911 3300005617 Bacteria 2522
156 Ga0068859_100157038 3300005617 Bacteria 2352
157 Ga0068859_100330094 3300005617 Bacteria 1619
158 Ga0068859_100440692 3300005617 Bacteria 1399
159 Ga0068864_100002127 3300005618 Bacteria 16380
160 Ga0068864_100005802 3300005618 Bacteria 10128
161 Ga0068864_100006166 3300005618 Bacteria 9833
162 Ga0068864_100300041 3300005618 Bacteria 1504
163 Ga0068866_10002296 3300005718 Bacteria 7919
164 Ga0068866_10027296 3300005718 Bacteria 2706
165 Ga0068861_100000922 3300005719 Bacteria 17854
166 Ga0068861_100037555 3300005719 Bacteria 3601
167 Ga0068861_100059254 3300005719 Bacteria 2930
168 Ga0068861_100150895 3300005719 Bacteria 1907
169 Ga0068861_100417986 3300005719 Bacteria 1194
170 Ga0068870_10021642 3300005840 Bacteria 3149
171 Ga0068870_10053179 3300005840 Bacteria 2150
172 Ga0068870_10076677 3300005840 Bacteria 1836
173 Ga0068863_100002365 3300005841 Bacteria 18771
174 Ga0068863_100046613 3300005841 Bacteria 4114
175 Ga0068863_100090271 3300005841 Bacteria 2905
176 Ga0068858_100009284 3300005842 Bacteria 9392
177 Ga0068858_100036564 3300005842 Bacteria 4552
178 Ga0068858_100102845 3300005842 Bacteria 2665
179 Ga0068858_100255466 3300005842 Bacteria 1665
180 Ga0068858_100359738 3300005842 Bacteria 1395
181 Ga0068860_100003499 3300005843 Bacteria 16161
182 Ga0068860_100012471 3300005843 Bacteria 8370
183 Ga0068860_100098420 3300005843 Bacteria 2789
184 Ga0068860_100100224 3300005843 Bacteria 2763
185 Ga0068860_100140476 3300005843 Bacteria 2321
186 Ga0068860_100227094 3300005843 Bacteria 1814
187 Ga0068860_100272577 3300005843 Bacteria 1652
188 Ga0068862_100005668 3300005844 Bacteria 10424
189 Ga0068862_100007778 3300005844 Bacteria 8863
190 Ga0068862_100011180 3300005844 Bacteria 7413
191 Ga0068862_100040247 3300005844 Bacteria 3973
192 Ga0068862_100054244 3300005844 Bacteria 3432
193 Ga0068862_100061609 3300005844 Bacteria 3225
194 Ga0068862_100217403 3300005844 Bacteria 1729
195 Ga0081455_10000984 3300005937 Bacteria 36271
196 Ga0081455_10009733 3300005937 Bacteria 9853
197 Ga0081455_10039777 3300005937 Bacteria 4152
198 Ga0081455_10052497 3300005937 Bacteria 3489
199 Ga0081455_10055384 3300005937 Bacteria 3373
200 Ga0081538_10002719 3300005981 Bacteria 16997
201 Ga0081538_10015526 3300005981 Bacteria 5888
202 Ga0081538_10056460 3300005981 Bacteria 2300
203 Ga0081538_10065785 3300005981 Bacteria 2038
204 Ga0081540_1010822 3300005983 Bacteria 6132
205 Ga0081539_10001927 3300005985 Bacteria 31993
206 Ga0081539_10016665 3300005985 Bacteria 5225
207 Ga0070717_10183089 3300006028 Unclassified 1827
208 Ga0075365_10000728 3300006038 Bacteria 13299
209 Ga0075365_10010086 3300006038 Bacteria 5478
210 Ga0075365_10025552 3300006038 Bacteria 3740
211 Ga0075365_10158107 3300006038 Bacteria 1578
212 Ga0075368_10000120 3300006042 Bacteria 20578
213 Ga0075368_10054404 3300006042 Bacteria 1595
214 Ga0075363_100011502 3300006048 Bacteria 4239
215 Ga0075364_10009885 3300006051 Bacteria 5740
216 Ga0075364_10018000 3300006051 Bacteria 4419
217 Ga0075432_10095338 3300006058 Bacteria 1094
218 Ga0070715_10089036 3300006163 Bacteria 1416
219 Ga0070716_100001998 3300006173 Bacteria 9299
220 Ga0070712_100019792 3300006175 Bacteria 4397
221 Ga0070712_100031307 3300006175 Bacteria 3583
222 Ga0070712_100100115 3300006175 Bacteria 2141
223 Ga0075367_10000650 3300006178 Bacteria 13320
224 Ga0075367_10003645 3300006178 Bacteria 7385
225 Ga0075367_10014314 3300006178 Bacteria 4292
226 Ga0075367_10157755 3300006178 Bacteria 1410
227 Ga0075369_10083854 3300006186 Bacteria 1416
228 Ga0075427_10014558 3300006194 Bacteria 1208
229 Ga0075427_10015619 3300006194 Bacteria 1174
230 Ga0075366_10007236 3300006195 Bacteria 6116
231 Ga0075366_10008316 3300006195 Bacteria 5762
232 Ga0097621_100007093 3300006237 Bacteria 7989
233 Ga0097621_100034527 3300006237 Bacteria 4035
234 Ga0097621_100042332 3300006237 Bacteria 3668
235 Ga0097621_100207584 3300006237 Bacteria 1703
236 Ga0075370_10046818 3300006353 Bacteria 2448
237 Ga0068871_100066530 3300006358 Bacteria 2954
238 Ga0068871_100086360 3300006358 Bacteria 2607
239 Ga0075428_100001938 3300006844 Bacteria 22230
240 Ga0075428_100010074 3300006844 Bacteria 10502
241 Ga0075428_100016097 3300006844 Bacteria 8268
242 Ga0075428_100019946 3300006844 Bacteria 7423
243 Ga0075428_100026020 3300006844 Bacteria 6479
244 Ga0075428_100038332 3300006844 Bacteria 5274
245 Ga0075428_100081393 3300006844 Bacteria 3534
246 Ga0075428_100084782 3300006844 Bacteria 3456
247 Ga0075428_100101787 3300006844 Bacteria 3132
248 Ga0075428_100254830 3300006844 Bacteria 1890
249 Ga0075430_100000117 3300006846 Bacteria 48550
250 Ga0075430_100000631 3300006846 Bacteria 26825
251 Ga0075430_100013548 3300006846 Bacteria 6951
252 Ga0075430_100037105 3300006846 Bacteria 4132
253 Ga0075430_100056466 3300006846 Bacteria 3301
254 Ga0075430_100266577 3300006846 Bacteria 1418
255 Ga0075431_100000169 3300006847 Bacteria 46379
256 Ga0075431_100000310 3300006847 Bacteria 38390
257 Ga0075431_100001546 3300006847 Bacteria 21340
258 Ga0075431_100007380 3300006847 Bacteria 10947
259 Ga0075431_100009035 3300006847 Bacteria 9992
260 Ga0075431_100012996 3300006847 Bacteria 8406
261 Ga0075431_100014927 3300006847 Bacteria 7865
262 Ga0075431_100029422 3300006847 Bacteria 5655
263 Ga0075431_100033086 3300006847 Bacteria 5328
264 Ga0075431_100056312 3300006847 Bacteria 4056
265 Ga0075431_100125624 3300006847 Bacteria 2647
266 Ga0075431_100133313 3300006847 Bacteria 2562
267 Ga0075431_100229790 3300006847 Bacteria 1890
268 Ga0075431_100354034 3300006847 Bacteria 1476
269 Ga0075431_100421978 3300006847 Bacteria 1333
270 Ga0075431_100434958 3300006847 Bacteria 1309
271 Ga0075431_100445935 3300006847 Bacteria 1290
272 Ga0075433_10000602 3300006852 Bacteria 23939
273 Ga0075433_10009519 3300006852 Bacteria 7766
274 Ga0075433_10038797 3300006852 Bacteria 4115
275 Ga0075433_10044282 3300006852 Bacteria 3866
276 Ga0075433_10053817 3300006852 Bacteria 3510
277 Ga0075433_10062171 3300006852 Bacteria 3270
278 Ga0075433_10103052 3300006852 Bacteria 2527
279 Ga0075433_10131045 3300006852 Bacteria 2228
280 Ga0075433_10179567 3300006852 Bacteria 1883
281 Ga0075433_10427863 3300006852 Bacteria 1167
282 Ga0075434_100000660 3300006871 Bacteria 26783
283 Ga0075434_100005059 3300006871 Bacteria 11972
284 Ga0075434_100131221 3300006871 Bacteria 2524
285 Ga0075434_100152107 3300006871 Bacteria 2334
286 Ga0075429_100001202 3300006880 Bacteria 20976
287 Ga0075429_100007696 3300006880 Bacteria 9353
288 Ga0075429_100008694 3300006880 Bacteria 8835
289 Ga0075429_100010104 3300006880 Bacteria 8177
290 Ga0075429_100038287 3300006880 Bacteria 4174
291 Ga0075429_100050469 3300006880 Bacteria 3619
292 Ga0075429_100057834 3300006880 Bacteria 3376
293 Ga0075429_100091165 3300006880 Bacteria 2658
294 Ga0075429_100140026 3300006880 Bacteria 2118
295 Ga0075429_100145579 3300006880 Bacteria 2074
296 Ga0075429_100173265 3300006880 Bacteria 1890
297 Ga0075429_100257964 3300006880 Bacteria 1526
298 Ga0075429_100280933 3300006880 Unclassified 1458
299 Ga0068865_100094819 3300006881 Bacteria 2173
300 Ga0068865_100179865 3300006881 Bacteria 1628
301 Ga0075436_100011647 3300006914 Bacteria 6033
302 Ga0075436_100025299 3300006914 Bacteria 4084
303 Ga0097620_100003564 3300006931 Bacteria 15858
304 Ga0097620_100007223 3300006931 Bacteria 11274
305 Ga0097620_100136912 3300006931 Bacteria 2522
306 Ga0097620_100157039 3300006931 Bacteria 2352
307 Ga0097620_100330109 3300006931 Bacteria 1619
308 Ga0097620_100440728 3300006931 Bacteria 1399
309 Ga0075435_100011815 3300007076 Bacteria 6445
310 Ga0075435_100023027 3300007076 Bacteria 4810
311 Ga0075435_100106659 3300007076 Bacteria 2326
312 Ga0075435_100370486 3300007076 Bacteria 1229
313 Ga0099794_10001270 3300007265 Bacteria 8739
314 Ga0099794_10008200 3300007265 Bacteria 4330
315 Ga0099794_10025092 3300007265 Bacteria 2742
316 Ga0099794_10027619 3300007265 Bacteria 2632
317 Ga0099794_10035006 3300007265 Bacteria 2368
318 Ga0105240_10028250 3300009093 Bacteria 7329
319 Ga0105240_10372657 3300009093 Bacteria 1614
320 Ga0111539_10000319 3300009094 Bacteria 58756
321 Ga0111539_10001949 3300009094 Bacteria 27525
322 Ga0111539_10013148 3300009094 Bacteria 10352
323 Ga0111539_10027210 3300009094 Bacteria 6985
324 Ga0111539_10212402 3300009094 Bacteria 2254
325 Ga0111539_10324877 3300009094 Bacteria 1791
326 Ga0105245_10001111 3300009098 Bacteria 24332
327 Ga0105245_10165784 3300009098 Bacteria 2100
328 Ga0105247_10000792 3300009101 Bacteria 24231
329 Ga0105247_10051349 3300009101 Bacteria 2539
330 Ga0105247_10126976 3300009101 Bacteria 1658
331 Ga0114129_10000328 3300009147 Bacteria 55522
332 Ga0114129_10000539 3300009147 Bacteria 46397
333 Ga0114129_10003348 3300009147 Bacteria 22517
334 Ga0114129_10020979 3300009147 Bacteria 9279
335 Ga0114129_10026272 3300009147 Bacteria 8247
336 Ga0114129_10045924 3300009147 Bacteria 6138
337 Ga0114129_10050900 3300009147 Bacteria 5816
338 Ga0114129_10128876 3300009147 Bacteria 3477
339 Ga0114129_10132086 3300009147 Bacteria 3428
340 Ga0114129_10159836 3300009147 Bacteria 3079
341 Ga0114129_10258007 3300009147 Bacteria 2338
342 Ga0114129_10264657 3300009147 Bacteria 2303
343 Ga0114129_10285575 3300009147 Bacteria 2203
344 Ga0114129_10327770 3300009147 Bacteria 2034
345 Ga0114129_10337519 3300009147 Bacteria 2000
346 Ga0114129_10366022 3300009147 Bacteria 1907
347 Ga0114129_10436921 3300009147 Bacteria 1719
348 Ga0105243_10055639 3300009148 Bacteria 3143
349 Ga0105243_10134711 3300009148 Bacteria 2100
350 Ga0105243_10217316 3300009148 Bacteria 1687
351 Ga0105241_10005538 3300009174 Bacteria 9331
352 Ga0105241_10137417 3300009174 Bacteria 1986
353 Ga0105241_10203019 3300009174 Bacteria 1657
354 Ga0105242_10363119 3300009176 Bacteria 1341
355 Ga0105248_10003750 3300009177 Bacteria 16849
356 Ga0105248_10278299 3300009177 Bacteria 1884
357 Ga0105248_10735472 3300009177 Bacteria 1113
358 Ga0105237_10019141 3300009545 Bacteria 7074
359 Ga0105237_10095669 3300009545 Bacteria 2960
360 Ga0105237_10161091 3300009545 Bacteria 2242
361 Ga0105238_10052280 3300009551 Bacteria 4107
362 Ga0105238_10068317 3300009551 Bacteria 3555
363 Ga0105238_10515350 3300009551 Bacteria 1198
364 Ga0105249_10007392 3300009553 Bacteria 9584
365 Ga0105249_10025141 3300009553 Bacteria 5359
366 Ga0105249_10054743 3300009553 Bacteria 3648
367 Ga0105249_10127486 3300009553 Bacteria 2425
368 Ga0105249_10213282 3300009553 Bacteria 1896
369 Ga0105249_10447590 3300009553 Bacteria 1330
370 Ga0105249_10520672 3300009553 Bacteria 1236
371 Ga0105246_10033679 3300011119 Bacteria 3408
372 Ga0105246_10042354 3300011119 Bacteria 3083
373 Ga0157371_10041152 3300013102 Bacteria 3299
374 Ga0157370_10022946 3300013104 Bacteria 6202
375 Ga0157374_10004727 3300013296 Bacteria 11422
376 Ga0157378_10041731 3300013297 Bacteria 4071
377 Ga0157378_10064224 3300013297 Bacteria 3283
378 Ga0157378_10227403 3300013297 Unclassified 1776
379 Ga0157378_10233059 3300013297 Bacteria 1755
380 Ga0163162_10003056 3300013306 Bacteria 15989
381 Ga0163162_10004311 3300013306 Bacteria 13699
382 Ga0163162_10014093 3300013306 Bacteria 7813
383 Ga0163162_10023856 3300013306 Bacteria 6037
384 Ga0163162_10357561 3300013306 Bacteria 1593
385 Ga0163162_10581568 3300013306 Bacteria 1247
386 Ga0157372_10179877 3300013307 Bacteria 2448
387 Ga0157375_10009264 3300013308 Bacteria 8639
388 Ga0157375_10176922 3300013308 Bacteria 2284
389 Ga0157375_10187216 3300013308 Bacteria 2224
390 Ga0157375_10212362 3300013308 Bacteria 2093
391 Ga0157375_10771094 3300013308 Bacteria 1112
392 Ga0163163_10001598 3300014325 Bacteria 19047
393 Ga0163163_10014348 3300014325 Bacteria 7283
394 Ga0163163_10207918 3300014325 Bacteria 2006
395 Ga0157380_10383316 3300014326 Bacteria 1327
396 Ga0157379_10002057 3300014968 Bacteria 16706
397 Ga0157379_10152538 3300014968 Bacteria 2084
398 Ga0157379_10242550 3300014968 Bacteria 1635
399 Ga0157376_10024260 3300014969 Bacteria 4758
400 Ga0157376_10028665 3300014969 Bacteria 4427
401 Ga0163161_10015428 3300017792 Bacteria 5327
402 Ga0163161_10307158 3300017792 Bacteria 1251
403 Ga0213875_10005766 3300021388 Bacteria 6594
404 Ga0213875_10030003 3300021388 Bacteria 2578
405 Ga0207697_10027942 3300025315 Bacteria 2306
406 Ga0207692_10034786 3300025898 Bacteria 2442
407 Ga0207642_10003825 3300025899 Bacteria 4797
408 Ga0207680_10284527 3300025903 Unclassified 1149
409 Ga0207647_10166955 3300025904 Bacteria 1283
410 Ga0207685_10042875 3300025905 Bacteria 1702
411 Ga0207699_10157544 3300025906 Bacteria 1508
412 Ga0207645_10050211 3300025907 Bacteria 2663
413 Ga0207643_10018865 3300025908 Bacteria 3778
414 Ga0207684_10004580 3300025910 Bacteria 12992
415 Ga0207684_10008013 3300025910 Bacteria 9436
416 Ga0207684_10013871 3300025910 Bacteria 6960
417 Ga0207684_10044844 3300025910 Bacteria 3750
418 Ga0207684_10052034 3300025910 Bacteria 3475
419 Ga0207684_10068173 3300025910 Bacteria 3024
420 Ga0207684_10118332 3300025910 Bacteria 2270
421 Ga0207684_10118952 3300025910 Bacteria 2264
422 Ga0207684_10207150 3300025910 Bacteria 1692
423 Ga0207654_10013307 3300025911 Bacteria 4232
424 Ga0207654_10023663 3300025911 Bacteria 3293
425 Ga0207654_10082296 3300025911 Bacteria 1941
426 Ga0207654_10120610 3300025911 Unclassified 1646
427 Ga0207707_10096152 3300025912 Bacteria 2588
428 Ga0207695_10195967 3300025913 Bacteria 1936
429 Ga0207671_10088603 3300025914 Bacteria 2328
430 Ga0207693_10001046 3300025915 Bacteria 24742
431 Ga0207693_10005971 3300025915 Bacteria 10101
432 Ga0207693_10025505 3300025915 Bacteria 4687
433 Ga0207693_10028645 3300025915 Bacteria 4401
434 Ga0207693_10110230 3300025915 Bacteria 2158
435 Ga0207660_10014668 3300025917 Bacteria 5160
436 Ga0207657_10007001 3300025919 Bacteria 11609
437 Ga0207652_10057063 3300025921 Bacteria 3362
438 Ga0207646_10003221 3300025922 Bacteria 18630
439 Ga0207646_10004343 3300025922 Bacteria 15455
440 Ga0207646_10009607 3300025922 Bacteria 9541
441 Ga0207646_10019103 3300025922 Bacteria 6375
442 Ga0207646_10029382 3300025922 Bacteria 4997
443 Ga0207646_10030343 3300025922 Bacteria 4902
444 Ga0207646_10033685 3300025922 Bacteria 4631
445 Ga0207646_10043078 3300025922 Bacteria 4054
446 Ga0207646_10073313 3300025922 Bacteria 3058
447 Ga0207646_10183237 3300025922 Bacteria 1891
448 Ga0207646_10265217 3300025922 Bacteria 1552
449 Ga0207681_10036083 3300025923 Bacteria 3260
450 Ga0207681_10061999 3300025923 Bacteria 2573
451 Ga0207681_10127358 3300025923 Bacteria 1877
452 Ga0207681_10208225 3300025923 Bacteria 1506
453 Ga0207650_10002984 3300025925 Bacteria 11672
454 Ga0207650_10011902 3300025925 Bacteria 5994
455 Ga0207650_10054622 3300025925 Bacteria 2964
456 Ga0207650_10230414 3300025925 Bacteria 1494
457 Ga0207650_10313024 3300025925 Bacteria 1284
458 Ga0207659_10008782 3300025926 Bacteria 6294
459 Ga0207659_10054464 3300025926 Bacteria 2857
460 Ga0207659_10286036 3300025926 Bacteria 1349
461 Ga0207687_10000635 3300025927 Bacteria 23711
462 Ga0207687_10003484 3300025927 Bacteria 10594
463 Ga0207687_10096531 3300025927 Bacteria 2166
464 Ga0207700_10000044 3300025928 Bacteria 89454
465 Ga0207700_10006567 3300025928 Bacteria 7041
466 Ga0207700_10018993 3300025928 Bacteria 4634
467 Ga0207664_10010348 3300025929 Bacteria 6588
468 Ga0207644_10001047 3300025931 Bacteria 17738
469 Ga0207644_10295869 3300025931 Bacteria 1303
470 Ga0207706_10017974 3300025933 Bacteria 6362
471 Ga0207706_10113213 3300025933 Bacteria 2387
472 Ga0207706_10129129 3300025933 Bacteria 2222
473 Ga0207706_10141268 3300025933 Unclassified 2118
474 Ga0207686_10000643 3300025934 Bacteria 21534
475 Ga0207709_10032098 3300025935 Bacteria 3073
476 Ga0207670_10056524 3300025936 Unclassified 2657
477 Ga0207670_10306015 3300025936 Bacteria 1246
478 Ga0207669_10038658 3300025937 Bacteria 2750
479 Ga0207669_10041812 3300025937 Unclassified 2671
480 Ga0207669_10121366 3300025937 Bacteria 1775
481 Ga0207704_10250443 3300025938 Bacteria 1329
482 Ga0207704_10281218 3300025938 Bacteria 1265
483 Ga0207665_10006026 3300025939 Bacteria 8051
484 Ga0207665_10017055 3300025939 Bacteria 4769
485 Ga0207665_10091843 3300025939 Bacteria 2105
486 Ga0207691_10013016 3300025940 Bacteria 7966
487 Ga0207691_10068564 3300025940 Bacteria 3204
488 Ga0207691_10146946 3300025940 Bacteria 2075
489 Ga0207691_10286203 3300025940 Bacteria 1418
490 Ga0207691_10318802 3300025940 Bacteria 1333
491 Ga0207711_10000841 3300025941 Bacteria 29654
492 Ga0207711_10005312 3300025941 Bacteria 10922
493 Ga0207689_10000063 3300025942 Bacteria 84295
494 Ga0207689_10010059 3300025942 Bacteria 8154
495 Ga0207689_10013669 3300025942 Bacteria 6922
496 Ga0207689_10020635 3300025942 Bacteria 5540
497 Ga0207689_10185257 3300025942 Bacteria 1717
498 Ga0207689_10212456 3300025942 Bacteria 1598
499 Ga0207679_10308239 3300025945 Bacteria 1367
500 Ga0207667_10243214 3300025949 Unclassified 1841
501 Ga0207651_10023911 3300025960 Bacteria 3768
502 Ga0207651_10028898 3300025960 Bacteria 3505
503 Ga0207651_10091941 3300025960 Bacteria 2223
504 Ga0207651_10169639 3300025960 Bacteria 1720
505 Ga0207651_10202506 3300025960 Bacteria 1592
506 Ga0207651_10252111 3300025960 Bacteria 1445
507 Ga0207712_10015359 3300025961 Bacteria 4938
508 Ga0207712_10045196 3300025961 Bacteria 3048
509 Ga0207668_10001978 3300025972 Bacteria 11979
510 Ga0207668_10011031 3300025972 Bacteria 5480
511 Ga0207668_10012226 3300025972 Bacteria 5248
512 Ga0207668_10032780 3300025972 Bacteria 3437
513 Ga0207668_10065481 3300025972 Bacteria 2572
514 Ga0207668_10103016 3300025972 Bacteria 2125
515 Ga0207668_10332053 3300025972 Bacteria 1265
516 Ga0207658_10008543 3300025986 Bacteria 6966
517 Ga0207658_10019288 3300025986 Bacteria 4715
518 Ga0207658_10046385 3300025986 Bacteria 3173
519 Ga0207658_10062496 3300025986 Bacteria 2787
520 Ga0207658_10105462 3300025986 Bacteria 2217
521 Ga0207658_10232403 3300025986 Bacteria 1557
522 Ga0207677_10002282 3300026023 Bacteria 10071
523 Ga0207703_10000555 3300026035 Bacteria 38310
524 Ga0207703_10002087 3300026035 Bacteria 17564
525 Ga0207703_10122763 3300026035 Bacteria 2232
526 Ga0207639_10435062 3300026041 Bacteria 1188
527 Ga0207678_10259107 3300026067 Bacteria 1490
528 Ga0207708_10018394 3300026075 Bacteria 5262
529 Ga0207708_10062575 3300026075 Bacteria 2843
530 Ga0207708_10081647 3300026075 Bacteria 2485
531 Ga0207702_10134330 3300026078 Bacteria 2230
532 Ga0207641_10020625 3300026088 Bacteria 5415
533 Ga0207641_10025929 3300026088 Bacteria 4836
534 Ga0207641_10047673 3300026088 Bacteria 3614
535 Ga0207641_10069192 3300026088 Bacteria 3029
536 Ga0207641_10100585 3300026088 Bacteria 2546
537 Ga0207641_10142203 3300026088 Bacteria 2166
538 Ga0207641_10399864 3300026088 Bacteria 1319
539 Ga0207648_10011859 3300026089 Bacteria 8191
540 Ga0207648_10029343 3300026089 Bacteria 4878
541 Ga0207648_10042001 3300026089 Bacteria 4015
542 Ga0207648_10079303 3300026089 Bacteria 2864
543 Ga0207648_10166593 3300026089 Bacteria 1947
544 Ga0207676_10000321 3300026095 Bacteria 41273
545 Ga0207676_10007399 3300026095 Bacteria 7786
546 Ga0207674_10012506 3300026116 Bacteria 9482
547 Ga0207674_10063296 3300026116 Bacteria 3734
548 Ga0207674_10172367 3300026116 Bacteria 2117
549 Ga0207675_100013970 3300026118 Bacteria 7486
550 Ga0207675_100035369 3300026118 Bacteria 4659
551 Ga0207675_100035830 3300026118 Bacteria 4629
552 Ga0207675_100058808 3300026118 Bacteria 3587
553 Ga0207675_100079992 3300026118 Bacteria 3063
554 Ga0207675_100082929 3300026118 Bacteria 3007
555 Ga0207675_100099791 3300026118 Bacteria 2735
556 Ga0207683_10000560 3300026121 Bacteria 34398
557 Ga0207683_10019830 3300026121 Bacteria 5743
558 Ga0207683_10093862 3300026121 Bacteria 2674
559 Ga0207698_10552693 3300026142 Bacteria 1129
560 Ga0209588_1004373 3300027671 Bacteria 3981
561 Ga0209588_1014535 3300027671 Bacteria 2411
562 Ga0209588_1015637 3300027671 Bacteria 2335
563 Ga0209588_1030415 3300027671 Bacteria 1725
564 Ga0209966_1008047 3300027695 Bacteria 1861
565 Ga0209813_10000575 3300027866 Bacteria 8590
566 Ga0209813_10018099 3300027866 Bacteria 1943
567 Ga0207428_10000559 3300027907 Bacteria 43979
568 Ga0207428_10000960 3300027907 Bacteria 31981
569 Ga0207428_10277953 3300027907 Bacteria 1243
570 Ga0268266_10006926 3300028379 Bacteria 10314
571 Ga0268266_10035284 3300028379 Bacteria 4254
572 Ga0268266_10367220 3300028379 Bacteria 1355
573 Ga0268265_10021342 3300028380 Bacteria 4535
574 Ga0268265_10034797 3300028380 Bacteria 3675
575 Ga0268265_10040660 3300028380 Bacteria 3435
576 Ga0268265_10054355 3300028380 Bacteria 3038
577 Ga0268265_10098771 3300028380 Bacteria 2352
578 Ga0268265_10248571 3300028380 Bacteria 1574
579 Ga0268265_10378072 3300028380 Bacteria 1302
580 Ga0268265_10468465 3300028380 Bacteria 1180
581 Ga0268264_10002943 3300028381 Bacteria 14790
582 Ga0268264_10005994 3300028381 Bacteria 10290
583 Ga0268264_10007734 3300028381 Bacteria 8950
584 Ga0268264_10034426 3300028381 Bacteria 4167
585 Ga0268264_10103526 3300028381 Bacteria 2479
586 Ga0268264_10159430 3300028381 Bacteria 2031
587 Ga0268264_10243829 3300028381 Bacteria 1666
588 Ga0268264_10269470 3300028381 Bacteria 1590
589 Ga0268264_10293130 3300028381 Bacteria 1529
590 Ga0268264_10345071 3300028381 Bacteria 1415
591 Ga0268264_10354527 3300028381 Bacteria 1397
592 Ga0268264_10393779 3300028381 Bacteria 1329
593 Ga0307512_10020379 3300030522 Bacteria 6005
594 Ga0265331_10063187 3300031250 Bacteria 1745
595 Ga0307513_10166155 3300031456 Bacteria 2091
596 Ga0307408_100049016 3300031548 Bacteria 3032
597 Ga0307408_100059241 3300031548 Bacteria 2787
598 Ga0307408_100137827 3300031548 Bacteria 1911
599 Ga0307408_100145617 3300031548 Bacteria 1864
600 Ga0307508_10051498 3300031616 Bacteria 3659
601 Ga0316576_10039079 3300031727 Bacteria 3406
602 Ga0316578_10010150 3300031728 Bacteria 4874
603 Ga0316578_10101152 3300031728 Bacteria 1728
604 Ga0307516_10001211 3300031730 Bacteria 35950
605 Ga0307410_10176607 3300031852 Bacteria 1614
606 Ga0307407_10162409 3300031903 Bacteria 1463
607 Ga0307415_100030288 3300032126 Bacteria 3471
608 Ga0307510_10033242 3300033180 Bacteria 5796
609 Ga0373940_0013572 3300035088 Bacteria 1974
610 Ga0373944_0040064 3300035089 Bacteria 1445
611 Ga0373949_0004726 3300035090 Bacteria 3093
612 Ga0373951_0014054 3300035091 Bacteria 1800
613 Ga0373923_0012836 3300035111 Bacteria 3109
614 Ga0373936_0039020 3300035113 Bacteria 1900
615 Ga0373941_0022067 3300035115 Bacteria 1803
616 Ga0373941_0062818 3300035115 Bacteria 1213
617 Ga0373954_0003658 3300035118 Bacteria 6543
618 Ga0373957_0059703 3300035120 Bacteria 1475
619 Ga0373957_0082670 3300035120 Bacteria 1270
620 Ga0373962_0014921 3300035242 Bacteria 1986
621 Ga0373931_0002667 3300035691 Bacteria 7931
622 Ga0373931_0188056 3300035691 Bacteria 1227
623 Ga0373935_0031208 3300035692 Bacteria 3306
624 Ga0373935_0185720 3300035692 Bacteria 1429
625 Ga0373927_0139357 3300035695 Bacteria 1586
626 Ga0373927_0279994 3300035695 Bacteria 1097
627 Ga0373947_0060851 3300035725 Bacteria 2293
628 Ga0373947_0164178 3300035725 Bacteria 1438
629 Ga0373937_0062523 3300036401 Bacteria 3423
630 Ga0373937_0126343 3300036401 Bacteria 2386
631 Ga0373937_0538006 3300036401 Bacteria 1110
632 Ga0316582_0105377 3300036647 Bacteria 1872
633 Ga0316584_0012447 3300036712 Bacteria 6001
634 Ga0373925_0118911 3300037068 Bacteria 2049
635 Ga0373925_0144422 3300037068 Bacteria 1864
636 Ga0395899_0054930 3300037312 Bacteria 2946
637 Ga0395900_0417467 3300037418 Bacteria 1303
638 Ga0395898_0026610 3300037466 Bacteria 5818
639 Ga0395905_0450368 3300037471 Bacteria 1185
640 Ga0436364_0005520 3300037853 Bacteria 24950
641 Ga0436364_0305897 3300037853 Bacteria 1206
642 Ga0436364_0488545 3300037853 Bacteria 3357
643 Ga0395901_0018260 3300038443 Bacteria 7161
644 Ga0436360_0181564 3300039438 Bacteria 1226
645 Ga0439453_0000397 3300041408 Bacteria 4663
646 Ga0451800_1408765 3300041459 Bacteria 1459
647 Ga0439443_005409 3300042003 Bacteria 1706
648 Ga0439435_0027496 3300042436 Bacteria 1522
649 Ga0439435_0068074 3300042436 Bacteria 1049
650 Ga0451577_0001374 3300042876 Bacteria 32703
651 Ga0451577_0046317 3300042876 Bacteria 3891
652 Ga0451577_0107293 3300042876 Bacteria 2496
653 Ga0453683_0016160 3300044673 Bacteria 4822
654 Ga0453683_0027055 3300044673 Bacteria 3641
655 Ga0453683_0033891 3300044673 Bacteria 3220
656 Ga0453683_0036150 3300044673 Bacteria 3109
657 Ga0453683_0067597 3300044673 Bacteria 2234
658 Ga0453683_0103393 3300044673 Bacteria 1789
659 Ga0453683_0120657 3300044673 Bacteria 1650
660 Ga0453683_0149677 3300044673 Bacteria 1475
661 Ga0453683_0203049 3300044673 Bacteria 1259
662 Ga0453684_0013625 3300044712 Bacteria 13175
663 Ga0453684_0019580 3300044712 Bacteria 10287
664 Ga0453684_0104944 3300044712 Bacteria 3448
665 Ga0453684_0111466 3300044712 Bacteria 3323
666 Ga0451576_0003424 3300045051 Bacteria 21816
667 Ga0451576_0047172 3300045051 Bacteria 4530
668 Ga0451576_0092367 3300045051 Bacteria 3148
669 Ga0451576_0254862 3300045051 Unclassified 1834
670 Ga0451576_0431058 3300045051 Bacteria 1383
671 Ga0495603_0048010 3300046455 Bacteria 2542
672 Ga0495580_0018598 3300046472 Bacteria 5172
673 Ga0495580_0037839 3300046472 Bacteria 3460
674 Ga0495580_0058091 3300046472 Bacteria 2722
675 Ga0495582_0004716 3300046473 Bacteria 7661
676 Ga0495582_0009718 3300046473 Bacteria 5299
677 Ga0495584_0032101 3300046491 Bacteria 2659
678 Ga0495628_0208639 3300046516 Unclassified 1470
679 Ga0495652_0149318 3300046529 Unclassified 1828
680 Ga0495635_0030606 3300046663 Bacteria 3739
681 Ga0495659_0008195 3300046664 Bacteria 3323
682 Ga0495659_0040516 3300046664 Bacteria 1661
683 Ga0495588_0049511 3300046674 Bacteria 2161
684 Ga0495623_0135494 3300046679 Bacteria 1470
685 Ga0495658_0001727 3300046683 Bacteria 11316
686 Ga0495613_0004826 3300046689 Bacteria 10117
687 Ga0495671_0005896 3300046692 Bacteria 7129
688 Ga0495636_0059668 3300047318 Bacteria 1610
689 Ga0495674_0051120 3300047319 Bacteria 3644
690 Ga0495684_0297306 3300047471 Unclassified 1160
691 Ga0496100_0010120 3300048903 Bacteria 5330
692 Ga0496101_0010478 3300048904 Bacteria 6122
693 Ga0496102_0003244 3300048905 Bacteria 13796
694 Ga0496102_0021322 3300048905 Bacteria 5730
695 Ga0496102_0031634 3300048905 Bacteria 4747
696 Ga0496102_0182207 3300048905 Bacteria 1979
697 Ga0496103_0023033 3300048906 Bacteria 3754
698 Ga0496103_0038336 3300048906 Bacteria 2940
699 Ga0496104_0000189 3300048907 Bacteria 55677
700 Ga0496104_0044835 3300048907 Bacteria 4156
701 Ga0496104_0210801 3300048907 Bacteria 1854
702 Ga0496105_0007294 3300048908 Bacteria 8543
703 Ga0496106_0015195 3300048909 Bacteria 5698
704 Ga0496107_0100021 3300048910 Bacteria 2125
705 Ga0496108_0039024 3300048911 Bacteria 3958
706 Ga0496108_0045684 3300048911 Bacteria 3658
707 Ga0496109_0052521 3300048912 Bacteria 3715
708 Ga0496109_0065295 3300048912 Bacteria 3331
709 Ga0496110_0004257 3300048913 Bacteria 11075
710 Ga0496110_0258763 3300048913 Bacteria 1584
711 Ga0496111_0001828 3300048914 Bacteria 12520
712 Ga0496111_0118435 3300048914 Bacteria 1955
713 Ga0496112_0001027 3300048915 Bacteria 20520
714 Ga0496112_0043357 3300048915 Bacteria 4405
715 Ga0496112_0104006 3300048915 Bacteria 2810
716 Ga0496112_0177067 3300048915 Bacteria 2097
717 Ga0496113_0010566 3300048916 Bacteria 6109
718 Ga0496115_0020594 3300048918 Bacteria 5088
719 Ga0496119_0004094 3300048922 Bacteria 14698
720 Ga0496119_0009210 3300048922 Bacteria 8520
721 Ga0496120_0026651 3300048923 Bacteria 3566
722 Ga0496122_0001180 3300048925 Bacteria 44683
723 Ga0496123_0001130 3300048926 Bacteria 39839
724 Ga0496124_0107016 3300048927 Bacteria 2257
725 Ga0501031_0031253 3300049568 Bacteria 3473
726 Ga0501034_0092269 3300049571 Bacteria 3026
727 Ga0501036_0004096 3300049572 Bacteria 11732
728 Ga0501036_0082912 3300049572 Bacteria 2710
729 Ga0501036_0188595 3300049572 Bacteria 1735
730 Ga0501036_0228642 3300049572 Bacteria 1561
731 Ga0501038_0021124 3300049574 Bacteria 5848
732 Ga0501038_0127420 3300049574 Bacteria 2094
733 Ga0501038_0196419 3300049574 Bacteria 1622
734 Ga0501038_0258493 3300049574 Bacteria 1377
735 Ga0501039_0077903 3300049575 Bacteria 2578
736 Ga0501039_0093681 3300049575 Bacteria 2341
737 Ga0501040_0000045 3300049576 Bacteria 57060
738 Ga0501040_0013930 3300049576 Bacteria 5295
739 Ga0501040_0113873 3300049576 Bacteria 1893
740 Ga0501041_0134117 3300049577 Bacteria 1543
741 Ga0501042_0000178 3300049578 Bacteria 29313
742 Ga0501042_0050769 3300049578 Bacteria 2958
743 Ga0501042_0087517 3300049578 Bacteria 2235
744 Ga0501042_0148991 3300049578 Bacteria 1687
745 Ga0501043_0028620 3300049579 Bacteria 4374
746 Ga0501046_0082903 3300049580 Bacteria 2476
747 Ga0501046_0114438 3300049580 Bacteria 2058
748 Ga0501048_0028169 3300049582 Bacteria 4079
749 Ga0501048_0032108 3300049582 Bacteria 3796
750 Ga0501048_0060586 3300049582 Bacteria 2682
751 Ga0501067_0030511 3300049583 Bacteria 2989
752 Ga0501068_0169347 3300049584 Bacteria 1378
753 Ga0501068_0172113 3300049584 Bacteria 1367
754 Ga0501071_0007435 3300049587 Bacteria 7195
755 Ga0501072_0000438 3300049588 Bacteria 29744
756 Ga0501072_0011936 3300049588 Bacteria 6635
757 Ga0501072_0094010 3300049588 Bacteria 2382
758 Ga0501072_0102815 3300049588 Bacteria 2271
759 Ga0501072_0352868 3300049588 Bacteria 1168
760 Ga0501073_0084134 3300049589 Bacteria 2214
761 Ga0501074_0016682 3300049590 Bacteria 5330
762 Ga0501074_0018261 3300049590 Bacteria 5096
763 Ga0501074_0191530 3300049590 Bacteria 1458
764 Ga0501075_0001220 3300049591 Bacteria 16663
765 Ga0501075_0034071 3300049591 Bacteria 3790
766 Ga0501075_0043028 3300049591 Bacteria 3387
767 Ga0501075_0045092 3300049591 Bacteria 3309
768 Ga0501075_0066894 3300049591 Bacteria 2712
769 Ga0501076_0000125 3300049592 Bacteria 42511
770 Ga0501076_0000151 3300049592 Bacteria 39780
771 Ga0501076_0009016 3300049592 Bacteria 7347
772 Ga0501076_0033709 3300049592 Bacteria 3999
773 Ga0501076_0036808 3300049592 Bacteria 3836
774 Ga0501077_0000473 3300049593 Bacteria 24496
775 Ga0501077_0145044 3300049593 Bacteria 1506
776 Ga0501077_0236693 3300049593 Bacteria 1160
777 Ga0501225_0023974 3300049705 Bacteria 1681
778 Ga0501079_0005031 3300049741 Bacteria 9813
779 Ga0501079_0005439 3300049741 Bacteria 9491
780 Ga0501079_0005896 3300049741 Bacteria 9172
781 Ga0501079_0008494 3300049741 Bacteria 7788
782 Ga0501079_0070760 3300049741 Bacteria 2694
783 Ga0501080_0095020 3300049742 Bacteria 2768
784 Ga0501080_0168475 3300049742 Bacteria 2021
785 Ga0501080_0215698 3300049742 Bacteria 1758
786 Ga0501080_0419388 3300049742 Bacteria 1202
787 Ga0501080_0454621 3300049742 Bacteria 1148
788 Ga0501081_0001205 3300049743 Bacteria 15707
789 Ga0501081_0010957 3300049743 Bacteria 5925
790 Ga0501081_0029596 3300049743 Bacteria 3702
791 Ga0501081_0060423 3300049743 Bacteria 2625
792 Ga0501081_0067889 3300049743 Bacteria 2481
793 Ga0501081_0154035 3300049743 Bacteria 1653
794 Ga0501081_0234220 3300049743 Bacteria 1338
795 Ga0501035_0176884 3300049822 Bacteria 1840
796 Ga0501045_0058638 3300049824 Bacteria 2819
797 Ga0501045_0068678 3300049824 Bacteria 2604
798 Ga0501045_0097757 3300049824 Bacteria 2172
799 Ga0501045_0166858 3300049824 Bacteria 1640
800 nmdc:mga03n38_1728_c1 3300050490 Bacteria 6440
801 nmdc:mga00v17_2121_c1 3300050491 Bacteria 10196
802 nmdc:mga0yw44_182566_c1 3300050492 Bacteria 1381
803 nmdc:mga0yw44_4220_c1 3300050492 Bacteria 6543
804 nmdc:mga0k408_42587_c1 3300050493 Bacteria 2615
805 nmdc:mga06z11_1905_c1 3300050494 Bacteria 7867
806 nmdc:mga06z11_22428_c1 3300050494 Bacteria 2949
807 nmdc:mga06z11_3010_c1 3300050494 Bacteria 6482
808 nmdc:mga06z11_448_c1 3300050494 Bacteria 15394
809 nmdc:mga04h51_275_c1 3300050495 Bacteria 13177
810 nmdc:mga07m45_67397_c1 3300050496 Bacteria 2034
811 nmdc:mga05p37_1334_c1 3300050507 Bacteria 28685
812 nmdc:mga05p37_144636_c1 3300050507 Bacteria 2912
813 nmdc:mga05p37_163251_c1 3300050507 Bacteria 2720
814 nmdc:mga05p37_16373_c1 3300050507 Bacteria 8930
815 nmdc:mga05p37_21020_c1 3300050507 Bacteria 7898
816 nmdc:mga05p37_219027_c1 3300050507 Bacteria 2298
817 nmdc:mga05p37_22349_c1 3300050507 Bacteria 7672
818 nmdc:mga05p37_224486_c1 3300050507 Bacteria 2266
819 nmdc:mga05p37_2446_c1 3300050507 Bacteria 21595
820 nmdc:mga05p37_268153_c1 3300050507 Bacteria 2041
821 nmdc:mga05p37_3021_c1 3300050507 Bacteria 19531
822 nmdc:mga05p37_484447_c1 3300050507 Bacteria 1424
823 nmdc:mga05p37_515418_c1 3300050507 Bacteria 1369
824 nmdc:mga05p37_68471_c1 3300050507 Bacteria 4365
825 nmdc:mga05p37_8208_c1 3300050507 Bacteria 12347
826 nmdc:mga05p37_8948_c1 3300050507 Bacteria 11841
827 nmdc:mga05p37_97695_c1 3300050507 Bacteria 3617
828 nmdc:mga09592_116731_c1 3300050508 Bacteria 2291
829 nmdc:mga09592_134126_c1 3300050508 Bacteria 2132
830 nmdc:mga09592_23281_c1 3300050508 Bacteria 5115
831 nmdc:mga09592_275625_c1 3300050508 Bacteria 1459
832 nmdc:mga09592_34412_c1 3300050508 Bacteria 4235
833 nmdc:mga09592_34524_c1 3300050508 Bacteria 4228
834 nmdc:mga09592_50785_c1 3300050508 Bacteria 3498
835 nmdc:mga09592_60915_c1 3300050508 Bacteria 3191
836 nmdc:mga09592_636_c1 3300050508 Bacteria 26756
837 nmdc:mga09592_87053_c1 3300050508 Bacteria 2666
838 nmdc:mga0qj67_14893_c1 3300050509 Bacteria 5882
839 nmdc:mga0qj67_1562_c1 3300050509 Bacteria 16088
840 nmdc:mga0qj67_29162_c1 3300050509 Bacteria 4286
841 nmdc:mga0qj67_377790_c1 3300050509 Bacteria 1144
842 nmdc:mga0qj67_49589_c1 3300050509 Bacteria 3318
843 nmdc:mga0qj67_559_c1 3300050509 Bacteria 25317
844 nmdc:mga0qj67_5647_c1 3300050509 Bacteria 9150
845 nmdc:mga0qj67_99085_c1 3300050509 Bacteria 2348
846 nmdc:mga06r32_10886_c1 3300050510 Bacteria 8191
847 nmdc:mga06r32_134110_c1 3300050510 Bacteria 2451
848 nmdc:mga06r32_15469_c1 3300050510 Bacteria 6925
849 nmdc:mga06r32_175853_c1 3300050510 Bacteria 2125
850 nmdc:mga06r32_2238_c1 3300050510 Bacteria 17320
851 nmdc:mga06r32_2497_c1 3300050510 Bacteria 16458
852 nmdc:mga06r32_43870_c1 3300050510 Bacteria 4256
853 nmdc:mga06r32_46506_c1 3300050510 Bacteria 4141
854 nmdc:mga06r32_5863_c1 3300050510 Bacteria 11056
855 nmdc:mga06r32_872_c1 3300050510 Bacteria 26841
856 nmdc:mga06r32_92832_c1 3300050510 Bacteria 2952
857 nmdc:mga06r32_943_c1 3300050510 Bacteria 25896
858 nmdc:mga08y16_17265_c1 3300050511 Bacteria 7598
859 nmdc:mga08y16_542_c1 3300050511 Bacteria 34971
860 nmdc:mga08y16_57612_c1 3300050511 Bacteria 4059
861 nmdc:mga08y16_9141_c1 3300050511 Bacteria 10401
862 nmdc:mga0n895_134839_c1 3300050512 Bacteria 2495
863 nmdc:mga0n895_149879_c1 3300050512 Bacteria 2362
864 nmdc:mga0n895_15187_c1 3300050512 Bacteria 7017
865 nmdc:mga0n895_159369_c1 3300050512 Bacteria 2288
866 nmdc:mga0n895_186823_c1 3300050512 Bacteria 2103
867 nmdc:mga0n895_209876_c1 3300050512 Bacteria 1978
868 nmdc:mga0n895_251589_c1 3300050512 Bacteria 1793
869 nmdc:mga0n895_3503_c1 3300050512 Bacteria 12673
870 nmdc:mga0n895_566216_c1 3300050512 Bacteria 1141
871 nmdc:mga0n895_93242_c1 3300050512 Bacteria 3015
872 nmdc:mga0rr50_177125_c1 3300050513 Bacteria 1741
873 nmdc:mga0rr50_184463_c1 3300050513 Bacteria 1707
874 nmdc:mga0rr50_204207_c1 3300050513 Bacteria 1625
875 nmdc:mga0rr50_31885_c1 3300050513 Bacteria 3748
876 nmdc:mga0rr50_89588_c1 3300050513 Bacteria 2392
877 nmdc:mga08x19_1159_c1 3300050514 Bacteria 16487
878 nmdc:mga08x19_147658_c1 3300050514 Bacteria 1591
879 nmdc:mga08x19_179301_c1 3300050514 Bacteria 1445
880 nmdc:mga08x19_38074_c1 3300050514 Bacteria 3054
881 nmdc:mga08x19_49725_c1 3300050514 Bacteria 2690
882 nmdc:mga08x19_55005_c1 3300050514 Bacteria 2563
883 nmdc:mga08x19_74397_c1 3300050514 Bacteria 2219
884 nmdc:mga08x19_99356_c1 3300050514 Bacteria 1929
885 nmdc:mga0a205_12600_c1 3300050515 Bacteria 7826
886 nmdc:mga0a205_188215_c1 3300050515 Bacteria 1957
887 nmdc:mga0a205_1924_c1 3300050515 Bacteria 18044
888 nmdc:mga0a205_222512_c1 3300050515 Bacteria 1772
889 nmdc:mga0a205_2792_c1 3300050515 Bacteria 15442
890 nmdc:mga0a205_300350_c1 3300050515 Bacteria 1479
891 nmdc:mga0a205_4234_c1 3300050515 Bacteria 7387
892 nmdc:mga0a205_4495_c1 3300050515 Bacteria 12512
893 nmdc:mga0a205_60489_c1 3300050515 Bacteria 3658
894 Ga0495601_0202348 3300053077 Bacteria 1297
895 Ga0495595_0060738 3300053084 Bacteria 1769
896 Ga0495619_0023214 3300053085 Bacteria 3975
897 Ga0495619_0192904 3300053085 Unclassified 1410
898 Ga0500646_0000278 3300053090 Bacteria 15722
899 Ga0500556_0000023 3300053104 Bacteria 168755
900 Ga0500568_0000052 3300053139 Bacteria 112079
901 Ga0500577_0007839 3300053142 Bacteria 3012
902 Ga0500588_0007200 3300053146 Bacteria 2555
903 Ga0500616_0041980 3300053153 Bacteria 2451
904 Ga0500634_0000023 3300053161 Bacteria 90425
905 Ga0501084_0000110 3300054114 Bacteria 61578
906 Ga0501084_0009385 3300054114 Bacteria 8094
907 Ga0501084_0019702 3300054114 Bacteria 5621
908 Ga0501084_0046471 3300054114 Bacteria 3637
909 Ga0501084_0058258 3300054114 Bacteria 3232
910 Ga0501084_0102898 3300054114 Bacteria 2398
911 Ga0590071_038495 3300059421 Bacteria 1149
912 Ga0501082_0000201 3300060353 Bacteria 52098
913 Ga0501082_0092648 3300060353 Bacteria 2610
914 Ga0501082_0441818 3300060353 Bacteria 1136
915 Ga0530510_0000184 3300061734 Bacteria 38295
916 Ga0530510_0005382 3300061734 Bacteria 8858
917 Ga0530510_0067888 3300061734 Bacteria 2587
918 Ga0530510_0073430 3300061734 Bacteria 2483
919 Ga0530510_0099084 3300061734 Bacteria 2131
920 Ga0530510_0191716 3300061734 Bacteria 1517
921 2894776976 2894772417 Bacteria 5305674
922 2929204296 2929199973 Bacteria 7260745
923 8055910627 8055909800 Bacteria 7278581
924 Ga0453684_0365656
925 JGI25406J46586_10009819
926 Ga0065715_10097211
927 Ga0065707_10015147
928 Ga0070676_10148340
929 Ga0070676_10225572
930 Ga0070683_100122886
931 Ga0070670_100001317
932 Ga0070670_100007583
933 Ga0070670_100037176
934 Ga0070670_100119949
935 Ga0068869_100000363
936 Ga0068869_100014493
937 Ga0068869_100017369
938 Ga0068869_100328003
939 Ga0070666_10004632
940 Ga0070666_10163627
941 Ga0070680_100035870
942 Ga0068868_100013049
943 Ga0070660_100268418
944 Ga0070689_100002678
945 Ga0070689_100062095
946 Ga0070689_100098591
947 Ga0070689_100399016
948 Ga0070691_10014945
949 Ga0070687_100032287
950 Ga0070687_100156794
951 Ga0070668_100005373
952 Ga0070668_100031143
953 Ga0070668_100053334
954 Ga0070668_100054571
955 Ga0070668_100076449
956 Ga0070668_100287482
957 Ga0070669_100050367
958 Ga0070669_100251450
959 Ga0070675_100004300
960 Ga0070675_100010178
961 Ga0070675_100012037
962 Ga0070675_100327143
963 Ga0070671_100029228
964 Ga0070671_100219861
965 Ga0070674_100044854
966 Ga0070674_100061537
967 Ga0070674_100112435
968 Ga0070673_100059167
969 Ga0070673_100125773
970 Ga0070688_100010856
971 Ga0070667_100001652
972 Ga0070667_100052660
973 Ga0070667_100069556
974 Ga0070667_100148596
975 Ga0070667_100187308
976 Ga0070709_10227703
977 Ga0070714_100016619
978 Ga0070713_100000129
979 Ga0070713_100016854
980 Ga0070713_100026206
981 Ga0070710_10023747
982 Ga0070701_10011779
983 Ga0070701_10115486
984 Ga0070711_100000301
985 Ga0070711_100169736
986 Ga0070705_100069330
987 Ga0070705_100169896
988 Ga0070700_100061652
989 Ga0070700_100069719
990 Ga0070694_100233925
991 Ga0070708_100009942
992 Ga0070708_100015637
993 Ga0070708_100033701
994 Ga0070708_100037459
995 Ga0070708_100042283
996 Ga0070708_100045638
997 Ga0070708_100099493
998 Ga0070708_100170529
999 Ga0070708_100291474
1000 Ga0070663_100012079
1001 Ga0070678_100039997
1002 Ga0070678_100042827
1003 Ga0070678_100089752
1004 Ga0070678_100477165
1005 Ga0070662_100059750
1006 Ga0068867_100002218
1007 Ga0068867_100123444
1008 Ga0068867_100126149
1009 Ga0070685_10001030
1010 Ga0070706_100009454
1011 Ga0070706_100011186
1012 Ga0070706_100015368
1013 Ga0070706_100025893
1014 Ga0070706_100036531
1015 Ga0070706_100063941
1016 Ga0070706_100256725
1017 Ga0070707_100011580
1018 Ga0070707_100013073
1019 Ga0070707_100020575
1020 Ga0070707_100044273
1021 Ga0070707_100077569
1022 Ga0070707_100083231
1023 Ga0070698_100014048
1024 Ga0070698_100017798
1025 Ga0070698_100024700
1026 Ga0070698_100048588
1027 Ga0070698_100059148
1028 Ga0070698_100094096
1029 Ga0070698_100275591
1030 Ga0070698_100455700
1031 Ga0070699_100005003
1032 Ga0070699_100009997
1033 Ga0070699_100010788
1034 Ga0070699_100018656
1035 Ga0070699_100021925
1036 Ga0070699_100055952
1037 Ga0070699_100126744
1038 Ga0070699_100166165
1039 Ga0070699_100221115
1040 Ga0070699_100246288
1041 Ga0070699_100327758
1042 Ga0070697_100005322
1043 Ga0070697_100033553
1044 Ga0070697_100035015
1045 Ga0070697_100053946
1046 Ga0070697_100084432
1047 Ga0070697_100166404
1048 Ga0070697_100333274
1049 Ga0070697_100343892
1050 Ga0070672_100002126
1051 Ga0070672_100108502
1052 Ga0070672_100339085
1053 Ga0070686_100206727
1054 Ga0070695_100019867
1055 Ga0070695_100204683
1056 Ga0070696_100052578
1057 Ga0070696_100090724
1058 Ga0070693_100010443
1059 Ga0070665_100065828
1060 Ga0070704_100026253
1061 Ga0070704_100053413
1062 Ga0070704_100071130
1063 Ga0070704_100256876
1064 Ga0068857_100005400
1065 Ga0068857_100038058
1066 Ga0068857_100098892
1067 Ga0068857_100180566
1068 Ga0068854_100016202
1069 Ga0068856_100364395
1070 Ga0070702_100063787
1071 Ga0070702_100134216
1072 Ga0070702_100237247
1073 Ga0068852_100188494
1074 Ga0068852_100338136
1075 Ga0068852_100360619
1076 Ga0068859_100003564
1077 Ga0068859_100007223
1078 Ga0068859_100136911
1079 Ga0068859_100157038
1080 Ga0068859_100330094
1081 Ga0068859_100440692
1082 Ga0068864_100002127
1083 Ga0068864_100005802
1084 Ga0068864_100006166
1085 Ga0068864_100300041
1086 Ga0068866_10002296
1087 Ga0068866_10027296
1088 Ga0068861_100000922
1089 Ga0068861_100037555
1090 Ga0068861_100059254
1091 Ga0068861_100150895
1092 Ga0068861_100417986
1093 Ga0068870_10021642
1094 Ga0068870_10053179
1095 Ga0068870_10076677
1096 Ga0068863_100002365
1097 Ga0068863_100046613
1098 Ga0068863_100090271
1099 Ga0068858_100009284
1100 Ga0068858_100036564
1101 Ga0068858_100102845
1102 Ga0068858_100255466
1103 Ga0068858_100359738
1104 Ga0068860_100003499
1105 Ga0068860_100012471
1106 Ga0068860_100098420
1107 Ga0068860_100100224
1108 Ga0068860_100140476
1109 Ga0068860_100227094
1110 Ga0068860_100272577
1111 Ga0068862_100005668
1112 Ga0068862_100007778
1113 Ga0068862_100011180
1114 Ga0068862_100040247
1115 Ga0068862_100054244
1116 Ga0068862_100061609
1117 Ga0068862_100217403
1118 Ga0081455_10000984
1119 Ga0081455_10009733
1120 Ga0081455_10039777
1121 Ga0081455_10052497
1122 Ga0081455_10055384
1123 Ga0081538_10002719
1124 Ga0081538_10015526
1125 Ga0081538_10056460
1126 Ga0081538_10065785
1127 Ga0081540_1010822
1128 Ga0081539_10001927
1129 Ga0081539_10016665
1130 Ga0070717_10183089
1131 Ga0075365_10000728
1132 Ga0075365_10010086
1133 Ga0075365_10025552
1134 Ga0075365_10158107
1135 Ga0075368_10000120
1136 Ga0075368_10054404
1137 Ga0075363_100011502
1138 Ga0075364_10009885
1139 Ga0075364_10018000
1140 Ga0075432_10095338
1141 Ga0070715_10089036
1142 Ga0070716_100001998
1143 Ga0070712_100019792
1144 Ga0070712_100031307
1145 Ga0070712_100100115
1146 Ga0075367_10000650
1147 Ga0075367_10003645
1148 Ga0075367_10014314
1149 Ga0075367_10157755
1150 Ga0075369_10083854
1151 Ga0075427_10014558
1152 Ga0075427_10015619
1153 Ga0075366_10007236
1154 Ga0075366_10008316
1155 Ga0097621_100007093
1156 Ga0097621_100034527
1157 Ga0097621_100042332
1158 Ga0097621_100207584
1159 Ga0075370_10046818
1160 Ga0068871_100066530
1161 Ga0068871_100086360
1162 Ga0075428_100001938
1163 Ga0075428_100010074
1164 Ga0075428_100016097
1165 Ga0075428_100019946
1166 Ga0075428_100026020
1167 Ga0075428_100038332
1168 Ga0075428_100081393
1169 Ga0075428_100084782
1170 Ga0075428_100101787
1171 Ga0075428_100254830
1172 Ga0075430_100000117
1173 Ga0075430_100000631
1174 Ga0075430_100013548
1175 Ga0075430_100037105
1176 Ga0075430_100056466
1177 Ga0075430_100266577
1178 Ga0075431_100000169
1179 Ga0075431_100000310
1180 Ga0075431_100001546
1181 Ga0075431_100007380
1182 Ga0075431_100009035
1183 Ga0075431_100012996
1184 Ga0075431_100014927
1185 Ga0075431_100029422
1186 Ga0075431_100033086
1187 Ga0075431_100056312
1188 Ga0075431_100125624
1189 Ga0075431_100133313
1190 Ga0075431_100229790
1191 Ga0075431_100354034
1192 Ga0075431_100421978
1193 Ga0075431_100434958
1194 Ga0075431_100445935
1195 Ga0075433_10000602
1196 Ga0075433_10009519
1197 Ga0075433_10038797
1198 Ga0075433_10044282
1199 Ga0075433_10053817
1200 Ga0075433_10062171
1201 Ga0075433_10103052
1202 Ga0075433_10131045
1203 Ga0075433_10179567
1204 Ga0075433_10427863
1205 Ga0075434_100000660
1206 Ga0075434_100005059
1207 Ga0075434_100131221
1208 Ga0075434_100152107
1209 Ga0075429_100001202
1210 Ga0075429_100007696
1211 Ga0075429_100008694
1212 Ga0075429_100010104
1213 Ga0075429_100038287
1214 Ga0075429_100050469
1215 Ga0075429_100057834
1216 Ga0075429_100091165
1217 Ga0075429_100140026
1218 Ga0075429_100145579
1219 Ga0075429_100173265
1220 Ga0075429_100257964
1221 Ga0075429_100280933
1222 Ga0068865_100094819
1223 Ga0068865_100179865
1224 Ga0075436_100011647
1225 Ga0075436_100025299
1226 Ga0097620_100003564
1227 Ga0097620_100007223
1228 Ga0097620_100136912
1229 Ga0097620_100157039
1230 Ga0097620_100330109
1231 Ga0097620_100440728
1232 Ga0075435_100011815
1233 Ga0075435_100023027
1234 Ga0075435_100106659
1235 Ga0075435_100370486
1236 Ga0099794_10001270
1237 Ga0099794_10008200
1238 Ga0099794_10025092
1239 Ga0099794_10027619
1240 Ga0099794_10035006
1241 Ga0105240_10028250
1242 Ga0105240_10372657
1243 Ga0111539_10000319
1244 Ga0111539_10001949
1245 Ga0111539_10013148
1246 Ga0111539_10027210
1247 Ga0111539_10212402
1248 Ga0111539_10324877
1249 Ga0105245_10001111
1250 Ga0105245_10165784
1251 Ga0105247_10000792
1252 Ga0105247_10051349
1253 Ga0105247_10126976
1254 Ga0114129_10000328
1255 Ga0114129_10000539
1256 Ga0114129_10003348
1257 Ga0114129_10020979
1258 Ga0114129_10026272
1259 Ga0114129_10045924
1260 Ga0114129_10050900
1261 Ga0114129_10128876
1262 Ga0114129_10132086
1263 Ga0114129_10159836
1264 Ga0114129_10258007
1265 Ga0114129_10264657
1266 Ga0114129_10285575
1267 Ga0114129_10327770
1268 Ga0114129_10337519
1269 Ga0114129_10366022
1270 Ga0114129_10436921
1271 Ga0105243_10055639
1272 Ga0105243_10134711
1273 Ga0105243_10217316
1274 Ga0105241_10005538
1275 Ga0105241_10137417
1276 Ga0105241_10203019
1277 Ga0105242_10363119
1278 Ga0105248_10003750
1279 Ga0105248_10278299
1280 Ga0105248_10735472
1281 Ga0105237_10019141
1282 Ga0105237_10095669
1283 Ga0105237_10161091
1284 Ga0105238_10052280
1285 Ga0105238_10068317
1286 Ga0105238_10515350
1287 Ga0105249_10007392
1288 Ga0105249_10025141
1289 Ga0105249_10054743
1290 Ga0105249_10127486
1291 Ga0105249_10213282
1292 Ga0105249_10447590
1293 Ga0105249_10520672
1294 Ga0105246_10033679
1295 Ga0105246_10042354
1296 Ga0157371_10041152
1297 Ga0157370_10022946
1298 Ga0157374_10004727
1299 Ga0157378_10041731
1300 Ga0157378_10064224
1301 Ga0157378_10227403
1302 Ga0157378_10233059
1303 Ga0163162_10003056
1304 Ga0163162_10004311
1305 Ga0163162_10014093
1306 Ga0163162_10023856
1307 Ga0163162_10357561
1308 Ga0163162_10581568
1309 Ga0157372_10179877
1310 Ga0157375_10009264
1311 Ga0157375_10176922
1312 Ga0157375_10187216
1313 Ga0157375_10212362
1314 Ga0157375_10771094
1315 Ga0163163_10001598
1316 Ga0163163_10014348
1317 Ga0163163_10207918
1318 Ga0157380_10383316
1319 Ga0157379_10002057
1320 Ga0157379_10152538
1321 Ga0157379_10242550
1322 Ga0157376_10024260
1323 Ga0157376_10028665
1324 Ga0163161_10015428
1325 Ga0163161_10307158
1326 Ga0213875_10005766
1327 Ga0213875_10030003
1328 Ga0207697_10027942
1329 Ga0207692_10034786
1330 Ga0207642_10003825
1331 Ga0207680_10284527
1332 Ga0207647_10166955
1333 Ga0207685_10042875
1334 Ga0207699_10157544
1335 Ga0207645_10050211
1336 Ga0207643_10018865
1337 Ga0207684_10004580
1338 Ga0207684_10008013
1339 Ga0207684_10013871
1340 Ga0207684_10044844
1341 Ga0207684_10052034
1342 Ga0207684_10068173
1343 Ga0207684_10118332
1344 Ga0207684_10118952
1345 Ga0207684_10207150
1346 Ga0207654_10013307
1347 Ga0207654_10023663
1348 Ga0207654_10082296
1349 Ga0207654_10120610
1350 Ga0207707_10096152
1351 Ga0207695_10195967
1352 Ga0207671_10088603
1353 Ga0207693_10001046
1354 Ga0207693_10005971
1355 Ga0207693_10025505
1356 Ga0207693_10028645
1357 Ga0207693_10110230
1358 Ga0207660_10014668
1359 Ga0207657_10007001
1360 Ga0207652_10057063
1361 Ga0207646_10003221
1362 Ga0207646_10004343
1363 Ga0207646_10009607
1364 Ga0207646_10019103
1365 Ga0207646_10029382
1366 Ga0207646_10030343
1367 Ga0207646_10033685
1368 Ga0207646_10043078
1369 Ga0207646_10073313
1370 Ga0207646_10183237
1371 Ga0207646_10265217
1372 Ga0207681_10036083
1373 Ga0207681_10061999
1374 Ga0207681_10127358
1375 Ga0207681_10208225
1376 Ga0207650_10002984
1377 Ga0207650_10011902
1378 Ga0207650_10054622
1379 Ga0207650_10230414
1380 Ga0207650_10313024
1381 Ga0207659_10008782
1382 Ga0207659_10054464
1383 Ga0207659_10286036
1384 Ga0207687_10000635
1385 Ga0207687_10003484
1386 Ga0207687_10096531
1387 Ga0207700_10000044
1388 Ga0207700_10006567
1389 Ga0207700_10018993
1390 Ga0207664_10010348
1391 Ga0207644_10001047
1392 Ga0207644_10295869
1393 Ga0207706_10017974
1394 Ga0207706_10113213
1395 Ga0207706_10129129
1396 Ga0207706_10141268
1397 Ga0207686_10000643
1398 Ga0207709_10032098
1399 Ga0207670_10056524
1400 Ga0207670_10306015
1401 Ga0207669_10038658
1402 Ga0207669_10041812
1403 Ga0207669_10121366
1404 Ga0207704_10250443
1405 Ga0207704_10281218
1406 Ga0207665_10006026
1407 Ga0207665_10017055
1408 Ga0207665_10091843
1409 Ga0207691_10013016
1410 Ga0207691_10068564
1411 Ga0207691_10146946
1412 Ga0207691_10286203
1413 Ga0207691_10318802
1414 Ga0207711_10000841
1415 Ga0207711_10005312
1416 Ga0207689_10000063
1417 Ga0207689_10010059
1418 Ga0207689_10013669
1419 Ga0207689_10020635
1420 Ga0207689_10185257
1421 Ga0207689_10212456
1422 Ga0207679_10308239
1423 Ga0207667_10243214
1424 Ga0207651_10023911
1425 Ga0207651_10028898
1426 Ga0207651_10091941
1427 Ga0207651_10169639
1428 Ga0207651_10202506
1429 Ga0207651_10252111
1430 Ga0207712_10015359
1431 Ga0207712_10045196
1432 Ga0207668_10001978
1433 Ga0207668_10011031
1434 Ga0207668_10012226
1435 Ga0207668_10032780
1436 Ga0207668_10065481
1437 Ga0207668_10103016
1438 Ga0207668_10332053
1439 Ga0207658_10008543
1440 Ga0207658_10019288
1441 Ga0207658_10046385
1442 Ga0207658_10062496
1443 Ga0207658_10105462
1444 Ga0207658_10232403
1445 Ga0207677_10002282
1446 Ga0207703_10000555
1447 Ga0207703_10002087
1448 Ga0207703_10122763
1449 Ga0207639_10435062
1450 Ga0207678_10259107
1451 Ga0207708_10018394
1452 Ga0207708_10062575
1453 Ga0207708_10081647
1454 Ga0207702_10134330
1455 Ga0207641_10020625
1456 Ga0207641_10025929
1457 Ga0207641_10047673
1458 Ga0207641_10069192
1459 Ga0207641_10100585
1460 Ga0207641_10142203
1461 Ga0207641_10399864
1462 Ga0207648_10011859
1463 Ga0207648_10029343
1464 Ga0207648_10042001
1465 Ga0207648_10079303
1466 Ga0207648_10166593
1467 Ga0207676_10000321
1468 Ga0207676_10007399
1469 Ga0207674_10012506
1470 Ga0207674_10063296
1471 Ga0207674_10172367
1472 Ga0207675_100013970
1473 Ga0207675_100035369
1474 Ga0207675_100035830
1475 Ga0207675_100058808
1476 Ga0207675_100079992
1477 Ga0207675_100082929
1478 Ga0207675_100099791
1479 Ga0207683_10000560
1480 Ga0207683_10019830
1481 Ga0207683_10093862
1482 Ga0207698_10552693
1483 Ga0209588_1004373
1484 Ga0209588_1014535
1485 Ga0209588_1015637
1486 Ga0209588_1030415
1487 Ga0209966_1008047
1488 Ga0209813_10000575
1489 Ga0209813_10018099
1490 Ga0207428_10000559
1491 Ga0207428_10000960
1492 Ga0207428_10277953
1493 Ga0268266_10006926
1494 Ga0268266_10035284
1495 Ga0268266_10367220
1496 Ga0268265_10021342
1497 Ga0268265_10034797
1498 Ga0268265_10040660
1499 Ga0268265_10054355
1500 Ga0268265_10098771
1501 Ga0268265_10248571
1502 Ga0268265_10378072
1503 Ga0268265_10468465
1504 Ga0268264_10002943
1505 Ga0268264_10005994
1506 Ga0268264_10007734
1507 Ga0268264_10034426
1508 Ga0268264_10103526
1509 Ga0268264_10159430
1510 Ga0268264_10243829
1511 Ga0268264_10269470
1512 Ga0268264_10293130
1513 Ga0268264_10345071
1514 Ga0268264_10354527
1515 Ga0268264_10393779
1516 Ga0307512_10020379
1517 Ga0265331_10063187
1518 Ga0307513_10166155
1519 Ga0307408_100049016
1520 Ga0307408_100059241
1521 Ga0307408_100137827
1522 Ga0307408_100145617
1523 Ga0307508_10051498
1524 Ga0316576_10039079
1525 Ga0316578_10010150
1526 Ga0316578_10101152
1527 Ga0307516_10001211
1528 Ga0307410_10176607
1529 Ga0307407_10162409
1530 Ga0307415_100030288
1531 Ga0307510_10033242
1532 Ga0373940_0013572
1533 Ga0373944_0040064
1534 Ga0373949_0004726
1535 Ga0373951_0014054
1536 Ga0373923_0012836
1537 Ga0373936_0039020
1538 Ga0373941_0022067
1539 Ga0373941_0062818
1540 Ga0373954_0003658
1541 Ga0373957_0059703
1542 Ga0373957_0082670
1543 Ga0373962_0014921
1544 Ga0373931_0002667
1545 Ga0373931_0188056
1546 Ga0373935_0031208
1547 Ga0373935_0185720
1548 Ga0373927_0139357
1549 Ga0373927_0279994
1550 Ga0373947_0060851
1551 Ga0373947_0164178
1552 Ga0373937_0062523
1553 Ga0373937_0126343
1554 Ga0373937_0538006
1555 Ga0316582_0105377
1556 Ga0316584_0012447
1557 Ga0373925_0118911
1558 Ga0373925_0144422
1559 Ga0395899_0054930
1560 Ga0395900_0417467
1561 Ga0395898_0026610
1562 Ga0395905_0450368
1563 Ga0436364_0005520
1564 Ga0436364_0305897
1565 Ga0436364_0488545
1566 Ga0395901_0018260
1567 Ga0436360_0181564
1568 Ga0439453_0000397
1569 Ga0451800_1408765
1570 Ga0439443_005409
1571 Ga0439435_0027496
1572 Ga0439435_0068074
1573 Ga0451577_0001374
1574 Ga0451577_0046317
1575 Ga0451577_0107293
1576 Ga0453683_0016160
1577 Ga0453683_0027055
1578 Ga0453683_0033891
1579 Ga0453683_0036150
1580 Ga0453683_0067597
1581 Ga0453683_0103393
1582 Ga0453683_0120657
1583 Ga0453683_0149677
1584 Ga0453683_0203049
1585 Ga0453684_0013625
1586 Ga0453684_0019580
1587 Ga0453684_0104944
1588 Ga0453684_0111466
1589 Ga0451576_0003424
1590 Ga0451576_0047172
1591 Ga0451576_0092367
1592 Ga0451576_0254862
1593 Ga0451576_0431058
1594 Ga0495603_0048010
1595 Ga0495580_0018598
1596 Ga0495580_0037839
1597 Ga0495580_0058091
1598 Ga0495582_0004716
1599 Ga0495582_0009718
1600 Ga0495584_0032101
1601 Ga0495628_0208639
1602 Ga0495652_0149318
1603 Ga0495635_0030606
1604 Ga0495659_0008195
1605 Ga0495659_0040516
1606 Ga0495588_0049511
1607 Ga0495623_0135494
1608 Ga0495658_0001727
1609 Ga0495613_0004826
1610 Ga0495671_0005896
1611 Ga0495636_0059668
1612 Ga0495674_0051120
1613 Ga0495684_0297306
1614 Ga0496100_0010120
1615 Ga0496101_0010478
1616 Ga0496102_0003244
1617 Ga0496102_0021322
1618 Ga0496102_0031634
1619 Ga0496102_0182207
1620 Ga0496103_0023033
1621 Ga0496103_0038336
1622 Ga0496104_0000189
1623 Ga0496104_0044835
1624 Ga0496104_0210801
1625 Ga0496105_0007294
1626 Ga0496106_0015195
1627 Ga0496107_0100021
1628 Ga0496108_0039024
1629 Ga0496108_0045684
1630 Ga0496109_0052521
1631 Ga0496109_0065295
1632 Ga0496110_0004257
1633 Ga0496110_0258763
1634 Ga0496111_0001828
1635 Ga0496111_0118435
1636 Ga0496112_0001027
1637 Ga0496112_0043357
1638 Ga0496112_0104006
1639 Ga0496112_0177067
1640 Ga0496113_0010566
1641 Ga0496115_0020594
1642 Ga0496119_0004094
1643 Ga0496119_0009210
1644 Ga0496120_0026651
1645 Ga0496122_0001180
1646 Ga0496123_0001130
1647 Ga0496124_0107016
1648 Ga0501031_0031253
1649 Ga0501034_0092269
1650 Ga0501036_0004096
1651 Ga0501036_0082912
1652 Ga0501036_0188595
1653 Ga0501036_0228642
1654 Ga0501038_0021124
1655 Ga0501038_0127420
1656 Ga0501038_0196419
1657 Ga0501038_0258493
1658 Ga0501039_0077903
1659 Ga0501039_0093681
1660 Ga0501040_0000045
1661 Ga0501040_0013930
1662 Ga0501040_0113873
1663 Ga0501041_0134117
1664 Ga0501042_0000178
1665 Ga0501042_0050769
1666 Ga0501042_0087517
1667 Ga0501042_0148991
1668 Ga0501043_0028620
1669 Ga0501046_0082903
1670 Ga0501046_0114438
1671 Ga0501048_0028169
1672 Ga0501048_0032108
1673 Ga0501048_0060586
1674 Ga0501067_0030511
1675 Ga0501068_0169347
1676 Ga0501068_0172113
1677 Ga0501071_0007435
1678 Ga0501072_0000438
1679 Ga0501072_0011936
1680 Ga0501072_0094010
1681 Ga0501072_0102815
1682 Ga0501072_0352868
1683 Ga0501073_0084134
1684 Ga0501074_0016682
1685 Ga0501074_0018261
1686 Ga0501074_0191530
1687 Ga0501075_0001220
1688 Ga0501075_0034071
1689 Ga0501075_0043028
1690 Ga0501075_0045092
1691 Ga0501075_0066894
1692 Ga0501076_0000125
1693 Ga0501076_0000151
1694 Ga0501076_0009016
1695 Ga0501076_0033709
1696 Ga0501076_0036808
1697 Ga0501077_0000473
1698 Ga0501077_0145044
1699 Ga0501077_0236693
1700 Ga0501225_0023974
1701 Ga0501079_0005031
1702 Ga0501079_0005439
1703 Ga0501079_0005896
1704 Ga0501079_0008494
1705 Ga0501079_0070760
1706 Ga0501080_0095020
1707 Ga0501080_0168475
1708 Ga0501080_0215698
1709 Ga0501080_0419388
1710 Ga0501080_0454621
1711 Ga0501081_0001205
1712 Ga0501081_0010957
1713 Ga0501081_0029596
1714 Ga0501081_0060423
1715 Ga0501081_0067889
1716 Ga0501081_0154035
1717 Ga0501081_0234220
1718 Ga0501035_0176884
1719 Ga0501045_0058638
1720 Ga0501045_0068678
1721 Ga0501045_0097757
1722 Ga0501045_0166858
1723 nmdc:mga03n38_1728_c1
1724 nmdc:mga00v17_2121_c1
1725 nmdc:mga0yw44_182566_c1
1726 nmdc:mga0yw44_4220_c1
1727 nmdc:mga0k408_42587_c1
1728 nmdc:mga06z11_1905_c1
1729 nmdc:mga06z11_22428_c1
1730 nmdc:mga06z11_3010_c1
1731 nmdc:mga06z11_448_c1
1732 nmdc:mga04h51_275_c1
1733 nmdc:mga07m45_67397_c1
1734 nmdc:mga05p37_1334_c1
1735 nmdc:mga05p37_144636_c1
1736 nmdc:mga05p37_163251_c1
1737 nmdc:mga05p37_16373_c1
1738 nmdc:mga05p37_21020_c1
1739 nmdc:mga05p37_219027_c1
1740 nmdc:mga05p37_22349_c1
1741 nmdc:mga05p37_224486_c1
1742 nmdc:mga05p37_2446_c1
1743 nmdc:mga05p37_268153_c1
1744 nmdc:mga05p37_3021_c1
1745 nmdc:mga05p37_484447_c1
1746 nmdc:mga05p37_515418_c1
1747 nmdc:mga05p37_68471_c1
1748 nmdc:mga05p37_8208_c1
1749 nmdc:mga05p37_8948_c1
1750 nmdc:mga05p37_97695_c1
1751 nmdc:mga09592_116731_c1
1752 nmdc:mga09592_134126_c1
1753 nmdc:mga09592_23281_c1
1754 nmdc:mga09592_275625_c1
1755 nmdc:mga09592_34412_c1
1756 nmdc:mga09592_34524_c1
1757 nmdc:mga09592_50785_c1
1758 nmdc:mga09592_60915_c1
1759 nmdc:mga09592_636_c1
1760 nmdc:mga09592_87053_c1
1761 nmdc:mga0qj67_14893_c1
1762 nmdc:mga0qj67_1562_c1
1763 nmdc:mga0qj67_29162_c1
1764 nmdc:mga0qj67_377790_c1
1765 nmdc:mga0qj67_49589_c1
1766 nmdc:mga0qj67_559_c1
1767 nmdc:mga0qj67_5647_c1
1768 nmdc:mga0qj67_99085_c1
1769 nmdc:mga06r32_10886_c1
1770 nmdc:mga06r32_134110_c1
1771 nmdc:mga06r32_15469_c1
1772 nmdc:mga06r32_175853_c1
1773 nmdc:mga06r32_2238_c1
1774 nmdc:mga06r32_2497_c1
1775 nmdc:mga06r32_43870_c1
1776 nmdc:mga06r32_46506_c1
1777 nmdc:mga06r32_5863_c1
1778 nmdc:mga06r32_872_c1
1779 nmdc:mga06r32_92832_c1
1780 nmdc:mga06r32_943_c1
1781 nmdc:mga08y16_17265_c1
1782 nmdc:mga08y16_542_c1
1783 nmdc:mga08y16_57612_c1
1784 nmdc:mga08y16_9141_c1
1785 nmdc:mga0n895_134839_c1
1786 nmdc:mga0n895_149879_c1
1787 nmdc:mga0n895_15187_c1
1788 nmdc:mga0n895_159369_c1
1789 nmdc:mga0n895_186823_c1
1790 nmdc:mga0n895_209876_c1
1791 nmdc:mga0n895_251589_c1
1792 nmdc:mga0n895_3503_c1
1793 nmdc:mga0n895_566216_c1
1794 nmdc:mga0n895_93242_c1
1795 nmdc:mga0rr50_177125_c1
1796 nmdc:mga0rr50_184463_c1
1797 nmdc:mga0rr50_204207_c1
1798 nmdc:mga0rr50_31885_c1
1799 nmdc:mga0rr50_89588_c1
1800 nmdc:mga08x19_1159_c1
1801 nmdc:mga08x19_147658_c1
1802 nmdc:mga08x19_179301_c1
1803 nmdc:mga08x19_38074_c1
1804 nmdc:mga08x19_49725_c1
1805 nmdc:mga08x19_55005_c1
1806 nmdc:mga08x19_74397_c1
1807 nmdc:mga08x19_99356_c1
1808 nmdc:mga0a205_12600_c1
1809 nmdc:mga0a205_188215_c1
1810 nmdc:mga0a205_1924_c1
1811 nmdc:mga0a205_222512_c1
1812 nmdc:mga0a205_2792_c1
1813 nmdc:mga0a205_300350_c1
1814 nmdc:mga0a205_4234_c1
1815 nmdc:mga0a205_4495_c1
1816 nmdc:mga0a205_60489_c1
1817 Ga0495601_0202348
1818 Ga0495595_0060738
1819 Ga0495619_0023214
1820 Ga0495619_0192904
1821 Ga0500646_0000278
1822 Ga0500556_0000023
1823 Ga0500568_0000052
1824 Ga0500577_0007839
1825 Ga0500588_0007200
1826 Ga0500616_0041980
1827 Ga0500634_0000023
1828 Ga0501084_0000110
1829 Ga0501084_0009385
1830 Ga0501084_0019702
1831 Ga0501084_0046471
1832 Ga0501084_0058258
1833 Ga0501084_0102898
1834 Ga0590071_038495
1835 Ga0501082_0000201
1836 Ga0501082_0092648
1837 Ga0501082_0441818
1838 Ga0530510_0000184
1839 Ga0530510_0005382
1840 Ga0530510_0067888
1841 Ga0530510_0073430
1842 Ga0530510_0099084
1843 Ga0530510_0191716
1844 2894776976
1845 2929204296
1846 8055910627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

311

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

95

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7818 97 321
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7537 103 306
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7496 97 321
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.7099 97 302
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7063 95 300
ID Description Score Start End Superfamily
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9126 86 323 1.10.3720.10
af_P0AGH3_48_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9058 76 322 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.901 86 323 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8969 92 321 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.893 92 321 1.10.3720.10
ID Description Score Start End GO Terms
AF-X1V549-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9468 113 302 GO:0005886
GO:0055085
AF-A0A3D5FLV8-F1-model_v4 ABC transporter permease 0.9437 15 328 GO:0005886
GO:0055085
AF-N6U184-F1-model_v4 Putative oligopeptide ABC transporter, permease protein 0.9418 1 325 GO:0005886
GO:0055085
AF-A0A382TZH5-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9412 74 325 GO:0005886
GO:0055085
AF-X1P894-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9389 83 297 GO:0005886
GO:0055085

Map