F485683
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 918 | 451 | 1836 | 161 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8056673599|8056674502 |
| Length | 157 |
| Sequence | SFWWQRYGTLAQMAQAAVALLGFVAILFQINEIRTGNRASSARQAFLGYTDLAFKNPKFAQPDYEKIKAGGDEHVQYESFVTYFLYACEEAISAFAGKREWQASCDYDLKPHLPFLCEKNAAQPAYLATYGADTQRWITASLKTASVTPPDCKLGKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 226 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 233 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 347 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 382 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 386 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 387 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 388 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 390 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 391 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 393 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 395 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 397 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 398 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 401 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 402 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 403 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 406 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 407 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 408 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 409 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 411 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 412 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 413 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 414 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 415 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 416 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 417 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 418 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 419 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 420 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 421 | 2791355199 | |||
| 422 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 423 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 424 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 425 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 426 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 427 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 428 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 429 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 430 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 431 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 432 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 433 | 2904699407 | |||
| 434 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 435 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 436 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 437 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 438 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 439 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 440 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 441 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 442 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 443 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 444 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 445 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 446 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 447 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 448 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 449 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 450 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 451 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.96 |
| Metatranscriptomes | 0 |
| Isolates | 4.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.24 |
| Nodule | 2.72 |
| Rhizoplane | 9.48 |
| Rhizosphere | 71.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10058784 | 3300001991 | Bacteria | 790 |
| 2 | JGI24743J22301_10059612 | 3300001991 | Bacteria | 785 |
| 3 | JGI24738J21930_10064694 | 3300002075 | Bacteria | 753 |
| 4 | JGI24034J26672_10032748 | 3300002239 | Bacteria | 852 |
| 5 | JGI25153J46596_10001663 | 3300003215 | Bacteria | 13186 |
| 6 | JGI25404J52841_10006374 | 3300003659 | Bacteria | 2466 |
| 7 | JGI25404J52841_10017892 | 3300003659 | Bacteria | 1536 |
| 8 | JGI25404J52841_10037060 | 3300003659 | Bacteria | 1037 |
| 9 | Ga0070658_10579805 | 3300005327 | Bacteria | 971 |
| 10 | Ga0070676_10221988 | 3300005328 | Bacteria | 1248 |
| 11 | Ga0070676_10371858 | 3300005328 | Bacteria | 987 |
| 12 | Ga0070670_100507789 | 3300005331 | Bacteria | 1073 |
| 13 | Ga0070677_10091220 | 3300005333 | Bacteria | 1325 |
| 14 | Ga0068869_100190485 | 3300005334 | Bacteria | 1612 |
| 15 | Ga0068869_100556035 | 3300005334 | Bacteria | 964 |
| 16 | Ga0068869_100702389 | 3300005334 | Bacteria | 862 |
| 17 | Ga0070666_10610229 | 3300005335 | Bacteria | 796 |
| 18 | Ga0070680_100095813 | 3300005336 | Bacteria | 2461 |
| 19 | Ga0070680_100319131 | 3300005336 | Bacteria | 1319 |
| 20 | Ga0070680_101495579 | 3300005336 | Bacteria | 585 |
| 21 | Ga0070682_100155569 | 3300005337 | Bacteria | 1573 |
| 22 | Ga0070682_100286193 | 3300005337 | Bacteria | 1203 |
| 23 | Ga0068868_100053906 | 3300005338 | Bacteria | 3168 |
| 24 | Ga0068868_100073736 | 3300005338 | Bacteria | 2725 |
| 25 | Ga0070660_100202391 | 3300005339 | Bacteria | 1611 |
| 26 | Ga0070660_100371648 | 3300005339 | Bacteria | 1179 |
| 27 | Ga0070660_100392485 | 3300005339 | Bacteria | 1147 |
| 28 | Ga0070689_101350541 | 3300005340 | Bacteria | 643 |
| 29 | Ga0070661_100212778 | 3300005344 | Bacteria | 1480 |
| 30 | Ga0070661_100734471 | 3300005344 | Bacteria | 806 |
| 31 | Ga0070661_100835237 | 3300005344 | Bacteria | 757 |
| 32 | Ga0070661_100889566 | 3300005344 | Bacteria | 735 |
| 33 | Ga0070692_10344675 | 3300005345 | Bacteria | 924 |
| 34 | Ga0070668_100594326 | 3300005347 | Bacteria | 967 |
| 35 | Ga0070668_100614123 | 3300005347 | Bacteria | 952 |
| 36 | Ga0070668_100622008 | 3300005347 | Bacteria | 946 |
| 37 | Ga0070668_100630239 | 3300005347 | Bacteria | 940 |
| 38 | Ga0070669_101112340 | 3300005353 | Bacteria | 681 |
| 39 | Ga0070669_101188750 | 3300005353 | Bacteria | 658 |
| 40 | Ga0070671_100324833 | 3300005355 | Bacteria | 1311 |
| 41 | Ga0070671_100382191 | 3300005355 | Bacteria | 1203 |
| 42 | Ga0070671_100622465 | 3300005355 | Bacteria | 933 |
| 43 | Ga0070674_100249077 | 3300005356 | Bacteria | 1394 |
| 44 | Ga0070673_100699534 | 3300005364 | Bacteria | 931 |
| 45 | Ga0070673_100772856 | 3300005364 | Bacteria | 885 |
| 46 | Ga0070673_101168485 | 3300005364 | Bacteria | 720 |
| 47 | Ga0070688_100251487 | 3300005365 | Bacteria | 1258 |
| 48 | Ga0070688_100415220 | 3300005365 | Bacteria | 999 |
| 49 | Ga0070688_100604806 | 3300005365 | Bacteria | 839 |
| 50 | Ga0070667_100314371 | 3300005367 | Bacteria | 1412 |
| 51 | Ga0070667_100555555 | 3300005367 | Bacteria | 1055 |
| 52 | Ga0070667_100560011 | 3300005367 | Bacteria | 1051 |
| 53 | Ga0070703_10152762 | 3300005406 | Bacteria | 868 |
| 54 | Ga0070713_100537791 | 3300005436 | Bacteria | 1106 |
| 55 | Ga0070710_10179464 | 3300005437 | Bacteria | 1324 |
| 56 | Ga0070710_10868680 | 3300005437 | Bacteria | 649 |
| 57 | Ga0070701_10575851 | 3300005438 | Bacteria | 742 |
| 58 | Ga0070711_100006622 | 3300005439 | Bacteria | 6999 |
| 59 | Ga0070700_100179719 | 3300005441 | Bacteria | 1471 |
| 60 | Ga0070694_100664380 | 3300005444 | Bacteria | 845 |
| 61 | Ga0070708_100753666 | 3300005445 | Bacteria | 916 |
| 62 | Ga0070708_101006235 | 3300005445 | Bacteria | 782 |
| 63 | Ga0070663_100013100 | 3300005455 | Bacteria | 5271 |
| 64 | Ga0070663_100188650 | 3300005455 | Bacteria | 1603 |
| 65 | Ga0070663_100277926 | 3300005455 | Bacteria | 1333 |
| 66 | Ga0070663_100362211 | 3300005455 | Bacteria | 1176 |
| 67 | Ga0070663_100483525 | 3300005455 | Bacteria | 1025 |
| 68 | Ga0070678_100128081 | 3300005456 | Bacteria | 2012 |
| 69 | Ga0070678_100142393 | 3300005456 | Bacteria | 1920 |
| 70 | Ga0070678_100240508 | 3300005456 | Bacteria | 1513 |
| 71 | Ga0070678_100753808 | 3300005456 | Bacteria | 881 |
| 72 | Ga0070678_101091591 | 3300005456 | Bacteria | 737 |
| 73 | Ga0070678_101379352 | 3300005456 | Bacteria | 657 |
| 74 | Ga0070662_100288205 | 3300005457 | Bacteria | 1330 |
| 75 | Ga0068867_100087390 | 3300005459 | Bacteria | 2360 |
| 76 | Ga0070685_10470555 | 3300005466 | Bacteria | 884 |
| 77 | Ga0070698_100284877 | 3300005471 | Bacteria | 1584 |
| 78 | Ga0070699_100303119 | 3300005518 | Bacteria | 1433 |
| 79 | Ga0070679_100017345 | 3300005530 | Bacteria | 6969 |
| 80 | Ga0070679_100429571 | 3300005530 | Bacteria | 1266 |
| 81 | Ga0070684_100794207 | 3300005535 | Bacteria | 885 |
| 82 | Ga0070697_100629856 | 3300005536 | Bacteria | 944 |
| 83 | Ga0068853_100110842 | 3300005539 | Bacteria | 2437 |
| 84 | Ga0068853_101684844 | 3300005539 | Bacteria | 615 |
| 85 | Ga0070672_100577794 | 3300005543 | Bacteria | 977 |
| 86 | Ga0070693_100333160 | 3300005547 | Bacteria | 1033 |
| 87 | Ga0070693_100462602 | 3300005547 | Bacteria | 893 |
| 88 | Ga0070665_100219326 | 3300005548 | Bacteria | 1902 |
| 89 | Ga0070665_100236234 | 3300005548 | Bacteria | 1828 |
| 90 | Ga0070665_100517771 | 3300005548 | Bacteria | 1204 |
| 91 | Ga0070704_100128107 | 3300005549 | Bacteria | 1962 |
| 92 | Ga0070704_100345952 | 3300005549 | Bacteria | 1253 |
| 93 | Ga0068855_100028801 | 3300005563 | Bacteria | 6645 |
| 94 | Ga0068855_100104411 | 3300005563 | Bacteria | 3259 |
| 95 | Ga0068855_100390797 | 3300005563 | Bacteria | 1526 |
| 96 | Ga0068855_100802989 | 3300005563 | Bacteria | 1000 |
| 97 | Ga0068855_101419513 | 3300005563 | Bacteria | 715 |
| 98 | Ga0070664_100325912 | 3300005564 | Bacteria | 1393 |
| 99 | Ga0070664_100742866 | 3300005564 | Bacteria | 916 |
| 100 | Ga0068857_100665451 | 3300005577 | Bacteria | 987 |
| 101 | Ga0068857_100790733 | 3300005577 | Bacteria | 906 |
| 102 | Ga0068854_100409708 | 3300005578 | Bacteria | 1124 |
| 103 | Ga0068856_100239551 | 3300005614 | Bacteria | 1829 |
| 104 | Ga0068856_100445512 | 3300005614 | Bacteria | 1315 |
| 105 | Ga0068856_100745147 | 3300005614 | Bacteria | 1000 |
| 106 | Ga0068856_101993429 | 3300005614 | Bacteria | 591 |
| 107 | Ga0070702_100935751 | 3300005615 | Bacteria | 681 |
| 108 | Ga0068852_100039877 | 3300005616 | Bacteria | 3957 |
| 109 | Ga0068852_100847470 | 3300005616 | Bacteria | 929 |
| 110 | Ga0068852_101602333 | 3300005616 | Bacteria | 673 |
| 111 | Ga0068859_100200655 | 3300005617 | Bacteria | 2079 |
| 112 | Ga0068859_100440961 | 3300005617 | Bacteria | 1398 |
| 113 | Ga0068859_100891373 | 3300005617 | Bacteria | 974 |
| 114 | Ga0068864_100015580 | 3300005618 | Bacteria | 6322 |
| 115 | Ga0068864_100623731 | 3300005618 | Bacteria | 1048 |
| 116 | Ga0068861_100135798 | 3300005719 | Bacteria | 2001 |
| 117 | Ga0068861_100717879 | 3300005719 | Bacteria | 930 |
| 118 | Ga0068861_100796681 | 3300005719 | Bacteria | 886 |
| 119 | Ga0068861_100959834 | 3300005719 | Bacteria | 813 |
| 120 | Ga0068851_10651675 | 3300005834 | Bacteria | 645 |
| 121 | Ga0068851_10924833 | 3300005834 | Bacteria | 547 |
| 122 | Ga0068863_101408481 | 3300005841 | Bacteria | 705 |
| 123 | Ga0068858_100378862 | 3300005842 | Bacteria | 1357 |
| 124 | Ga0068858_100958441 | 3300005842 | Bacteria | 838 |
| 125 | Ga0068860_100769118 | 3300005843 | Bacteria | 975 |
| 126 | Ga0068860_101278022 | 3300005843 | Bacteria | 755 |
| 127 | Ga0068860_101340831 | 3300005843 | Bacteria | 736 |
| 128 | Ga0068862_100511309 | 3300005844 | Bacteria | 1141 |
| 129 | Ga0068862_100743795 | 3300005844 | Bacteria | 953 |
| 130 | Ga0068862_101400352 | 3300005844 | Bacteria | 702 |
| 131 | Ga0081455_10046597 | 3300005937 | Bacteria | 3760 |
| 132 | Ga0081455_10059345 | 3300005937 | Bacteria | 3231 |
| 133 | Ga0081455_10085186 | 3300005937 | Bacteria | 2578 |
| 134 | Ga0081538_10041630 | 3300005981 | Bacteria | 2912 |
| 135 | Ga0081540_1008342 | 3300005983 | Bacteria | 7244 |
| 136 | Ga0081540_1015698 | 3300005983 | Bacteria | 4781 |
| 137 | Ga0081540_1017290 | 3300005983 | Bacteria | 4469 |
| 138 | Ga0081540_1187154 | 3300005983 | Bacteria | 767 |
| 139 | Ga0081539_10046039 | 3300005985 | Bacteria | 2503 |
| 140 | Ga0070717_10141347 | 3300006028 | Bacteria | 2076 |
| 141 | Ga0070717_10626894 | 3300006028 | Bacteria | 976 |
| 142 | Ga0075365_10009719 | 3300006038 | Bacteria | 5552 |
| 143 | Ga0075365_10135672 | 3300006038 | Bacteria | 1705 |
| 144 | Ga0075365_10202026 | 3300006038 | Bacteria | 1392 |
| 145 | Ga0075365_10394581 | 3300006038 | Bacteria | 976 |
| 146 | Ga0075368_10017552 | 3300006042 | Bacteria | 2680 |
| 147 | Ga0075368_10054708 | 3300006042 | Bacteria | 1591 |
| 148 | Ga0075368_10207655 | 3300006042 | Bacteria | 830 |
| 149 | Ga0075363_100010490 | 3300006048 | Bacteria | 4404 |
| 150 | Ga0075363_100112265 | 3300006048 | Bacteria | 1516 |
| 151 | Ga0075363_100167706 | 3300006048 | Bacteria | 1245 |
| 152 | Ga0075363_100269343 | 3300006048 | Bacteria | 983 |
| 153 | Ga0075363_100444211 | 3300006048 | Bacteria | 765 |
| 154 | Ga0075364_10054582 | 3300006051 | Bacteria | 2613 |
| 155 | Ga0075364_10385948 | 3300006051 | Bacteria | 955 |
| 156 | Ga0075364_10421841 | 3300006051 | Bacteria | 911 |
| 157 | Ga0075364_10644546 | 3300006051 | Bacteria | 723 |
| 158 | Ga0075432_10290314 | 3300006058 | Bacteria | 676 |
| 159 | Ga0070716_100780825 | 3300006173 | Bacteria | 738 |
| 160 | Ga0070712_100398056 | 3300006175 | Bacteria | 1137 |
| 161 | Ga0075362_10063771 | 3300006177 | Bacteria | 1671 |
| 162 | Ga0075362_10066601 | 3300006177 | Bacteria | 1637 |
| 163 | Ga0075362_10217339 | 3300006177 | Bacteria | 933 |
| 164 | Ga0075362_10362849 | 3300006177 | Bacteria | 726 |
| 165 | Ga0075367_10041004 | 3300006178 | Bacteria | 2705 |
| 166 | Ga0075367_10045732 | 3300006178 | Bacteria | 2569 |
| 167 | Ga0075367_10116690 | 3300006178 | Bacteria | 1642 |
| 168 | Ga0075367_10291655 | 3300006178 | Bacteria | 1026 |
| 169 | Ga0075369_10058163 | 3300006186 | Bacteria | 1683 |
| 170 | Ga0075369_10268021 | 3300006186 | Bacteria | 794 |
| 171 | Ga0075369_10381246 | 3300006186 | Bacteria | 663 |
| 172 | Ga0075366_10096611 | 3300006195 | Bacteria | 1771 |
| 173 | Ga0075366_10239347 | 3300006195 | Bacteria | 1106 |
| 174 | Ga0075366_10538786 | 3300006195 | Bacteria | 722 |
| 175 | Ga0097621_100317329 | 3300006237 | Bacteria | 1379 |
| 176 | Ga0097621_100425398 | 3300006237 | Bacteria | 1193 |
| 177 | Ga0097621_100828473 | 3300006237 | Bacteria | 859 |
| 178 | Ga0097621_101049116 | 3300006237 | Bacteria | 764 |
| 179 | Ga0075370_10019945 | 3300006353 | Bacteria | 3655 |
| 180 | Ga0075370_10045847 | 3300006353 | Bacteria | 2473 |
| 181 | Ga0068871_100519984 | 3300006358 | Bacteria | 1075 |
| 182 | Ga0068871_100616653 | 3300006358 | Bacteria | 988 |
| 183 | Ga0068871_101474303 | 3300006358 | Bacteria | 642 |
| 184 | Ga0068871_101477788 | 3300006358 | Bacteria | 642 |
| 185 | Ga0075434_100340551 | 3300006871 | Bacteria | 1520 |
| 186 | Ga0068865_100135871 | 3300006881 | Bacteria | 1848 |
| 187 | Ga0097620_100200657 | 3300006931 | Bacteria | 2079 |
| 188 | Ga0097620_100440943 | 3300006931 | Bacteria | 1398 |
| 189 | Ga0097620_100891328 | 3300006931 | Bacteria | 974 |
| 190 | Ga0099794_10188751 | 3300007265 | Bacteria | 1054 |
| 191 | Ga0099795_10206119 | 3300007788 | Bacteria | 831 |
| 192 | Ga0099795_10271338 | 3300007788 | Bacteria | 738 |
| 193 | Ga0099795_10363544 | 3300007788 | Bacteria | 650 |
| 194 | Ga0105240_10711281 | 3300009093 | Bacteria | 1095 |
| 195 | Ga0111539_10397101 | 3300009094 | Bacteria | 1606 |
| 196 | Ga0105245_10128755 | 3300009098 | Bacteria | 2372 |
| 197 | Ga0105245_10254418 | 3300009098 | Bacteria | 1707 |
| 198 | Ga0105245_10933260 | 3300009098 | Bacteria | 910 |
| 199 | Ga0105245_11285705 | 3300009098 | Bacteria | 780 |
| 200 | Ga0105247_10427331 | 3300009101 | Bacteria | 950 |
| 201 | Ga0105247_10967371 | 3300009101 | Bacteria | 662 |
| 202 | Ga0105247_11088053 | 3300009101 | Bacteria | 630 |
| 203 | Ga0105247_11113133 | 3300009101 | Bacteria | 624 |
| 204 | Ga0114129_10661569 | 3300009147 | Bacteria | 1347 |
| 205 | Ga0114129_10769222 | 3300009147 | Bacteria | 1231 |
| 206 | Ga0105243_10188344 | 3300009148 | Bacteria | 1800 |
| 207 | Ga0105243_10647013 | 3300009148 | Bacteria | 1024 |
| 208 | Ga0105243_10685693 | 3300009148 | Bacteria | 997 |
| 209 | Ga0105243_11026912 | 3300009148 | Bacteria | 829 |
| 210 | Ga0105241_10361206 | 3300009174 | Bacteria | 1264 |
| 211 | Ga0105242_10327509 | 3300009176 | Bacteria | 1407 |
| 212 | Ga0105242_10365430 | 3300009176 | Bacteria | 1337 |
| 213 | Ga0105242_10368949 | 3300009176 | Bacteria | 1331 |
| 214 | Ga0105242_12011974 | 3300009176 | Bacteria | 620 |
| 215 | Ga0105248_10192219 | 3300009177 | Bacteria | 2300 |
| 216 | Ga0105248_10601570 | 3300009177 | Bacteria | 1241 |
| 217 | Ga0105248_10727801 | 3300009177 | Bacteria | 1119 |
| 218 | Ga0105248_10821394 | 3300009177 | Bacteria | 1049 |
| 219 | Ga0105248_10904908 | 3300009177 | Bacteria | 996 |
| 220 | Ga0105237_10805020 | 3300009545 | Bacteria | 946 |
| 221 | Ga0105237_10969375 | 3300009545 | Bacteria | 857 |
| 222 | Ga0105237_11304856 | 3300009545 | Bacteria | 732 |
| 223 | Ga0105238_10375587 | 3300009551 | Bacteria | 1412 |
| 224 | Ga0105238_10676241 | 3300009551 | Bacteria | 1043 |
| 225 | Ga0105238_10728562 | 3300009551 | Bacteria | 1005 |
| 226 | Ga0105238_11535889 | 3300009551 | Bacteria | 695 |
| 227 | Ga0105249_10220912 | 3300009553 | Bacteria | 1864 |
| 228 | Ga0105249_10386862 | 3300009553 | Bacteria | 1426 |
| 229 | Ga0105249_10986979 | 3300009553 | Bacteria | 911 |
| 230 | Ga0105249_11604151 | 3300009553 | Bacteria | 723 |
| 231 | Ga0105249_11941385 | 3300009553 | Bacteria | 661 |
| 232 | Ga0099796_10030556 | 3300010159 | Bacteria | 1749 |
| 233 | Ga0099796_10081890 | 3300010159 | Bacteria | 1185 |
| 234 | Ga0099796_10143760 | 3300010159 | Bacteria | 934 |
| 235 | Ga0099796_10433111 | 3300010159 | Bacteria | 582 |
| 236 | Ga0105239_10250831 | 3300010375 | Bacteria | 1988 |
| 237 | Ga0105239_10730892 | 3300010375 | Bacteria | 1133 |
| 238 | Ga0105239_10741330 | 3300010375 | Bacteria | 1124 |
| 239 | Ga0105239_11300611 | 3300010375 | Bacteria | 839 |
| 240 | Ga0105239_11524491 | 3300010375 | Bacteria | 772 |
| 241 | Ga0105239_11772335 | 3300010375 | Bacteria | 715 |
| 242 | Ga0105246_10431986 | 3300011119 | Bacteria | 1102 |
| 243 | Ga0105246_10566570 | 3300011119 | Bacteria | 976 |
| 244 | Ga0105246_10591664 | 3300011119 | Bacteria | 957 |
| 245 | Ga0105246_10616279 | 3300011119 | Bacteria | 940 |
| 246 | Ga0105246_11060203 | 3300011119 | Bacteria | 738 |
| 247 | Ga0105246_11071439 | 3300011119 | Bacteria | 734 |
| 248 | Ga0157313_1034310 | 3300012503 | Bacteria | 593 |
| 249 | Ga0157370_10084579 | 3300013104 | Bacteria | 2982 |
| 250 | Ga0157369_10706453 | 3300013105 | Bacteria | 1038 |
| 251 | Ga0157374_10111572 | 3300013296 | Bacteria | 2631 |
| 252 | Ga0157374_10427529 | 3300013296 | Bacteria | 1324 |
| 253 | Ga0157378_10835723 | 3300013297 | Bacteria | 948 |
| 254 | Ga0157378_10945283 | 3300013297 | Bacteria | 894 |
| 255 | Ga0157378_11055394 | 3300013297 | Bacteria | 848 |
| 256 | Ga0163162_10317431 | 3300013306 | Bacteria | 1691 |
| 257 | Ga0163162_10458914 | 3300013306 | Bacteria | 1406 |
| 258 | Ga0163162_10545137 | 3300013306 | Bacteria | 1288 |
| 259 | Ga0163162_10869676 | 3300013306 | Bacteria | 1016 |
| 260 | Ga0163162_10899421 | 3300013306 | Bacteria | 998 |
| 261 | Ga0163162_11687831 | 3300013306 | Bacteria | 723 |
| 262 | Ga0163162_12213928 | 3300013306 | Bacteria | 631 |
| 263 | Ga0157375_10486244 | 3300013308 | Bacteria | 1399 |
| 264 | Ga0157375_10749445 | 3300013308 | Bacteria | 1128 |
| 265 | Ga0157375_11074346 | 3300013308 | Bacteria | 941 |
| 266 | Ga0163163_10023070 | 3300014325 | Bacteria | 5901 |
| 267 | Ga0163163_10275897 | 3300014325 | Bacteria | 1732 |
| 268 | Ga0163163_10314975 | 3300014325 | Bacteria | 1618 |
| 269 | Ga0163163_10465131 | 3300014325 | Bacteria | 1325 |
| 270 | Ga0157380_10162993 | 3300014326 | Bacteria | 1940 |
| 271 | Ga0157380_11542747 | 3300014326 | Bacteria | 718 |
| 272 | Ga0157380_11910570 | 3300014326 | Bacteria | 654 |
| 273 | Ga0157380_12367490 | 3300014326 | Bacteria | 596 |
| 274 | Ga0157377_10365429 | 3300014745 | Bacteria | 973 |
| 275 | Ga0157377_10410198 | 3300014745 | Bacteria | 925 |
| 276 | Ga0157379_10033139 | 3300014968 | Bacteria | 4607 |
| 277 | Ga0157379_10791970 | 3300014968 | Bacteria | 894 |
| 278 | Ga0157379_11216182 | 3300014968 | Bacteria | 725 |
| 279 | Ga0157376_10465240 | 3300014969 | Bacteria | 1236 |
| 280 | Ga0157376_10978925 | 3300014969 | Bacteria | 867 |
| 281 | Ga0157376_11049219 | 3300014969 | Bacteria | 839 |
| 282 | Ga0163161_10137602 | 3300017792 | Bacteria | 1847 |
| 283 | Ga0163161_10279002 | 3300017792 | Bacteria | 1310 |
| 284 | Ga0163161_10441933 | 3300017792 | Bacteria | 1050 |
| 285 | Ga0163161_10747129 | 3300017792 | Bacteria | 818 |
| 286 | Ga0209758_1003248 | 3300025297 | Bacteria | 15075 |
| 287 | Ga0209758_1111111 | 3300025297 | Bacteria | 758 |
| 288 | Ga0207697_10179104 | 3300025315 | Bacteria | 929 |
| 289 | Ga0207656_10196513 | 3300025321 | Bacteria | 973 |
| 290 | Ga0207656_10271883 | 3300025321 | Bacteria | 834 |
| 291 | Ga0207696_1028849 | 3300025711 | Bacteria | 1699 |
| 292 | Ga0207653_10118253 | 3300025885 | Bacteria | 952 |
| 293 | Ga0207642_10422612 | 3300025899 | Bacteria | 802 |
| 294 | Ga0207642_10473994 | 3300025899 | Bacteria | 762 |
| 295 | Ga0207710_10163879 | 3300025900 | Bacteria | 1084 |
| 296 | Ga0207710_10380814 | 3300025900 | Bacteria | 722 |
| 297 | Ga0207688_10222671 | 3300025901 | Bacteria | 1137 |
| 298 | Ga0207688_10578812 | 3300025901 | Bacteria | 707 |
| 299 | Ga0207680_10358637 | 3300025903 | Bacteria | 1025 |
| 300 | Ga0207680_10656209 | 3300025903 | Bacteria | 751 |
| 301 | Ga0207647_10380973 | 3300025904 | Bacteria | 796 |
| 302 | Ga0207645_10057724 | 3300025907 | Bacteria | 2478 |
| 303 | Ga0207645_10103605 | 3300025907 | Bacteria | 1838 |
| 304 | Ga0207645_10680578 | 3300025907 | Bacteria | 699 |
| 305 | Ga0207705_10461045 | 3300025909 | Bacteria | 986 |
| 306 | Ga0207684_10290950 | 3300025910 | Bacteria | 1408 |
| 307 | Ga0207654_10727023 | 3300025911 | Bacteria | 714 |
| 308 | Ga0207707_10330325 | 3300025912 | Bacteria | 1315 |
| 309 | Ga0207695_10465988 | 3300025913 | Bacteria | 1146 |
| 310 | Ga0207671_10973526 | 3300025914 | Bacteria | 669 |
| 311 | Ga0207693_10028464 | 3300025915 | Bacteria | 4415 |
| 312 | Ga0207693_10091760 | 3300025915 | Bacteria | 2381 |
| 313 | Ga0207693_10511800 | 3300025915 | Bacteria | 937 |
| 314 | Ga0207693_10588136 | 3300025915 | Bacteria | 867 |
| 315 | Ga0207663_10060954 | 3300025916 | Bacteria | 2393 |
| 316 | Ga0207660_10144030 | 3300025917 | Bacteria | 1824 |
| 317 | Ga0207660_10271656 | 3300025917 | Bacteria | 1343 |
| 318 | Ga0207662_10290628 | 3300025918 | Bacteria | 1084 |
| 319 | Ga0207657_10261181 | 3300025919 | Bacteria | 1378 |
| 320 | Ga0207657_10640755 | 3300025919 | Bacteria | 828 |
| 321 | Ga0207652_10015934 | 3300025921 | Bacteria | 6126 |
| 322 | Ga0207681_10142231 | 3300025923 | Bacteria | 1788 |
| 323 | Ga0207650_10264311 | 3300025925 | Bacteria | 1397 |
| 324 | Ga0207650_10600920 | 3300025925 | Bacteria | 925 |
| 325 | Ga0207659_11405721 | 3300025926 | Bacteria | 598 |
| 326 | Ga0207687_10047614 | 3300025927 | Bacteria | 2973 |
| 327 | Ga0207687_10550900 | 3300025927 | Bacteria | 968 |
| 328 | Ga0207687_11225756 | 3300025927 | Bacteria | 645 |
| 329 | Ga0207700_10295303 | 3300025928 | Bacteria | 1398 |
| 330 | Ga0207644_10637207 | 3300025931 | Bacteria | 886 |
| 331 | Ga0207690_10789197 | 3300025932 | Bacteria | 784 |
| 332 | Ga0207706_10078846 | 3300025933 | Bacteria | 2897 |
| 333 | Ga0207686_10403116 | 3300025934 | Bacteria | 1042 |
| 334 | Ga0207709_10081403 | 3300025935 | Bacteria | 2088 |
| 335 | Ga0207709_10335183 | 3300025935 | Bacteria | 1137 |
| 336 | Ga0207709_11181283 | 3300025935 | Bacteria | 630 |
| 337 | Ga0207669_10025168 | 3300025937 | Bacteria | 3211 |
| 338 | Ga0207669_10626209 | 3300025937 | Bacteria | 877 |
| 339 | Ga0207704_10505313 | 3300025938 | Bacteria | 975 |
| 340 | Ga0207704_10796004 | 3300025938 | Bacteria | 789 |
| 341 | Ga0207665_10154911 | 3300025939 | Bacteria | 1644 |
| 342 | Ga0207665_10264299 | 3300025939 | Bacteria | 1276 |
| 343 | Ga0207691_10210957 | 3300025940 | Bacteria | 1687 |
| 344 | Ga0207691_10490953 | 3300025940 | Bacteria | 1043 |
| 345 | Ga0207691_10963975 | 3300025940 | Bacteria | 712 |
| 346 | Ga0207691_11131052 | 3300025940 | Bacteria | 651 |
| 347 | Ga0207711_10097167 | 3300025941 | Bacteria | 2600 |
| 348 | Ga0207711_10437167 | 3300025941 | Bacteria | 1217 |
| 349 | Ga0207711_10896368 | 3300025941 | Bacteria | 825 |
| 350 | Ga0207689_10455407 | 3300025942 | Bacteria | 1070 |
| 351 | Ga0207689_10616136 | 3300025942 | Bacteria | 913 |
| 352 | Ga0207689_10746306 | 3300025942 | Bacteria | 826 |
| 353 | Ga0207679_10252431 | 3300025945 | Bacteria | 1500 |
| 354 | Ga0207667_10017031 | 3300025949 | Bacteria | 8198 |
| 355 | Ga0207667_10123208 | 3300025949 | Bacteria | 2671 |
| 356 | Ga0207667_10335217 | 3300025949 | Bacteria | 1544 |
| 357 | Ga0207667_10647137 | 3300025949 | Bacteria | 1063 |
| 358 | Ga0207651_10052362 | 3300025960 | Bacteria | 2783 |
| 359 | Ga0207651_10458215 | 3300025960 | Bacteria | 1095 |
| 360 | Ga0207651_10510770 | 3300025960 | Bacteria | 1040 |
| 361 | Ga0207651_11280246 | 3300025960 | Bacteria | 659 |
| 362 | Ga0207712_11253749 | 3300025961 | Bacteria | 662 |
| 363 | Ga0207668_10517827 | 3300025972 | Bacteria | 1028 |
| 364 | Ga0207668_10680376 | 3300025972 | Bacteria | 903 |
| 365 | Ga0207668_10868620 | 3300025972 | Bacteria | 801 |
| 366 | Ga0207658_10385062 | 3300025986 | Bacteria | 1229 |
| 367 | Ga0207658_10717079 | 3300025986 | Bacteria | 904 |
| 368 | Ga0207658_11217121 | 3300025986 | Bacteria | 688 |
| 369 | Ga0207677_10021030 | 3300026023 | Bacteria | 3978 |
| 370 | Ga0207677_10527654 | 3300026023 | Bacteria | 1025 |
| 371 | Ga0207703_10410696 | 3300026035 | Bacteria | 1258 |
| 372 | Ga0207703_10729551 | 3300026035 | Bacteria | 943 |
| 373 | Ga0207639_10264354 | 3300026041 | Bacteria | 1506 |
| 374 | Ga0207639_11183512 | 3300026041 | Bacteria | 717 |
| 375 | Ga0207678_10326082 | 3300026067 | Bacteria | 1321 |
| 376 | Ga0207678_10436271 | 3300026067 | Bacteria | 1137 |
| 377 | Ga0207678_11036763 | 3300026067 | Bacteria | 726 |
| 378 | Ga0207678_11464959 | 3300026067 | Bacteria | 603 |
| 379 | Ga0207708_10108248 | 3300026075 | Bacteria | 2156 |
| 380 | Ga0207708_10485706 | 3300026075 | Bacteria | 1033 |
| 381 | Ga0207708_11032369 | 3300026075 | Bacteria | 715 |
| 382 | Ga0207708_11356189 | 3300026075 | Bacteria | 624 |
| 383 | Ga0207702_10236595 | 3300026078 | Bacteria | 1709 |
| 384 | Ga0207702_10249945 | 3300026078 | Bacteria | 1665 |
| 385 | Ga0207702_10298771 | 3300026078 | Bacteria | 1528 |
| 386 | Ga0207641_10185072 | 3300026088 | Bacteria | 1910 |
| 387 | Ga0207641_10857673 | 3300026088 | Bacteria | 900 |
| 388 | Ga0207648_10039644 | 3300026089 | Bacteria | 4141 |
| 389 | Ga0207676_10231760 | 3300026095 | Bacteria | 1651 |
| 390 | Ga0207676_10299134 | 3300026095 | Bacteria | 1468 |
| 391 | Ga0207676_11917353 | 3300026095 | Bacteria | 591 |
| 392 | Ga0207676_11983794 | 3300026095 | Bacteria | 581 |
| 393 | Ga0207674_10225143 | 3300026116 | Bacteria | 1824 |
| 394 | Ga0207675_100105346 | 3300026118 | Bacteria | 2658 |
| 395 | Ga0207675_100692436 | 3300026118 | Bacteria | 1027 |
| 396 | Ga0207675_100696859 | 3300026118 | Bacteria | 1024 |
| 397 | Ga0207675_101105569 | 3300026118 | Bacteria | 812 |
| 398 | Ga0207683_10153602 | 3300026121 | Bacteria | 2078 |
| 399 | Ga0207683_10484505 | 3300026121 | Bacteria | 1142 |
| 400 | Ga0207683_10975859 | 3300026121 | Bacteria | 787 |
| 401 | Ga0207683_11185824 | 3300026121 | Bacteria | 708 |
| 402 | Ga0207683_11247552 | 3300026121 | Bacteria | 689 |
| 403 | Ga0207698_10084393 | 3300026142 | Bacteria | 2575 |
| 404 | Ga0207698_10332547 | 3300026142 | Bacteria | 1428 |
| 405 | Ga0209813_10014046 | 3300027866 | Bacteria | 2149 |
| 406 | Ga0207428_10308306 | 3300027907 | Bacteria | 1171 |
| 407 | Ga0268266_10003299 | 3300028379 | Bacteria | 16216 |
| 408 | Ga0268266_10078801 | 3300028379 | Bacteria | 2867 |
| 409 | Ga0268266_11338606 | 3300028379 | Bacteria | 691 |
| 410 | Ga0268265_10033437 | 3300028380 | Bacteria | 3738 |
| 411 | Ga0268265_11395205 | 3300028380 | Bacteria | 702 |
| 412 | Ga0268265_11885470 | 3300028380 | Bacteria | 604 |
| 413 | Ga0268264_10711360 | 3300028381 | Bacteria | 998 |
| 414 | Ga0307517_10000111 | 3300028786 | Bacteria | 120304 |
| 415 | Ga0307515_10066624 | 3300028794 | Bacteria | 4985 |
| 416 | Ga0307515_10449843 | 3300028794 | Bacteria | 904 |
| 417 | Ga0307515_10718653 | 3300028794 | Bacteria | 616 |
| 418 | Ga0265339_10009277 | 3300031249 | Bacteria | 6199 |
| 419 | Ga0265331_10053097 | 3300031250 | Bacteria | 1935 |
| 420 | Ga0265331_10125738 | 3300031250 | Bacteria | 1171 |
| 421 | Ga0307513_10100899 | 3300031456 | Bacteria | 2910 |
| 422 | Ga0307513_10142176 | 3300031456 | Bacteria | 2324 |
| 423 | Ga0307513_10695197 | 3300031456 | Bacteria | 723 |
| 424 | Ga0307513_10725872 | 3300031456 | Bacteria | 699 |
| 425 | Ga0307509_10328519 | 3300031507 | Bacteria | 1262 |
| 426 | Ga0307509_10416174 | 3300031507 | Bacteria | 1046 |
| 427 | Ga0307408_100996469 | 3300031548 | Bacteria | 772 |
| 428 | Ga0307508_10011459 | 3300031616 | Bacteria | 8102 |
| 429 | Ga0307508_10151197 | 3300031616 | Bacteria | 1926 |
| 430 | Ga0307508_10386252 | 3300031616 | Bacteria | 991 |
| 431 | Ga0307508_10589762 | 3300031616 | Bacteria | 712 |
| 432 | Ga0265314_10047945 | 3300031711 | Bacteria | 3002 |
| 433 | Ga0265342_10006887 | 3300031712 | Bacteria | 8400 |
| 434 | Ga0307516_10187640 | 3300031730 | Bacteria | 1796 |
| 435 | Ga0307413_10487408 | 3300031824 | Bacteria | 987 |
| 436 | Ga0307407_10232986 | 3300031903 | Bacteria | 1252 |
| 437 | Ga0307412_10457155 | 3300031911 | Bacteria | 1053 |
| 438 | Ga0307414_10914113 | 3300032004 | Bacteria | 805 |
| 439 | Ga0307411_10021434 | 3300032005 | Bacteria | 3782 |
| 440 | Ga0307411_11015490 | 3300032005 | Bacteria | 743 |
| 441 | Ga0307415_100353365 | 3300032126 | Bacteria | 1238 |
| 442 | Ga0307510_10002750 | 3300033180 | Bacteria | 20142 |
| 443 | Ga0307510_10036687 | 3300033180 | Bacteria | 5453 |
| 444 | Ga0307510_10179818 | 3300033180 | Bacteria | 1680 |
| 445 | Ga0307510_10276523 | 3300033180 | Bacteria | 1152 |
| 446 | Ga0307510_10322235 | 3300033180 | Bacteria | 1002 |
| 447 | Ga0307510_10437472 | 3300033180 | Bacteria | 749 |
| 448 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 449 | Ga0373926_0123435 | 3300035083 | Bacteria | 977 |
| 450 | Ga0373928_0032698 | 3300035084 | Bacteria | 1161 |
| 451 | Ga0373929_0045609 | 3300035085 | Bacteria | 988 |
| 452 | Ga0373934_0002075 | 3300035086 | Bacteria | 7353 |
| 453 | Ga0373934_0051444 | 3300035086 | Bacteria | 1633 |
| 454 | Ga0373934_0053526 | 3300035086 | Bacteria | 1601 |
| 455 | Ga0373951_0044565 | 3300035091 | Bacteria | 1078 |
| 456 | Ga0373923_0004381 | 3300035111 | Bacteria | 4678 |
| 457 | Ga0373923_0445357 | 3300035111 | Bacteria | 627 |
| 458 | Ga0373932_0180908 | 3300035112 | Bacteria | 740 |
| 459 | Ga0373932_0251113 | 3300035112 | Bacteria | 645 |
| 460 | Ga0373936_0004513 | 3300035113 | Bacteria | 5271 |
| 461 | Ga0373936_0089382 | 3300035113 | Bacteria | 1290 |
| 462 | Ga0373936_0145615 | 3300035113 | Bacteria | 1025 |
| 463 | Ga0373953_0000167 | 3300035117 | Bacteria | 17273 |
| 464 | Ga0373954_0000035 | 3300035118 | Bacteria | 51266 |
| 465 | Ga0373954_0053833 | 3300035118 | Bacteria | 1892 |
| 466 | Ga0373956_0024009 | 3300035119 | Bacteria | 2622 |
| 467 | Ga0373957_0078352 | 3300035120 | Bacteria | 1301 |
| 468 | Ga0373960_0161258 | 3300035121 | Bacteria | 772 |
| 469 | Ga0373943_0149988 | 3300035170 | Bacteria | 1262 |
| 470 | Ga0373943_0660472 | 3300035170 | Bacteria | 618 |
| 471 | Ga0373946_0073976 | 3300035171 | Bacteria | 1478 |
| 472 | Ga0373946_0201352 | 3300035171 | Bacteria | 954 |
| 473 | Ga0373955_0005583 | 3300035172 | Bacteria | 5657 |
| 474 | Ga0373955_0014576 | 3300035172 | Bacteria | 3827 |
| 475 | Ga0373955_0137335 | 3300035172 | Bacteria | 1431 |
| 476 | Ga0373942_0082732 | 3300035207 | Bacteria | 956 |
| 477 | Ga0373961_0070820 | 3300035241 | Bacteria | 1078 |
| 478 | Ga0373961_0078649 | 3300035241 | Bacteria | 1034 |
| 479 | Ga0373924_0014763 | 3300035410 | Bacteria | 2955 |
| 480 | Ga0373924_0098077 | 3300035410 | Bacteria | 1259 |
| 481 | Ga0373924_0136343 | 3300035410 | Bacteria | 1069 |
| 482 | Ga0373931_0010956 | 3300035691 | Bacteria | 4369 |
| 483 | Ga0373931_0025212 | 3300035691 | Bacteria | 3020 |
| 484 | Ga0373931_0231060 | 3300035691 | Bacteria | 1117 |
| 485 | Ga0373931_0248664 | 3300035691 | Bacteria | 1080 |
| 486 | Ga0373931_0723862 | 3300035691 | Bacteria | 659 |
| 487 | Ga0373935_0000758 | 3300035692 | Bacteria | 17187 |
| 488 | Ga0373935_1055749 | 3300035692 | Bacteria | 604 |
| 489 | Ga0373927_0002965 | 3300035695 | Bacteria | 12316 |
| 490 | Ga0373933_0000037 | 3300035724 | Bacteria | 81092 |
| 491 | Ga0373947_0026555 | 3300035725 | Bacteria | 3386 |
| 492 | Ga0373937_0000118 | 3300036401 | Bacteria | 75902 |
| 493 | Ga0373937_0057240 | 3300036401 | Bacteria | 3581 |
| 494 | Ga0373937_1293772 | 3300036401 | Bacteria | 677 |
| 495 | Ga0373925_0008176 | 3300037068 | Bacteria | 7618 |
| 496 | Ga0373925_0075159 | 3300037068 | Bacteria | 2560 |
| 497 | Ga0395905_0910239 | 3300037471 | Bacteria | 782 |
| 498 | Ga0439465_0063256 | 3300041413 | Bacteria | 1229 |
| 499 | Ga0451797_1204241 | 3300041453 | Bacteria | 533 |
| 500 | Ga0451795_0987322 | 3300041456 | Bacteria | 672 |
| 501 | Ga0451802_0425428 | 3300041460 | Bacteria | 949 |
| 502 | Ga0451807_2359835 | 3300041486 | Bacteria | 841 |
| 503 | Ga0451807_2648159 | 3300041486 | Bacteria | 675 |
| 504 | Ga0451833_1265906 | 3300041491 | Bacteria | 815 |
| 505 | Ga0451853_0743401 | 3300041512 | Bacteria | 647 |
| 506 | Ga0439431_0038409 | 3300041997 | Bacteria | 1212 |
| 507 | Ga0439458_0057062 | 3300042157 | Bacteria | 971 |
| 508 | Ga0439458_0120792 | 3300042157 | Bacteria | 690 |
| 509 | Ga0466959_0103000 | 3300045049 | Bacteria | 2042 |
| 510 | Ga0495617_069187 | 3300046452 | Bacteria | 1161 |
| 511 | Ga0495627_059722 | 3300046453 | Bacteria | 1131 |
| 512 | Ga0495592_0002185 | 3300046454 | Bacteria | 13770 |
| 513 | Ga0495603_0000027 | 3300046455 | Bacteria | 61238 |
| 514 | Ga0495603_0067970 | 3300046455 | Bacteria | 2096 |
| 515 | Ga0495603_0194657 | 3300046455 | Bacteria | 1172 |
| 516 | Ga0495603_0348182 | 3300046455 | Bacteria | 850 |
| 517 | Ga0495603_0557647 | 3300046455 | Bacteria | 656 |
| 518 | Ga0495590_0081146 | 3300046457 | Bacteria | 1142 |
| 519 | Ga0495591_067348 | 3300046458 | Bacteria | 937 |
| 520 | Ga0495629_0000290 | 3300046459 | Bacteria | 43459 |
| 521 | Ga0495629_0050941 | 3300046459 | Bacteria | 2898 |
| 522 | Ga0495629_0602384 | 3300046459 | Bacteria | 735 |
| 523 | Ga0495638_0305499 | 3300046460 | Bacteria | 855 |
| 524 | Ga0495638_0373676 | 3300046460 | Bacteria | 746 |
| 525 | Ga0495638_0450372 | 3300046460 | Bacteria | 657 |
| 526 | Ga0495641_0005129 | 3300046461 | Bacteria | 8967 |
| 527 | Ga0495651_0000412 | 3300046462 | Bacteria | 33198 |
| 528 | Ga0495651_0166998 | 3300046462 | Bacteria | 1571 |
| 529 | Ga0495651_0210996 | 3300046462 | Bacteria | 1351 |
| 530 | Ga0495651_0216888 | 3300046462 | Bacteria | 1327 |
| 531 | Ga0495653_0000161 | 3300046463 | Bacteria | 55322 |
| 532 | Ga0495650_0125540 | 3300046471 | Bacteria | 941 |
| 533 | Ga0495650_0169990 | 3300046471 | Bacteria | 772 |
| 534 | Ga0495580_0003356 | 3300046472 | Bacteria | 13678 |
| 535 | Ga0495580_0306484 | 3300046472 | Bacteria | 1081 |
| 536 | Ga0495582_0000157 | 3300046473 | Bacteria | 36665 |
| 537 | Ga0495605_0195845 | 3300046474 | Bacteria | 882 |
| 538 | Ga0495639_0000048 | 3300046475 | Bacteria | 53257 |
| 539 | Ga0495639_0606149 | 3300046475 | Bacteria | 563 |
| 540 | Ga0495662_0000814 | 3300046476 | Bacteria | 15152 |
| 541 | Ga0495664_0032625 | 3300046477 | Bacteria | 3057 |
| 542 | Ga0495664_0114065 | 3300046477 | Bacteria | 1632 |
| 543 | Ga0495664_0173731 | 3300046477 | Bacteria | 1307 |
| 544 | Ga0495664_0181282 | 3300046477 | Bacteria | 1277 |
| 545 | Ga0495584_0191921 | 3300046491 | Bacteria | 1038 |
| 546 | Ga0495584_0217869 | 3300046491 | Bacteria | 970 |
| 547 | Ga0495585_0139867 | 3300046492 | Bacteria | 1268 |
| 548 | Ga0495594_0001217 | 3300046499 | Bacteria | 13445 |
| 549 | Ga0495596_0222467 | 3300046500 | Bacteria | 733 |
| 550 | Ga0495607_0195017 | 3300046501 | Bacteria | 1006 |
| 551 | Ga0495583_0121046 | 3300046506 | Bacteria | 1102 |
| 552 | Ga0495583_0129998 | 3300046506 | Bacteria | 1054 |
| 553 | Ga0495583_0229880 | 3300046506 | Bacteria | 748 |
| 554 | Ga0495608_0000337 | 3300046511 | Bacteria | 33005 |
| 555 | Ga0495608_0328794 | 3300046511 | Bacteria | 943 |
| 556 | Ga0495610_0180727 | 3300046512 | Bacteria | 877 |
| 557 | Ga0495610_0280143 | 3300046512 | Bacteria | 650 |
| 558 | Ga0495616_0105154 | 3300046513 | Bacteria | 1318 |
| 559 | Ga0495616_0413764 | 3300046513 | Bacteria | 552 |
| 560 | Ga0495618_0443494 | 3300046514 | Bacteria | 789 |
| 561 | Ga0495620_0159916 | 3300046515 | Bacteria | 875 |
| 562 | Ga0495628_0036389 | 3300046516 | Bacteria | 3951 |
| 563 | Ga0495628_0293628 | 3300046516 | Bacteria | 1204 |
| 564 | Ga0495630_0000846 | 3300046517 | Bacteria | 21588 |
| 565 | Ga0495631_0101559 | 3300046518 | Bacteria | 1237 |
| 566 | Ga0495632_0059700 | 3300046519 | Bacteria | 1855 |
| 567 | Ga0495632_0177841 | 3300046519 | Bacteria | 975 |
| 568 | Ga0495632_0189799 | 3300046519 | Bacteria | 939 |
| 569 | Ga0495632_0206832 | 3300046519 | Bacteria | 891 |
| 570 | Ga0495632_0374128 | 3300046519 | Bacteria | 624 |
| 571 | Ga0495637_0171649 | 3300046520 | Bacteria | 808 |
| 572 | Ga0495643_0379002 | 3300046522 | Bacteria | 628 |
| 573 | Ga0495643_0414032 | 3300046522 | Bacteria | 592 |
| 574 | Ga0495643_0464663 | 3300046522 | Bacteria | 549 |
| 575 | Ga0495644_0090089 | 3300046523 | Bacteria | 1157 |
| 576 | Ga0495644_0158754 | 3300046523 | Bacteria | 867 |
| 577 | Ga0495648_0003360 | 3300046524 | Bacteria | 14095 |
| 578 | Ga0495648_0324484 | 3300046524 | Bacteria | 712 |
| 579 | Ga0495648_0346372 | 3300046524 | Bacteria | 680 |
| 580 | Ga0495663_0012324 | 3300046525 | Bacteria | 2382 |
| 581 | Ga0495666_0170382 | 3300046526 | Bacteria | 1007 |
| 582 | Ga0495666_0214820 | 3300046526 | Bacteria | 882 |
| 583 | Ga0495642_0286078 | 3300046528 | Bacteria | 722 |
| 584 | Ga0495652_0012092 | 3300046529 | Bacteria | 7798 |
| 585 | Ga0495652_0115522 | 3300046529 | Bacteria | 2150 |
| 586 | Ga0495652_0240059 | 3300046529 | Bacteria | 1349 |
| 587 | Ga0495654_0180546 | 3300046530 | Bacteria | 914 |
| 588 | Ga0495654_0287348 | 3300046530 | Bacteria | 675 |
| 589 | Ga0495665_0002259 | 3300046531 | Bacteria | 10438 |
| 590 | Ga0495665_0283055 | 3300046531 | Bacteria | 850 |
| 591 | Ga0495640_0004105 | 3300046533 | Bacteria | 11649 |
| 592 | Ga0495640_0004805 | 3300046533 | Bacteria | 10757 |
| 593 | Ga0495587_0000668 | 3300046536 | Bacteria | 22979 |
| 594 | Ga0495587_0191793 | 3300046536 | Bacteria | 1157 |
| 595 | Ga0495598_0043288 | 3300046537 | Bacteria | 1325 |
| 596 | Ga0495609_0095484 | 3300046538 | Bacteria | 1290 |
| 597 | Ga0495609_0168032 | 3300046538 | Bacteria | 927 |
| 598 | Ga0495609_0276146 | 3300046538 | Bacteria | 688 |
| 599 | Ga0495621_0045106 | 3300046539 | Bacteria | 1560 |
| 600 | Ga0495645_0050107 | 3300046543 | Bacteria | 3040 |
| 601 | Ga0495645_0385493 | 3300046543 | Bacteria | 896 |
| 602 | Ga0495622_0014669 | 3300046557 | Bacteria | 3640 |
| 603 | Ga0495622_0339614 | 3300046557 | Bacteria | 651 |
| 604 | Ga0495622_0466854 | 3300046557 | Bacteria | 541 |
| 605 | Ga0495633_0181053 | 3300046558 | Bacteria | 970 |
| 606 | Ga0495667_0000147 | 3300046559 | Bacteria | 47993 |
| 607 | Ga0495667_0198544 | 3300046559 | Bacteria | 1284 |
| 608 | Ga0495656_0277376 | 3300046615 | Bacteria | 853 |
| 609 | Ga0495668_0289132 | 3300046616 | Bacteria | 898 |
| 610 | Ga0495668_0408206 | 3300046616 | Bacteria | 746 |
| 611 | Ga0495668_0657359 | 3300046616 | Bacteria | 579 |
| 612 | Ga0495634_0001002 | 3300046642 | Bacteria | 26604 |
| 613 | Ga0495611_0222265 | 3300046648 | Bacteria | 878 |
| 614 | Ga0495625_0245969 | 3300046660 | Bacteria | 1162 |
| 615 | Ga0495625_0310071 | 3300046660 | Bacteria | 1007 |
| 616 | Ga0495625_0741135 | 3300046660 | Bacteria | 577 |
| 617 | Ga0495635_0000094 | 3300046663 | Bacteria | 52578 |
| 618 | Ga0495635_0001877 | 3300046663 | Bacteria | 14243 |
| 619 | Ga0495635_0503554 | 3300046663 | Bacteria | 797 |
| 620 | Ga0495659_0040840 | 3300046664 | Bacteria | 1655 |
| 621 | Ga0495659_0278960 | 3300046664 | Bacteria | 702 |
| 622 | Ga0495661_0159652 | 3300046665 | Bacteria | 1211 |
| 623 | Ga0495588_0004956 | 3300046674 | Bacteria | 5910 |
| 624 | Ga0495588_0156603 | 3300046674 | Bacteria | 1204 |
| 625 | Ga0495657_0001420 | 3300046675 | Bacteria | 20703 |
| 626 | Ga0495657_0263082 | 3300046675 | Bacteria | 1036 |
| 627 | Ga0495657_0531189 | 3300046675 | Bacteria | 684 |
| 628 | Ga0495599_0000253 | 3300046678 | Bacteria | 33822 |
| 629 | Ga0495599_0344043 | 3300046678 | Bacteria | 895 |
| 630 | Ga0495623_0000768 | 3300046679 | Bacteria | 21497 |
| 631 | Ga0495623_0055642 | 3300046679 | Bacteria | 2493 |
| 632 | Ga0495623_0243496 | 3300046679 | Bacteria | 1015 |
| 633 | Ga0495646_0002668 | 3300046680 | Bacteria | 11037 |
| 634 | Ga0495646_0010961 | 3300046680 | Bacteria | 5758 |
| 635 | Ga0495647_0001301 | 3300046681 | Bacteria | 7674 |
| 636 | Ga0495658_0048666 | 3300046683 | Bacteria | 2391 |
| 637 | Ga0495669_0023405 | 3300046684 | Bacteria | 2688 |
| 638 | Ga0495669_0132973 | 3300046684 | Bacteria | 1171 |
| 639 | Ga0495669_0267054 | 3300046684 | Bacteria | 822 |
| 640 | Ga0495613_0006428 | 3300046689 | Bacteria | 8785 |
| 641 | Ga0495613_0386358 | 3300046689 | Bacteria | 956 |
| 642 | Ga0495624_0000380 | 3300046690 | Bacteria | 35436 |
| 643 | Ga0495624_0151058 | 3300046690 | Bacteria | 1421 |
| 644 | Ga0495670_0226385 | 3300046691 | Bacteria | 994 |
| 645 | Ga0495670_0358224 | 3300046691 | Bacteria | 785 |
| 646 | Ga0495671_0162984 | 3300046692 | Bacteria | 1084 |
| 647 | Ga0495671_0214610 | 3300046692 | Bacteria | 932 |
| 648 | Ga0495671_0283809 | 3300046692 | Bacteria | 797 |
| 649 | Ga0495589_0071888 | 3300046794 | Bacteria | 1690 |
| 650 | Ga0495589_0329986 | 3300046794 | Bacteria | 704 |
| 651 | Ga0495589_0330592 | 3300046794 | Bacteria | 703 |
| 652 | Ga0495589_0445084 | 3300046794 | Bacteria | 593 |
| 653 | Ga0495600_0002207 | 3300046809 | Bacteria | 11075 |
| 654 | Ga0495600_0403777 | 3300046809 | Bacteria | 850 |
| 655 | Ga0495581_0000233 | 3300047315 | Bacteria | 26288 |
| 656 | Ga0495581_0368778 | 3300047315 | Bacteria | 838 |
| 657 | Ga0495604_0000253 | 3300047317 | Bacteria | 47392 |
| 658 | Ga0495636_0304620 | 3300047318 | Bacteria | 746 |
| 659 | Ga0495674_0002874 | 3300047319 | Bacteria | 16742 |
| 660 | Ga0495674_0102638 | 3300047319 | Bacteria | 2432 |
| 661 | Ga0495672_0040313 | 3300047320 | Bacteria | 2833 |
| 662 | Ga0495676_0260320 | 3300047321 | Bacteria | 1180 |
| 663 | Ga0495680_0000406 | 3300047322 | Bacteria | 48300 |
| 664 | Ga0495680_0068965 | 3300047322 | Bacteria | 2700 |
| 665 | Ga0495683_0123902 | 3300047323 | Bacteria | 1224 |
| 666 | Ga0495683_0154962 | 3300047323 | Bacteria | 1063 |
| 667 | Ga0495675_0000285 | 3300047444 | Bacteria | 36643 |
| 668 | Ga0495675_0113399 | 3300047444 | Bacteria | 1691 |
| 669 | Ga0495677_0032962 | 3300047445 | Bacteria | 1887 |
| 670 | Ga0495679_099623 | 3300047446 | Bacteria | 808 |
| 671 | Ga0495679_150982 | 3300047446 | Bacteria | 624 |
| 672 | Ga0495685_076758 | 3300047447 | Bacteria | 1115 |
| 673 | Ga0495685_193752 | 3300047447 | Bacteria | 652 |
| 674 | Ga0495673_0115015 | 3300047469 | Bacteria | 1071 |
| 675 | Ga0495673_0237132 | 3300047469 | Bacteria | 670 |
| 676 | Ga0495673_0283976 | 3300047469 | Bacteria | 597 |
| 677 | Ga0495673_0371252 | 3300047469 | Bacteria | 502 |
| 678 | Ga0495681_0149432 | 3300047470 | Bacteria | 981 |
| 679 | Ga0495684_0000184 | 3300047471 | Bacteria | 47730 |
| 680 | Ga0495684_0030110 | 3300047471 | Bacteria | 4167 |
| 681 | Ga0495593_0000160 | 3300047673 | Bacteria | 34170 |
| 682 | Ga0495593_0226917 | 3300047673 | Bacteria | 937 |
| 683 | Ga0495602_0001148 | 3300048088 | Bacteria | 25888 |
| 684 | Ga0495602_0132250 | 3300048088 | Bacteria | 1988 |
| 685 | Ga0495602_0139333 | 3300048088 | Bacteria | 1922 |
| 686 | Ga0495602_0665355 | 3300048088 | Bacteria | 710 |
| 687 | Ga0495614_0011061 | 3300048089 | Bacteria | 3970 |
| 688 | Ga0495615_0104819 | 3300048090 | Bacteria | 803 |
| 689 | Ga0496100_0037478 | 3300048903 | Bacteria | 3066 |
| 690 | Ga0496100_0534082 | 3300048903 | Bacteria | 906 |
| 691 | Ga0496100_0719989 | 3300048903 | Bacteria | 779 |
| 692 | Ga0496101_0014849 | 3300048904 | Bacteria | 5240 |
| 693 | Ga0496101_0323311 | 3300048904 | Bacteria | 1210 |
| 694 | Ga0496101_0338550 | 3300048904 | Bacteria | 1181 |
| 695 | Ga0496101_0344316 | 3300048904 | Bacteria | 1171 |
| 696 | Ga0496101_0765112 | 3300048904 | Bacteria | 762 |
| 697 | Ga0496101_1209103 | 3300048904 | Bacteria | 592 |
| 698 | Ga0496102_0362108 | 3300048905 | Bacteria | 1365 |
| 699 | Ga0496102_0412418 | 3300048905 | Bacteria | 1269 |
| 700 | Ga0496102_0684594 | 3300048905 | Bacteria | 948 |
| 701 | Ga0496103_0038610 | 3300048906 | Bacteria | 2931 |
| 702 | Ga0496103_0361787 | 3300048906 | Bacteria | 933 |
| 703 | Ga0496103_0736745 | 3300048906 | Bacteria | 624 |
| 704 | Ga0496103_0931976 | 3300048906 | Bacteria | 543 |
| 705 | Ga0496104_0004525 | 3300048907 | Bacteria | 12115 |
| 706 | Ga0496104_0005723 | 3300048907 | Bacteria | 10878 |
| 707 | Ga0496104_0093215 | 3300048907 | Bacteria | 2880 |
| 708 | Ga0496104_0211028 | 3300048907 | Bacteria | 1853 |
| 709 | Ga0496104_0221254 | 3300048907 | Bacteria | 1805 |
| 710 | Ga0496104_0708016 | 3300048907 | Bacteria | 915 |
| 711 | Ga0496104_0811163 | 3300048907 | Bacteria | 842 |
| 712 | Ga0496104_0824428 | 3300048907 | Bacteria | 833 |
| 713 | Ga0496105_0022833 | 3300048908 | Bacteria | 5070 |
| 714 | Ga0496105_0051568 | 3300048908 | Bacteria | 3399 |
| 715 | Ga0496105_0961602 | 3300048908 | Bacteria | 641 |
| 716 | Ga0496106_0020373 | 3300048909 | Bacteria | 4921 |
| 717 | Ga0496106_0393711 | 3300048909 | Bacteria | 1113 |
| 718 | Ga0496107_0009868 | 3300048910 | Bacteria | 6621 |
| 719 | Ga0496107_0010008 | 3300048910 | Bacteria | 6577 |
| 720 | Ga0496107_0128306 | 3300048910 | Bacteria | 1871 |
| 721 | Ga0496107_0246760 | 3300048910 | Bacteria | 1329 |
| 722 | Ga0496107_0251021 | 3300048910 | Bacteria | 1316 |
| 723 | Ga0496107_1089774 | 3300048910 | Bacteria | 577 |
| 724 | Ga0496108_0012626 | 3300048911 | Bacteria | 6883 |
| 725 | Ga0496108_0014497 | 3300048911 | Bacteria | 6435 |
| 726 | Ga0496108_0107718 | 3300048911 | Bacteria | 2380 |
| 727 | Ga0496108_0135669 | 3300048911 | Bacteria | 2117 |
| 728 | Ga0496108_0589937 | 3300048911 | Bacteria | 968 |
| 729 | Ga0496108_0801613 | 3300048911 | Bacteria | 812 |
| 730 | Ga0496108_1665184 | 3300048911 | Bacteria | 526 |
| 731 | Ga0496109_0001625 | 3300048912 | Bacteria | 18767 |
| 732 | Ga0496109_0014487 | 3300048912 | Bacteria | 6860 |
| 733 | Ga0496109_0135206 | 3300048912 | Bacteria | 2303 |
| 734 | Ga0496109_0471419 | 3300048912 | Bacteria | 1185 |
| 735 | Ga0496110_0003188 | 3300048913 | Bacteria | 12488 |
| 736 | Ga0496110_0011002 | 3300048913 | Bacteria | 7383 |
| 737 | Ga0496110_0016721 | 3300048913 | Bacteria | 6127 |
| 738 | Ga0496110_0038042 | 3300048913 | Bacteria | 4184 |
| 739 | Ga0496110_0120912 | 3300048913 | Bacteria | 2359 |
| 740 | Ga0496110_0227730 | 3300048913 | Bacteria | 1695 |
| 741 | Ga0496110_1928005 | 3300048913 | Bacteria | 501 |
| 742 | Ga0496111_0144305 | 3300048914 | Bacteria | 1764 |
| 743 | Ga0496111_0225412 | 3300048914 | Bacteria | 1392 |
| 744 | Ga0496111_0397643 | 3300048914 | Bacteria | 1018 |
| 745 | Ga0496111_0491724 | 3300048914 | Bacteria | 903 |
| 746 | Ga0496112_0001486 | 3300048915 | Bacteria | 18040 |
| 747 | Ga0496112_0012497 | 3300048915 | Bacteria | 7802 |
| 748 | Ga0496112_0029342 | 3300048915 | Bacteria | 5319 |
| 749 | Ga0496112_0071601 | 3300048915 | Bacteria | 3426 |
| 750 | Ga0496112_0169400 | 3300048915 | Bacteria | 2149 |
| 751 | Ga0496112_0420633 | 3300048915 | Bacteria | 1275 |
| 752 | Ga0496112_1289849 | 3300048915 | Bacteria | 646 |
| 753 | Ga0496113_0140188 | 3300048916 | Bacteria | 1902 |
| 754 | Ga0496113_0200674 | 3300048916 | Bacteria | 1585 |
| 755 | Ga0496113_0321581 | 3300048916 | Bacteria | 1240 |
| 756 | Ga0496114_0020268 | 3300048917 | Bacteria | 5395 |
| 757 | Ga0496114_0396818 | 3300048917 | Bacteria | 1222 |
| 758 | Ga0496114_0533855 | 3300048917 | Bacteria | 1037 |
| 759 | Ga0496114_0704165 | 3300048917 | Bacteria | 885 |
| 760 | Ga0496115_0000957 | 3300048918 | Bacteria | 20941 |
| 761 | Ga0496115_0017252 | 3300048918 | Bacteria | 5513 |
| 762 | Ga0496115_0026693 | 3300048918 | Bacteria | 4510 |
| 763 | Ga0496115_0067536 | 3300048918 | Bacteria | 2892 |
| 764 | Ga0496115_0152734 | 3300048918 | Bacteria | 1907 |
| 765 | Ga0496115_0213225 | 3300048918 | Bacteria | 1595 |
| 766 | Ga0496115_0287498 | 3300048918 | Bacteria | 1349 |
| 767 | Ga0496115_0435924 | 3300048918 | Bacteria | 1060 |
| 768 | Ga0496115_0558334 | 3300048918 | Bacteria | 914 |
| 769 | Ga0496115_1068453 | 3300048918 | Bacteria | 613 |
| 770 | Ga0496117_0452804 | 3300048920 | Bacteria | 634 |
| 771 | Ga0496118_0316948 | 3300048921 | Bacteria | 848 |
| 772 | Ga0496119_0094919 | 3300048922 | Bacteria | 1686 |
| 773 | Ga0496120_0399211 | 3300048923 | Bacteria | 608 |
| 774 | Ga0496121_0183693 | 3300048924 | Bacteria | 1506 |
| 775 | Ga0496121_0258887 | 3300048924 | Bacteria | 1202 |
| 776 | Ga0496121_0382177 | 3300048924 | Bacteria | 928 |
| 777 | Ga0496121_0656276 | 3300048924 | Bacteria | 638 |
| 778 | Ga0496124_0358509 | 3300048927 | Bacteria | 1028 |
| 779 | Ga0496124_0799804 | 3300048927 | Bacteria | 584 |
| 780 | Ga0496125_0095613 | 3300048928 | Bacteria | 2209 |
| 781 | Ga0496125_0750610 | 3300048928 | Bacteria | 511 |
| 782 | Ga0496126_0012947 | 3300048929 | Bacteria | 8517 |
| 783 | Ga0496126_0027023 | 3300048929 | Bacteria | 5491 |
| 784 | Ga0496126_0096463 | 3300048929 | Bacteria | 2592 |
| 785 | Ga0496126_0156382 | 3300048929 | Bacteria | 1951 |
| 786 | Ga0496126_0160059 | 3300048929 | Bacteria | 1924 |
| 787 | Ga0496126_0238314 | 3300048929 | Bacteria | 1521 |
| 788 | Ga0496126_0253820 | 3300048929 | Bacteria | 1464 |
| 789 | Ga0496126_0691027 | 3300048929 | Bacteria | 794 |
| 790 | Ga0496126_1006238 | 3300048929 | Bacteria | 625 |
| 791 | Ga0496126_1021187 | 3300048929 | Bacteria | 619 |
| 792 | Ga0495678_086534 | 3300049459 | Bacteria | 1114 |
| 793 | Ga0495682_0112232 | 3300049460 | Bacteria | 977 |
| 794 | Ga0495682_0165893 | 3300049460 | Bacteria | 786 |
| 795 | Ga0501036_1166602 | 3300049572 | Bacteria | 628 |
| 796 | Ga0501037_0122526 | 3300049573 | Bacteria | 1869 |
| 797 | Ga0501039_0532769 | 3300049575 | Bacteria | 922 |
| 798 | Ga0501040_0259289 | 3300049576 | Bacteria | 1241 |
| 799 | Ga0501041_0164239 | 3300049577 | Bacteria | 1389 |
| 800 | Ga0501067_0497976 | 3300049583 | Bacteria | 681 |
| 801 | Ga0501069_0362305 | 3300049585 | Bacteria | 855 |
| 802 | Ga0501070_0690684 | 3300049586 | Bacteria | 808 |
| 803 | Ga0501071_0447329 | 3300049587 | Bacteria | 989 |
| 804 | Ga0501072_0553898 | 3300049588 | Bacteria | 908 |
| 805 | Ga0501076_0622138 | 3300049592 | Bacteria | 891 |
| 806 | Ga0501081_0496183 | 3300049743 | Bacteria | 910 |
| 807 | nmdc:mga03683_123863_c1 | 3300050489 | Bacteria | 1151 |
| 808 | nmdc:mga03683_236608_c1 | 3300050489 | Bacteria | 846 |
| 809 | nmdc:mga03683_297205_c1 | 3300050489 | Bacteria | 757 |
| 810 | nmdc:mga03683_33917_c1 | 3300050489 | Bacteria | 1064 |
| 811 | nmdc:mga03683_46904_c1 | 3300050489 | Bacteria | 1792 |
| 812 | nmdc:mga03n38_259940_c1 | 3300050490 | Bacteria | 920 |
| 813 | nmdc:mga03n38_4297_c1 | 3300050490 | Bacteria | 4697 |
| 814 | nmdc:mga00v17_225126_c1 | 3300050491 | Bacteria | 1215 |
| 815 | nmdc:mga00v17_276426_c1 | 3300050491 | Bacteria | 1090 |
| 816 | nmdc:mga00v17_371347_c1 | 3300050491 | Bacteria | 930 |
| 817 | nmdc:mga00v17_497202_c1 | 3300050491 | Bacteria | 791 |
| 818 | nmdc:mga0yw44_159032_c1 | 3300050492 | Bacteria | 1478 |
| 819 | nmdc:mga0k408_257415_c1 | 3300050493 | Bacteria | 1042 |
| 820 | nmdc:mga0k408_350090_c1 | 3300050493 | Bacteria | 881 |
| 821 | nmdc:mga06z11_232409_c1 | 3300050494 | Bacteria | 1081 |
| 822 | nmdc:mga06z11_289417_c1 | 3300050494 | Bacteria | 972 |
| 823 | nmdc:mga06z11_4502_c1 | 3300050494 | Bacteria | 5487 |
| 824 | nmdc:mga04h51_157441_c1 | 3300050495 | Bacteria | 872 |
| 825 | nmdc:mga04h51_273244_c1 | 3300050495 | Bacteria | 683 |
| 826 | nmdc:mga04h51_70415_c1 | 3300050495 | Bacteria | 1220 |
| 827 | nmdc:mga07m45_39194_c1 | 3300050496 | Bacteria | 2647 |
| 828 | nmdc:mga07m45_40246_c1 | 3300050496 | Bacteria | 2615 |
| 829 | nmdc:mga05p37_332591_c1 | 3300050507 | Bacteria | 1794 |
| 830 | nmdc:mga08y16_700503_c1 | 3300050511 | Bacteria | 1013 |
| 831 | nmdc:mga0n895_569228_c1 | 3300050512 | Bacteria | 1138 |
| 832 | nmdc:mga0rr50_162110_c1 | 3300050513 | Bacteria | 1815 |
| 833 | nmdc:mga0sz30_14151_c1 | 3300050516 | Bacteria | 3136 |
| 834 | nmdc:mga0sz30_272597_c1 | 3300050516 | Bacteria | 754 |
| 835 | Ga0495601_0214456 | 3300053077 | Bacteria | 1257 |
| 836 | Ga0495601_0330755 | 3300053077 | Bacteria | 992 |
| 837 | Ga0495601_0829178 | 3300053077 | Bacteria | 586 |
| 838 | Ga0495601_0839541 | 3300053077 | Bacteria | 582 |
| 839 | Ga0495612_0091003 | 3300053078 | Bacteria | 1292 |
| 840 | Ga0495612_0118384 | 3300053078 | Bacteria | 1138 |
| 841 | Ga0500635_0222076 | 3300053080 | Bacteria | 738 |
| 842 | Ga0495655_0122051 | 3300053083 | Bacteria | 794 |
| 843 | Ga0495595_0002312 | 3300053084 | Bacteria | 7431 |
| 844 | Ga0495595_0274241 | 3300053084 | Bacteria | 846 |
| 845 | Ga0495619_0000209 | 3300053085 | Bacteria | 42507 |
| 846 | Ga0495619_0497802 | 3300053085 | Bacteria | 838 |
| 847 | Ga0500578_0340591 | 3300053086 | Bacteria | 879 |
| 848 | Ga0500583_0057799 | 3300053092 | Bacteria | 1822 |
| 849 | Ga0500583_0494185 | 3300053092 | Bacteria | 575 |
| 850 | Ga0500651_0375615 | 3300053093 | Bacteria | 802 |
| 851 | Ga0500566_0144995 | 3300053094 | Bacteria | 1255 |
| 852 | Ga0500641_0062919 | 3300053096 | Bacteria | 1548 |
| 853 | Ga0500554_013386 | 3300053102 | Bacteria | 2090 |
| 854 | Ga0500555_014921 | 3300053103 | Bacteria | 2240 |
| 855 | Ga0500569_093499 | 3300053109 | Bacteria | 977 |
| 856 | Ga0500595_002765 | 3300053119 | Bacteria | 8449 |
| 857 | Ga0500595_058997 | 3300053119 | Bacteria | 1164 |
| 858 | Ga0500607_304551 | 3300053121 | Bacteria | 586 |
| 859 | Ga0500608_181198 | 3300053122 | Bacteria | 892 |
| 860 | Ga0500617_201580 | 3300053124 | Bacteria | 729 |
| 861 | Ga0500655_066561 | 3300053133 | Bacteria | 731 |
| 862 | Ga0500658_0384979 | 3300053134 | Bacteria | 642 |
| 863 | Ga0500568_0085400 | 3300053139 | Bacteria | 1195 |
| 864 | Ga0500577_0322953 | 3300053142 | Bacteria | 674 |
| 865 | Ga0500589_090739 | 3300053147 | Bacteria | 1346 |
| 866 | Ga0500603_063380 | 3300053150 | Bacteria | 1038 |
| 867 | Ga0500603_101442 | 3300053150 | Bacteria | 855 |
| 868 | Ga0500604_0107189 | 3300053151 | Bacteria | 925 |
| 869 | Ga0500604_0217347 | 3300053151 | Bacteria | 659 |
| 870 | Ga0500627_0199014 | 3300053158 | Bacteria | 898 |
| 871 | Ga0500634_0100956 | 3300053161 | Bacteria | 1444 |
| 872 | Ga0500638_080847 | 3300053162 | Bacteria | 1543 |
| 873 | Ga0500637_0024183 | 3300053178 | Bacteria | 3327 |
| 874 | Ga0500637_0255955 | 3300053178 | Bacteria | 974 |
| 875 | Ga0500611_104865 | 3300053727 | Bacteria | 737 |
| 876 | Ga0500645_011669 | 3300053730 | Bacteria | 2860 |
| 877 | Ga0500609_019939 | 3300053731 | Bacteria | 914 |
| 878 | Ga0500656_038759 | 3300053732 | Bacteria | 660 |
| 879 | Ga0500661_022339 | 3300055283 | Bacteria | 1121 |
| 880 | 8056674502 | 8056673599 | Bacteria | 7871253 |
| 881 | 2513656702 | 2513237096 | Bacteria | 8722461 |
| 882 | 2513672258 | 2513237098 | Bacteria | 9902361 |
| 883 | 2513858507 | 2513237137 | Bacteria | 9558895 |
| 884 | 2513917887 | 2513237145 | Bacteria | 8979722 |
| 885 | 2517893067 | 2517572143 | Bacteria | 9484767 |
| 886 | 2524536815 | 2524023228 | Bacteria | 10118060 |
| 887 | 2671117690 | 2667528175 | Bacteria | 7532676 |
| 888 | 2793077272 | |||
| 889 | 2824603292 | 2824600985 | Bacteria | 8488197 |
| 890 | 2824614059 | 2824609381 | Bacteria | 8672835 |
| 891 | 2824656607 | 2824653114 | Bacteria | 8493680 |
| 892 | 2874609627 | 2874604998 | Bacteria | 7834745 |
| 893 | 2876809506 | 2876808645 | Bacteria | 8824342 |
| 894 | 2879118512 | 2879110137 | Bacteria | 8907982 |
| 895 | 2885383820 | 2885383462 | Bacteria | 9473874 |
| 896 | 2888423712 | 2888419890 | Bacteria | 7857137 |
| 897 | 2889040570 | 2889033259 | Bacteria | 9099371 |
| 898 | 2903772717 | 2903768456 | Bacteria | 9749579 |
| 899 | 2904696249 | 2904690495 | Bacteria | 9412302 |
| 900 | 2904702578 | |||
| 901 | 2906640691 | 2906635258 | Bacteria | 8601019 |
| 902 | 2906661423 | 2906660503 | Bacteria | 8595048 |
| 903 | 2908760965 | 2908756301 | Bacteria | 8864324 |
| 904 | 2922367698 | 2922361189 | Bacteria | 7436256 |
| 905 | 2922392406 | 2922386360 | Bacteria | 7017218 |
| 906 | 2932796503 | 2932794094 | Bacteria | 7915132 |
| 907 | 2932803501 | 2932801729 | Bacteria | 7987968 |
| 908 | 2935633697 | 2935630451 | Bacteria | 8169952 |
| 909 | 2935886571 | 2935883170 | Bacteria | 7964738 |
| 910 | 2941510588 | 2941507105 | Bacteria | 8166816 |
| 911 | 2941517673 | 2941515067 | Bacteria | 8166720 |
| 912 | 2941525690 | 2941523033 | Bacteria | 8169134 |
| 913 | 8006941534 | 8006933436 | Bacteria | 10410654 |
| 914 | 8006967397 | 8006964411 | Bacteria | 8966052 |
| 915 | 8006981243 | 8006973647 | Bacteria | 10679141 |
| 916 | 8006988147 | 8006984368 | Bacteria | 9651211 |
| 917 | 8006997711 | 8006994254 | Bacteria | 8309700 |
| 918 | 8056690163 | 8056689827 | Bacteria | 6712655 |
| 919 | JGI24743J22301_10058784 | |||
| 920 | JGI24743J22301_10059612 | |||
| 921 | JGI24738J21930_10064694 | |||
| 922 | JGI24034J26672_10032748 | |||
| 923 | JGI25153J46596_10001663 | |||
| 924 | JGI25404J52841_10006374 | |||
| 925 | JGI25404J52841_10017892 | |||
| 926 | JGI25404J52841_10037060 | |||
| 927 | Ga0070658_10579805 | |||
| 928 | Ga0070676_10221988 | |||
| 929 | Ga0070676_10371858 | |||
| 930 | Ga0070670_100507789 | |||
| 931 | Ga0070677_10091220 | |||
| 932 | Ga0068869_100190485 | |||
| 933 | Ga0068869_100556035 | |||
| 934 | Ga0068869_100702389 | |||
| 935 | Ga0070666_10610229 | |||
| 936 | Ga0070680_100095813 | |||
| 937 | Ga0070680_100319131 | |||
| 938 | Ga0070680_101495579 | |||
| 939 | Ga0070682_100155569 | |||
| 940 | Ga0070682_100286193 | |||
| 941 | Ga0068868_100053906 | |||
| 942 | Ga0068868_100073736 | |||
| 943 | Ga0070660_100202391 | |||
| 944 | Ga0070660_100371648 | |||
| 945 | Ga0070660_100392485 | |||
| 946 | Ga0070689_101350541 | |||
| 947 | Ga0070661_100212778 | |||
| 948 | Ga0070661_100734471 | |||
| 949 | Ga0070661_100835237 | |||
| 950 | Ga0070661_100889566 | |||
| 951 | Ga0070692_10344675 | |||
| 952 | Ga0070668_100594326 | |||
| 953 | Ga0070668_100614123 | |||
| 954 | Ga0070668_100622008 | |||
| 955 | Ga0070668_100630239 | |||
| 956 | Ga0070669_101112340 | |||
| 957 | Ga0070669_101188750 | |||
| 958 | Ga0070671_100324833 | |||
| 959 | Ga0070671_100382191 | |||
| 960 | Ga0070671_100622465 | |||
| 961 | Ga0070674_100249077 | |||
| 962 | Ga0070673_100699534 | |||
| 963 | Ga0070673_100772856 | |||
| 964 | Ga0070673_101168485 | |||
| 965 | Ga0070688_100251487 | |||
| 966 | Ga0070688_100415220 | |||
| 967 | Ga0070688_100604806 | |||
| 968 | Ga0070667_100314371 | |||
| 969 | Ga0070667_100555555 | |||
| 970 | Ga0070667_100560011 | |||
| 971 | Ga0070703_10152762 | |||
| 972 | Ga0070713_100537791 | |||
| 973 | Ga0070710_10179464 | |||
| 974 | Ga0070710_10868680 | |||
| 975 | Ga0070701_10575851 | |||
| 976 | Ga0070711_100006622 | |||
| 977 | Ga0070700_100179719 | |||
| 978 | Ga0070694_100664380 | |||
| 979 | Ga0070708_100753666 | |||
| 980 | Ga0070708_101006235 | |||
| 981 | Ga0070663_100013100 | |||
| 982 | Ga0070663_100188650 | |||
| 983 | Ga0070663_100277926 | |||
| 984 | Ga0070663_100362211 | |||
| 985 | Ga0070663_100483525 | |||
| 986 | Ga0070678_100128081 | |||
| 987 | Ga0070678_100142393 | |||
| 988 | Ga0070678_100240508 | |||
| 989 | Ga0070678_100753808 | |||
| 990 | Ga0070678_101091591 | |||
| 991 | Ga0070678_101379352 | |||
| 992 | Ga0070662_100288205 | |||
| 993 | Ga0068867_100087390 | |||
| 994 | Ga0070685_10470555 | |||
| 995 | Ga0070698_100284877 | |||
| 996 | Ga0070699_100303119 | |||
| 997 | Ga0070679_100017345 | |||
| 998 | Ga0070679_100429571 | |||
| 999 | Ga0070684_100794207 | |||
| 1000 | Ga0070697_100629856 | |||
| 1001 | Ga0068853_100110842 | |||
| 1002 | Ga0068853_101684844 | |||
| 1003 | Ga0070672_100577794 | |||
| 1004 | Ga0070693_100333160 | |||
| 1005 | Ga0070693_100462602 | |||
| 1006 | Ga0070665_100219326 | |||
| 1007 | Ga0070665_100236234 | |||
| 1008 | Ga0070665_100517771 | |||
| 1009 | Ga0070704_100128107 | |||
| 1010 | Ga0070704_100345952 | |||
| 1011 | Ga0068855_100028801 | |||
| 1012 | Ga0068855_100104411 | |||
| 1013 | Ga0068855_100390797 | |||
| 1014 | Ga0068855_100802989 | |||
| 1015 | Ga0068855_101419513 | |||
| 1016 | Ga0070664_100325912 | |||
| 1017 | Ga0070664_100742866 | |||
| 1018 | Ga0068857_100665451 | |||
| 1019 | Ga0068857_100790733 | |||
| 1020 | Ga0068854_100409708 | |||
| 1021 | Ga0068856_100239551 | |||
| 1022 | Ga0068856_100445512 | |||
| 1023 | Ga0068856_100745147 | |||
| 1024 | Ga0068856_101993429 | |||
| 1025 | Ga0070702_100935751 | |||
| 1026 | Ga0068852_100039877 | |||
| 1027 | Ga0068852_100847470 | |||
| 1028 | Ga0068852_101602333 | |||
| 1029 | Ga0068859_100200655 | |||
| 1030 | Ga0068859_100440961 | |||
| 1031 | Ga0068859_100891373 | |||
| 1032 | Ga0068864_100015580 | |||
| 1033 | Ga0068864_100623731 | |||
| 1034 | Ga0068861_100135798 | |||
| 1035 | Ga0068861_100717879 | |||
| 1036 | Ga0068861_100796681 | |||
| 1037 | Ga0068861_100959834 | |||
| 1038 | Ga0068851_10651675 | |||
| 1039 | Ga0068851_10924833 | |||
| 1040 | Ga0068863_101408481 | |||
| 1041 | Ga0068858_100378862 | |||
| 1042 | Ga0068858_100958441 | |||
| 1043 | Ga0068860_100769118 | |||
| 1044 | Ga0068860_101278022 | |||
| 1045 | Ga0068860_101340831 | |||
| 1046 | Ga0068862_100511309 | |||
| 1047 | Ga0068862_100743795 | |||
| 1048 | Ga0068862_101400352 | |||
| 1049 | Ga0081455_10046597 | |||
| 1050 | Ga0081455_10059345 | |||
| 1051 | Ga0081455_10085186 | |||
| 1052 | Ga0081538_10041630 | |||
| 1053 | Ga0081540_1008342 | |||
| 1054 | Ga0081540_1015698 | |||
| 1055 | Ga0081540_1017290 | |||
| 1056 | Ga0081540_1187154 | |||
| 1057 | Ga0081539_10046039 | |||
| 1058 | Ga0070717_10141347 | |||
| 1059 | Ga0070717_10626894 | |||
| 1060 | Ga0075365_10009719 | |||
| 1061 | Ga0075365_10135672 | |||
| 1062 | Ga0075365_10202026 | |||
| 1063 | Ga0075365_10394581 | |||
| 1064 | Ga0075368_10017552 | |||
| 1065 | Ga0075368_10054708 | |||
| 1066 | Ga0075368_10207655 | |||
| 1067 | Ga0075363_100010490 | |||
| 1068 | Ga0075363_100112265 | |||
| 1069 | Ga0075363_100167706 | |||
| 1070 | Ga0075363_100269343 | |||
| 1071 | Ga0075363_100444211 | |||
| 1072 | Ga0075364_10054582 | |||
| 1073 | Ga0075364_10385948 | |||
| 1074 | Ga0075364_10421841 | |||
| 1075 | Ga0075364_10644546 | |||
| 1076 | Ga0075432_10290314 | |||
| 1077 | Ga0070716_100780825 | |||
| 1078 | Ga0070712_100398056 | |||
| 1079 | Ga0075362_10063771 | |||
| 1080 | Ga0075362_10066601 | |||
| 1081 | Ga0075362_10217339 | |||
| 1082 | Ga0075362_10362849 | |||
| 1083 | Ga0075367_10041004 | |||
| 1084 | Ga0075367_10045732 | |||
| 1085 | Ga0075367_10116690 | |||
| 1086 | Ga0075367_10291655 | |||
| 1087 | Ga0075369_10058163 | |||
| 1088 | Ga0075369_10268021 | |||
| 1089 | Ga0075369_10381246 | |||
| 1090 | Ga0075366_10096611 | |||
| 1091 | Ga0075366_10239347 | |||
| 1092 | Ga0075366_10538786 | |||
| 1093 | Ga0097621_100317329 | |||
| 1094 | Ga0097621_100425398 | |||
| 1095 | Ga0097621_100828473 | |||
| 1096 | Ga0097621_101049116 | |||
| 1097 | Ga0075370_10019945 | |||
| 1098 | Ga0075370_10045847 | |||
| 1099 | Ga0068871_100519984 | |||
| 1100 | Ga0068871_100616653 | |||
| 1101 | Ga0068871_101474303 | |||
| 1102 | Ga0068871_101477788 | |||
| 1103 | Ga0075434_100340551 | |||
| 1104 | Ga0068865_100135871 | |||
| 1105 | Ga0097620_100200657 | |||
| 1106 | Ga0097620_100440943 | |||
| 1107 | Ga0097620_100891328 | |||
| 1108 | Ga0099794_10188751 | |||
| 1109 | Ga0099795_10206119 | |||
| 1110 | Ga0099795_10271338 | |||
| 1111 | Ga0099795_10363544 | |||
| 1112 | Ga0105240_10711281 | |||
| 1113 | Ga0111539_10397101 | |||
| 1114 | Ga0105245_10128755 | |||
| 1115 | Ga0105245_10254418 | |||
| 1116 | Ga0105245_10933260 | |||
| 1117 | Ga0105245_11285705 | |||
| 1118 | Ga0105247_10427331 | |||
| 1119 | Ga0105247_10967371 | |||
| 1120 | Ga0105247_11088053 | |||
| 1121 | Ga0105247_11113133 | |||
| 1122 | Ga0114129_10661569 | |||
| 1123 | Ga0114129_10769222 | |||
| 1124 | Ga0105243_10188344 | |||
| 1125 | Ga0105243_10647013 | |||
| 1126 | Ga0105243_10685693 | |||
| 1127 | Ga0105243_11026912 | |||
| 1128 | Ga0105241_10361206 | |||
| 1129 | Ga0105242_10327509 | |||
| 1130 | Ga0105242_10365430 | |||
| 1131 | Ga0105242_10368949 | |||
| 1132 | Ga0105242_12011974 | |||
| 1133 | Ga0105248_10192219 | |||
| 1134 | Ga0105248_10601570 | |||
| 1135 | Ga0105248_10727801 | |||
| 1136 | Ga0105248_10821394 | |||
| 1137 | Ga0105248_10904908 | |||
| 1138 | Ga0105237_10805020 | |||
| 1139 | Ga0105237_10969375 | |||
| 1140 | Ga0105237_11304856 | |||
| 1141 | Ga0105238_10375587 | |||
| 1142 | Ga0105238_10676241 | |||
| 1143 | Ga0105238_10728562 | |||
| 1144 | Ga0105238_11535889 | |||
| 1145 | Ga0105249_10220912 | |||
| 1146 | Ga0105249_10386862 | |||
| 1147 | Ga0105249_10986979 | |||
| 1148 | Ga0105249_11604151 | |||
| 1149 | Ga0105249_11941385 | |||
| 1150 | Ga0099796_10030556 | |||
| 1151 | Ga0099796_10081890 | |||
| 1152 | Ga0099796_10143760 | |||
| 1153 | Ga0099796_10433111 | |||
| 1154 | Ga0105239_10250831 | |||
| 1155 | Ga0105239_10730892 | |||
| 1156 | Ga0105239_10741330 | |||
| 1157 | Ga0105239_11300611 | |||
| 1158 | Ga0105239_11524491 | |||
| 1159 | Ga0105239_11772335 | |||
| 1160 | Ga0105246_10431986 | |||
| 1161 | Ga0105246_10566570 | |||
| 1162 | Ga0105246_10591664 | |||
| 1163 | Ga0105246_10616279 | |||
| 1164 | Ga0105246_11060203 | |||
| 1165 | Ga0105246_11071439 | |||
| 1166 | Ga0157313_1034310 | |||
| 1167 | Ga0157370_10084579 | |||
| 1168 | Ga0157369_10706453 | |||
| 1169 | Ga0157374_10111572 | |||
| 1170 | Ga0157374_10427529 | |||
| 1171 | Ga0157378_10835723 | |||
| 1172 | Ga0157378_10945283 | |||
| 1173 | Ga0157378_11055394 | |||
| 1174 | Ga0163162_10317431 | |||
| 1175 | Ga0163162_10458914 | |||
| 1176 | Ga0163162_10545137 | |||
| 1177 | Ga0163162_10869676 | |||
| 1178 | Ga0163162_10899421 | |||
| 1179 | Ga0163162_11687831 | |||
| 1180 | Ga0163162_12213928 | |||
| 1181 | Ga0157375_10486244 | |||
| 1182 | Ga0157375_10749445 | |||
| 1183 | Ga0157375_11074346 | |||
| 1184 | Ga0163163_10023070 | |||
| 1185 | Ga0163163_10275897 | |||
| 1186 | Ga0163163_10314975 | |||
| 1187 | Ga0163163_10465131 | |||
| 1188 | Ga0157380_10162993 | |||
| 1189 | Ga0157380_11542747 | |||
| 1190 | Ga0157380_11910570 | |||
| 1191 | Ga0157380_12367490 | |||
| 1192 | Ga0157377_10365429 | |||
| 1193 | Ga0157377_10410198 | |||
| 1194 | Ga0157379_10033139 | |||
| 1195 | Ga0157379_10791970 | |||
| 1196 | Ga0157379_11216182 | |||
| 1197 | Ga0157376_10465240 | |||
| 1198 | Ga0157376_10978925 | |||
| 1199 | Ga0157376_11049219 | |||
| 1200 | Ga0163161_10137602 | |||
| 1201 | Ga0163161_10279002 | |||
| 1202 | Ga0163161_10441933 | |||
| 1203 | Ga0163161_10747129 | |||
| 1204 | Ga0209758_1003248 | |||
| 1205 | Ga0209758_1111111 | |||
| 1206 | Ga0207697_10179104 | |||
| 1207 | Ga0207656_10196513 | |||
| 1208 | Ga0207656_10271883 | |||
| 1209 | Ga0207696_1028849 | |||
| 1210 | Ga0207653_10118253 | |||
| 1211 | Ga0207642_10422612 | |||
| 1212 | Ga0207642_10473994 | |||
| 1213 | Ga0207710_10163879 | |||
| 1214 | Ga0207710_10380814 | |||
| 1215 | Ga0207688_10222671 | |||
| 1216 | Ga0207688_10578812 | |||
| 1217 | Ga0207680_10358637 | |||
| 1218 | Ga0207680_10656209 | |||
| 1219 | Ga0207647_10380973 | |||
| 1220 | Ga0207645_10057724 | |||
| 1221 | Ga0207645_10103605 | |||
| 1222 | Ga0207645_10680578 | |||
| 1223 | Ga0207705_10461045 | |||
| 1224 | Ga0207684_10290950 | |||
| 1225 | Ga0207654_10727023 | |||
| 1226 | Ga0207707_10330325 | |||
| 1227 | Ga0207695_10465988 | |||
| 1228 | Ga0207671_10973526 | |||
| 1229 | Ga0207693_10028464 | |||
| 1230 | Ga0207693_10091760 | |||
| 1231 | Ga0207693_10511800 | |||
| 1232 | Ga0207693_10588136 | |||
| 1233 | Ga0207663_10060954 | |||
| 1234 | Ga0207660_10144030 | |||
| 1235 | Ga0207660_10271656 | |||
| 1236 | Ga0207662_10290628 | |||
| 1237 | Ga0207657_10261181 | |||
| 1238 | Ga0207657_10640755 | |||
| 1239 | Ga0207652_10015934 | |||
| 1240 | Ga0207681_10142231 | |||
| 1241 | Ga0207650_10264311 | |||
| 1242 | Ga0207650_10600920 | |||
| 1243 | Ga0207659_11405721 | |||
| 1244 | Ga0207687_10047614 | |||
| 1245 | Ga0207687_10550900 | |||
| 1246 | Ga0207687_11225756 | |||
| 1247 | Ga0207700_10295303 | |||
| 1248 | Ga0207644_10637207 | |||
| 1249 | Ga0207690_10789197 | |||
| 1250 | Ga0207706_10078846 | |||
| 1251 | Ga0207686_10403116 | |||
| 1252 | Ga0207709_10081403 | |||
| 1253 | Ga0207709_10335183 | |||
| 1254 | Ga0207709_11181283 | |||
| 1255 | Ga0207669_10025168 | |||
| 1256 | Ga0207669_10626209 | |||
| 1257 | Ga0207704_10505313 | |||
| 1258 | Ga0207704_10796004 | |||
| 1259 | Ga0207665_10154911 | |||
| 1260 | Ga0207665_10264299 | |||
| 1261 | Ga0207691_10210957 | |||
| 1262 | Ga0207691_10490953 | |||
| 1263 | Ga0207691_10963975 | |||
| 1264 | Ga0207691_11131052 | |||
| 1265 | Ga0207711_10097167 | |||
| 1266 | Ga0207711_10437167 | |||
| 1267 | Ga0207711_10896368 | |||
| 1268 | Ga0207689_10455407 | |||
| 1269 | Ga0207689_10616136 | |||
| 1270 | Ga0207689_10746306 | |||
| 1271 | Ga0207679_10252431 | |||
| 1272 | Ga0207667_10017031 | |||
| 1273 | Ga0207667_10123208 | |||
| 1274 | Ga0207667_10335217 | |||
| 1275 | Ga0207667_10647137 | |||
| 1276 | Ga0207651_10052362 | |||
| 1277 | Ga0207651_10458215 | |||
| 1278 | Ga0207651_10510770 | |||
| 1279 | Ga0207651_11280246 | |||
| 1280 | Ga0207712_11253749 | |||
| 1281 | Ga0207668_10517827 | |||
| 1282 | Ga0207668_10680376 | |||
| 1283 | Ga0207668_10868620 | |||
| 1284 | Ga0207658_10385062 | |||
| 1285 | Ga0207658_10717079 | |||
| 1286 | Ga0207658_11217121 | |||
| 1287 | Ga0207677_10021030 | |||
| 1288 | Ga0207677_10527654 | |||
| 1289 | Ga0207703_10410696 | |||
| 1290 | Ga0207703_10729551 | |||
| 1291 | Ga0207639_10264354 | |||
| 1292 | Ga0207639_11183512 | |||
| 1293 | Ga0207678_10326082 | |||
| 1294 | Ga0207678_10436271 | |||
| 1295 | Ga0207678_11036763 | |||
| 1296 | Ga0207678_11464959 | |||
| 1297 | Ga0207708_10108248 | |||
| 1298 | Ga0207708_10485706 | |||
| 1299 | Ga0207708_11032369 | |||
| 1300 | Ga0207708_11356189 | |||
| 1301 | Ga0207702_10236595 | |||
| 1302 | Ga0207702_10249945 | |||
| 1303 | Ga0207702_10298771 | |||
| 1304 | Ga0207641_10185072 | |||
| 1305 | Ga0207641_10857673 | |||
| 1306 | Ga0207648_10039644 | |||
| 1307 | Ga0207676_10231760 | |||
| 1308 | Ga0207676_10299134 | |||
| 1309 | Ga0207676_11917353 | |||
| 1310 | Ga0207676_11983794 | |||
| 1311 | Ga0207674_10225143 | |||
| 1312 | Ga0207675_100105346 | |||
| 1313 | Ga0207675_100692436 | |||
| 1314 | Ga0207675_100696859 | |||
| 1315 | Ga0207675_101105569 | |||
| 1316 | Ga0207683_10153602 | |||
| 1317 | Ga0207683_10484505 | |||
| 1318 | Ga0207683_10975859 | |||
| 1319 | Ga0207683_11185824 | |||
| 1320 | Ga0207683_11247552 | |||
| 1321 | Ga0207698_10084393 | |||
| 1322 | Ga0207698_10332547 | |||
| 1323 | Ga0209813_10014046 | |||
| 1324 | Ga0207428_10308306 | |||
| 1325 | Ga0268266_10003299 | |||
| 1326 | Ga0268266_10078801 | |||
| 1327 | Ga0268266_11338606 | |||
| 1328 | Ga0268265_10033437 | |||
| 1329 | Ga0268265_11395205 | |||
| 1330 | Ga0268265_11885470 | |||
| 1331 | Ga0268264_10711360 | |||
| 1332 | Ga0307517_10000111 | |||
| 1333 | Ga0307515_10066624 | |||
| 1334 | Ga0307515_10449843 | |||
| 1335 | Ga0307515_10718653 | |||
| 1336 | Ga0265339_10009277 | |||
| 1337 | Ga0265331_10053097 | |||
| 1338 | Ga0265331_10125738 | |||
| 1339 | Ga0307513_10100899 | |||
| 1340 | Ga0307513_10142176 | |||
| 1341 | Ga0307513_10695197 | |||
| 1342 | Ga0307513_10725872 | |||
| 1343 | Ga0307509_10328519 | |||
| 1344 | Ga0307509_10416174 | |||
| 1345 | Ga0307408_100996469 | |||
| 1346 | Ga0307508_10011459 | |||
| 1347 | Ga0307508_10151197 | |||
| 1348 | Ga0307508_10386252 | |||
| 1349 | Ga0307508_10589762 | |||
| 1350 | Ga0265314_10047945 | |||
| 1351 | Ga0265342_10006887 | |||
| 1352 | Ga0307516_10187640 | |||
| 1353 | Ga0307413_10487408 | |||
| 1354 | Ga0307407_10232986 | |||
| 1355 | Ga0307412_10457155 | |||
| 1356 | Ga0307414_10914113 | |||
| 1357 | Ga0307411_10021434 | |||
| 1358 | Ga0307411_11015490 | |||
| 1359 | Ga0307415_100353365 | |||
| 1360 | Ga0307510_10002750 | |||
| 1361 | Ga0307510_10036687 | |||
| 1362 | Ga0307510_10179818 | |||
| 1363 | Ga0307510_10276523 | |||
| 1364 | Ga0307510_10322235 | |||
| 1365 | Ga0307510_10437472 | |||
| 1366 | Ga0315911_1000001 | |||
| 1367 | Ga0373926_0123435 | |||
| 1368 | Ga0373928_0032698 | |||
| 1369 | Ga0373929_0045609 | |||
| 1370 | Ga0373934_0002075 | |||
| 1371 | Ga0373934_0051444 | |||
| 1372 | Ga0373934_0053526 | |||
| 1373 | Ga0373951_0044565 | |||
| 1374 | Ga0373923_0004381 | |||
| 1375 | Ga0373923_0445357 | |||
| 1376 | Ga0373932_0180908 | |||
| 1377 | Ga0373932_0251113 | |||
| 1378 | Ga0373936_0004513 | |||
| 1379 | Ga0373936_0089382 | |||
| 1380 | Ga0373936_0145615 | |||
| 1381 | Ga0373953_0000167 | |||
| 1382 | Ga0373954_0000035 | |||
| 1383 | Ga0373954_0053833 | |||
| 1384 | Ga0373956_0024009 | |||
| 1385 | Ga0373957_0078352 | |||
| 1386 | Ga0373960_0161258 | |||
| 1387 | Ga0373943_0149988 | |||
| 1388 | Ga0373943_0660472 | |||
| 1389 | Ga0373946_0073976 | |||
| 1390 | Ga0373946_0201352 | |||
| 1391 | Ga0373955_0005583 | |||
| 1392 | Ga0373955_0014576 | |||
| 1393 | Ga0373955_0137335 | |||
| 1394 | Ga0373942_0082732 | |||
| 1395 | Ga0373961_0070820 | |||
| 1396 | Ga0373961_0078649 | |||
| 1397 | Ga0373924_0014763 | |||
| 1398 | Ga0373924_0098077 | |||
| 1399 | Ga0373924_0136343 | |||
| 1400 | Ga0373931_0010956 | |||
| 1401 | Ga0373931_0025212 | |||
| 1402 | Ga0373931_0231060 | |||
| 1403 | Ga0373931_0248664 | |||
| 1404 | Ga0373931_0723862 | |||
| 1405 | Ga0373935_0000758 | |||
| 1406 | Ga0373935_1055749 | |||
| 1407 | Ga0373927_0002965 | |||
| 1408 | Ga0373933_0000037 | |||
| 1409 | Ga0373947_0026555 | |||
| 1410 | Ga0373937_0000118 | |||
| 1411 | Ga0373937_0057240 | |||
| 1412 | Ga0373937_1293772 | |||
| 1413 | Ga0373925_0008176 | |||
| 1414 | Ga0373925_0075159 | |||
| 1415 | Ga0395905_0910239 | |||
| 1416 | Ga0439465_0063256 | |||
| 1417 | Ga0451797_1204241 | |||
| 1418 | Ga0451795_0987322 | |||
| 1419 | Ga0451802_0425428 | |||
| 1420 | Ga0451807_2359835 | |||
| 1421 | Ga0451807_2648159 | |||
| 1422 | Ga0451833_1265906 | |||
| 1423 | Ga0451853_0743401 | |||
| 1424 | Ga0439431_0038409 | |||
| 1425 | Ga0439458_0057062 | |||
| 1426 | Ga0439458_0120792 | |||
| 1427 | Ga0466959_0103000 | |||
| 1428 | Ga0495617_069187 | |||
| 1429 | Ga0495627_059722 | |||
| 1430 | Ga0495592_0002185 | |||
| 1431 | Ga0495603_0000027 | |||
| 1432 | Ga0495603_0067970 | |||
| 1433 | Ga0495603_0194657 | |||
| 1434 | Ga0495603_0348182 | |||
| 1435 | Ga0495603_0557647 | |||
| 1436 | Ga0495590_0081146 | |||
| 1437 | Ga0495591_067348 | |||
| 1438 | Ga0495629_0000290 | |||
| 1439 | Ga0495629_0050941 | |||
| 1440 | Ga0495629_0602384 | |||
| 1441 | Ga0495638_0305499 | |||
| 1442 | Ga0495638_0373676 | |||
| 1443 | Ga0495638_0450372 | |||
| 1444 | Ga0495641_0005129 | |||
| 1445 | Ga0495651_0000412 | |||
| 1446 | Ga0495651_0166998 | |||
| 1447 | Ga0495651_0210996 | |||
| 1448 | Ga0495651_0216888 | |||
| 1449 | Ga0495653_0000161 | |||
| 1450 | Ga0495650_0125540 | |||
| 1451 | Ga0495650_0169990 | |||
| 1452 | Ga0495580_0003356 | |||
| 1453 | Ga0495580_0306484 | |||
| 1454 | Ga0495582_0000157 | |||
| 1455 | Ga0495605_0195845 | |||
| 1456 | Ga0495639_0000048 | |||
| 1457 | Ga0495639_0606149 | |||
| 1458 | Ga0495662_0000814 | |||
| 1459 | Ga0495664_0032625 | |||
| 1460 | Ga0495664_0114065 | |||
| 1461 | Ga0495664_0173731 | |||
| 1462 | Ga0495664_0181282 | |||
| 1463 | Ga0495584_0191921 | |||
| 1464 | Ga0495584_0217869 | |||
| 1465 | Ga0495585_0139867 | |||
| 1466 | Ga0495594_0001217 | |||
| 1467 | Ga0495596_0222467 | |||
| 1468 | Ga0495607_0195017 | |||
| 1469 | Ga0495583_0121046 | |||
| 1470 | Ga0495583_0129998 | |||
| 1471 | Ga0495583_0229880 | |||
| 1472 | Ga0495608_0000337 | |||
| 1473 | Ga0495608_0328794 | |||
| 1474 | Ga0495610_0180727 | |||
| 1475 | Ga0495610_0280143 | |||
| 1476 | Ga0495616_0105154 | |||
| 1477 | Ga0495616_0413764 | |||
| 1478 | Ga0495618_0443494 | |||
| 1479 | Ga0495620_0159916 | |||
| 1480 | Ga0495628_0036389 | |||
| 1481 | Ga0495628_0293628 | |||
| 1482 | Ga0495630_0000846 | |||
| 1483 | Ga0495631_0101559 | |||
| 1484 | Ga0495632_0059700 | |||
| 1485 | Ga0495632_0177841 | |||
| 1486 | Ga0495632_0189799 | |||
| 1487 | Ga0495632_0206832 | |||
| 1488 | Ga0495632_0374128 | |||
| 1489 | Ga0495637_0171649 | |||
| 1490 | Ga0495643_0379002 | |||
| 1491 | Ga0495643_0414032 | |||
| 1492 | Ga0495643_0464663 | |||
| 1493 | Ga0495644_0090089 | |||
| 1494 | Ga0495644_0158754 | |||
| 1495 | Ga0495648_0003360 | |||
| 1496 | Ga0495648_0324484 | |||
| 1497 | Ga0495648_0346372 | |||
| 1498 | Ga0495663_0012324 | |||
| 1499 | Ga0495666_0170382 | |||
| 1500 | Ga0495666_0214820 | |||
| 1501 | Ga0495642_0286078 | |||
| 1502 | Ga0495652_0012092 | |||
| 1503 | Ga0495652_0115522 | |||
| 1504 | Ga0495652_0240059 | |||
| 1505 | Ga0495654_0180546 | |||
| 1506 | Ga0495654_0287348 | |||
| 1507 | Ga0495665_0002259 | |||
| 1508 | Ga0495665_0283055 | |||
| 1509 | Ga0495640_0004105 | |||
| 1510 | Ga0495640_0004805 | |||
| 1511 | Ga0495587_0000668 | |||
| 1512 | Ga0495587_0191793 | |||
| 1513 | Ga0495598_0043288 | |||
| 1514 | Ga0495609_0095484 | |||
| 1515 | Ga0495609_0168032 | |||
| 1516 | Ga0495609_0276146 | |||
| 1517 | Ga0495621_0045106 | |||
| 1518 | Ga0495645_0050107 | |||
| 1519 | Ga0495645_0385493 | |||
| 1520 | Ga0495622_0014669 | |||
| 1521 | Ga0495622_0339614 | |||
| 1522 | Ga0495622_0466854 | |||
| 1523 | Ga0495633_0181053 | |||
| 1524 | Ga0495667_0000147 | |||
| 1525 | Ga0495667_0198544 | |||
| 1526 | Ga0495656_0277376 | |||
| 1527 | Ga0495668_0289132 | |||
| 1528 | Ga0495668_0408206 | |||
| 1529 | Ga0495668_0657359 | |||
| 1530 | Ga0495634_0001002 | |||
| 1531 | Ga0495611_0222265 | |||
| 1532 | Ga0495625_0245969 | |||
| 1533 | Ga0495625_0310071 | |||
| 1534 | Ga0495625_0741135 | |||
| 1535 | Ga0495635_0000094 | |||
| 1536 | Ga0495635_0001877 | |||
| 1537 | Ga0495635_0503554 | |||
| 1538 | Ga0495659_0040840 | |||
| 1539 | Ga0495659_0278960 | |||
| 1540 | Ga0495661_0159652 | |||
| 1541 | Ga0495588_0004956 | |||
| 1542 | Ga0495588_0156603 | |||
| 1543 | Ga0495657_0001420 | |||
| 1544 | Ga0495657_0263082 | |||
| 1545 | Ga0495657_0531189 | |||
| 1546 | Ga0495599_0000253 | |||
| 1547 | Ga0495599_0344043 | |||
| 1548 | Ga0495623_0000768 | |||
| 1549 | Ga0495623_0055642 | |||
| 1550 | Ga0495623_0243496 | |||
| 1551 | Ga0495646_0002668 | |||
| 1552 | Ga0495646_0010961 | |||
| 1553 | Ga0495647_0001301 | |||
| 1554 | Ga0495658_0048666 | |||
| 1555 | Ga0495669_0023405 | |||
| 1556 | Ga0495669_0132973 | |||
| 1557 | Ga0495669_0267054 | |||
| 1558 | Ga0495613_0006428 | |||
| 1559 | Ga0495613_0386358 | |||
| 1560 | Ga0495624_0000380 | |||
| 1561 | Ga0495624_0151058 | |||
| 1562 | Ga0495670_0226385 | |||
| 1563 | Ga0495670_0358224 | |||
| 1564 | Ga0495671_0162984 | |||
| 1565 | Ga0495671_0214610 | |||
| 1566 | Ga0495671_0283809 | |||
| 1567 | Ga0495589_0071888 | |||
| 1568 | Ga0495589_0329986 | |||
| 1569 | Ga0495589_0330592 | |||
| 1570 | Ga0495589_0445084 | |||
| 1571 | Ga0495600_0002207 | |||
| 1572 | Ga0495600_0403777 | |||
| 1573 | Ga0495581_0000233 | |||
| 1574 | Ga0495581_0368778 | |||
| 1575 | Ga0495604_0000253 | |||
| 1576 | Ga0495636_0304620 | |||
| 1577 | Ga0495674_0002874 | |||
| 1578 | Ga0495674_0102638 | |||
| 1579 | Ga0495672_0040313 | |||
| 1580 | Ga0495676_0260320 | |||
| 1581 | Ga0495680_0000406 | |||
| 1582 | Ga0495680_0068965 | |||
| 1583 | Ga0495683_0123902 | |||
| 1584 | Ga0495683_0154962 | |||
| 1585 | Ga0495675_0000285 | |||
| 1586 | Ga0495675_0113399 | |||
| 1587 | Ga0495677_0032962 | |||
| 1588 | Ga0495679_099623 | |||
| 1589 | Ga0495679_150982 | |||
| 1590 | Ga0495685_076758 | |||
| 1591 | Ga0495685_193752 | |||
| 1592 | Ga0495673_0115015 | |||
| 1593 | Ga0495673_0237132 | |||
| 1594 | Ga0495673_0283976 | |||
| 1595 | Ga0495673_0371252 | |||
| 1596 | Ga0495681_0149432 | |||
| 1597 | Ga0495684_0000184 | |||
| 1598 | Ga0495684_0030110 | |||
| 1599 | Ga0495593_0000160 | |||
| 1600 | Ga0495593_0226917 | |||
| 1601 | Ga0495602_0001148 | |||
| 1602 | Ga0495602_0132250 | |||
| 1603 | Ga0495602_0139333 | |||
| 1604 | Ga0495602_0665355 | |||
| 1605 | Ga0495614_0011061 | |||
| 1606 | Ga0495615_0104819 | |||
| 1607 | Ga0496100_0037478 | |||
| 1608 | Ga0496100_0534082 | |||
| 1609 | Ga0496100_0719989 | |||
| 1610 | Ga0496101_0014849 | |||
| 1611 | Ga0496101_0323311 | |||
| 1612 | Ga0496101_0338550 | |||
| 1613 | Ga0496101_0344316 | |||
| 1614 | Ga0496101_0765112 | |||
| 1615 | Ga0496101_1209103 | |||
| 1616 | Ga0496102_0362108 | |||
| 1617 | Ga0496102_0412418 | |||
| 1618 | Ga0496102_0684594 | |||
| 1619 | Ga0496103_0038610 | |||
| 1620 | Ga0496103_0361787 | |||
| 1621 | Ga0496103_0736745 | |||
| 1622 | Ga0496103_0931976 | |||
| 1623 | Ga0496104_0004525 | |||
| 1624 | Ga0496104_0005723 | |||
| 1625 | Ga0496104_0093215 | |||
| 1626 | Ga0496104_0211028 | |||
| 1627 | Ga0496104_0221254 | |||
| 1628 | Ga0496104_0708016 | |||
| 1629 | Ga0496104_0811163 | |||
| 1630 | Ga0496104_0824428 | |||
| 1631 | Ga0496105_0022833 | |||
| 1632 | Ga0496105_0051568 | |||
| 1633 | Ga0496105_0961602 | |||
| 1634 | Ga0496106_0020373 | |||
| 1635 | Ga0496106_0393711 | |||
| 1636 | Ga0496107_0009868 | |||
| 1637 | Ga0496107_0010008 | |||
| 1638 | Ga0496107_0128306 | |||
| 1639 | Ga0496107_0246760 | |||
| 1640 | Ga0496107_0251021 | |||
| 1641 | Ga0496107_1089774 | |||
| 1642 | Ga0496108_0012626 | |||
| 1643 | Ga0496108_0014497 | |||
| 1644 | Ga0496108_0107718 | |||
| 1645 | Ga0496108_0135669 | |||
| 1646 | Ga0496108_0589937 | |||
| 1647 | Ga0496108_0801613 | |||
| 1648 | Ga0496108_1665184 | |||
| 1649 | Ga0496109_0001625 | |||
| 1650 | Ga0496109_0014487 | |||
| 1651 | Ga0496109_0135206 | |||
| 1652 | Ga0496109_0471419 | |||
| 1653 | Ga0496110_0003188 | |||
| 1654 | Ga0496110_0011002 | |||
| 1655 | Ga0496110_0016721 | |||
| 1656 | Ga0496110_0038042 | |||
| 1657 | Ga0496110_0120912 | |||
| 1658 | Ga0496110_0227730 | |||
| 1659 | Ga0496110_1928005 | |||
| 1660 | Ga0496111_0144305 | |||
| 1661 | Ga0496111_0225412 | |||
| 1662 | Ga0496111_0397643 | |||
| 1663 | Ga0496111_0491724 | |||
| 1664 | Ga0496112_0001486 | |||
| 1665 | Ga0496112_0012497 | |||
| 1666 | Ga0496112_0029342 | |||
| 1667 | Ga0496112_0071601 | |||
| 1668 | Ga0496112_0169400 | |||
| 1669 | Ga0496112_0420633 | |||
| 1670 | Ga0496112_1289849 | |||
| 1671 | Ga0496113_0140188 | |||
| 1672 | Ga0496113_0200674 | |||
| 1673 | Ga0496113_0321581 | |||
| 1674 | Ga0496114_0020268 | |||
| 1675 | Ga0496114_0396818 | |||
| 1676 | Ga0496114_0533855 | |||
| 1677 | Ga0496114_0704165 | |||
| 1678 | Ga0496115_0000957 | |||
| 1679 | Ga0496115_0017252 | |||
| 1680 | Ga0496115_0026693 | |||
| 1681 | Ga0496115_0067536 | |||
| 1682 | Ga0496115_0152734 | |||
| 1683 | Ga0496115_0213225 | |||
| 1684 | Ga0496115_0287498 | |||
| 1685 | Ga0496115_0435924 | |||
| 1686 | Ga0496115_0558334 | |||
| 1687 | Ga0496115_1068453 | |||
| 1688 | Ga0496117_0452804 | |||
| 1689 | Ga0496118_0316948 | |||
| 1690 | Ga0496119_0094919 | |||
| 1691 | Ga0496120_0399211 | |||
| 1692 | Ga0496121_0183693 | |||
| 1693 | Ga0496121_0258887 | |||
| 1694 | Ga0496121_0382177 | |||
| 1695 | Ga0496121_0656276 | |||
| 1696 | Ga0496124_0358509 | |||
| 1697 | Ga0496124_0799804 | |||
| 1698 | Ga0496125_0095613 | |||
| 1699 | Ga0496125_0750610 | |||
| 1700 | Ga0496126_0012947 | |||
| 1701 | Ga0496126_0027023 | |||
| 1702 | Ga0496126_0096463 | |||
| 1703 | Ga0496126_0156382 | |||
| 1704 | Ga0496126_0160059 | |||
| 1705 | Ga0496126_0238314 | |||
| 1706 | Ga0496126_0253820 | |||
| 1707 | Ga0496126_0691027 | |||
| 1708 | Ga0496126_1006238 | |||
| 1709 | Ga0496126_1021187 | |||
| 1710 | Ga0495678_086534 | |||
| 1711 | Ga0495682_0112232 | |||
| 1712 | Ga0495682_0165893 | |||
| 1713 | Ga0501036_1166602 | |||
| 1714 | Ga0501037_0122526 | |||
| 1715 | Ga0501039_0532769 | |||
| 1716 | Ga0501040_0259289 | |||
| 1717 | Ga0501041_0164239 | |||
| 1718 | Ga0501067_0497976 | |||
| 1719 | Ga0501069_0362305 | |||
| 1720 | Ga0501070_0690684 | |||
| 1721 | Ga0501071_0447329 | |||
| 1722 | Ga0501072_0553898 | |||
| 1723 | Ga0501076_0622138 | |||
| 1724 | Ga0501081_0496183 | |||
| 1725 | nmdc:mga03683_123863_c1 | |||
| 1726 | nmdc:mga03683_236608_c1 | |||
| 1727 | nmdc:mga03683_297205_c1 | |||
| 1728 | nmdc:mga03683_33917_c1 | |||
| 1729 | nmdc:mga03683_46904_c1 | |||
| 1730 | nmdc:mga03n38_259940_c1 | |||
| 1731 | nmdc:mga03n38_4297_c1 | |||
| 1732 | nmdc:mga00v17_225126_c1 | |||
| 1733 | nmdc:mga00v17_276426_c1 | |||
| 1734 | nmdc:mga00v17_371347_c1 | |||
| 1735 | nmdc:mga00v17_497202_c1 | |||
| 1736 | nmdc:mga0yw44_159032_c1 | |||
| 1737 | nmdc:mga0k408_257415_c1 | |||
| 1738 | nmdc:mga0k408_350090_c1 | |||
| 1739 | nmdc:mga06z11_232409_c1 | |||
| 1740 | nmdc:mga06z11_289417_c1 | |||
| 1741 | nmdc:mga06z11_4502_c1 | |||
| 1742 | nmdc:mga04h51_157441_c1 | |||
| 1743 | nmdc:mga04h51_273244_c1 | |||
| 1744 | nmdc:mga04h51_70415_c1 | |||
| 1745 | nmdc:mga07m45_39194_c1 | |||
| 1746 | nmdc:mga07m45_40246_c1 | |||
| 1747 | nmdc:mga05p37_332591_c1 | |||
| 1748 | nmdc:mga08y16_700503_c1 | |||
| 1749 | nmdc:mga0n895_569228_c1 | |||
| 1750 | nmdc:mga0rr50_162110_c1 | |||
| 1751 | nmdc:mga0sz30_14151_c1 | |||
| 1752 | nmdc:mga0sz30_272597_c1 | |||
| 1753 | Ga0495601_0214456 | |||
| 1754 | Ga0495601_0330755 | |||
| 1755 | Ga0495601_0829178 | |||
| 1756 | Ga0495601_0839541 | |||
| 1757 | Ga0495612_0091003 | |||
| 1758 | Ga0495612_0118384 | |||
| 1759 | Ga0500635_0222076 | |||
| 1760 | Ga0495655_0122051 | |||
| 1761 | Ga0495595_0002312 | |||
| 1762 | Ga0495595_0274241 | |||
| 1763 | Ga0495619_0000209 | |||
| 1764 | Ga0495619_0497802 | |||
| 1765 | Ga0500578_0340591 | |||
| 1766 | Ga0500583_0057799 | |||
| 1767 | Ga0500583_0494185 | |||
| 1768 | Ga0500651_0375615 | |||
| 1769 | Ga0500566_0144995 | |||
| 1770 | Ga0500641_0062919 | |||
| 1771 | Ga0500554_013386 | |||
| 1772 | Ga0500555_014921 | |||
| 1773 | Ga0500569_093499 | |||
| 1774 | Ga0500595_002765 | |||
| 1775 | Ga0500595_058997 | |||
| 1776 | Ga0500607_304551 | |||
| 1777 | Ga0500608_181198 | |||
| 1778 | Ga0500617_201580 | |||
| 1779 | Ga0500655_066561 | |||
| 1780 | Ga0500658_0384979 | |||
| 1781 | Ga0500568_0085400 | |||
| 1782 | Ga0500577_0322953 | |||
| 1783 | Ga0500589_090739 | |||
| 1784 | Ga0500603_063380 | |||
| 1785 | Ga0500603_101442 | |||
| 1786 | Ga0500604_0107189 | |||
| 1787 | Ga0500604_0217347 | |||
| 1788 | Ga0500627_0199014 | |||
| 1789 | Ga0500634_0100956 | |||
| 1790 | Ga0500638_080847 | |||
| 1791 | Ga0500637_0024183 | |||
| 1792 | Ga0500637_0255955 | |||
| 1793 | Ga0500611_104865 | |||
| 1794 | Ga0500645_011669 | |||
| 1795 | Ga0500609_019939 | |||
| 1796 | Ga0500656_038759 | |||
| 1797 | Ga0500661_022339 | |||
| 1798 | 8056674502 | |||
| 1799 | 2513656702 | |||
| 1800 | 2513672258 | |||
| 1801 | 2513858507 | |||
| 1802 | 2513917887 | |||
| 1803 | 2517893067 | |||
| 1804 | 2524536815 | |||
| 1805 | 2671117690 | |||
| 1806 | 2793077272 | |||
| 1807 | 2824603292 | |||
| 1808 | 2824614059 | |||
| 1809 | 2824656607 | |||
| 1810 | 2874609627 | |||
| 1811 | 2876809506 | |||
| 1812 | 2879118512 | |||
| 1813 | 2885383820 | |||
| 1814 | 2888423712 | |||
| 1815 | 2889040570 | |||
| 1816 | 2903772717 | |||
| 1817 | 2904696249 | |||
| 1818 | 2904702578 | |||
| 1819 | 2906640691 | |||
| 1820 | 2906661423 | |||
| 1821 | 2908760965 | |||
| 1822 | 2922367698 | |||
| 1823 | 2922392406 | |||
| 1824 | 2932796503 | |||
| 1825 | 2932803501 | |||
| 1826 | 2935633697 | |||
| 1827 | 2935886571 | |||
| 1828 | 2941510588 | |||
| 1829 | 2941517673 | |||
| 1830 | 2941525690 | |||
| 1831 | 8006941534 | |||
| 1832 | 8006967397 | |||
| 1833 | 8006981243 | |||
| 1834 | 8006988147 | |||
| 1835 | 8006997711 | |||
| 1836 | 8056690163 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gtv-assembly1.cif.gz_A | engineered rabggtase in complex with bms analogue 13 | 0.5253 | 70 | 139 |
| 3c72-assembly1.cif.gz_A | engineered rabggtase in complex with a peptidomimetic inhibitor | 0.4815 | 61 | 139 |
| 3ax5-assembly1.cif.gz_A | crystal structure of rat tom20-aldh presequence complex: a complex (form1) between tom20 and a disulfide-bridged presequence peptide containing d-cys and l-cys at the i and i+3 positions. | 0.4738 | 64 | 136 |
| 3ax5-assembly1.cif.gz_A | crystal structure of rat tom20-aldh presequence complex: a complex (form1) between tom20 and a disulfide-bridged presequence peptide containing d-cys and l-cys at the i and i+3 positions. | 0.4653 | 64 | 136 |
| 6nu2-assembly1.cif.gz_AL | structural insights into unique features of the human mitochondrial ribosome recycling | 0.4275 | 59 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2v1sE00 | Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain | 0.5294 | 64 | 135 | 1.20.960.10 |
| 2v1sE00 | Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain | 0.5042 | 64 | 135 | 1.20.960.10 |
| af_Q4CSV2_11_448_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.4946 | 66 | 139 | 1.25.10.10 |
| af_Q4DD09_427_681_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.491 | 103 | 152 | 1.25.10.10 |
| 3ax5A00 | Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain | 0.4738 | 64 | 136 | 1.20.960.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R3LV94-F1-model_v4 | Uncharacterized protein | 0.7764 | 19 | 152 |
|
| AF-A0A0R3LV94-F1-model_v4 | Uncharacterized protein | 0.7086 | 19 | 152 |
|
| AF-A0A1N6K8H2-F1-model_v4 | deleted | 0.6924 | 1 | 152 |
|
| AF-A0A1N6K8H2-F1-model_v4 | deleted | 0.6879 | 1 | 152 |
|
| AF-A0A5N3SDB2-F1-model_v4 | DUF4760 domain-containing protein | 0.6037 | 6 | 137 |
GO:0016020
|