F485683

General Info

Members Datasets Scaffolds Average Seq Length
918 451 1836 161

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056673599|8056674502
Length 157
Sequence SFWWQRYGTLAQMAQAAVALLGFVAILFQINEIRTGNRASSARQAFLGYTDLAFKNPKFAQPDYEKIKAGGDEHVQYESFVTYFLYACEEAISAFAGKREWQASCDYDLKPHLPFLCEKNAAQPAYLATYGADTQRWITASLKTASVTPPDCKLGKT

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
227 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
258 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
322 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
353 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
365 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
382 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
386 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
387 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
388 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
389 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
390 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
391 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
392 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
395 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
396 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
397 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
400 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
401 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
402 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
403 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
404 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
405 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
406 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
407 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
408 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
409 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
410 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
411 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
412 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
413 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
414 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
415 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
416 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
417 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
418 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
419 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
420 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
421 2791355199
422 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
423 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
424 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
425 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
426 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
427 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
428 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
429 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
430 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
431 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
432 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
433 2904699407
434 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
435 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
436 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
437 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
438 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
439 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
440 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
441 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
442 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
443 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
444 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
445 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
446 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
447 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
448 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
449 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
450 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
451 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.24
Nodule 2.72
Rhizoplane 9.48
Rhizosphere 71.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10058784 3300001991 Bacteria 790
2 JGI24743J22301_10059612 3300001991 Bacteria 785
3 JGI24738J21930_10064694 3300002075 Bacteria 753
4 JGI24034J26672_10032748 3300002239 Bacteria 852
5 JGI25153J46596_10001663 3300003215 Bacteria 13186
6 JGI25404J52841_10006374 3300003659 Bacteria 2466
7 JGI25404J52841_10017892 3300003659 Bacteria 1536
8 JGI25404J52841_10037060 3300003659 Bacteria 1037
9 Ga0070658_10579805 3300005327 Bacteria 971
10 Ga0070676_10221988 3300005328 Bacteria 1248
11 Ga0070676_10371858 3300005328 Bacteria 987
12 Ga0070670_100507789 3300005331 Bacteria 1073
13 Ga0070677_10091220 3300005333 Bacteria 1325
14 Ga0068869_100190485 3300005334 Bacteria 1612
15 Ga0068869_100556035 3300005334 Bacteria 964
16 Ga0068869_100702389 3300005334 Bacteria 862
17 Ga0070666_10610229 3300005335 Bacteria 796
18 Ga0070680_100095813 3300005336 Bacteria 2461
19 Ga0070680_100319131 3300005336 Bacteria 1319
20 Ga0070680_101495579 3300005336 Bacteria 585
21 Ga0070682_100155569 3300005337 Bacteria 1573
22 Ga0070682_100286193 3300005337 Bacteria 1203
23 Ga0068868_100053906 3300005338 Bacteria 3168
24 Ga0068868_100073736 3300005338 Bacteria 2725
25 Ga0070660_100202391 3300005339 Bacteria 1611
26 Ga0070660_100371648 3300005339 Bacteria 1179
27 Ga0070660_100392485 3300005339 Bacteria 1147
28 Ga0070689_101350541 3300005340 Bacteria 643
29 Ga0070661_100212778 3300005344 Bacteria 1480
30 Ga0070661_100734471 3300005344 Bacteria 806
31 Ga0070661_100835237 3300005344 Bacteria 757
32 Ga0070661_100889566 3300005344 Bacteria 735
33 Ga0070692_10344675 3300005345 Bacteria 924
34 Ga0070668_100594326 3300005347 Bacteria 967
35 Ga0070668_100614123 3300005347 Bacteria 952
36 Ga0070668_100622008 3300005347 Bacteria 946
37 Ga0070668_100630239 3300005347 Bacteria 940
38 Ga0070669_101112340 3300005353 Bacteria 681
39 Ga0070669_101188750 3300005353 Bacteria 658
40 Ga0070671_100324833 3300005355 Bacteria 1311
41 Ga0070671_100382191 3300005355 Bacteria 1203
42 Ga0070671_100622465 3300005355 Bacteria 933
43 Ga0070674_100249077 3300005356 Bacteria 1394
44 Ga0070673_100699534 3300005364 Bacteria 931
45 Ga0070673_100772856 3300005364 Bacteria 885
46 Ga0070673_101168485 3300005364 Bacteria 720
47 Ga0070688_100251487 3300005365 Bacteria 1258
48 Ga0070688_100415220 3300005365 Bacteria 999
49 Ga0070688_100604806 3300005365 Bacteria 839
50 Ga0070667_100314371 3300005367 Bacteria 1412
51 Ga0070667_100555555 3300005367 Bacteria 1055
52 Ga0070667_100560011 3300005367 Bacteria 1051
53 Ga0070703_10152762 3300005406 Bacteria 868
54 Ga0070713_100537791 3300005436 Bacteria 1106
55 Ga0070710_10179464 3300005437 Bacteria 1324
56 Ga0070710_10868680 3300005437 Bacteria 649
57 Ga0070701_10575851 3300005438 Bacteria 742
58 Ga0070711_100006622 3300005439 Bacteria 6999
59 Ga0070700_100179719 3300005441 Bacteria 1471
60 Ga0070694_100664380 3300005444 Bacteria 845
61 Ga0070708_100753666 3300005445 Bacteria 916
62 Ga0070708_101006235 3300005445 Bacteria 782
63 Ga0070663_100013100 3300005455 Bacteria 5271
64 Ga0070663_100188650 3300005455 Bacteria 1603
65 Ga0070663_100277926 3300005455 Bacteria 1333
66 Ga0070663_100362211 3300005455 Bacteria 1176
67 Ga0070663_100483525 3300005455 Bacteria 1025
68 Ga0070678_100128081 3300005456 Bacteria 2012
69 Ga0070678_100142393 3300005456 Bacteria 1920
70 Ga0070678_100240508 3300005456 Bacteria 1513
71 Ga0070678_100753808 3300005456 Bacteria 881
72 Ga0070678_101091591 3300005456 Bacteria 737
73 Ga0070678_101379352 3300005456 Bacteria 657
74 Ga0070662_100288205 3300005457 Bacteria 1330
75 Ga0068867_100087390 3300005459 Bacteria 2360
76 Ga0070685_10470555 3300005466 Bacteria 884
77 Ga0070698_100284877 3300005471 Bacteria 1584
78 Ga0070699_100303119 3300005518 Bacteria 1433
79 Ga0070679_100017345 3300005530 Bacteria 6969
80 Ga0070679_100429571 3300005530 Bacteria 1266
81 Ga0070684_100794207 3300005535 Bacteria 885
82 Ga0070697_100629856 3300005536 Bacteria 944
83 Ga0068853_100110842 3300005539 Bacteria 2437
84 Ga0068853_101684844 3300005539 Bacteria 615
85 Ga0070672_100577794 3300005543 Bacteria 977
86 Ga0070693_100333160 3300005547 Bacteria 1033
87 Ga0070693_100462602 3300005547 Bacteria 893
88 Ga0070665_100219326 3300005548 Bacteria 1902
89 Ga0070665_100236234 3300005548 Bacteria 1828
90 Ga0070665_100517771 3300005548 Bacteria 1204
91 Ga0070704_100128107 3300005549 Bacteria 1962
92 Ga0070704_100345952 3300005549 Bacteria 1253
93 Ga0068855_100028801 3300005563 Bacteria 6645
94 Ga0068855_100104411 3300005563 Bacteria 3259
95 Ga0068855_100390797 3300005563 Bacteria 1526
96 Ga0068855_100802989 3300005563 Bacteria 1000
97 Ga0068855_101419513 3300005563 Bacteria 715
98 Ga0070664_100325912 3300005564 Bacteria 1393
99 Ga0070664_100742866 3300005564 Bacteria 916
100 Ga0068857_100665451 3300005577 Bacteria 987
101 Ga0068857_100790733 3300005577 Bacteria 906
102 Ga0068854_100409708 3300005578 Bacteria 1124
103 Ga0068856_100239551 3300005614 Bacteria 1829
104 Ga0068856_100445512 3300005614 Bacteria 1315
105 Ga0068856_100745147 3300005614 Bacteria 1000
106 Ga0068856_101993429 3300005614 Bacteria 591
107 Ga0070702_100935751 3300005615 Bacteria 681
108 Ga0068852_100039877 3300005616 Bacteria 3957
109 Ga0068852_100847470 3300005616 Bacteria 929
110 Ga0068852_101602333 3300005616 Bacteria 673
111 Ga0068859_100200655 3300005617 Bacteria 2079
112 Ga0068859_100440961 3300005617 Bacteria 1398
113 Ga0068859_100891373 3300005617 Bacteria 974
114 Ga0068864_100015580 3300005618 Bacteria 6322
115 Ga0068864_100623731 3300005618 Bacteria 1048
116 Ga0068861_100135798 3300005719 Bacteria 2001
117 Ga0068861_100717879 3300005719 Bacteria 930
118 Ga0068861_100796681 3300005719 Bacteria 886
119 Ga0068861_100959834 3300005719 Bacteria 813
120 Ga0068851_10651675 3300005834 Bacteria 645
121 Ga0068851_10924833 3300005834 Bacteria 547
122 Ga0068863_101408481 3300005841 Bacteria 705
123 Ga0068858_100378862 3300005842 Bacteria 1357
124 Ga0068858_100958441 3300005842 Bacteria 838
125 Ga0068860_100769118 3300005843 Bacteria 975
126 Ga0068860_101278022 3300005843 Bacteria 755
127 Ga0068860_101340831 3300005843 Bacteria 736
128 Ga0068862_100511309 3300005844 Bacteria 1141
129 Ga0068862_100743795 3300005844 Bacteria 953
130 Ga0068862_101400352 3300005844 Bacteria 702
131 Ga0081455_10046597 3300005937 Bacteria 3760
132 Ga0081455_10059345 3300005937 Bacteria 3231
133 Ga0081455_10085186 3300005937 Bacteria 2578
134 Ga0081538_10041630 3300005981 Bacteria 2912
135 Ga0081540_1008342 3300005983 Bacteria 7244
136 Ga0081540_1015698 3300005983 Bacteria 4781
137 Ga0081540_1017290 3300005983 Bacteria 4469
138 Ga0081540_1187154 3300005983 Bacteria 767
139 Ga0081539_10046039 3300005985 Bacteria 2503
140 Ga0070717_10141347 3300006028 Bacteria 2076
141 Ga0070717_10626894 3300006028 Bacteria 976
142 Ga0075365_10009719 3300006038 Bacteria 5552
143 Ga0075365_10135672 3300006038 Bacteria 1705
144 Ga0075365_10202026 3300006038 Bacteria 1392
145 Ga0075365_10394581 3300006038 Bacteria 976
146 Ga0075368_10017552 3300006042 Bacteria 2680
147 Ga0075368_10054708 3300006042 Bacteria 1591
148 Ga0075368_10207655 3300006042 Bacteria 830
149 Ga0075363_100010490 3300006048 Bacteria 4404
150 Ga0075363_100112265 3300006048 Bacteria 1516
151 Ga0075363_100167706 3300006048 Bacteria 1245
152 Ga0075363_100269343 3300006048 Bacteria 983
153 Ga0075363_100444211 3300006048 Bacteria 765
154 Ga0075364_10054582 3300006051 Bacteria 2613
155 Ga0075364_10385948 3300006051 Bacteria 955
156 Ga0075364_10421841 3300006051 Bacteria 911
157 Ga0075364_10644546 3300006051 Bacteria 723
158 Ga0075432_10290314 3300006058 Bacteria 676
159 Ga0070716_100780825 3300006173 Bacteria 738
160 Ga0070712_100398056 3300006175 Bacteria 1137
161 Ga0075362_10063771 3300006177 Bacteria 1671
162 Ga0075362_10066601 3300006177 Bacteria 1637
163 Ga0075362_10217339 3300006177 Bacteria 933
164 Ga0075362_10362849 3300006177 Bacteria 726
165 Ga0075367_10041004 3300006178 Bacteria 2705
166 Ga0075367_10045732 3300006178 Bacteria 2569
167 Ga0075367_10116690 3300006178 Bacteria 1642
168 Ga0075367_10291655 3300006178 Bacteria 1026
169 Ga0075369_10058163 3300006186 Bacteria 1683
170 Ga0075369_10268021 3300006186 Bacteria 794
171 Ga0075369_10381246 3300006186 Bacteria 663
172 Ga0075366_10096611 3300006195 Bacteria 1771
173 Ga0075366_10239347 3300006195 Bacteria 1106
174 Ga0075366_10538786 3300006195 Bacteria 722
175 Ga0097621_100317329 3300006237 Bacteria 1379
176 Ga0097621_100425398 3300006237 Bacteria 1193
177 Ga0097621_100828473 3300006237 Bacteria 859
178 Ga0097621_101049116 3300006237 Bacteria 764
179 Ga0075370_10019945 3300006353 Bacteria 3655
180 Ga0075370_10045847 3300006353 Bacteria 2473
181 Ga0068871_100519984 3300006358 Bacteria 1075
182 Ga0068871_100616653 3300006358 Bacteria 988
183 Ga0068871_101474303 3300006358 Bacteria 642
184 Ga0068871_101477788 3300006358 Bacteria 642
185 Ga0075434_100340551 3300006871 Bacteria 1520
186 Ga0068865_100135871 3300006881 Bacteria 1848
187 Ga0097620_100200657 3300006931 Bacteria 2079
188 Ga0097620_100440943 3300006931 Bacteria 1398
189 Ga0097620_100891328 3300006931 Bacteria 974
190 Ga0099794_10188751 3300007265 Bacteria 1054
191 Ga0099795_10206119 3300007788 Bacteria 831
192 Ga0099795_10271338 3300007788 Bacteria 738
193 Ga0099795_10363544 3300007788 Bacteria 650
194 Ga0105240_10711281 3300009093 Bacteria 1095
195 Ga0111539_10397101 3300009094 Bacteria 1606
196 Ga0105245_10128755 3300009098 Bacteria 2372
197 Ga0105245_10254418 3300009098 Bacteria 1707
198 Ga0105245_10933260 3300009098 Bacteria 910
199 Ga0105245_11285705 3300009098 Bacteria 780
200 Ga0105247_10427331 3300009101 Bacteria 950
201 Ga0105247_10967371 3300009101 Bacteria 662
202 Ga0105247_11088053 3300009101 Bacteria 630
203 Ga0105247_11113133 3300009101 Bacteria 624
204 Ga0114129_10661569 3300009147 Bacteria 1347
205 Ga0114129_10769222 3300009147 Bacteria 1231
206 Ga0105243_10188344 3300009148 Bacteria 1800
207 Ga0105243_10647013 3300009148 Bacteria 1024
208 Ga0105243_10685693 3300009148 Bacteria 997
209 Ga0105243_11026912 3300009148 Bacteria 829
210 Ga0105241_10361206 3300009174 Bacteria 1264
211 Ga0105242_10327509 3300009176 Bacteria 1407
212 Ga0105242_10365430 3300009176 Bacteria 1337
213 Ga0105242_10368949 3300009176 Bacteria 1331
214 Ga0105242_12011974 3300009176 Bacteria 620
215 Ga0105248_10192219 3300009177 Bacteria 2300
216 Ga0105248_10601570 3300009177 Bacteria 1241
217 Ga0105248_10727801 3300009177 Bacteria 1119
218 Ga0105248_10821394 3300009177 Bacteria 1049
219 Ga0105248_10904908 3300009177 Bacteria 996
220 Ga0105237_10805020 3300009545 Bacteria 946
221 Ga0105237_10969375 3300009545 Bacteria 857
222 Ga0105237_11304856 3300009545 Bacteria 732
223 Ga0105238_10375587 3300009551 Bacteria 1412
224 Ga0105238_10676241 3300009551 Bacteria 1043
225 Ga0105238_10728562 3300009551 Bacteria 1005
226 Ga0105238_11535889 3300009551 Bacteria 695
227 Ga0105249_10220912 3300009553 Bacteria 1864
228 Ga0105249_10386862 3300009553 Bacteria 1426
229 Ga0105249_10986979 3300009553 Bacteria 911
230 Ga0105249_11604151 3300009553 Bacteria 723
231 Ga0105249_11941385 3300009553 Bacteria 661
232 Ga0099796_10030556 3300010159 Bacteria 1749
233 Ga0099796_10081890 3300010159 Bacteria 1185
234 Ga0099796_10143760 3300010159 Bacteria 934
235 Ga0099796_10433111 3300010159 Bacteria 582
236 Ga0105239_10250831 3300010375 Bacteria 1988
237 Ga0105239_10730892 3300010375 Bacteria 1133
238 Ga0105239_10741330 3300010375 Bacteria 1124
239 Ga0105239_11300611 3300010375 Bacteria 839
240 Ga0105239_11524491 3300010375 Bacteria 772
241 Ga0105239_11772335 3300010375 Bacteria 715
242 Ga0105246_10431986 3300011119 Bacteria 1102
243 Ga0105246_10566570 3300011119 Bacteria 976
244 Ga0105246_10591664 3300011119 Bacteria 957
245 Ga0105246_10616279 3300011119 Bacteria 940
246 Ga0105246_11060203 3300011119 Bacteria 738
247 Ga0105246_11071439 3300011119 Bacteria 734
248 Ga0157313_1034310 3300012503 Bacteria 593
249 Ga0157370_10084579 3300013104 Bacteria 2982
250 Ga0157369_10706453 3300013105 Bacteria 1038
251 Ga0157374_10111572 3300013296 Bacteria 2631
252 Ga0157374_10427529 3300013296 Bacteria 1324
253 Ga0157378_10835723 3300013297 Bacteria 948
254 Ga0157378_10945283 3300013297 Bacteria 894
255 Ga0157378_11055394 3300013297 Bacteria 848
256 Ga0163162_10317431 3300013306 Bacteria 1691
257 Ga0163162_10458914 3300013306 Bacteria 1406
258 Ga0163162_10545137 3300013306 Bacteria 1288
259 Ga0163162_10869676 3300013306 Bacteria 1016
260 Ga0163162_10899421 3300013306 Bacteria 998
261 Ga0163162_11687831 3300013306 Bacteria 723
262 Ga0163162_12213928 3300013306 Bacteria 631
263 Ga0157375_10486244 3300013308 Bacteria 1399
264 Ga0157375_10749445 3300013308 Bacteria 1128
265 Ga0157375_11074346 3300013308 Bacteria 941
266 Ga0163163_10023070 3300014325 Bacteria 5901
267 Ga0163163_10275897 3300014325 Bacteria 1732
268 Ga0163163_10314975 3300014325 Bacteria 1618
269 Ga0163163_10465131 3300014325 Bacteria 1325
270 Ga0157380_10162993 3300014326 Bacteria 1940
271 Ga0157380_11542747 3300014326 Bacteria 718
272 Ga0157380_11910570 3300014326 Bacteria 654
273 Ga0157380_12367490 3300014326 Bacteria 596
274 Ga0157377_10365429 3300014745 Bacteria 973
275 Ga0157377_10410198 3300014745 Bacteria 925
276 Ga0157379_10033139 3300014968 Bacteria 4607
277 Ga0157379_10791970 3300014968 Bacteria 894
278 Ga0157379_11216182 3300014968 Bacteria 725
279 Ga0157376_10465240 3300014969 Bacteria 1236
280 Ga0157376_10978925 3300014969 Bacteria 867
281 Ga0157376_11049219 3300014969 Bacteria 839
282 Ga0163161_10137602 3300017792 Bacteria 1847
283 Ga0163161_10279002 3300017792 Bacteria 1310
284 Ga0163161_10441933 3300017792 Bacteria 1050
285 Ga0163161_10747129 3300017792 Bacteria 818
286 Ga0209758_1003248 3300025297 Bacteria 15075
287 Ga0209758_1111111 3300025297 Bacteria 758
288 Ga0207697_10179104 3300025315 Bacteria 929
289 Ga0207656_10196513 3300025321 Bacteria 973
290 Ga0207656_10271883 3300025321 Bacteria 834
291 Ga0207696_1028849 3300025711 Bacteria 1699
292 Ga0207653_10118253 3300025885 Bacteria 952
293 Ga0207642_10422612 3300025899 Bacteria 802
294 Ga0207642_10473994 3300025899 Bacteria 762
295 Ga0207710_10163879 3300025900 Bacteria 1084
296 Ga0207710_10380814 3300025900 Bacteria 722
297 Ga0207688_10222671 3300025901 Bacteria 1137
298 Ga0207688_10578812 3300025901 Bacteria 707
299 Ga0207680_10358637 3300025903 Bacteria 1025
300 Ga0207680_10656209 3300025903 Bacteria 751
301 Ga0207647_10380973 3300025904 Bacteria 796
302 Ga0207645_10057724 3300025907 Bacteria 2478
303 Ga0207645_10103605 3300025907 Bacteria 1838
304 Ga0207645_10680578 3300025907 Bacteria 699
305 Ga0207705_10461045 3300025909 Bacteria 986
306 Ga0207684_10290950 3300025910 Bacteria 1408
307 Ga0207654_10727023 3300025911 Bacteria 714
308 Ga0207707_10330325 3300025912 Bacteria 1315
309 Ga0207695_10465988 3300025913 Bacteria 1146
310 Ga0207671_10973526 3300025914 Bacteria 669
311 Ga0207693_10028464 3300025915 Bacteria 4415
312 Ga0207693_10091760 3300025915 Bacteria 2381
313 Ga0207693_10511800 3300025915 Bacteria 937
314 Ga0207693_10588136 3300025915 Bacteria 867
315 Ga0207663_10060954 3300025916 Bacteria 2393
316 Ga0207660_10144030 3300025917 Bacteria 1824
317 Ga0207660_10271656 3300025917 Bacteria 1343
318 Ga0207662_10290628 3300025918 Bacteria 1084
319 Ga0207657_10261181 3300025919 Bacteria 1378
320 Ga0207657_10640755 3300025919 Bacteria 828
321 Ga0207652_10015934 3300025921 Bacteria 6126
322 Ga0207681_10142231 3300025923 Bacteria 1788
323 Ga0207650_10264311 3300025925 Bacteria 1397
324 Ga0207650_10600920 3300025925 Bacteria 925
325 Ga0207659_11405721 3300025926 Bacteria 598
326 Ga0207687_10047614 3300025927 Bacteria 2973
327 Ga0207687_10550900 3300025927 Bacteria 968
328 Ga0207687_11225756 3300025927 Bacteria 645
329 Ga0207700_10295303 3300025928 Bacteria 1398
330 Ga0207644_10637207 3300025931 Bacteria 886
331 Ga0207690_10789197 3300025932 Bacteria 784
332 Ga0207706_10078846 3300025933 Bacteria 2897
333 Ga0207686_10403116 3300025934 Bacteria 1042
334 Ga0207709_10081403 3300025935 Bacteria 2088
335 Ga0207709_10335183 3300025935 Bacteria 1137
336 Ga0207709_11181283 3300025935 Bacteria 630
337 Ga0207669_10025168 3300025937 Bacteria 3211
338 Ga0207669_10626209 3300025937 Bacteria 877
339 Ga0207704_10505313 3300025938 Bacteria 975
340 Ga0207704_10796004 3300025938 Bacteria 789
341 Ga0207665_10154911 3300025939 Bacteria 1644
342 Ga0207665_10264299 3300025939 Bacteria 1276
343 Ga0207691_10210957 3300025940 Bacteria 1687
344 Ga0207691_10490953 3300025940 Bacteria 1043
345 Ga0207691_10963975 3300025940 Bacteria 712
346 Ga0207691_11131052 3300025940 Bacteria 651
347 Ga0207711_10097167 3300025941 Bacteria 2600
348 Ga0207711_10437167 3300025941 Bacteria 1217
349 Ga0207711_10896368 3300025941 Bacteria 825
350 Ga0207689_10455407 3300025942 Bacteria 1070
351 Ga0207689_10616136 3300025942 Bacteria 913
352 Ga0207689_10746306 3300025942 Bacteria 826
353 Ga0207679_10252431 3300025945 Bacteria 1500
354 Ga0207667_10017031 3300025949 Bacteria 8198
355 Ga0207667_10123208 3300025949 Bacteria 2671
356 Ga0207667_10335217 3300025949 Bacteria 1544
357 Ga0207667_10647137 3300025949 Bacteria 1063
358 Ga0207651_10052362 3300025960 Bacteria 2783
359 Ga0207651_10458215 3300025960 Bacteria 1095
360 Ga0207651_10510770 3300025960 Bacteria 1040
361 Ga0207651_11280246 3300025960 Bacteria 659
362 Ga0207712_11253749 3300025961 Bacteria 662
363 Ga0207668_10517827 3300025972 Bacteria 1028
364 Ga0207668_10680376 3300025972 Bacteria 903
365 Ga0207668_10868620 3300025972 Bacteria 801
366 Ga0207658_10385062 3300025986 Bacteria 1229
367 Ga0207658_10717079 3300025986 Bacteria 904
368 Ga0207658_11217121 3300025986 Bacteria 688
369 Ga0207677_10021030 3300026023 Bacteria 3978
370 Ga0207677_10527654 3300026023 Bacteria 1025
371 Ga0207703_10410696 3300026035 Bacteria 1258
372 Ga0207703_10729551 3300026035 Bacteria 943
373 Ga0207639_10264354 3300026041 Bacteria 1506
374 Ga0207639_11183512 3300026041 Bacteria 717
375 Ga0207678_10326082 3300026067 Bacteria 1321
376 Ga0207678_10436271 3300026067 Bacteria 1137
377 Ga0207678_11036763 3300026067 Bacteria 726
378 Ga0207678_11464959 3300026067 Bacteria 603
379 Ga0207708_10108248 3300026075 Bacteria 2156
380 Ga0207708_10485706 3300026075 Bacteria 1033
381 Ga0207708_11032369 3300026075 Bacteria 715
382 Ga0207708_11356189 3300026075 Bacteria 624
383 Ga0207702_10236595 3300026078 Bacteria 1709
384 Ga0207702_10249945 3300026078 Bacteria 1665
385 Ga0207702_10298771 3300026078 Bacteria 1528
386 Ga0207641_10185072 3300026088 Bacteria 1910
387 Ga0207641_10857673 3300026088 Bacteria 900
388 Ga0207648_10039644 3300026089 Bacteria 4141
389 Ga0207676_10231760 3300026095 Bacteria 1651
390 Ga0207676_10299134 3300026095 Bacteria 1468
391 Ga0207676_11917353 3300026095 Bacteria 591
392 Ga0207676_11983794 3300026095 Bacteria 581
393 Ga0207674_10225143 3300026116 Bacteria 1824
394 Ga0207675_100105346 3300026118 Bacteria 2658
395 Ga0207675_100692436 3300026118 Bacteria 1027
396 Ga0207675_100696859 3300026118 Bacteria 1024
397 Ga0207675_101105569 3300026118 Bacteria 812
398 Ga0207683_10153602 3300026121 Bacteria 2078
399 Ga0207683_10484505 3300026121 Bacteria 1142
400 Ga0207683_10975859 3300026121 Bacteria 787
401 Ga0207683_11185824 3300026121 Bacteria 708
402 Ga0207683_11247552 3300026121 Bacteria 689
403 Ga0207698_10084393 3300026142 Bacteria 2575
404 Ga0207698_10332547 3300026142 Bacteria 1428
405 Ga0209813_10014046 3300027866 Bacteria 2149
406 Ga0207428_10308306 3300027907 Bacteria 1171
407 Ga0268266_10003299 3300028379 Bacteria 16216
408 Ga0268266_10078801 3300028379 Bacteria 2867
409 Ga0268266_11338606 3300028379 Bacteria 691
410 Ga0268265_10033437 3300028380 Bacteria 3738
411 Ga0268265_11395205 3300028380 Bacteria 702
412 Ga0268265_11885470 3300028380 Bacteria 604
413 Ga0268264_10711360 3300028381 Bacteria 998
414 Ga0307517_10000111 3300028786 Bacteria 120304
415 Ga0307515_10066624 3300028794 Bacteria 4985
416 Ga0307515_10449843 3300028794 Bacteria 904
417 Ga0307515_10718653 3300028794 Bacteria 616
418 Ga0265339_10009277 3300031249 Bacteria 6199
419 Ga0265331_10053097 3300031250 Bacteria 1935
420 Ga0265331_10125738 3300031250 Bacteria 1171
421 Ga0307513_10100899 3300031456 Bacteria 2910
422 Ga0307513_10142176 3300031456 Bacteria 2324
423 Ga0307513_10695197 3300031456 Bacteria 723
424 Ga0307513_10725872 3300031456 Bacteria 699
425 Ga0307509_10328519 3300031507 Bacteria 1262
426 Ga0307509_10416174 3300031507 Bacteria 1046
427 Ga0307408_100996469 3300031548 Bacteria 772
428 Ga0307508_10011459 3300031616 Bacteria 8102
429 Ga0307508_10151197 3300031616 Bacteria 1926
430 Ga0307508_10386252 3300031616 Bacteria 991
431 Ga0307508_10589762 3300031616 Bacteria 712
432 Ga0265314_10047945 3300031711 Bacteria 3002
433 Ga0265342_10006887 3300031712 Bacteria 8400
434 Ga0307516_10187640 3300031730 Bacteria 1796
435 Ga0307413_10487408 3300031824 Bacteria 987
436 Ga0307407_10232986 3300031903 Bacteria 1252
437 Ga0307412_10457155 3300031911 Bacteria 1053
438 Ga0307414_10914113 3300032004 Bacteria 805
439 Ga0307411_10021434 3300032005 Bacteria 3782
440 Ga0307411_11015490 3300032005 Bacteria 743
441 Ga0307415_100353365 3300032126 Bacteria 1238
442 Ga0307510_10002750 3300033180 Bacteria 20142
443 Ga0307510_10036687 3300033180 Bacteria 5453
444 Ga0307510_10179818 3300033180 Bacteria 1680
445 Ga0307510_10276523 3300033180 Bacteria 1152
446 Ga0307510_10322235 3300033180 Bacteria 1002
447 Ga0307510_10437472 3300033180 Bacteria 749
448 Ga0315911_1000001 3300033442 Bacteria 1088602
449 Ga0373926_0123435 3300035083 Bacteria 977
450 Ga0373928_0032698 3300035084 Bacteria 1161
451 Ga0373929_0045609 3300035085 Bacteria 988
452 Ga0373934_0002075 3300035086 Bacteria 7353
453 Ga0373934_0051444 3300035086 Bacteria 1633
454 Ga0373934_0053526 3300035086 Bacteria 1601
455 Ga0373951_0044565 3300035091 Bacteria 1078
456 Ga0373923_0004381 3300035111 Bacteria 4678
457 Ga0373923_0445357 3300035111 Bacteria 627
458 Ga0373932_0180908 3300035112 Bacteria 740
459 Ga0373932_0251113 3300035112 Bacteria 645
460 Ga0373936_0004513 3300035113 Bacteria 5271
461 Ga0373936_0089382 3300035113 Bacteria 1290
462 Ga0373936_0145615 3300035113 Bacteria 1025
463 Ga0373953_0000167 3300035117 Bacteria 17273
464 Ga0373954_0000035 3300035118 Bacteria 51266
465 Ga0373954_0053833 3300035118 Bacteria 1892
466 Ga0373956_0024009 3300035119 Bacteria 2622
467 Ga0373957_0078352 3300035120 Bacteria 1301
468 Ga0373960_0161258 3300035121 Bacteria 772
469 Ga0373943_0149988 3300035170 Bacteria 1262
470 Ga0373943_0660472 3300035170 Bacteria 618
471 Ga0373946_0073976 3300035171 Bacteria 1478
472 Ga0373946_0201352 3300035171 Bacteria 954
473 Ga0373955_0005583 3300035172 Bacteria 5657
474 Ga0373955_0014576 3300035172 Bacteria 3827
475 Ga0373955_0137335 3300035172 Bacteria 1431
476 Ga0373942_0082732 3300035207 Bacteria 956
477 Ga0373961_0070820 3300035241 Bacteria 1078
478 Ga0373961_0078649 3300035241 Bacteria 1034
479 Ga0373924_0014763 3300035410 Bacteria 2955
480 Ga0373924_0098077 3300035410 Bacteria 1259
481 Ga0373924_0136343 3300035410 Bacteria 1069
482 Ga0373931_0010956 3300035691 Bacteria 4369
483 Ga0373931_0025212 3300035691 Bacteria 3020
484 Ga0373931_0231060 3300035691 Bacteria 1117
485 Ga0373931_0248664 3300035691 Bacteria 1080
486 Ga0373931_0723862 3300035691 Bacteria 659
487 Ga0373935_0000758 3300035692 Bacteria 17187
488 Ga0373935_1055749 3300035692 Bacteria 604
489 Ga0373927_0002965 3300035695 Bacteria 12316
490 Ga0373933_0000037 3300035724 Bacteria 81092
491 Ga0373947_0026555 3300035725 Bacteria 3386
492 Ga0373937_0000118 3300036401 Bacteria 75902
493 Ga0373937_0057240 3300036401 Bacteria 3581
494 Ga0373937_1293772 3300036401 Bacteria 677
495 Ga0373925_0008176 3300037068 Bacteria 7618
496 Ga0373925_0075159 3300037068 Bacteria 2560
497 Ga0395905_0910239 3300037471 Bacteria 782
498 Ga0439465_0063256 3300041413 Bacteria 1229
499 Ga0451797_1204241 3300041453 Bacteria 533
500 Ga0451795_0987322 3300041456 Bacteria 672
501 Ga0451802_0425428 3300041460 Bacteria 949
502 Ga0451807_2359835 3300041486 Bacteria 841
503 Ga0451807_2648159 3300041486 Bacteria 675
504 Ga0451833_1265906 3300041491 Bacteria 815
505 Ga0451853_0743401 3300041512 Bacteria 647
506 Ga0439431_0038409 3300041997 Bacteria 1212
507 Ga0439458_0057062 3300042157 Bacteria 971
508 Ga0439458_0120792 3300042157 Bacteria 690
509 Ga0466959_0103000 3300045049 Bacteria 2042
510 Ga0495617_069187 3300046452 Bacteria 1161
511 Ga0495627_059722 3300046453 Bacteria 1131
512 Ga0495592_0002185 3300046454 Bacteria 13770
513 Ga0495603_0000027 3300046455 Bacteria 61238
514 Ga0495603_0067970 3300046455 Bacteria 2096
515 Ga0495603_0194657 3300046455 Bacteria 1172
516 Ga0495603_0348182 3300046455 Bacteria 850
517 Ga0495603_0557647 3300046455 Bacteria 656
518 Ga0495590_0081146 3300046457 Bacteria 1142
519 Ga0495591_067348 3300046458 Bacteria 937
520 Ga0495629_0000290 3300046459 Bacteria 43459
521 Ga0495629_0050941 3300046459 Bacteria 2898
522 Ga0495629_0602384 3300046459 Bacteria 735
523 Ga0495638_0305499 3300046460 Bacteria 855
524 Ga0495638_0373676 3300046460 Bacteria 746
525 Ga0495638_0450372 3300046460 Bacteria 657
526 Ga0495641_0005129 3300046461 Bacteria 8967
527 Ga0495651_0000412 3300046462 Bacteria 33198
528 Ga0495651_0166998 3300046462 Bacteria 1571
529 Ga0495651_0210996 3300046462 Bacteria 1351
530 Ga0495651_0216888 3300046462 Bacteria 1327
531 Ga0495653_0000161 3300046463 Bacteria 55322
532 Ga0495650_0125540 3300046471 Bacteria 941
533 Ga0495650_0169990 3300046471 Bacteria 772
534 Ga0495580_0003356 3300046472 Bacteria 13678
535 Ga0495580_0306484 3300046472 Bacteria 1081
536 Ga0495582_0000157 3300046473 Bacteria 36665
537 Ga0495605_0195845 3300046474 Bacteria 882
538 Ga0495639_0000048 3300046475 Bacteria 53257
539 Ga0495639_0606149 3300046475 Bacteria 563
540 Ga0495662_0000814 3300046476 Bacteria 15152
541 Ga0495664_0032625 3300046477 Bacteria 3057
542 Ga0495664_0114065 3300046477 Bacteria 1632
543 Ga0495664_0173731 3300046477 Bacteria 1307
544 Ga0495664_0181282 3300046477 Bacteria 1277
545 Ga0495584_0191921 3300046491 Bacteria 1038
546 Ga0495584_0217869 3300046491 Bacteria 970
547 Ga0495585_0139867 3300046492 Bacteria 1268
548 Ga0495594_0001217 3300046499 Bacteria 13445
549 Ga0495596_0222467 3300046500 Bacteria 733
550 Ga0495607_0195017 3300046501 Bacteria 1006
551 Ga0495583_0121046 3300046506 Bacteria 1102
552 Ga0495583_0129998 3300046506 Bacteria 1054
553 Ga0495583_0229880 3300046506 Bacteria 748
554 Ga0495608_0000337 3300046511 Bacteria 33005
555 Ga0495608_0328794 3300046511 Bacteria 943
556 Ga0495610_0180727 3300046512 Bacteria 877
557 Ga0495610_0280143 3300046512 Bacteria 650
558 Ga0495616_0105154 3300046513 Bacteria 1318
559 Ga0495616_0413764 3300046513 Bacteria 552
560 Ga0495618_0443494 3300046514 Bacteria 789
561 Ga0495620_0159916 3300046515 Bacteria 875
562 Ga0495628_0036389 3300046516 Bacteria 3951
563 Ga0495628_0293628 3300046516 Bacteria 1204
564 Ga0495630_0000846 3300046517 Bacteria 21588
565 Ga0495631_0101559 3300046518 Bacteria 1237
566 Ga0495632_0059700 3300046519 Bacteria 1855
567 Ga0495632_0177841 3300046519 Bacteria 975
568 Ga0495632_0189799 3300046519 Bacteria 939
569 Ga0495632_0206832 3300046519 Bacteria 891
570 Ga0495632_0374128 3300046519 Bacteria 624
571 Ga0495637_0171649 3300046520 Bacteria 808
572 Ga0495643_0379002 3300046522 Bacteria 628
573 Ga0495643_0414032 3300046522 Bacteria 592
574 Ga0495643_0464663 3300046522 Bacteria 549
575 Ga0495644_0090089 3300046523 Bacteria 1157
576 Ga0495644_0158754 3300046523 Bacteria 867
577 Ga0495648_0003360 3300046524 Bacteria 14095
578 Ga0495648_0324484 3300046524 Bacteria 712
579 Ga0495648_0346372 3300046524 Bacteria 680
580 Ga0495663_0012324 3300046525 Bacteria 2382
581 Ga0495666_0170382 3300046526 Bacteria 1007
582 Ga0495666_0214820 3300046526 Bacteria 882
583 Ga0495642_0286078 3300046528 Bacteria 722
584 Ga0495652_0012092 3300046529 Bacteria 7798
585 Ga0495652_0115522 3300046529 Bacteria 2150
586 Ga0495652_0240059 3300046529 Bacteria 1349
587 Ga0495654_0180546 3300046530 Bacteria 914
588 Ga0495654_0287348 3300046530 Bacteria 675
589 Ga0495665_0002259 3300046531 Bacteria 10438
590 Ga0495665_0283055 3300046531 Bacteria 850
591 Ga0495640_0004105 3300046533 Bacteria 11649
592 Ga0495640_0004805 3300046533 Bacteria 10757
593 Ga0495587_0000668 3300046536 Bacteria 22979
594 Ga0495587_0191793 3300046536 Bacteria 1157
595 Ga0495598_0043288 3300046537 Bacteria 1325
596 Ga0495609_0095484 3300046538 Bacteria 1290
597 Ga0495609_0168032 3300046538 Bacteria 927
598 Ga0495609_0276146 3300046538 Bacteria 688
599 Ga0495621_0045106 3300046539 Bacteria 1560
600 Ga0495645_0050107 3300046543 Bacteria 3040
601 Ga0495645_0385493 3300046543 Bacteria 896
602 Ga0495622_0014669 3300046557 Bacteria 3640
603 Ga0495622_0339614 3300046557 Bacteria 651
604 Ga0495622_0466854 3300046557 Bacteria 541
605 Ga0495633_0181053 3300046558 Bacteria 970
606 Ga0495667_0000147 3300046559 Bacteria 47993
607 Ga0495667_0198544 3300046559 Bacteria 1284
608 Ga0495656_0277376 3300046615 Bacteria 853
609 Ga0495668_0289132 3300046616 Bacteria 898
610 Ga0495668_0408206 3300046616 Bacteria 746
611 Ga0495668_0657359 3300046616 Bacteria 579
612 Ga0495634_0001002 3300046642 Bacteria 26604
613 Ga0495611_0222265 3300046648 Bacteria 878
614 Ga0495625_0245969 3300046660 Bacteria 1162
615 Ga0495625_0310071 3300046660 Bacteria 1007
616 Ga0495625_0741135 3300046660 Bacteria 577
617 Ga0495635_0000094 3300046663 Bacteria 52578
618 Ga0495635_0001877 3300046663 Bacteria 14243
619 Ga0495635_0503554 3300046663 Bacteria 797
620 Ga0495659_0040840 3300046664 Bacteria 1655
621 Ga0495659_0278960 3300046664 Bacteria 702
622 Ga0495661_0159652 3300046665 Bacteria 1211
623 Ga0495588_0004956 3300046674 Bacteria 5910
624 Ga0495588_0156603 3300046674 Bacteria 1204
625 Ga0495657_0001420 3300046675 Bacteria 20703
626 Ga0495657_0263082 3300046675 Bacteria 1036
627 Ga0495657_0531189 3300046675 Bacteria 684
628 Ga0495599_0000253 3300046678 Bacteria 33822
629 Ga0495599_0344043 3300046678 Bacteria 895
630 Ga0495623_0000768 3300046679 Bacteria 21497
631 Ga0495623_0055642 3300046679 Bacteria 2493
632 Ga0495623_0243496 3300046679 Bacteria 1015
633 Ga0495646_0002668 3300046680 Bacteria 11037
634 Ga0495646_0010961 3300046680 Bacteria 5758
635 Ga0495647_0001301 3300046681 Bacteria 7674
636 Ga0495658_0048666 3300046683 Bacteria 2391
637 Ga0495669_0023405 3300046684 Bacteria 2688
638 Ga0495669_0132973 3300046684 Bacteria 1171
639 Ga0495669_0267054 3300046684 Bacteria 822
640 Ga0495613_0006428 3300046689 Bacteria 8785
641 Ga0495613_0386358 3300046689 Bacteria 956
642 Ga0495624_0000380 3300046690 Bacteria 35436
643 Ga0495624_0151058 3300046690 Bacteria 1421
644 Ga0495670_0226385 3300046691 Bacteria 994
645 Ga0495670_0358224 3300046691 Bacteria 785
646 Ga0495671_0162984 3300046692 Bacteria 1084
647 Ga0495671_0214610 3300046692 Bacteria 932
648 Ga0495671_0283809 3300046692 Bacteria 797
649 Ga0495589_0071888 3300046794 Bacteria 1690
650 Ga0495589_0329986 3300046794 Bacteria 704
651 Ga0495589_0330592 3300046794 Bacteria 703
652 Ga0495589_0445084 3300046794 Bacteria 593
653 Ga0495600_0002207 3300046809 Bacteria 11075
654 Ga0495600_0403777 3300046809 Bacteria 850
655 Ga0495581_0000233 3300047315 Bacteria 26288
656 Ga0495581_0368778 3300047315 Bacteria 838
657 Ga0495604_0000253 3300047317 Bacteria 47392
658 Ga0495636_0304620 3300047318 Bacteria 746
659 Ga0495674_0002874 3300047319 Bacteria 16742
660 Ga0495674_0102638 3300047319 Bacteria 2432
661 Ga0495672_0040313 3300047320 Bacteria 2833
662 Ga0495676_0260320 3300047321 Bacteria 1180
663 Ga0495680_0000406 3300047322 Bacteria 48300
664 Ga0495680_0068965 3300047322 Bacteria 2700
665 Ga0495683_0123902 3300047323 Bacteria 1224
666 Ga0495683_0154962 3300047323 Bacteria 1063
667 Ga0495675_0000285 3300047444 Bacteria 36643
668 Ga0495675_0113399 3300047444 Bacteria 1691
669 Ga0495677_0032962 3300047445 Bacteria 1887
670 Ga0495679_099623 3300047446 Bacteria 808
671 Ga0495679_150982 3300047446 Bacteria 624
672 Ga0495685_076758 3300047447 Bacteria 1115
673 Ga0495685_193752 3300047447 Bacteria 652
674 Ga0495673_0115015 3300047469 Bacteria 1071
675 Ga0495673_0237132 3300047469 Bacteria 670
676 Ga0495673_0283976 3300047469 Bacteria 597
677 Ga0495673_0371252 3300047469 Bacteria 502
678 Ga0495681_0149432 3300047470 Bacteria 981
679 Ga0495684_0000184 3300047471 Bacteria 47730
680 Ga0495684_0030110 3300047471 Bacteria 4167
681 Ga0495593_0000160 3300047673 Bacteria 34170
682 Ga0495593_0226917 3300047673 Bacteria 937
683 Ga0495602_0001148 3300048088 Bacteria 25888
684 Ga0495602_0132250 3300048088 Bacteria 1988
685 Ga0495602_0139333 3300048088 Bacteria 1922
686 Ga0495602_0665355 3300048088 Bacteria 710
687 Ga0495614_0011061 3300048089 Bacteria 3970
688 Ga0495615_0104819 3300048090 Bacteria 803
689 Ga0496100_0037478 3300048903 Bacteria 3066
690 Ga0496100_0534082 3300048903 Bacteria 906
691 Ga0496100_0719989 3300048903 Bacteria 779
692 Ga0496101_0014849 3300048904 Bacteria 5240
693 Ga0496101_0323311 3300048904 Bacteria 1210
694 Ga0496101_0338550 3300048904 Bacteria 1181
695 Ga0496101_0344316 3300048904 Bacteria 1171
696 Ga0496101_0765112 3300048904 Bacteria 762
697 Ga0496101_1209103 3300048904 Bacteria 592
698 Ga0496102_0362108 3300048905 Bacteria 1365
699 Ga0496102_0412418 3300048905 Bacteria 1269
700 Ga0496102_0684594 3300048905 Bacteria 948
701 Ga0496103_0038610 3300048906 Bacteria 2931
702 Ga0496103_0361787 3300048906 Bacteria 933
703 Ga0496103_0736745 3300048906 Bacteria 624
704 Ga0496103_0931976 3300048906 Bacteria 543
705 Ga0496104_0004525 3300048907 Bacteria 12115
706 Ga0496104_0005723 3300048907 Bacteria 10878
707 Ga0496104_0093215 3300048907 Bacteria 2880
708 Ga0496104_0211028 3300048907 Bacteria 1853
709 Ga0496104_0221254 3300048907 Bacteria 1805
710 Ga0496104_0708016 3300048907 Bacteria 915
711 Ga0496104_0811163 3300048907 Bacteria 842
712 Ga0496104_0824428 3300048907 Bacteria 833
713 Ga0496105_0022833 3300048908 Bacteria 5070
714 Ga0496105_0051568 3300048908 Bacteria 3399
715 Ga0496105_0961602 3300048908 Bacteria 641
716 Ga0496106_0020373 3300048909 Bacteria 4921
717 Ga0496106_0393711 3300048909 Bacteria 1113
718 Ga0496107_0009868 3300048910 Bacteria 6621
719 Ga0496107_0010008 3300048910 Bacteria 6577
720 Ga0496107_0128306 3300048910 Bacteria 1871
721 Ga0496107_0246760 3300048910 Bacteria 1329
722 Ga0496107_0251021 3300048910 Bacteria 1316
723 Ga0496107_1089774 3300048910 Bacteria 577
724 Ga0496108_0012626 3300048911 Bacteria 6883
725 Ga0496108_0014497 3300048911 Bacteria 6435
726 Ga0496108_0107718 3300048911 Bacteria 2380
727 Ga0496108_0135669 3300048911 Bacteria 2117
728 Ga0496108_0589937 3300048911 Bacteria 968
729 Ga0496108_0801613 3300048911 Bacteria 812
730 Ga0496108_1665184 3300048911 Bacteria 526
731 Ga0496109_0001625 3300048912 Bacteria 18767
732 Ga0496109_0014487 3300048912 Bacteria 6860
733 Ga0496109_0135206 3300048912 Bacteria 2303
734 Ga0496109_0471419 3300048912 Bacteria 1185
735 Ga0496110_0003188 3300048913 Bacteria 12488
736 Ga0496110_0011002 3300048913 Bacteria 7383
737 Ga0496110_0016721 3300048913 Bacteria 6127
738 Ga0496110_0038042 3300048913 Bacteria 4184
739 Ga0496110_0120912 3300048913 Bacteria 2359
740 Ga0496110_0227730 3300048913 Bacteria 1695
741 Ga0496110_1928005 3300048913 Bacteria 501
742 Ga0496111_0144305 3300048914 Bacteria 1764
743 Ga0496111_0225412 3300048914 Bacteria 1392
744 Ga0496111_0397643 3300048914 Bacteria 1018
745 Ga0496111_0491724 3300048914 Bacteria 903
746 Ga0496112_0001486 3300048915 Bacteria 18040
747 Ga0496112_0012497 3300048915 Bacteria 7802
748 Ga0496112_0029342 3300048915 Bacteria 5319
749 Ga0496112_0071601 3300048915 Bacteria 3426
750 Ga0496112_0169400 3300048915 Bacteria 2149
751 Ga0496112_0420633 3300048915 Bacteria 1275
752 Ga0496112_1289849 3300048915 Bacteria 646
753 Ga0496113_0140188 3300048916 Bacteria 1902
754 Ga0496113_0200674 3300048916 Bacteria 1585
755 Ga0496113_0321581 3300048916 Bacteria 1240
756 Ga0496114_0020268 3300048917 Bacteria 5395
757 Ga0496114_0396818 3300048917 Bacteria 1222
758 Ga0496114_0533855 3300048917 Bacteria 1037
759 Ga0496114_0704165 3300048917 Bacteria 885
760 Ga0496115_0000957 3300048918 Bacteria 20941
761 Ga0496115_0017252 3300048918 Bacteria 5513
762 Ga0496115_0026693 3300048918 Bacteria 4510
763 Ga0496115_0067536 3300048918 Bacteria 2892
764 Ga0496115_0152734 3300048918 Bacteria 1907
765 Ga0496115_0213225 3300048918 Bacteria 1595
766 Ga0496115_0287498 3300048918 Bacteria 1349
767 Ga0496115_0435924 3300048918 Bacteria 1060
768 Ga0496115_0558334 3300048918 Bacteria 914
769 Ga0496115_1068453 3300048918 Bacteria 613
770 Ga0496117_0452804 3300048920 Bacteria 634
771 Ga0496118_0316948 3300048921 Bacteria 848
772 Ga0496119_0094919 3300048922 Bacteria 1686
773 Ga0496120_0399211 3300048923 Bacteria 608
774 Ga0496121_0183693 3300048924 Bacteria 1506
775 Ga0496121_0258887 3300048924 Bacteria 1202
776 Ga0496121_0382177 3300048924 Bacteria 928
777 Ga0496121_0656276 3300048924 Bacteria 638
778 Ga0496124_0358509 3300048927 Bacteria 1028
779 Ga0496124_0799804 3300048927 Bacteria 584
780 Ga0496125_0095613 3300048928 Bacteria 2209
781 Ga0496125_0750610 3300048928 Bacteria 511
782 Ga0496126_0012947 3300048929 Bacteria 8517
783 Ga0496126_0027023 3300048929 Bacteria 5491
784 Ga0496126_0096463 3300048929 Bacteria 2592
785 Ga0496126_0156382 3300048929 Bacteria 1951
786 Ga0496126_0160059 3300048929 Bacteria 1924
787 Ga0496126_0238314 3300048929 Bacteria 1521
788 Ga0496126_0253820 3300048929 Bacteria 1464
789 Ga0496126_0691027 3300048929 Bacteria 794
790 Ga0496126_1006238 3300048929 Bacteria 625
791 Ga0496126_1021187 3300048929 Bacteria 619
792 Ga0495678_086534 3300049459 Bacteria 1114
793 Ga0495682_0112232 3300049460 Bacteria 977
794 Ga0495682_0165893 3300049460 Bacteria 786
795 Ga0501036_1166602 3300049572 Bacteria 628
796 Ga0501037_0122526 3300049573 Bacteria 1869
797 Ga0501039_0532769 3300049575 Bacteria 922
798 Ga0501040_0259289 3300049576 Bacteria 1241
799 Ga0501041_0164239 3300049577 Bacteria 1389
800 Ga0501067_0497976 3300049583 Bacteria 681
801 Ga0501069_0362305 3300049585 Bacteria 855
802 Ga0501070_0690684 3300049586 Bacteria 808
803 Ga0501071_0447329 3300049587 Bacteria 989
804 Ga0501072_0553898 3300049588 Bacteria 908
805 Ga0501076_0622138 3300049592 Bacteria 891
806 Ga0501081_0496183 3300049743 Bacteria 910
807 nmdc:mga03683_123863_c1 3300050489 Bacteria 1151
808 nmdc:mga03683_236608_c1 3300050489 Bacteria 846
809 nmdc:mga03683_297205_c1 3300050489 Bacteria 757
810 nmdc:mga03683_33917_c1 3300050489 Bacteria 1064
811 nmdc:mga03683_46904_c1 3300050489 Bacteria 1792
812 nmdc:mga03n38_259940_c1 3300050490 Bacteria 920
813 nmdc:mga03n38_4297_c1 3300050490 Bacteria 4697
814 nmdc:mga00v17_225126_c1 3300050491 Bacteria 1215
815 nmdc:mga00v17_276426_c1 3300050491 Bacteria 1090
816 nmdc:mga00v17_371347_c1 3300050491 Bacteria 930
817 nmdc:mga00v17_497202_c1 3300050491 Bacteria 791
818 nmdc:mga0yw44_159032_c1 3300050492 Bacteria 1478
819 nmdc:mga0k408_257415_c1 3300050493 Bacteria 1042
820 nmdc:mga0k408_350090_c1 3300050493 Bacteria 881
821 nmdc:mga06z11_232409_c1 3300050494 Bacteria 1081
822 nmdc:mga06z11_289417_c1 3300050494 Bacteria 972
823 nmdc:mga06z11_4502_c1 3300050494 Bacteria 5487
824 nmdc:mga04h51_157441_c1 3300050495 Bacteria 872
825 nmdc:mga04h51_273244_c1 3300050495 Bacteria 683
826 nmdc:mga04h51_70415_c1 3300050495 Bacteria 1220
827 nmdc:mga07m45_39194_c1 3300050496 Bacteria 2647
828 nmdc:mga07m45_40246_c1 3300050496 Bacteria 2615
829 nmdc:mga05p37_332591_c1 3300050507 Bacteria 1794
830 nmdc:mga08y16_700503_c1 3300050511 Bacteria 1013
831 nmdc:mga0n895_569228_c1 3300050512 Bacteria 1138
832 nmdc:mga0rr50_162110_c1 3300050513 Bacteria 1815
833 nmdc:mga0sz30_14151_c1 3300050516 Bacteria 3136
834 nmdc:mga0sz30_272597_c1 3300050516 Bacteria 754
835 Ga0495601_0214456 3300053077 Bacteria 1257
836 Ga0495601_0330755 3300053077 Bacteria 992
837 Ga0495601_0829178 3300053077 Bacteria 586
838 Ga0495601_0839541 3300053077 Bacteria 582
839 Ga0495612_0091003 3300053078 Bacteria 1292
840 Ga0495612_0118384 3300053078 Bacteria 1138
841 Ga0500635_0222076 3300053080 Bacteria 738
842 Ga0495655_0122051 3300053083 Bacteria 794
843 Ga0495595_0002312 3300053084 Bacteria 7431
844 Ga0495595_0274241 3300053084 Bacteria 846
845 Ga0495619_0000209 3300053085 Bacteria 42507
846 Ga0495619_0497802 3300053085 Bacteria 838
847 Ga0500578_0340591 3300053086 Bacteria 879
848 Ga0500583_0057799 3300053092 Bacteria 1822
849 Ga0500583_0494185 3300053092 Bacteria 575
850 Ga0500651_0375615 3300053093 Bacteria 802
851 Ga0500566_0144995 3300053094 Bacteria 1255
852 Ga0500641_0062919 3300053096 Bacteria 1548
853 Ga0500554_013386 3300053102 Bacteria 2090
854 Ga0500555_014921 3300053103 Bacteria 2240
855 Ga0500569_093499 3300053109 Bacteria 977
856 Ga0500595_002765 3300053119 Bacteria 8449
857 Ga0500595_058997 3300053119 Bacteria 1164
858 Ga0500607_304551 3300053121 Bacteria 586
859 Ga0500608_181198 3300053122 Bacteria 892
860 Ga0500617_201580 3300053124 Bacteria 729
861 Ga0500655_066561 3300053133 Bacteria 731
862 Ga0500658_0384979 3300053134 Bacteria 642
863 Ga0500568_0085400 3300053139 Bacteria 1195
864 Ga0500577_0322953 3300053142 Bacteria 674
865 Ga0500589_090739 3300053147 Bacteria 1346
866 Ga0500603_063380 3300053150 Bacteria 1038
867 Ga0500603_101442 3300053150 Bacteria 855
868 Ga0500604_0107189 3300053151 Bacteria 925
869 Ga0500604_0217347 3300053151 Bacteria 659
870 Ga0500627_0199014 3300053158 Bacteria 898
871 Ga0500634_0100956 3300053161 Bacteria 1444
872 Ga0500638_080847 3300053162 Bacteria 1543
873 Ga0500637_0024183 3300053178 Bacteria 3327
874 Ga0500637_0255955 3300053178 Bacteria 974
875 Ga0500611_104865 3300053727 Bacteria 737
876 Ga0500645_011669 3300053730 Bacteria 2860
877 Ga0500609_019939 3300053731 Bacteria 914
878 Ga0500656_038759 3300053732 Bacteria 660
879 Ga0500661_022339 3300055283 Bacteria 1121
880 8056674502 8056673599 Bacteria 7871253
881 2513656702 2513237096 Bacteria 8722461
882 2513672258 2513237098 Bacteria 9902361
883 2513858507 2513237137 Bacteria 9558895
884 2513917887 2513237145 Bacteria 8979722
885 2517893067 2517572143 Bacteria 9484767
886 2524536815 2524023228 Bacteria 10118060
887 2671117690 2667528175 Bacteria 7532676
888 2793077272
889 2824603292 2824600985 Bacteria 8488197
890 2824614059 2824609381 Bacteria 8672835
891 2824656607 2824653114 Bacteria 8493680
892 2874609627 2874604998 Bacteria 7834745
893 2876809506 2876808645 Bacteria 8824342
894 2879118512 2879110137 Bacteria 8907982
895 2885383820 2885383462 Bacteria 9473874
896 2888423712 2888419890 Bacteria 7857137
897 2889040570 2889033259 Bacteria 9099371
898 2903772717 2903768456 Bacteria 9749579
899 2904696249 2904690495 Bacteria 9412302
900 2904702578
901 2906640691 2906635258 Bacteria 8601019
902 2906661423 2906660503 Bacteria 8595048
903 2908760965 2908756301 Bacteria 8864324
904 2922367698 2922361189 Bacteria 7436256
905 2922392406 2922386360 Bacteria 7017218
906 2932796503 2932794094 Bacteria 7915132
907 2932803501 2932801729 Bacteria 7987968
908 2935633697 2935630451 Bacteria 8169952
909 2935886571 2935883170 Bacteria 7964738
910 2941510588 2941507105 Bacteria 8166816
911 2941517673 2941515067 Bacteria 8166720
912 2941525690 2941523033 Bacteria 8169134
913 8006941534 8006933436 Bacteria 10410654
914 8006967397 8006964411 Bacteria 8966052
915 8006981243 8006973647 Bacteria 10679141
916 8006988147 8006984368 Bacteria 9651211
917 8006997711 8006994254 Bacteria 8309700
918 8056690163 8056689827 Bacteria 6712655
919 JGI24743J22301_10058784
920 JGI24743J22301_10059612
921 JGI24738J21930_10064694
922 JGI24034J26672_10032748
923 JGI25153J46596_10001663
924 JGI25404J52841_10006374
925 JGI25404J52841_10017892
926 JGI25404J52841_10037060
927 Ga0070658_10579805
928 Ga0070676_10221988
929 Ga0070676_10371858
930 Ga0070670_100507789
931 Ga0070677_10091220
932 Ga0068869_100190485
933 Ga0068869_100556035
934 Ga0068869_100702389
935 Ga0070666_10610229
936 Ga0070680_100095813
937 Ga0070680_100319131
938 Ga0070680_101495579
939 Ga0070682_100155569
940 Ga0070682_100286193
941 Ga0068868_100053906
942 Ga0068868_100073736
943 Ga0070660_100202391
944 Ga0070660_100371648
945 Ga0070660_100392485
946 Ga0070689_101350541
947 Ga0070661_100212778
948 Ga0070661_100734471
949 Ga0070661_100835237
950 Ga0070661_100889566
951 Ga0070692_10344675
952 Ga0070668_100594326
953 Ga0070668_100614123
954 Ga0070668_100622008
955 Ga0070668_100630239
956 Ga0070669_101112340
957 Ga0070669_101188750
958 Ga0070671_100324833
959 Ga0070671_100382191
960 Ga0070671_100622465
961 Ga0070674_100249077
962 Ga0070673_100699534
963 Ga0070673_100772856
964 Ga0070673_101168485
965 Ga0070688_100251487
966 Ga0070688_100415220
967 Ga0070688_100604806
968 Ga0070667_100314371
969 Ga0070667_100555555
970 Ga0070667_100560011
971 Ga0070703_10152762
972 Ga0070713_100537791
973 Ga0070710_10179464
974 Ga0070710_10868680
975 Ga0070701_10575851
976 Ga0070711_100006622
977 Ga0070700_100179719
978 Ga0070694_100664380
979 Ga0070708_100753666
980 Ga0070708_101006235
981 Ga0070663_100013100
982 Ga0070663_100188650
983 Ga0070663_100277926
984 Ga0070663_100362211
985 Ga0070663_100483525
986 Ga0070678_100128081
987 Ga0070678_100142393
988 Ga0070678_100240508
989 Ga0070678_100753808
990 Ga0070678_101091591
991 Ga0070678_101379352
992 Ga0070662_100288205
993 Ga0068867_100087390
994 Ga0070685_10470555
995 Ga0070698_100284877
996 Ga0070699_100303119
997 Ga0070679_100017345
998 Ga0070679_100429571
999 Ga0070684_100794207
1000 Ga0070697_100629856
1001 Ga0068853_100110842
1002 Ga0068853_101684844
1003 Ga0070672_100577794
1004 Ga0070693_100333160
1005 Ga0070693_100462602
1006 Ga0070665_100219326
1007 Ga0070665_100236234
1008 Ga0070665_100517771
1009 Ga0070704_100128107
1010 Ga0070704_100345952
1011 Ga0068855_100028801
1012 Ga0068855_100104411
1013 Ga0068855_100390797
1014 Ga0068855_100802989
1015 Ga0068855_101419513
1016 Ga0070664_100325912
1017 Ga0070664_100742866
1018 Ga0068857_100665451
1019 Ga0068857_100790733
1020 Ga0068854_100409708
1021 Ga0068856_100239551
1022 Ga0068856_100445512
1023 Ga0068856_100745147
1024 Ga0068856_101993429
1025 Ga0070702_100935751
1026 Ga0068852_100039877
1027 Ga0068852_100847470
1028 Ga0068852_101602333
1029 Ga0068859_100200655
1030 Ga0068859_100440961
1031 Ga0068859_100891373
1032 Ga0068864_100015580
1033 Ga0068864_100623731
1034 Ga0068861_100135798
1035 Ga0068861_100717879
1036 Ga0068861_100796681
1037 Ga0068861_100959834
1038 Ga0068851_10651675
1039 Ga0068851_10924833
1040 Ga0068863_101408481
1041 Ga0068858_100378862
1042 Ga0068858_100958441
1043 Ga0068860_100769118
1044 Ga0068860_101278022
1045 Ga0068860_101340831
1046 Ga0068862_100511309
1047 Ga0068862_100743795
1048 Ga0068862_101400352
1049 Ga0081455_10046597
1050 Ga0081455_10059345
1051 Ga0081455_10085186
1052 Ga0081538_10041630
1053 Ga0081540_1008342
1054 Ga0081540_1015698
1055 Ga0081540_1017290
1056 Ga0081540_1187154
1057 Ga0081539_10046039
1058 Ga0070717_10141347
1059 Ga0070717_10626894
1060 Ga0075365_10009719
1061 Ga0075365_10135672
1062 Ga0075365_10202026
1063 Ga0075365_10394581
1064 Ga0075368_10017552
1065 Ga0075368_10054708
1066 Ga0075368_10207655
1067 Ga0075363_100010490
1068 Ga0075363_100112265
1069 Ga0075363_100167706
1070 Ga0075363_100269343
1071 Ga0075363_100444211
1072 Ga0075364_10054582
1073 Ga0075364_10385948
1074 Ga0075364_10421841
1075 Ga0075364_10644546
1076 Ga0075432_10290314
1077 Ga0070716_100780825
1078 Ga0070712_100398056
1079 Ga0075362_10063771
1080 Ga0075362_10066601
1081 Ga0075362_10217339
1082 Ga0075362_10362849
1083 Ga0075367_10041004
1084 Ga0075367_10045732
1085 Ga0075367_10116690
1086 Ga0075367_10291655
1087 Ga0075369_10058163
1088 Ga0075369_10268021
1089 Ga0075369_10381246
1090 Ga0075366_10096611
1091 Ga0075366_10239347
1092 Ga0075366_10538786
1093 Ga0097621_100317329
1094 Ga0097621_100425398
1095 Ga0097621_100828473
1096 Ga0097621_101049116
1097 Ga0075370_10019945
1098 Ga0075370_10045847
1099 Ga0068871_100519984
1100 Ga0068871_100616653
1101 Ga0068871_101474303
1102 Ga0068871_101477788
1103 Ga0075434_100340551
1104 Ga0068865_100135871
1105 Ga0097620_100200657
1106 Ga0097620_100440943
1107 Ga0097620_100891328
1108 Ga0099794_10188751
1109 Ga0099795_10206119
1110 Ga0099795_10271338
1111 Ga0099795_10363544
1112 Ga0105240_10711281
1113 Ga0111539_10397101
1114 Ga0105245_10128755
1115 Ga0105245_10254418
1116 Ga0105245_10933260
1117 Ga0105245_11285705
1118 Ga0105247_10427331
1119 Ga0105247_10967371
1120 Ga0105247_11088053
1121 Ga0105247_11113133
1122 Ga0114129_10661569
1123 Ga0114129_10769222
1124 Ga0105243_10188344
1125 Ga0105243_10647013
1126 Ga0105243_10685693
1127 Ga0105243_11026912
1128 Ga0105241_10361206
1129 Ga0105242_10327509
1130 Ga0105242_10365430
1131 Ga0105242_10368949
1132 Ga0105242_12011974
1133 Ga0105248_10192219
1134 Ga0105248_10601570
1135 Ga0105248_10727801
1136 Ga0105248_10821394
1137 Ga0105248_10904908
1138 Ga0105237_10805020
1139 Ga0105237_10969375
1140 Ga0105237_11304856
1141 Ga0105238_10375587
1142 Ga0105238_10676241
1143 Ga0105238_10728562
1144 Ga0105238_11535889
1145 Ga0105249_10220912
1146 Ga0105249_10386862
1147 Ga0105249_10986979
1148 Ga0105249_11604151
1149 Ga0105249_11941385
1150 Ga0099796_10030556
1151 Ga0099796_10081890
1152 Ga0099796_10143760
1153 Ga0099796_10433111
1154 Ga0105239_10250831
1155 Ga0105239_10730892
1156 Ga0105239_10741330
1157 Ga0105239_11300611
1158 Ga0105239_11524491
1159 Ga0105239_11772335
1160 Ga0105246_10431986
1161 Ga0105246_10566570
1162 Ga0105246_10591664
1163 Ga0105246_10616279
1164 Ga0105246_11060203
1165 Ga0105246_11071439
1166 Ga0157313_1034310
1167 Ga0157370_10084579
1168 Ga0157369_10706453
1169 Ga0157374_10111572
1170 Ga0157374_10427529
1171 Ga0157378_10835723
1172 Ga0157378_10945283
1173 Ga0157378_11055394
1174 Ga0163162_10317431
1175 Ga0163162_10458914
1176 Ga0163162_10545137
1177 Ga0163162_10869676
1178 Ga0163162_10899421
1179 Ga0163162_11687831
1180 Ga0163162_12213928
1181 Ga0157375_10486244
1182 Ga0157375_10749445
1183 Ga0157375_11074346
1184 Ga0163163_10023070
1185 Ga0163163_10275897
1186 Ga0163163_10314975
1187 Ga0163163_10465131
1188 Ga0157380_10162993
1189 Ga0157380_11542747
1190 Ga0157380_11910570
1191 Ga0157380_12367490
1192 Ga0157377_10365429
1193 Ga0157377_10410198
1194 Ga0157379_10033139
1195 Ga0157379_10791970
1196 Ga0157379_11216182
1197 Ga0157376_10465240
1198 Ga0157376_10978925
1199 Ga0157376_11049219
1200 Ga0163161_10137602
1201 Ga0163161_10279002
1202 Ga0163161_10441933
1203 Ga0163161_10747129
1204 Ga0209758_1003248
1205 Ga0209758_1111111
1206 Ga0207697_10179104
1207 Ga0207656_10196513
1208 Ga0207656_10271883
1209 Ga0207696_1028849
1210 Ga0207653_10118253
1211 Ga0207642_10422612
1212 Ga0207642_10473994
1213 Ga0207710_10163879
1214 Ga0207710_10380814
1215 Ga0207688_10222671
1216 Ga0207688_10578812
1217 Ga0207680_10358637
1218 Ga0207680_10656209
1219 Ga0207647_10380973
1220 Ga0207645_10057724
1221 Ga0207645_10103605
1222 Ga0207645_10680578
1223 Ga0207705_10461045
1224 Ga0207684_10290950
1225 Ga0207654_10727023
1226 Ga0207707_10330325
1227 Ga0207695_10465988
1228 Ga0207671_10973526
1229 Ga0207693_10028464
1230 Ga0207693_10091760
1231 Ga0207693_10511800
1232 Ga0207693_10588136
1233 Ga0207663_10060954
1234 Ga0207660_10144030
1235 Ga0207660_10271656
1236 Ga0207662_10290628
1237 Ga0207657_10261181
1238 Ga0207657_10640755
1239 Ga0207652_10015934
1240 Ga0207681_10142231
1241 Ga0207650_10264311
1242 Ga0207650_10600920
1243 Ga0207659_11405721
1244 Ga0207687_10047614
1245 Ga0207687_10550900
1246 Ga0207687_11225756
1247 Ga0207700_10295303
1248 Ga0207644_10637207
1249 Ga0207690_10789197
1250 Ga0207706_10078846
1251 Ga0207686_10403116
1252 Ga0207709_10081403
1253 Ga0207709_10335183
1254 Ga0207709_11181283
1255 Ga0207669_10025168
1256 Ga0207669_10626209
1257 Ga0207704_10505313
1258 Ga0207704_10796004
1259 Ga0207665_10154911
1260 Ga0207665_10264299
1261 Ga0207691_10210957
1262 Ga0207691_10490953
1263 Ga0207691_10963975
1264 Ga0207691_11131052
1265 Ga0207711_10097167
1266 Ga0207711_10437167
1267 Ga0207711_10896368
1268 Ga0207689_10455407
1269 Ga0207689_10616136
1270 Ga0207689_10746306
1271 Ga0207679_10252431
1272 Ga0207667_10017031
1273 Ga0207667_10123208
1274 Ga0207667_10335217
1275 Ga0207667_10647137
1276 Ga0207651_10052362
1277 Ga0207651_10458215
1278 Ga0207651_10510770
1279 Ga0207651_11280246
1280 Ga0207712_11253749
1281 Ga0207668_10517827
1282 Ga0207668_10680376
1283 Ga0207668_10868620
1284 Ga0207658_10385062
1285 Ga0207658_10717079
1286 Ga0207658_11217121
1287 Ga0207677_10021030
1288 Ga0207677_10527654
1289 Ga0207703_10410696
1290 Ga0207703_10729551
1291 Ga0207639_10264354
1292 Ga0207639_11183512
1293 Ga0207678_10326082
1294 Ga0207678_10436271
1295 Ga0207678_11036763
1296 Ga0207678_11464959
1297 Ga0207708_10108248
1298 Ga0207708_10485706
1299 Ga0207708_11032369
1300 Ga0207708_11356189
1301 Ga0207702_10236595
1302 Ga0207702_10249945
1303 Ga0207702_10298771
1304 Ga0207641_10185072
1305 Ga0207641_10857673
1306 Ga0207648_10039644
1307 Ga0207676_10231760
1308 Ga0207676_10299134
1309 Ga0207676_11917353
1310 Ga0207676_11983794
1311 Ga0207674_10225143
1312 Ga0207675_100105346
1313 Ga0207675_100692436
1314 Ga0207675_100696859
1315 Ga0207675_101105569
1316 Ga0207683_10153602
1317 Ga0207683_10484505
1318 Ga0207683_10975859
1319 Ga0207683_11185824
1320 Ga0207683_11247552
1321 Ga0207698_10084393
1322 Ga0207698_10332547
1323 Ga0209813_10014046
1324 Ga0207428_10308306
1325 Ga0268266_10003299
1326 Ga0268266_10078801
1327 Ga0268266_11338606
1328 Ga0268265_10033437
1329 Ga0268265_11395205
1330 Ga0268265_11885470
1331 Ga0268264_10711360
1332 Ga0307517_10000111
1333 Ga0307515_10066624
1334 Ga0307515_10449843
1335 Ga0307515_10718653
1336 Ga0265339_10009277
1337 Ga0265331_10053097
1338 Ga0265331_10125738
1339 Ga0307513_10100899
1340 Ga0307513_10142176
1341 Ga0307513_10695197
1342 Ga0307513_10725872
1343 Ga0307509_10328519
1344 Ga0307509_10416174
1345 Ga0307408_100996469
1346 Ga0307508_10011459
1347 Ga0307508_10151197
1348 Ga0307508_10386252
1349 Ga0307508_10589762
1350 Ga0265314_10047945
1351 Ga0265342_10006887
1352 Ga0307516_10187640
1353 Ga0307413_10487408
1354 Ga0307407_10232986
1355 Ga0307412_10457155
1356 Ga0307414_10914113
1357 Ga0307411_10021434
1358 Ga0307411_11015490
1359 Ga0307415_100353365
1360 Ga0307510_10002750
1361 Ga0307510_10036687
1362 Ga0307510_10179818
1363 Ga0307510_10276523
1364 Ga0307510_10322235
1365 Ga0307510_10437472
1366 Ga0315911_1000001
1367 Ga0373926_0123435
1368 Ga0373928_0032698
1369 Ga0373929_0045609
1370 Ga0373934_0002075
1371 Ga0373934_0051444
1372 Ga0373934_0053526
1373 Ga0373951_0044565
1374 Ga0373923_0004381
1375 Ga0373923_0445357
1376 Ga0373932_0180908
1377 Ga0373932_0251113
1378 Ga0373936_0004513
1379 Ga0373936_0089382
1380 Ga0373936_0145615
1381 Ga0373953_0000167
1382 Ga0373954_0000035
1383 Ga0373954_0053833
1384 Ga0373956_0024009
1385 Ga0373957_0078352
1386 Ga0373960_0161258
1387 Ga0373943_0149988
1388 Ga0373943_0660472
1389 Ga0373946_0073976
1390 Ga0373946_0201352
1391 Ga0373955_0005583
1392 Ga0373955_0014576
1393 Ga0373955_0137335
1394 Ga0373942_0082732
1395 Ga0373961_0070820
1396 Ga0373961_0078649
1397 Ga0373924_0014763
1398 Ga0373924_0098077
1399 Ga0373924_0136343
1400 Ga0373931_0010956
1401 Ga0373931_0025212
1402 Ga0373931_0231060
1403 Ga0373931_0248664
1404 Ga0373931_0723862
1405 Ga0373935_0000758
1406 Ga0373935_1055749
1407 Ga0373927_0002965
1408 Ga0373933_0000037
1409 Ga0373947_0026555
1410 Ga0373937_0000118
1411 Ga0373937_0057240
1412 Ga0373937_1293772
1413 Ga0373925_0008176
1414 Ga0373925_0075159
1415 Ga0395905_0910239
1416 Ga0439465_0063256
1417 Ga0451797_1204241
1418 Ga0451795_0987322
1419 Ga0451802_0425428
1420 Ga0451807_2359835
1421 Ga0451807_2648159
1422 Ga0451833_1265906
1423 Ga0451853_0743401
1424 Ga0439431_0038409
1425 Ga0439458_0057062
1426 Ga0439458_0120792
1427 Ga0466959_0103000
1428 Ga0495617_069187
1429 Ga0495627_059722
1430 Ga0495592_0002185
1431 Ga0495603_0000027
1432 Ga0495603_0067970
1433 Ga0495603_0194657
1434 Ga0495603_0348182
1435 Ga0495603_0557647
1436 Ga0495590_0081146
1437 Ga0495591_067348
1438 Ga0495629_0000290
1439 Ga0495629_0050941
1440 Ga0495629_0602384
1441 Ga0495638_0305499
1442 Ga0495638_0373676
1443 Ga0495638_0450372
1444 Ga0495641_0005129
1445 Ga0495651_0000412
1446 Ga0495651_0166998
1447 Ga0495651_0210996
1448 Ga0495651_0216888
1449 Ga0495653_0000161
1450 Ga0495650_0125540
1451 Ga0495650_0169990
1452 Ga0495580_0003356
1453 Ga0495580_0306484
1454 Ga0495582_0000157
1455 Ga0495605_0195845
1456 Ga0495639_0000048
1457 Ga0495639_0606149
1458 Ga0495662_0000814
1459 Ga0495664_0032625
1460 Ga0495664_0114065
1461 Ga0495664_0173731
1462 Ga0495664_0181282
1463 Ga0495584_0191921
1464 Ga0495584_0217869
1465 Ga0495585_0139867
1466 Ga0495594_0001217
1467 Ga0495596_0222467
1468 Ga0495607_0195017
1469 Ga0495583_0121046
1470 Ga0495583_0129998
1471 Ga0495583_0229880
1472 Ga0495608_0000337
1473 Ga0495608_0328794
1474 Ga0495610_0180727
1475 Ga0495610_0280143
1476 Ga0495616_0105154
1477 Ga0495616_0413764
1478 Ga0495618_0443494
1479 Ga0495620_0159916
1480 Ga0495628_0036389
1481 Ga0495628_0293628
1482 Ga0495630_0000846
1483 Ga0495631_0101559
1484 Ga0495632_0059700
1485 Ga0495632_0177841
1486 Ga0495632_0189799
1487 Ga0495632_0206832
1488 Ga0495632_0374128
1489 Ga0495637_0171649
1490 Ga0495643_0379002
1491 Ga0495643_0414032
1492 Ga0495643_0464663
1493 Ga0495644_0090089
1494 Ga0495644_0158754
1495 Ga0495648_0003360
1496 Ga0495648_0324484
1497 Ga0495648_0346372
1498 Ga0495663_0012324
1499 Ga0495666_0170382
1500 Ga0495666_0214820
1501 Ga0495642_0286078
1502 Ga0495652_0012092
1503 Ga0495652_0115522
1504 Ga0495652_0240059
1505 Ga0495654_0180546
1506 Ga0495654_0287348
1507 Ga0495665_0002259
1508 Ga0495665_0283055
1509 Ga0495640_0004105
1510 Ga0495640_0004805
1511 Ga0495587_0000668
1512 Ga0495587_0191793
1513 Ga0495598_0043288
1514 Ga0495609_0095484
1515 Ga0495609_0168032
1516 Ga0495609_0276146
1517 Ga0495621_0045106
1518 Ga0495645_0050107
1519 Ga0495645_0385493
1520 Ga0495622_0014669
1521 Ga0495622_0339614
1522 Ga0495622_0466854
1523 Ga0495633_0181053
1524 Ga0495667_0000147
1525 Ga0495667_0198544
1526 Ga0495656_0277376
1527 Ga0495668_0289132
1528 Ga0495668_0408206
1529 Ga0495668_0657359
1530 Ga0495634_0001002
1531 Ga0495611_0222265
1532 Ga0495625_0245969
1533 Ga0495625_0310071
1534 Ga0495625_0741135
1535 Ga0495635_0000094
1536 Ga0495635_0001877
1537 Ga0495635_0503554
1538 Ga0495659_0040840
1539 Ga0495659_0278960
1540 Ga0495661_0159652
1541 Ga0495588_0004956
1542 Ga0495588_0156603
1543 Ga0495657_0001420
1544 Ga0495657_0263082
1545 Ga0495657_0531189
1546 Ga0495599_0000253
1547 Ga0495599_0344043
1548 Ga0495623_0000768
1549 Ga0495623_0055642
1550 Ga0495623_0243496
1551 Ga0495646_0002668
1552 Ga0495646_0010961
1553 Ga0495647_0001301
1554 Ga0495658_0048666
1555 Ga0495669_0023405
1556 Ga0495669_0132973
1557 Ga0495669_0267054
1558 Ga0495613_0006428
1559 Ga0495613_0386358
1560 Ga0495624_0000380
1561 Ga0495624_0151058
1562 Ga0495670_0226385
1563 Ga0495670_0358224
1564 Ga0495671_0162984
1565 Ga0495671_0214610
1566 Ga0495671_0283809
1567 Ga0495589_0071888
1568 Ga0495589_0329986
1569 Ga0495589_0330592
1570 Ga0495589_0445084
1571 Ga0495600_0002207
1572 Ga0495600_0403777
1573 Ga0495581_0000233
1574 Ga0495581_0368778
1575 Ga0495604_0000253
1576 Ga0495636_0304620
1577 Ga0495674_0002874
1578 Ga0495674_0102638
1579 Ga0495672_0040313
1580 Ga0495676_0260320
1581 Ga0495680_0000406
1582 Ga0495680_0068965
1583 Ga0495683_0123902
1584 Ga0495683_0154962
1585 Ga0495675_0000285
1586 Ga0495675_0113399
1587 Ga0495677_0032962
1588 Ga0495679_099623
1589 Ga0495679_150982
1590 Ga0495685_076758
1591 Ga0495685_193752
1592 Ga0495673_0115015
1593 Ga0495673_0237132
1594 Ga0495673_0283976
1595 Ga0495673_0371252
1596 Ga0495681_0149432
1597 Ga0495684_0000184
1598 Ga0495684_0030110
1599 Ga0495593_0000160
1600 Ga0495593_0226917
1601 Ga0495602_0001148
1602 Ga0495602_0132250
1603 Ga0495602_0139333
1604 Ga0495602_0665355
1605 Ga0495614_0011061
1606 Ga0495615_0104819
1607 Ga0496100_0037478
1608 Ga0496100_0534082
1609 Ga0496100_0719989
1610 Ga0496101_0014849
1611 Ga0496101_0323311
1612 Ga0496101_0338550
1613 Ga0496101_0344316
1614 Ga0496101_0765112
1615 Ga0496101_1209103
1616 Ga0496102_0362108
1617 Ga0496102_0412418
1618 Ga0496102_0684594
1619 Ga0496103_0038610
1620 Ga0496103_0361787
1621 Ga0496103_0736745
1622 Ga0496103_0931976
1623 Ga0496104_0004525
1624 Ga0496104_0005723
1625 Ga0496104_0093215
1626 Ga0496104_0211028
1627 Ga0496104_0221254
1628 Ga0496104_0708016
1629 Ga0496104_0811163
1630 Ga0496104_0824428
1631 Ga0496105_0022833
1632 Ga0496105_0051568
1633 Ga0496105_0961602
1634 Ga0496106_0020373
1635 Ga0496106_0393711
1636 Ga0496107_0009868
1637 Ga0496107_0010008
1638 Ga0496107_0128306
1639 Ga0496107_0246760
1640 Ga0496107_0251021
1641 Ga0496107_1089774
1642 Ga0496108_0012626
1643 Ga0496108_0014497
1644 Ga0496108_0107718
1645 Ga0496108_0135669
1646 Ga0496108_0589937
1647 Ga0496108_0801613
1648 Ga0496108_1665184
1649 Ga0496109_0001625
1650 Ga0496109_0014487
1651 Ga0496109_0135206
1652 Ga0496109_0471419
1653 Ga0496110_0003188
1654 Ga0496110_0011002
1655 Ga0496110_0016721
1656 Ga0496110_0038042
1657 Ga0496110_0120912
1658 Ga0496110_0227730
1659 Ga0496110_1928005
1660 Ga0496111_0144305
1661 Ga0496111_0225412
1662 Ga0496111_0397643
1663 Ga0496111_0491724
1664 Ga0496112_0001486
1665 Ga0496112_0012497
1666 Ga0496112_0029342
1667 Ga0496112_0071601
1668 Ga0496112_0169400
1669 Ga0496112_0420633
1670 Ga0496112_1289849
1671 Ga0496113_0140188
1672 Ga0496113_0200674
1673 Ga0496113_0321581
1674 Ga0496114_0020268
1675 Ga0496114_0396818
1676 Ga0496114_0533855
1677 Ga0496114_0704165
1678 Ga0496115_0000957
1679 Ga0496115_0017252
1680 Ga0496115_0026693
1681 Ga0496115_0067536
1682 Ga0496115_0152734
1683 Ga0496115_0213225
1684 Ga0496115_0287498
1685 Ga0496115_0435924
1686 Ga0496115_0558334
1687 Ga0496115_1068453
1688 Ga0496117_0452804
1689 Ga0496118_0316948
1690 Ga0496119_0094919
1691 Ga0496120_0399211
1692 Ga0496121_0183693
1693 Ga0496121_0258887
1694 Ga0496121_0382177
1695 Ga0496121_0656276
1696 Ga0496124_0358509
1697 Ga0496124_0799804
1698 Ga0496125_0095613
1699 Ga0496125_0750610
1700 Ga0496126_0012947
1701 Ga0496126_0027023
1702 Ga0496126_0096463
1703 Ga0496126_0156382
1704 Ga0496126_0160059
1705 Ga0496126_0238314
1706 Ga0496126_0253820
1707 Ga0496126_0691027
1708 Ga0496126_1006238
1709 Ga0496126_1021187
1710 Ga0495678_086534
1711 Ga0495682_0112232
1712 Ga0495682_0165893
1713 Ga0501036_1166602
1714 Ga0501037_0122526
1715 Ga0501039_0532769
1716 Ga0501040_0259289
1717 Ga0501041_0164239
1718 Ga0501067_0497976
1719 Ga0501069_0362305
1720 Ga0501070_0690684
1721 Ga0501071_0447329
1722 Ga0501072_0553898
1723 Ga0501076_0622138
1724 Ga0501081_0496183
1725 nmdc:mga03683_123863_c1
1726 nmdc:mga03683_236608_c1
1727 nmdc:mga03683_297205_c1
1728 nmdc:mga03683_33917_c1
1729 nmdc:mga03683_46904_c1
1730 nmdc:mga03n38_259940_c1
1731 nmdc:mga03n38_4297_c1
1732 nmdc:mga00v17_225126_c1
1733 nmdc:mga00v17_276426_c1
1734 nmdc:mga00v17_371347_c1
1735 nmdc:mga00v17_497202_c1
1736 nmdc:mga0yw44_159032_c1
1737 nmdc:mga0k408_257415_c1
1738 nmdc:mga0k408_350090_c1
1739 nmdc:mga06z11_232409_c1
1740 nmdc:mga06z11_289417_c1
1741 nmdc:mga06z11_4502_c1
1742 nmdc:mga04h51_157441_c1
1743 nmdc:mga04h51_273244_c1
1744 nmdc:mga04h51_70415_c1
1745 nmdc:mga07m45_39194_c1
1746 nmdc:mga07m45_40246_c1
1747 nmdc:mga05p37_332591_c1
1748 nmdc:mga08y16_700503_c1
1749 nmdc:mga0n895_569228_c1
1750 nmdc:mga0rr50_162110_c1
1751 nmdc:mga0sz30_14151_c1
1752 nmdc:mga0sz30_272597_c1
1753 Ga0495601_0214456
1754 Ga0495601_0330755
1755 Ga0495601_0829178
1756 Ga0495601_0839541
1757 Ga0495612_0091003
1758 Ga0495612_0118384
1759 Ga0500635_0222076
1760 Ga0495655_0122051
1761 Ga0495595_0002312
1762 Ga0495595_0274241
1763 Ga0495619_0000209
1764 Ga0495619_0497802
1765 Ga0500578_0340591
1766 Ga0500583_0057799
1767 Ga0500583_0494185
1768 Ga0500651_0375615
1769 Ga0500566_0144995
1770 Ga0500641_0062919
1771 Ga0500554_013386
1772 Ga0500555_014921
1773 Ga0500569_093499
1774 Ga0500595_002765
1775 Ga0500595_058997
1776 Ga0500607_304551
1777 Ga0500608_181198
1778 Ga0500617_201580
1779 Ga0500655_066561
1780 Ga0500658_0384979
1781 Ga0500568_0085400
1782 Ga0500577_0322953
1783 Ga0500589_090739
1784 Ga0500603_063380
1785 Ga0500603_101442
1786 Ga0500604_0107189
1787 Ga0500604_0217347
1788 Ga0500627_0199014
1789 Ga0500634_0100956
1790 Ga0500638_080847
1791 Ga0500637_0024183
1792 Ga0500637_0255955
1793 Ga0500611_104865
1794 Ga0500645_011669
1795 Ga0500609_019939
1796 Ga0500656_038759
1797 Ga0500661_022339
1798 8056674502
1799 2513656702
1800 2513672258
1801 2513858507
1802 2513917887
1803 2517893067
1804 2524536815
1805 2671117690
1806 2793077272
1807 2824603292
1808 2824614059
1809 2824656607
1810 2874609627
1811 2876809506
1812 2879118512
1813 2885383820
1814 2888423712
1815 2889040570
1816 2903772717
1817 2904696249
1818 2904702578
1819 2906640691
1820 2906661423
1821 2908760965
1822 2922367698
1823 2922392406
1824 2932796503
1825 2932803501
1826 2935633697
1827 2935886571
1828 2941510588
1829 2941517673
1830 2941525690
1831 8006941534
1832 8006967397
1833 8006981243
1834 8006988147
1835 8006997711
1836 8056690163

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gtv-assembly1.cif.gz_A engineered rabggtase in complex with bms analogue 13 0.5253 70 139
3c72-assembly1.cif.gz_A engineered rabggtase in complex with a peptidomimetic inhibitor 0.4815 61 139
3ax5-assembly1.cif.gz_A crystal structure of rat tom20-aldh presequence complex: a complex (form1) between tom20 and a disulfide-bridged presequence peptide containing d-cys and l-cys at the i and i+3 positions. 0.4738 64 136
3ax5-assembly1.cif.gz_A crystal structure of rat tom20-aldh presequence complex: a complex (form1) between tom20 and a disulfide-bridged presequence peptide containing d-cys and l-cys at the i and i+3 positions. 0.4653 64 136
6nu2-assembly1.cif.gz_AL structural insights into unique features of the human mitochondrial ribosome recycling 0.4275 59 145
ID Description Score Start End Superfamily
2v1sE00 Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain 0.5294 64 135 1.20.960.10
2v1sE00 Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain 0.5042 64 135 1.20.960.10
af_Q4CSV2_11_448_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4946 66 139 1.25.10.10
af_Q4DD09_427_681_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.491 103 152 1.25.10.10
3ax5A00 Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain 0.4738 64 136 1.20.960.10
ID Description Score Start End GO Terms
AF-A0A0R3LV94-F1-model_v4 Uncharacterized protein 0.7764 19 152
AF-A0A0R3LV94-F1-model_v4 Uncharacterized protein 0.7086 19 152
AF-A0A1N6K8H2-F1-model_v4 deleted 0.6924 1 152
AF-A0A1N6K8H2-F1-model_v4 deleted 0.6879 1 152
AF-A0A5N3SDB2-F1-model_v4 DUF4760 domain-containing protein 0.6037 6 137 GO:0016020

Map