F485658

General Info

Members Datasets Scaffolds Average Seq Length
918 230 1836 411

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10006304|JGI24740J21852_100063043
Length 417
Sequence MAREDSQPTPKALGERLSATRRLTLDLAAPLSDADATIQPFPDASPAKWHLAHTTWFFETFVLRDHVAGYRLFDERWPYLFNSYYDGEGERHARPKRGMTSRPSLDEVRSYRAXVDEALERALPALPPPALELIELGINHEQQHQELFLTDILATFAENPLEPAYAPLRHCEEQKATRQSTDGGGGWMPGRDGLVEVGAPDGGFAFDSERPRHQALLHPHEIANRKVTNGEWRQFIEDGGYRTPGLWLSDGWVWAQQERISAPLYWREDGTEFTLAGRCEIDWAAPVAHVSHYEADAFAHWAGARLPTEFEWEAFAASADPNLGNQLDGAGAIRPRAGGGLFGDVWEWTQSAFAPYPGFAPAEGAVGEYNGKFMSGQLVLKGASCATPRGHSRDSYRNFFPPAARWQFTGVRLARNA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
176 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
188 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
230 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.22
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 5.56
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006304 3300001979 Bacteria 4924
2 JGI24740J21852_10000089 3300001979 Bacteria 31515
3 JGI24740J21852_10006169 3300001979 Bacteria 4998
4 JGI24739J22299_10000097 3300001989 Bacteria 25965
5 JGI24739J22299_10000510 3300001989 Bacteria 13820
6 JGI24739J22299_10002839 3300001989 Bacteria 6655
7 JGI24739J22299_10008448 3300001989 Bacteria 3846
8 JGI24739J22299_10013584 3300001989 Bacteria 2970
9 JGI24739J22299_10020380 3300001989 Bacteria 2370
10 JGI24737J22298_10000037 3300001990 Bacteria 37991
11 JGI24737J22298_10000930 3300001990 Bacteria 10388
12 JGI24737J22298_10002268 3300001990 Bacteria 6852
13 JGI24737J22298_10024358 3300001990 Bacteria 1917
14 JGI24737J22298_10032738 3300001990 Bacteria 1617
15 JGI24735J21928_10006140 3300002067 Bacteria 3966
16 JGI24735J21928_10015026 3300002067 Bacteria 2419
17 JGI24738J21930_10000023 3300002075 Bacteria 29088
18 JGI24744J21845_10001585 3300002077 Bacteria 4537
19 Ga0070658_10013086 3300005327 Bacteria 6657
20 Ga0070658_10030124 3300005327 Bacteria 4361
21 Ga0070658_10041747 3300005327 Bacteria 3701
22 Ga0070658_10084357 3300005327 Bacteria 2612
23 Ga0070658_10128082 3300005327 Bacteria 2114
24 Ga0070676_10001215 3300005328 Bacteria 12921
25 Ga0070676_10015404 3300005328 Bacteria 4218
26 Ga0070676_10016027 3300005328 Bacteria 4139
27 Ga0070683_100101781 3300005329 Bacteria 2705
28 Ga0070683_100126397 3300005329 Bacteria 2417
29 Ga0070683_100153466 3300005329 Bacteria 2183
30 Ga0070690_100060744 3300005330 Bacteria 2433
31 Ga0070670_100003109 3300005331 Bacteria 13741
32 Ga0070670_100003400 3300005331 Bacteria 13192
33 Ga0070670_100013225 3300005331 Bacteria 7070
34 Ga0070670_100019277 3300005331 Bacteria 5851
35 Ga0070670_100049493 3300005331 Bacteria 3613
36 Ga0070670_100094360 3300005331 Bacteria 2573
37 Ga0070670_100145947 3300005331 Bacteria 2047
38 Ga0070670_100194280 3300005331 Bacteria 1763
39 Ga0070677_10002149 3300005333 Bacteria 6301
40 Ga0070677_10011735 3300005333 Bacteria 3028
41 Ga0068869_100002765 3300005334 Bacteria 10626
42 Ga0070666_10000779 3300005335 Bacteria 19305
43 Ga0070666_10004292 3300005335 Bacteria 8676
44 Ga0070666_10016691 3300005335 Bacteria 4698
45 Ga0070666_10045105 3300005335 Bacteria 2955
46 Ga0070666_10059795 3300005335 Bacteria 2578
47 Ga0070680_100000683 3300005336 Bacteria 23493
48 Ga0070680_100005956 3300005336 Bacteria 9250
49 Ga0070682_100022704 3300005337 Bacteria 3719
50 Ga0070682_100037625 3300005337 Bacteria 2964
51 Ga0068868_100000259 3300005338 Bacteria 36003
52 Ga0068868_100015245 3300005338 Bacteria 5681
53 Ga0070660_100002456 3300005339 Bacteria 12715
54 Ga0070660_100010742 3300005339 Bacteria 6481
55 Ga0070660_100048545 3300005339 Bacteria 3261
56 Ga0070660_100059145 3300005339 Bacteria 2972
57 Ga0070660_100077842 3300005339 Bacteria 2599
58 Ga0070660_100098870 3300005339 Bacteria 2310
59 Ga0070660_100100038 3300005339 Bacteria 2296
60 Ga0070689_100028985 3300005340 Bacteria 4187
61 Ga0070661_100000187 3300005344 Bacteria 51095
62 Ga0070661_100022566 3300005344 Bacteria 4507
63 Ga0070661_100037714 3300005344 Bacteria 3516
64 Ga0070661_100053706 3300005344 Bacteria 2950
65 Ga0070661_100065878 3300005344 Bacteria 2662
66 Ga0070661_100067473 3300005344 Bacteria 2629
67 Ga0070661_100101598 3300005344 Bacteria 2139
68 Ga0070661_100104672 3300005344 Bacteria 2108
69 Ga0070661_100129845 3300005344 Bacteria 1892
70 Ga0070661_100144504 3300005344 Bacteria 1795
71 Ga0070692_10005107 3300005345 Bacteria 5553
72 Ga0070692_10062598 3300005345 Bacteria 1964
73 Ga0070668_100001011 3300005347 Bacteria 19707
74 Ga0070668_100197675 3300005347 Bacteria 1650
75 Ga0070669_100000174 3300005353 Bacteria 56290
76 Ga0070669_100016812 3300005353 Bacteria 5221
77 Ga0070669_100032524 3300005353 Bacteria 3767
78 Ga0070669_100080852 3300005353 Bacteria 2419
79 Ga0070669_100122251 3300005353 Bacteria 1987
80 Ga0070675_100002370 3300005354 Bacteria 14027
81 Ga0070675_100005311 3300005354 Bacteria 9842
82 Ga0070675_100023558 3300005354 Bacteria 4925
83 Ga0070671_100000051 3300005355 Bacteria 79207
84 Ga0070671_100007591 3300005355 Bacteria 8672
85 Ga0070671_100029886 3300005355 Bacteria 4495
86 Ga0070671_100139013 3300005355 Bacteria 2049
87 Ga0070674_100011997 3300005356 Bacteria 5306
88 Ga0070674_100014374 3300005356 Bacteria 4922
89 Ga0070674_100026956 3300005356 Bacteria 3760
90 Ga0070674_100054822 3300005356 Bacteria 2758
91 Ga0070674_100054931 3300005356 Bacteria 2756
92 Ga0070673_100000337 3300005364 Bacteria 24629
93 Ga0070673_100003346 3300005364 Bacteria 9964
94 Ga0070673_100005138 3300005364 Bacteria 8347
95 Ga0070673_100007992 3300005364 Bacteria 7007
96 Ga0070673_100011602 3300005364 Bacteria 6020
97 Ga0070673_100011732 3300005364 Bacteria 5992
98 Ga0070673_100030159 3300005364 Bacteria 4053
99 Ga0070659_100000191 3300005366 Bacteria 47035
100 Ga0070659_100000674 3300005366 Bacteria 24835
101 Ga0070659_100001559 3300005366 Bacteria 16520
102 Ga0070659_100003926 3300005366 Bacteria 10583
103 Ga0070659_100024740 3300005366 Bacteria 4605
104 Ga0070659_100061929 3300005366 Bacteria 2957
105 Ga0070659_100068906 3300005366 Bacteria 2807
106 Ga0070659_100071425 3300005366 Bacteria 2760
107 Ga0070659_100087728 3300005366 Bacteria 2491
108 Ga0070667_100002108 3300005367 Bacteria 17531
109 Ga0070667_100003559 3300005367 Bacteria 13269
110 Ga0070667_100006890 3300005367 Bacteria 9439
111 Ga0070667_100011927 3300005367 Bacteria 7191
112 Ga0070667_100019048 3300005367 Bacteria 5690
113 Ga0070667_100056394 3300005367 Bacteria 3319
114 Ga0070667_100058351 3300005367 Bacteria 3263
115 Ga0070667_100065494 3300005367 Bacteria 3085
116 Ga0070667_100167725 3300005367 Bacteria 1937
117 Ga0070667_100176266 3300005367 Bacteria 1889
118 Ga0070714_100012808 3300005435 Bacteria 6702
119 Ga0070714_100030038 3300005435 Bacteria 4522
120 Ga0070714_100207450 3300005435 Bacteria 1795
121 Ga0070713_100032969 3300005436 Bacteria 4144
122 Ga0070713_100150447 3300005436 Bacteria 2070
123 Ga0070694_100005641 3300005444 Bacteria 7584
124 Ga0070663_100000754 3300005455 Bacteria 17546
125 Ga0070663_100005688 3300005455 Bacteria 7428
126 Ga0070663_100045617 3300005455 Bacteria 3097
127 Ga0070663_100062643 3300005455 Bacteria 2682
128 Ga0070663_100077876 3300005455 Bacteria 2429
129 Ga0070663_100175873 3300005455 Bacteria 1657
130 Ga0070678_100001121 3300005456 Bacteria 14070
131 Ga0070662_100000012 3300005457 Bacteria 129380
132 Ga0070662_100001658 3300005457 Bacteria 13697
133 Ga0070662_100004959 3300005457 Bacteria 8456
134 Ga0070662_100008261 3300005457 Bacteria 6779
135 Ga0070662_100044464 3300005457 Bacteria 3181
136 Ga0070662_100058911 3300005457 Bacteria 2796
137 Ga0070662_100061068 3300005457 Bacteria 2750
138 Ga0070662_100101962 3300005457 Bacteria 2173
139 Ga0070662_100127982 3300005457 Bacteria 1954
140 Ga0070681_10095326 3300005458 Bacteria 2924
141 Ga0068867_100004031 3300005459 Bacteria 10331
142 Ga0068867_100006572 3300005459 Bacteria 8214
143 Ga0068867_100016133 3300005459 Bacteria 5305
144 Ga0068867_100022766 3300005459 Bacteria 4482
145 Ga0070679_100193151 3300005530 Bacteria 2004
146 Ga0070679_100213501 3300005530 Bacteria 1892
147 Ga0070684_100003278 3300005535 Bacteria 12122
148 Ga0070684_100009174 3300005535 Bacteria 7780
149 Ga0070684_100021129 3300005535 Bacteria 5409
150 Ga0070684_100061789 3300005535 Bacteria 3280
151 Ga0068853_100000032 3300005539 Bacteria 114306
152 Ga0068853_100000811 3300005539 Bacteria 21781
153 Ga0068853_100023014 3300005539 Bacteria 5212
154 Ga0068853_100025405 3300005539 Bacteria 4969
155 Ga0068853_100050345 3300005539 Bacteria 3584
156 Ga0068853_100057859 3300005539 Bacteria 3346
157 Ga0068853_100067619 3300005539 Bacteria 3105
158 Ga0068853_100130701 3300005539 Bacteria 2247
159 Ga0068853_100138960 3300005539 Bacteria 2180
160 Ga0068853_100179786 3300005539 Bacteria 1918
161 Ga0070672_100000945 3300005543 Bacteria 17467
162 Ga0070672_100015335 3300005543 Bacteria 5454
163 Ga0070672_100020977 3300005543 Bacteria 4775
164 Ga0070672_100057134 3300005543 Bacteria 3062
165 Ga0070686_100050166 3300005544 Bacteria 2651
166 Ga0070696_100009397 3300005546 Bacteria 6546
167 Ga0070696_100022125 3300005546 Bacteria 4318
168 Ga0070693_100000332 3300005547 Bacteria 21624
169 Ga0070693_100022677 3300005547 Bacteria 3342
170 Ga0070693_100124508 3300005547 Bacteria 1603
171 Ga0070665_100003604 3300005548 Bacteria 16399
172 Ga0070665_100021059 3300005548 Bacteria 6556
173 Ga0070665_100031747 3300005548 Bacteria 5316
174 Ga0070665_100034781 3300005548 Bacteria 5068
175 Ga0070665_100044349 3300005548 Bacteria 4466
176 Ga0070665_100222921 3300005548 Bacteria 1886
177 Ga0068855_100000591 3300005563 Bacteria 44412
178 Ga0068855_100003900 3300005563 Bacteria 18212
179 Ga0068855_100032731 3300005563 Bacteria 6207
180 Ga0068855_100034640 3300005563 Bacteria 6018
181 Ga0068855_100058967 3300005563 Bacteria 4493
182 Ga0068855_100134864 3300005563 Bacteria 2817
183 Ga0070664_100000187 3300005564 Bacteria 43750
184 Ga0070664_100001469 3300005564 Bacteria 18785
185 Ga0070664_100005323 3300005564 Bacteria 10325
186 Ga0070664_100006520 3300005564 Bacteria 9411
187 Ga0070664_100015366 3300005564 Bacteria 6260
188 Ga0070664_100020615 3300005564 Bacteria 5429
189 Ga0070664_100056593 3300005564 Bacteria 3332
190 Ga0070664_100283300 3300005564 Bacteria 1495
191 Ga0068857_100004021 3300005577 Bacteria 12383
192 Ga0068857_100006668 3300005577 Bacteria 9923
193 Ga0068857_100008116 3300005577 Bacteria 9064
194 Ga0068857_100012300 3300005577 Bacteria 7445
195 Ga0068857_100039164 3300005577 Bacteria 4198
196 Ga0068857_100058302 3300005577 Bacteria 3428
197 Ga0068854_100003701 3300005578 Bacteria 9566
198 Ga0068854_100009237 3300005578 Bacteria 6361
199 Ga0068854_100016964 3300005578 Bacteria 4865
200 Ga0068854_100141518 3300005578 Bacteria 1846
201 Ga0068854_100178955 3300005578 Bacteria 1655
202 Ga0068854_100187076 3300005578 Bacteria 1621
203 Ga0068856_100000291 3300005614 Bacteria 54890
204 Ga0068856_100013426 3300005614 Bacteria 7930
205 Ga0068852_100000906 3300005616 Bacteria 19629
206 Ga0068852_100000992 3300005616 Bacteria 18727
207 Ga0068852_100001448 3300005616 Bacteria 16016
208 Ga0068852_100032401 3300005616 Bacteria 4327
209 Ga0068852_100073062 3300005616 Bacteria 3016
210 Ga0068852_100078193 3300005616 Bacteria 2926
211 Ga0068852_100262857 3300005616 Bacteria 1658
212 Ga0068859_100000104 3300005617 Bacteria 78653
213 Ga0068859_100002786 3300005617 Bacteria 17711
214 Ga0068859_100106974 3300005617 Bacteria 2857
215 Ga0068864_100001558 3300005618 Bacteria 18888
216 Ga0068864_100002633 3300005618 Bacteria 14809
217 Ga0068864_100003198 3300005618 Bacteria 13529
218 Ga0068864_100023399 3300005618 Bacteria 5187
219 Ga0068864_100027341 3300005618 Bacteria 4817
220 Ga0068864_100095184 3300005618 Bacteria 2633
221 Ga0068866_10009481 3300005718 Bacteria 4134
222 Ga0068861_100145653 3300005719 Bacteria 1938
223 Ga0068851_10017422 3300005834 Bacteria 3450
224 Ga0068863_100001970 3300005841 Bacteria 20407
225 Ga0068863_100002317 3300005841 Bacteria 18934
226 Ga0068863_100004174 3300005841 Bacteria 14263
227 Ga0068863_100011841 3300005841 Bacteria 8430
228 Ga0068863_100025271 3300005841 Bacteria 5661
229 Ga0068863_100109773 3300005841 Bacteria 2626
230 Ga0068863_100111507 3300005841 Bacteria 2605
231 Ga0068858_100000620 3300005842 Bacteria 36979
232 Ga0068858_100000655 3300005842 Bacteria 36151
233 Ga0068858_100019464 3300005842 Bacteria 6349
234 Ga0068858_100019548 3300005842 Bacteria 6333
235 Ga0068858_100088363 3300005842 Bacteria 2883
236 Ga0068858_100094676 3300005842 Bacteria 2782
237 Ga0068858_100320682 3300005842 Bacteria 1481
238 Ga0068860_100003524 3300005843 Bacteria 16093
239 Ga0068860_100012707 3300005843 Bacteria 8283
240 Ga0068860_100013576 3300005843 Bacteria 7986
241 Ga0068860_100052681 3300005843 Bacteria 3870
242 Ga0068860_100072430 3300005843 Bacteria 3275
243 Ga0068860_100195285 3300005843 Bacteria 1960
244 Ga0068860_100279796 3300005843 Bacteria 1630
245 Ga0068862_100018353 3300005844 Bacteria 5825
246 Ga0068862_100030744 3300005844 Bacteria 4527
247 Ga0068862_100045476 3300005844 Bacteria 3746
248 Ga0068862_100087891 3300005844 Bacteria 2703
249 Ga0068862_100095436 3300005844 Bacteria 2594
250 Ga0081539_10021962 3300005985 Bacteria 4240
251 Ga0097621_100001388 3300006237 Bacteria 16665
252 Ga0097621_100009124 3300006237 Bacteria 7188
253 Ga0097621_100125899 3300006237 Bacteria 2176
254 Ga0068871_100002654 3300006358 Bacteria 12217
255 Ga0068871_100007505 3300006358 Bacteria 7797
256 Ga0068871_100148182 3300006358 Bacteria 2000
257 Ga0075428_100227991 3300006844 Bacteria 2011
258 Ga0075431_100010494 3300006847 Bacteria 9315
259 Ga0075429_100209751 3300006880 Bacteria 1707
260 Ga0068865_100001550 3300006881 Bacteria 13415
261 Ga0068865_100015551 3300006881 Bacteria 4854
262 Ga0097620_100000104 3300006931 Bacteria 78653
263 Ga0097620_100002786 3300006931 Bacteria 17711
264 Ga0097620_100106979 3300006931 Bacteria 2857
265 Ga0105240_10048201 3300009093 Bacteria 5386
266 Ga0105240_10064113 3300009093 Bacteria 4567
267 Ga0105240_10168840 3300009093 Bacteria 2593
268 Ga0111539_10014979 3300009094 Bacteria 9666
269 Ga0105245_10000229 3300009098 Bacteria 53255
270 Ga0105245_10019606 3300009098 Bacteria 5925
271 Ga0105245_10023282 3300009098 Bacteria 5437
272 Ga0105245_10230738 3300009098 Bacteria 1790
273 Ga0105243_10008878 3300009148 Bacteria 7692
274 Ga0105243_10017247 3300009148 Bacteria 5460
275 Ga0105241_10047772 3300009174 Bacteria 3256
276 Ga0105241_10186897 3300009174 Bacteria 1722
277 Ga0105242_10024170 3300009176 Bacteria 4796
278 Ga0105248_10000083 3300009177 Bacteria 110619
279 Ga0105248_10000790 3300009177 Bacteria 35522
280 Ga0105248_10002811 3300009177 Bacteria 19328
281 Ga0105248_10003127 3300009177 Bacteria 18320
282 Ga0105248_10007296 3300009177 Bacteria 12130
283 Ga0105248_10023083 3300009177 Bacteria 6909
284 Ga0105248_10037899 3300009177 Bacteria 5393
285 Ga0105248_10052041 3300009177 Bacteria 4595
286 Ga0105248_10070165 3300009177 Bacteria 3935
287 Ga0105248_10097313 3300009177 Bacteria 3316
288 Ga0105248_10119412 3300009177 Bacteria 2974
289 Ga0105248_10220789 3300009177 Bacteria 2134
290 Ga0105248_10460116 3300009177 Bacteria 1434
291 Ga0105238_10024793 3300009551 Bacteria 6113
292 Ga0105238_10049820 3300009551 Bacteria 4217
293 Ga0105249_10029817 3300009553 Bacteria 4929
294 Ga0105249_10061411 3300009553 Bacteria 3448
295 Ga0105239_10052783 3300010375 Bacteria 4458
296 Ga0105239_10168916 3300010375 Bacteria 2446
297 Ga0105239_10224192 3300010375 Bacteria 2108
298 Ga0105246_10006237 3300011119 Bacteria 7278
299 Ga0105246_10133612 3300011119 Bacteria 1857
300 Ga0157373_10030008 3300013100 Bacteria 3913
301 Ga0157373_10036160 3300013100 Bacteria 3545
302 Ga0157373_10040009 3300013100 Bacteria 3355
303 Ga0157373_10066122 3300013100 Bacteria 2558
304 Ga0157371_10000756 3300013102 Bacteria 37389
305 Ga0157371_10011263 3300013102 Bacteria 6906
306 Ga0157371_10017090 3300013102 Bacteria 5398
307 Ga0157371_10024460 3300013102 Bacteria 4410
308 Ga0157371_10035280 3300013102 Bacteria 3584
309 Ga0157371_10081466 3300013102 Bacteria 2292
310 Ga0157371_10091598 3300013102 Bacteria 2153
311 Ga0157371_10148579 3300013102 Bacteria 1671
312 Ga0157370_10037177 3300013104 Bacteria 4720
313 Ga0157370_10115742 3300013104 Bacteria 2504
314 Ga0157370_10138211 3300013104 Bacteria 2270
315 Ga0157370_10233529 3300013104 Bacteria 1702
316 Ga0157369_10001725 3300013105 Bacteria 26610
317 Ga0157369_10019245 3300013105 Bacteria 7638
318 Ga0157369_10042284 3300013105 Bacteria 4972
319 Ga0157369_10049116 3300013105 Bacteria 4574
320 Ga0157369_10060266 3300013105 Bacteria 4092
321 Ga0157369_10071633 3300013105 Bacteria 3720
322 Ga0157369_10099786 3300013105 Bacteria 3095
323 Ga0157369_10127123 3300013105 Bacteria 2701
324 Ga0157369_10131964 3300013105 Bacteria 2646
325 Ga0157374_10019076 3300013296 Bacteria 6068
326 Ga0157374_10062500 3300013296 Bacteria 3490
327 Ga0157378_10000154 3300013297 Bacteria 64986
328 Ga0157378_10031009 3300013297 Bacteria 4721
329 Ga0157378_10033181 3300013297 Bacteria 4563
330 Ga0163162_10000768 3300013306 Bacteria 29827
331 Ga0163162_10014072 3300013306 Bacteria 7819
332 Ga0163162_10023881 3300013306 Bacteria 6034
333 Ga0163162_10058003 3300013306 Bacteria 3900
334 Ga0157372_10031057 3300013307 Bacteria 5847
335 Ga0157372_10102783 3300013307 Bacteria 3265
336 Ga0157375_10020583 3300013308 Bacteria 6030
337 Ga0157375_10198226 3300013308 Bacteria 2163
338 Ga0163163_10000307 3300014325 Bacteria 48168
339 Ga0163163_10001064 3300014325 Bacteria 23319
340 Ga0163163_10006906 3300014325 Bacteria 9963
341 Ga0163163_10125121 3300014325 Bacteria 2608
342 Ga0157380_10055583 3300014326 Bacteria 3144
343 Ga0157380_10091614 3300014326 Bacteria 2510
344 Ga0157379_10009025 3300014968 Bacteria 8689
345 Ga0157379_10062287 3300014968 Bacteria 3337
346 Ga0157379_10208048 3300014968 Bacteria 1770
347 Ga0157379_10311258 3300014968 Bacteria 1437
348 Ga0157379_10330901 3300014968 Bacteria 1392
349 Ga0206354_10179513 3300020081 Bacteria 4196
350 Ga0206353_11072419 3300020082 Bacteria 2614
351 Ga0213876_10032249 3300021384 Bacteria 2764
352 Ga0209147_100479 3300025229 Bacteria 24363
353 Ga0207697_10000187 3300025315 Bacteria 32396
354 Ga0207656_10001253 3300025321 Bacteria 8367
355 Ga0207656_10006606 3300025321 Bacteria 4184
356 Ga0207682_10000542 3300025893 Bacteria 17400
357 Ga0207682_10004204 3300025893 Bacteria 6081
358 Ga0207710_10020204 3300025900 Bacteria 2846
359 Ga0207688_10000595 3300025901 Bacteria 17763
360 Ga0207688_10009345 3300025901 Bacteria 5344
361 Ga0207688_10124924 3300025901 Bacteria 1504
362 Ga0207680_10001410 3300025903 Bacteria 11373
363 Ga0207680_10002649 3300025903 Bacteria 8366
364 Ga0207647_10000090 3300025904 Bacteria 69395
365 Ga0207647_10000850 3300025904 Bacteria 23703
366 Ga0207647_10003312 3300025904 Bacteria 12101
367 Ga0207647_10012986 3300025904 Bacteria 5785
368 Ga0207647_10019826 3300025904 Bacteria 4516
369 Ga0207647_10054221 3300025904 Bacteria 2467
370 Ga0207647_10061475 3300025904 Bacteria 2292
371 Ga0207699_10115758 3300025906 Bacteria 1725
372 Ga0207645_10000470 3300025907 Bacteria 33310
373 Ga0207645_10020823 3300025907 Bacteria 4285
374 Ga0207645_10034022 3300025907 Bacteria 3274
375 Ga0207645_10046178 3300025907 Bacteria 2783
376 Ga0207645_10062660 3300025907 Bacteria 2376
377 Ga0207643_10022975 3300025908 Bacteria 3437
378 Ga0207705_10000072 3300025909 Bacteria 126043
379 Ga0207705_10003597 3300025909 Bacteria 11806
380 Ga0207705_10004771 3300025909 Bacteria 10210
381 Ga0207705_10010411 3300025909 Bacteria 6760
382 Ga0207705_10016507 3300025909 Bacteria 5290
383 Ga0207705_10020167 3300025909 Bacteria 4769
384 Ga0207705_10023019 3300025909 Bacteria 4443
385 Ga0207705_10027693 3300025909 Bacteria 4043
386 Ga0207705_10036709 3300025909 Bacteria 3506
387 Ga0207705_10077679 3300025909 Bacteria 2415
388 Ga0207695_10014730 3300025913 Bacteria 9246
389 Ga0207695_10234805 3300025913 Bacteria 1737
390 Ga0207671_10063933 3300025914 Bacteria 2735
391 Ga0207660_10000438 3300025917 Bacteria 27496
392 Ga0207660_10000522 3300025917 Bacteria 25663
393 Ga0207660_10001960 3300025917 Bacteria 13720
394 Ga0207660_10074374 3300025917 Bacteria 2480
395 Ga0207657_10000176 3300025919 Bacteria 65856
396 Ga0207657_10002682 3300025919 Bacteria 19192
397 Ga0207657_10002813 3300025919 Bacteria 18715
398 Ga0207657_10003875 3300025919 Bacteria 15879
399 Ga0207657_10005081 3300025919 Bacteria 13794
400 Ga0207657_10007866 3300025919 Bacteria 10882
401 Ga0207657_10008375 3300025919 Bacteria 10500
402 Ga0207657_10011747 3300025919 Bacteria 8674
403 Ga0207657_10015470 3300025919 Bacteria 7390
404 Ga0207657_10018127 3300025919 Bacteria 6735
405 Ga0207657_10020043 3300025919 Bacteria 6334
406 Ga0207657_10024081 3300025919 Bacteria 5651
407 Ga0207657_10042145 3300025919 Bacteria 4030
408 Ga0207657_10059810 3300025919 Bacteria 3272
409 Ga0207657_10077586 3300025919 Bacteria 2799
410 Ga0207657_10089498 3300025919 Bacteria 2571
411 Ga0207657_10129877 3300025919 Bacteria 2066
412 Ga0207649_10000810 3300025920 Bacteria 20093
413 Ga0207649_10004374 3300025920 Bacteria 7667
414 Ga0207649_10011041 3300025920 Bacteria 4970
415 Ga0207649_10027276 3300025920 Bacteria 3350
416 Ga0207649_10059800 3300025920 Bacteria 2392
417 Ga0207649_10104891 3300025920 Bacteria 1878
418 Ga0207649_10112963 3300025920 Bacteria 1818
419 Ga0207652_10003111 3300025921 Bacteria 13832
420 Ga0207652_10172169 3300025921 Bacteria 1943
421 Ga0207681_10002744 3300025923 Bacteria 11146
422 Ga0207681_10004355 3300025923 Bacteria 8731
423 Ga0207681_10026711 3300025923 Bacteria 3727
424 Ga0207681_10027534 3300025923 Bacteria 3676
425 Ga0207681_10041331 3300025923 Bacteria 3073
426 Ga0207681_10049244 3300025923 Bacteria 2847
427 Ga0207681_10095134 3300025923 Bacteria 2136
428 Ga0207694_10118591 3300025924 Bacteria 2111
429 Ga0207650_10007357 3300025925 Bacteria 7494
430 Ga0207650_10016751 3300025925 Bacteria 5125
431 Ga0207650_10045049 3300025925 Bacteria 3245
432 Ga0207650_10057067 3300025925 Bacteria 2903
433 Ga0207650_10072157 3300025925 Bacteria 2598
434 Ga0207650_10108280 3300025925 Bacteria 2148
435 Ga0207650_10129228 3300025925 Bacteria 1975
436 Ga0207650_10165338 3300025925 Bacteria 1755
437 Ga0207687_10001063 3300025927 Bacteria 18628
438 Ga0207687_10012657 3300025927 Bacteria 5512
439 Ga0207664_10018146 3300025929 Bacteria 5171
440 Ga0207664_10075385 3300025929 Bacteria 2727
441 Ga0207664_10106496 3300025929 Bacteria 2325
442 Ga0207664_10134278 3300025929 Bacteria 2086
443 Ga0207664_10163061 3300025929 Bacteria 1902
444 Ga0207644_10000052 3300025931 Bacteria 91473
445 Ga0207644_10000243 3300025931 Bacteria 37412
446 Ga0207644_10000996 3300025931 Bacteria 18076
447 Ga0207644_10004635 3300025931 Bacteria 8941
448 Ga0207644_10057686 3300025931 Bacteria 2804
449 Ga0207644_10131874 3300025931 Bacteria 1914
450 Ga0207644_10276566 3300025931 Bacteria 1347
451 Ga0207690_10000245 3300025932 Bacteria 39464
452 Ga0207690_10001351 3300025932 Bacteria 15395
453 Ga0207690_10002842 3300025932 Bacteria 10446
454 Ga0207690_10005573 3300025932 Bacteria 7437
455 Ga0207690_10010331 3300025932 Bacteria 5542
456 Ga0207690_10048730 3300025932 Bacteria 2819
457 Ga0207690_10060295 3300025932 Bacteria 2574
458 Ga0207690_10073307 3300025932 Bacteria 2367
459 Ga0207690_10077399 3300025932 Bacteria 2312
460 Ga0207690_10138994 3300025932 Bacteria 1787
461 Ga0207690_10163049 3300025932 Bacteria 1663
462 Ga0207690_10226029 3300025932 Bacteria 1434
463 Ga0207706_10000041 3300025933 Bacteria 130090
464 Ga0207706_10001429 3300025933 Bacteria 23905
465 Ga0207706_10002285 3300025933 Bacteria 18695
466 Ga0207706_10003596 3300025933 Bacteria 14803
467 Ga0207706_10007215 3300025933 Bacteria 10277
468 Ga0207706_10020396 3300025933 Bacteria 5959
469 Ga0207706_10039525 3300025933 Bacteria 4183
470 Ga0207706_10049283 3300025933 Bacteria 3722
471 Ga0207706_10062833 3300025933 Bacteria 3270
472 Ga0207706_10086216 3300025933 Bacteria 2760
473 Ga0207706_10088204 3300025933 Bacteria 2727
474 Ga0207706_10136268 3300025933 Bacteria 2160
475 Ga0207706_10159076 3300025933 Bacteria 1986
476 Ga0207706_10159430 3300025933 Bacteria 1984
477 Ga0207669_10003142 3300025937 Bacteria 7123
478 Ga0207669_10028589 3300025937 Bacteria 3069
479 Ga0207704_10028647 3300025938 Bacteria 3093
480 Ga0207691_10000045 3300025940 Bacteria 99798
481 Ga0207691_10010000 3300025940 Bacteria 9107
482 Ga0207691_10013011 3300025940 Bacteria 7967
483 Ga0207691_10016113 3300025940 Bacteria 7100
484 Ga0207691_10023185 3300025940 Bacteria 5845
485 Ga0207691_10026944 3300025940 Bacteria 5392
486 Ga0207691_10028922 3300025940 Bacteria 5186
487 Ga0207691_10052135 3300025940 Bacteria 3737
488 Ga0207691_10287550 3300025940 Bacteria 1414
489 Ga0207711_10000420 3300025941 Bacteria 44798
490 Ga0207711_10001243 3300025941 Bacteria 24174
491 Ga0207711_10001677 3300025941 Bacteria 20395
492 Ga0207711_10002858 3300025941 Bacteria 15138
493 Ga0207711_10003863 3300025941 Bacteria 12888
494 Ga0207711_10011832 3300025941 Bacteria 7250
495 Ga0207711_10020951 3300025941 Bacteria 5458
496 Ga0207711_10063127 3300025941 Bacteria 3197
497 Ga0207711_10069412 3300025941 Bacteria 3055
498 Ga0207711_10109055 3300025941 Bacteria 2460
499 Ga0207689_10000226 3300025942 Bacteria 50110
500 Ga0207689_10032840 3300025942 Bacteria 4314
501 Ga0207689_10033251 3300025942 Bacteria 4285
502 Ga0207689_10038228 3300025942 Bacteria 3977
503 Ga0207689_10246733 3300025942 Bacteria 1476
504 Ga0207661_10000953 3300025944 Bacteria 19059
505 Ga0207661_10005783 3300025944 Bacteria 8719
506 Ga0207661_10069612 3300025944 Bacteria 2869
507 Ga0207679_10000243 3300025945 Bacteria 41706
508 Ga0207679_10004152 3300025945 Bacteria 8997
509 Ga0207679_10008060 3300025945 Bacteria 6698
510 Ga0207679_10008266 3300025945 Bacteria 6627
511 Ga0207679_10015168 3300025945 Bacteria 5083
512 Ga0207679_10023965 3300025945 Bacteria 4180
513 Ga0207679_10034407 3300025945 Bacteria 3574
514 Ga0207679_10067901 3300025945 Bacteria 2676
515 Ga0207679_10078551 3300025945 Bacteria 2514
516 Ga0207679_10125049 3300025945 Bacteria 2054
517 Ga0207679_10125364 3300025945 Bacteria 2051
518 Ga0207667_10006092 3300025949 Bacteria 14659
519 Ga0207667_10012505 3300025949 Bacteria 9771
520 Ga0207667_10030940 3300025949 Bacteria 5784
521 Ga0207667_10063553 3300025949 Bacteria 3857
522 Ga0207667_10067839 3300025949 Bacteria 3715
523 Ga0207651_10000201 3300025960 Bacteria 26086
524 Ga0207651_10004324 3300025960 Bacteria 7134
525 Ga0207651_10076238 3300025960 Bacteria 2396
526 Ga0207651_10097259 3300025960 Bacteria 2173
527 Ga0207651_10173946 3300025960 Bacteria 1701
528 Ga0207712_10009916 3300025961 Bacteria 6038
529 Ga0207712_10026646 3300025961 Bacteria 3854
530 Ga0207668_10000050 3300025972 Bacteria 98767
531 Ga0207668_10039013 3300025972 Bacteria 3193
532 Ga0207668_10195822 3300025972 Bacteria 1605
533 Ga0207640_10001049 3300025981 Bacteria 15289
534 Ga0207640_10006685 3300025981 Bacteria 6335
535 Ga0207640_10021861 3300025981 Bacteria 3819
536 Ga0207640_10048700 3300025981 Bacteria 2741
537 Ga0207640_10053283 3300025981 Bacteria 2640
538 Ga0207658_10008518 3300025986 Bacteria 6977
539 Ga0207658_10008814 3300025986 Bacteria 6848
540 Ga0207658_10013696 3300025986 Bacteria 5546
541 Ga0207658_10054504 3300025986 Bacteria 2959
542 Ga0207658_10066062 3300025986 Bacteria 2719
543 Ga0207658_10074708 3300025986 Bacteria 2576
544 Ga0207677_10000529 3300026023 Bacteria 24143
545 Ga0207677_10003117 3300026023 Bacteria 8747
546 Ga0207677_10036446 3300026023 Bacteria 3206
547 Ga0207677_10045385 3300026023 Bacteria 2935
548 Ga0207703_10002105 3300026035 Bacteria 17519
549 Ga0207703_10015019 3300026035 Bacteria 6044
550 Ga0207703_10037440 3300026035 Bacteria 3864
551 Ga0207703_10041155 3300026035 Bacteria 3700
552 Ga0207639_10000074 3300026041 Bacteria 91671
553 Ga0207639_10000222 3300026041 Bacteria 42464
554 Ga0207639_10006140 3300026041 Bacteria 8157
555 Ga0207639_10013902 3300026041 Bacteria 5646
556 Ga0207639_10052643 3300026041 Bacteria 3103
557 Ga0207678_10004795 3300026067 Bacteria 12143
558 Ga0207678_10017001 3300026067 Bacteria 6386
559 Ga0207678_10020292 3300026067 Bacteria 5831
560 Ga0207678_10050871 3300026067 Bacteria 3578
561 Ga0207678_10071150 3300026067 Bacteria 2982
562 Ga0207678_10162007 3300026067 Bacteria 1910
563 Ga0207678_10168086 3300026067 Bacteria 1873
564 Ga0207702_10000074 3300026078 Bacteria 113070
565 Ga0207702_10033679 3300026078 Bacteria 4280
566 Ga0207702_10036578 3300026078 Bacteria 4107
567 Ga0207702_10039551 3300026078 Bacteria 3952
568 Ga0207702_10047297 3300026078 Bacteria 3625
569 Ga0207702_10120067 3300026078 Bacteria 2351
570 Ga0207702_10139448 3300026078 Bacteria 2192
571 Ga0207702_10182501 3300026078 Bacteria 1933
572 Ga0207641_10000502 3300026088 Bacteria 44127
573 Ga0207641_10006363 3300026088 Bacteria 9971
574 Ga0207641_10027068 3300026088 Bacteria 4734
575 Ga0207641_10046446 3300026088 Bacteria 3660
576 Ga0207648_10002102 3300026089 Bacteria 21704
577 Ga0207648_10002999 3300026089 Bacteria 17838
578 Ga0207648_10008748 3300026089 Bacteria 9757
579 Ga0207648_10016503 3300026089 Bacteria 6744
580 Ga0207676_10000694 3300026095 Bacteria 26554
581 Ga0207676_10001193 3300026095 Bacteria 19504
582 Ga0207676_10009498 3300026095 Bacteria 6923
583 Ga0207676_10012915 3300026095 Bacteria 5998
584 Ga0207676_10134216 3300026095 Bacteria 2109
585 Ga0207674_10000086 3300026116 Bacteria 100722
586 Ga0207674_10000531 3300026116 Bacteria 49979
587 Ga0207674_10002528 3300026116 Bacteria 23055
588 Ga0207674_10002589 3300026116 Bacteria 22783
589 Ga0207674_10004106 3300026116 Bacteria 17638
590 Ga0207674_10006741 3300026116 Bacteria 13483
591 Ga0207674_10006868 3300026116 Bacteria 13343
592 Ga0207674_10031906 3300026116 Bacteria 5530
593 Ga0207674_10057626 3300026116 Bacteria 3938
594 Ga0207674_10070494 3300026116 Bacteria 3514
595 Ga0207674_10338475 3300026116 Bacteria 1455
596 Ga0207683_10028597 3300026121 Bacteria 4821
597 Ga0207683_10044169 3300026121 Bacteria 3895
598 Ga0207683_10067903 3300026121 Bacteria 3146
599 Ga0207683_10084865 3300026121 Bacteria 2815
600 Ga0207683_10092731 3300026121 Bacteria 2691
601 Ga0207683_10123481 3300026121 Bacteria 2326
602 Ga0207698_10000739 3300026142 Bacteria 18966
603 Ga0207698_10000892 3300026142 Bacteria 17333
604 Ga0207698_10003349 3300026142 Bacteria 9648
605 Ga0207698_10005568 3300026142 Bacteria 7788
606 Ga0207698_10013037 3300026142 Bacteria 5469
607 Ga0207698_10021502 3300026142 Bacteria 4464
608 Ga0207698_10096816 3300026142 Bacteria 2433
609 Ga0207698_10128030 3300026142 Bacteria 2164
610 Ga0207698_10294621 3300026142 Bacteria 1507
611 Ga0209974_10018950 3300027876 Bacteria 2282
612 Ga0207428_10184565 3300027907 Bacteria 1574
613 Ga0268266_10001810 3300028379 Bacteria 24195
614 Ga0268266_10004494 3300028379 Bacteria 13330
615 Ga0268266_10005157 3300028379 Bacteria 12305
616 Ga0268266_10041470 3300028379 Bacteria 3928
617 Ga0268266_10047364 3300028379 Bacteria 3682
618 Ga0268265_10014335 3300028380 Bacteria 5398
619 Ga0268265_10016185 3300028380 Bacteria 5119
620 Ga0268265_10016776 3300028380 Bacteria 5040
621 Ga0268265_10031403 3300028380 Bacteria 3836
622 Ga0268265_10072162 3300028380 Bacteria 2692
623 Ga0268265_10157648 3300028380 Bacteria 1923
624 Ga0268265_10289618 3300028380 Bacteria 1469
625 Ga0268264_10000410 3300028381 Bacteria 60680
626 Ga0268264_10000418 3300028381 Bacteria 59942
627 Ga0268264_10021320 3300028381 Bacteria 5291
628 Ga0268264_10067611 3300028381 Bacteria 3016
629 Ga0268264_10097514 3300028381 Bacteria 2548
630 Ga0268264_10158922 3300028381 Bacteria 2034
631 Ga0268264_10165034 3300028381 Bacteria 1998
632 Ga0307408_100004452 3300031548 Bacteria 9514
633 Ga0307408_100068309 3300031548 Bacteria 2617
634 Ga0307408_100071226 3300031548 Bacteria 2570
635 Ga0307405_10000240 3300031731 Bacteria 19933
636 Ga0307405_10004019 3300031731 Bacteria 6900
637 Ga0307405_10019782 3300031731 Bacteria 3749
638 Ga0307405_10025754 3300031731 Bacteria 3382
639 Ga0307405_10068883 3300031731 Bacteria 2266
640 Ga0307405_10153301 3300031731 Bacteria 1623
641 Ga0307413_10002654 3300031824 Bacteria 7323
642 Ga0307413_10003433 3300031824 Bacteria 6664
643 Ga0307413_10156648 3300031824 Bacteria 1594
644 Ga0307410_10001596 3300031852 Bacteria 10400
645 Ga0307410_10005046 3300031852 Bacteria 6936
646 Ga0307410_10019296 3300031852 Bacteria 4143
647 Ga0307410_10022266 3300031852 Bacteria 3913
648 Ga0307410_10022617 3300031852 Bacteria 3890
649 Ga0307410_10031327 3300031852 Bacteria 3411
650 Ga0307410_10034961 3300031852 Bacteria 3259
651 Ga0307410_10095027 3300031852 Bacteria 2124
652 Ga0307410_10107552 3300031852 Bacteria 2012
653 Ga0307410_10217312 3300031852 Bacteria 1468
654 Ga0307406_10009950 3300031901 Bacteria 5350
655 Ga0307406_10050593 3300031901 Bacteria 2635
656 Ga0307407_10012141 3300031903 Bacteria 4130
657 Ga0307407_10053853 3300031903 Bacteria 2317
658 Ga0307407_10080377 3300031903 Bacteria 1969
659 Ga0307412_10033278 3300031911 Bacteria 3275
660 Ga0307412_10079479 3300031911 Bacteria 2262
661 Ga0307412_10092624 3300031911 Bacteria 2118
662 Ga0307409_100009484 3300031995 Bacteria 5982
663 Ga0307409_100011467 3300031995 Bacteria 5592
664 Ga0307409_100025333 3300031995 Bacteria 4158
665 Ga0307409_100030714 3300031995 Bacteria 3865
666 Ga0307409_100046276 3300031995 Bacteria 3292
667 Ga0307409_100047390 3300031995 Bacteria 3261
668 Ga0307409_100117737 3300031995 Bacteria 2242
669 Ga0307409_100137884 3300031995 Bacteria 2097
670 Ga0307409_100184753 3300031995 Bacteria 1849
671 Ga0307416_100001974 3300032002 Bacteria 11501
672 Ga0307416_100003230 3300032002 Bacteria 9550
673 Ga0307416_100014929 3300032002 Bacteria 5344
674 Ga0307416_100029232 3300032002 Bacteria 4113
675 Ga0307416_100079674 3300032002 Bacteria 2761
676 Ga0307416_100142943 3300032002 Bacteria 2178
677 Ga0307416_100183898 3300032002 Bacteria 1962
678 Ga0307416_100201445 3300032002 Bacteria 1889
679 Ga0307416_100205419 3300032002 Bacteria 1873
680 Ga0307416_100365269 3300032002 Bacteria 1467
681 Ga0307414_10002750 3300032004 Bacteria 9260
682 Ga0307414_10004382 3300032004 Bacteria 7664
683 Ga0307414_10006719 3300032004 Bacteria 6436
684 Ga0307414_10020483 3300032004 Bacteria 4123
685 Ga0307414_10051521 3300032004 Bacteria 2858
686 Ga0307414_10070129 3300032004 Bacteria 2523
687 Ga0307414_10096343 3300032004 Bacteria 2213
688 Ga0307411_10000656 3300032005 Bacteria 12607
689 Ga0307411_10009146 3300032005 Bacteria 5187
690 Ga0307411_10016425 3300032005 Bacteria 4188
691 Ga0307411_10018606 3300032005 Bacteria 3990
692 Ga0307411_10027393 3300032005 Bacteria 3447
693 Ga0307411_10032660 3300032005 Bacteria 3218
694 Ga0307411_10073441 3300032005 Bacteria 2327
695 Ga0307415_100000898 3300032126 Bacteria 13619
696 Ga0307415_100003980 3300032126 Bacteria 7604
697 Ga0307415_100016712 3300032126 Bacteria 4381
698 Ga0307415_100035303 3300032126 Bacteria 3265
699 Ga0307415_100085376 3300032126 Bacteria 2268
700 Ga0307415_100146846 3300032126 Bacteria 1809
701 Ga0307415_100218855 3300032126 Bacteria 1525
702 Ga0373938_0006502 3300034957 Bacteria 2021
703 Ga0373931_0005016 3300035691 Bacteria 6089
704 Ga0373937_0030959 3300036401 Bacteria 4845
705 Ga0395899_0000302 3300037312 Bacteria 63367
706 Ga0395899_0002732 3300037312 Bacteria 14223
707 Ga0395899_0006423 3300037312 Bacteria 9109
708 Ga0395899_0016118 3300037312 Bacteria 5697
709 Ga0395899_0017806 3300037312 Bacteria 5409
710 Ga0395899_0032366 3300037312 Bacteria 3927
711 Ga0395899_0101310 3300037312 Bacteria 2079
712 Ga0395899_0155691 3300037312 Bacteria 1617
713 Ga0395900_0000997 3300037418 Bacteria 36770
714 Ga0395900_0002684 3300037418 Bacteria 19451
715 Ga0395900_0002957 3300037418 Bacteria 18497
716 Ga0395900_0005624 3300037418 Bacteria 13109
717 Ga0395900_0011036 3300037418 Bacteria 9232
718 Ga0395900_0012743 3300037418 Bacteria 8593
719 Ga0395900_0017664 3300037418 Bacteria 7280
720 Ga0395900_0047146 3300037418 Bacteria 4437
721 Ga0395900_0051521 3300037418 Bacteria 4239
722 Ga0395900_0051661 3300037418 Bacteria 4233
723 Ga0395900_0089574 3300037418 Bacteria 3162
724 Ga0395900_0104726 3300037418 Bacteria 2906
725 Ga0395900_0105296 3300037418 Bacteria 2898
726 Ga0395900_0107014 3300037418 Bacteria 2873
727 Ga0395900_0149419 3300037418 Bacteria 2387
728 Ga0395900_0256429 3300037418 Bacteria 1748
729 Ga0395900_0289726 3300037418 Bacteria 1626
730 Ga0395900_0327148 3300037418 Bacteria 1511
731 Ga0395898_0000054 3300037466 Bacteria 279561
732 Ga0395898_0001674 3300037466 Bacteria 29720
733 Ga0395898_0003637 3300037466 Bacteria 17137
734 Ga0395898_0005758 3300037466 Bacteria 13337
735 Ga0395898_0010562 3300037466 Bacteria 9643
736 Ga0395898_0049338 3300037466 Bacteria 4124
737 Ga0395898_0051691 3300037466 Bacteria 4017
738 Ga0395898_0081030 3300037466 Bacteria 3130
739 Ga0395898_0094178 3300037466 Bacteria 2878
740 Ga0395898_0210265 3300037466 Bacteria 1856
741 Ga0395898_0279848 3300037466 Bacteria 1591
742 Ga0395898_0306838 3300037466 Bacteria 1514
743 Ga0395905_0000046 3300037471 Bacteria 240463
744 Ga0395905_0000226 3300037471 Bacteria 85938
745 Ga0395905_0001164 3300037471 Bacteria 32823
746 Ga0395905_0002780 3300037471 Bacteria 19161
747 Ga0395905_0003670 3300037471 Bacteria 16275
748 Ga0395905_0004090 3300037471 Bacteria 15281
749 Ga0395905_0004740 3300037471 Bacteria 14051
750 Ga0395905_0010087 3300037471 Bacteria 9207
751 Ga0395905_0014783 3300037471 Bacteria 7442
752 Ga0395905_0017301 3300037471 Bacteria 6846
753 Ga0395905_0025080 3300037471 Bacteria 5623
754 Ga0395905_0031707 3300037471 Bacteria 4973
755 Ga0395905_0035069 3300037471 Bacteria 4710
756 Ga0395905_0035158 3300037471 Bacteria 4704
757 Ga0395905_0055100 3300037471 Bacteria 3722
758 Ga0395905_0075621 3300037471 Bacteria 3156
759 Ga0395905_0076846 3300037471 Bacteria 3129
760 Ga0395905_0080875 3300037471 Bacteria 3045
761 Ga0395905_0092447 3300037471 Bacteria 2837
762 Ga0395905_0101738 3300037471 Bacteria 2697
763 Ga0395905_0143256 3300037471 Bacteria 2248
764 Ga0395905_0164049 3300037471 Bacteria 2088
765 Ga0395905_0175787 3300037471 Bacteria 2010
766 Ga0395905_0265055 3300037471 Bacteria 1603
767 Ga0395905_0282963 3300037471 Bacteria 1544
768 Ga0395901_0000086 3300038443 Bacteria 125359
769 Ga0395901_0000516 3300038443 Bacteria 44694
770 Ga0395901_0002142 3300038443 Bacteria 20180
771 Ga0395901_0002161 3300038443 Bacteria 20073
772 Ga0395901_0003908 3300038443 Bacteria 14995
773 Ga0395901_0007579 3300038443 Bacteria 10963
774 Ga0395901_0012496 3300038443 Bacteria 8617
775 Ga0395901_0016592 3300038443 Bacteria 7505
776 Ga0395901_0018539 3300038443 Bacteria 7105
777 Ga0395901_0027652 3300038443 Bacteria 5829
778 Ga0395901_0046720 3300038443 Bacteria 4498
779 Ga0395901_0061759 3300038443 Bacteria 3899
780 Ga0395901_0062494 3300038443 Bacteria 3875
781 Ga0395901_0096413 3300038443 Bacteria 3099
782 Ga0395901_0124867 3300038443 Bacteria 2704
783 Ga0395901_0135353 3300038443 Bacteria 2590
784 Ga0395901_0135865 3300038443 Bacteria 2584
785 Ga0395901_0155812 3300038443 Bacteria 2399
786 Ga0395901_0166724 3300038443 Bacteria 2312
787 Ga0395901_0206503 3300038443 Bacteria 2057
788 Ga0395901_0209214 3300038443 Bacteria 2042
789 Ga0395901_0218821 3300038443 Bacteria 1991
790 Ga0436365_1575011 3300039437 Bacteria 17698
791 Ga0439445_0003273 3300042004 Bacteria 3635
792 Ga0439445_0006896 3300042004 Bacteria 2623
793 Ga0439448_0000627 3300042005 Bacteria 8335
794 Ga0439432_006474 3300042006 Bacteria 4180
795 Ga0439449_0010549 3300042007 Bacteria 3492
796 Ga0450920_011865 3300042122 Bacteria 1629
797 Ga0450889_000026 3300042144 Bacteria 12524
798 Ga0439458_0000006 3300042157 Bacteria 32402
799 Ga0439458_0000616 3300042157 Bacteria 9192
800 Ga0439464_0000987 3300042439 Bacteria 6461
801 Ga0466969_0083052 3300044656 Bacteria 1526
802 Ga0466965_0112191 3300044683 Bacteria 1402
803 Ga0466961_0078365 3300044693 Bacteria 2093
804 Ga0466963_0005313 3300044694 Bacteria 7529
805 Ga0466963_0017251 3300044694 Bacteria 4498
806 Ga0466963_0019822 3300044694 Bacteria 4223
807 Ga0466963_0043986 3300044694 Bacteria 2938
808 Ga0466963_0093648 3300044694 Bacteria 2048
809 Ga0466963_0129034 3300044694 Bacteria 1745
810 Ga0466964_0014906 3300044706 Bacteria 2960
811 Ga0466957_0006177 3300044842 Bacteria 6764
812 Ga0466958_0003422 3300045836 Bacteria 8232
813 Ga0466958_0080974 3300045836 Bacteria 1998
814 Ga0466967_0002800 3300045976 Bacteria 11059
815 Ga0466967_0042416 3300045976 Bacteria 3931
816 Ga0466967_0078587 3300045976 Bacteria 2972
817 Ga0466967_0094188 3300045976 Bacteria 2727
818 Ga0466967_0134941 3300045976 Bacteria 2294
819 Ga0466967_0263330 3300045976 Bacteria 1650
820 Ga0466967_0271798 3300045976 Bacteria 1624
821 Ga0466967_0279869 3300045976 Bacteria 1600
822 Ga0466967_0375552 3300045976 Bacteria 1379
823 Ga0495617_003366 3300046452 Bacteria 6028
824 Ga0495627_000024 3300046453 Bacteria 250480
825 Ga0495627_011988 3300046453 Bacteria 3088
826 Ga0495584_0019967 3300046491 Bacteria 3404
827 Ga0495610_0000053 3300046512 Bacteria 142545
828 Ga0495610_0038364 3300046512 Bacteria 2432
829 Ga0495632_0000076 3300046519 Bacteria 101121
830 Ga0495632_0017315 3300046519 Bacteria 3982
831 Ga0495637_0000219 3300046520 Bacteria 44013
832 Ga0495637_0002782 3300046520 Bacteria 9488
833 Ga0495643_0000009 3300046522 Bacteria 344767
834 Ga0495648_0016089 3300046524 Bacteria 5398
835 Ga0495663_0000023 3300046525 Bacteria 105104
836 Ga0495642_0012290 3300046528 Bacteria 3300
837 Ga0495633_0000190 3300046558 Bacteria 79967
838 Ga0495633_0000397 3300046558 Bacteria 45712
839 Ga0495633_0010756 3300046558 Bacteria 4976
840 Ga0495633_0064509 3300046558 Bacteria 1712
841 Ga0495668_0007775 3300046616 Bacteria 6797
842 Ga0495668_0025770 3300046616 Bacteria 3339
843 Ga0495669_0000089 3300046684 Bacteria 60373
844 Ga0495669_0001170 3300046684 Bacteria 10906
845 Ga0495669_0002980 3300046684 Bacteria 6958
846 Ga0495669_0006331 3300046684 Bacteria 4945
847 Ga0495669_0037351 3300046684 Bacteria 2149
848 Ga0495669_0041035 3300046684 Bacteria 2054
849 Ga0495671_0000013 3300046692 Bacteria 344767
850 Ga0495671_0015883 3300046692 Bacteria 4030
851 Ga0495681_0000015 3300047470 Bacteria 183538
852 Ga0495686_0016172 3300047472 Bacteria 5067
853 Ga0495686_0048010 3300047472 Bacteria 2694
854 Ga0496100_0022281 3300048903 Bacteria 3832
855 Ga0496100_0055664 3300048903 Bacteria 2585
856 Ga0496101_0000256 3300048904 Bacteria 37912
857 Ga0496101_0088028 3300048904 Bacteria 2306
858 Ga0496101_0199092 3300048904 Bacteria 1548
859 Ga0496102_0066653 3300048905 Bacteria 3300
860 Ga0496102_0146074 3300048905 Bacteria 2220
861 Ga0496103_0013742 3300048906 Bacteria 4805
862 Ga0496104_0022966 3300048907 Bacteria 5733
863 Ga0496106_0011259 3300048909 Bacteria 6620
864 Ga0496106_0078849 3300048909 Bacteria 2528
865 Ga0496107_0009349 3300048910 Bacteria 6794
866 Ga0496107_0044572 3300048910 Bacteria 3189
867 Ga0496107_0055370 3300048910 Bacteria 2864
868 Ga0496107_0092695 3300048910 Bacteria 2209
869 Ga0496108_0000673 3300048911 Bacteria 26408
870 Ga0496108_0001159 3300048911 Bacteria 20578
871 Ga0496108_0027555 3300048911 Bacteria 4693
872 Ga0496108_0176312 3300048911 Bacteria 1850
873 Ga0496108_0256897 3300048911 Bacteria 1520
874 Ga0496109_0000610 3300048912 Bacteria 29899
875 Ga0496109_0000775 3300048912 Bacteria 26550
876 Ga0496109_0022187 3300048912 Bacteria 5620
877 Ga0496109_0076127 3300048912 Bacteria 3086
878 Ga0496110_0001683 3300048913 Bacteria 16224
879 Ga0496110_0005805 3300048913 Bacteria 9702
880 Ga0496110_0012933 3300048913 Bacteria 6882
881 Ga0496110_0015197 3300048913 Bacteria 6404
882 Ga0496110_0026654 3300048913 Bacteria 4948
883 Ga0496111_0000247 3300048914 Bacteria 25998
884 Ga0496111_0068779 3300048914 Bacteria 2574
885 Ga0496111_0162363 3300048914 Bacteria 1659
886 Ga0496112_0000369 3300048915 Bacteria 29388
887 Ga0496112_0004014 3300048915 Bacteria 12339
888 Ga0496112_0017268 3300048915 Bacteria 6775
889 Ga0496112_0019860 3300048915 Bacteria 6357
890 Ga0496112_0073509 3300048915 Bacteria 3380
891 Ga0496112_0104900 3300048915 Bacteria 2796
892 Ga0496112_0138612 3300048915 Bacteria 2402
893 Ga0496112_0267583 3300048915 Bacteria 1658
894 Ga0496113_0000242 3300048916 Bacteria 25756
895 Ga0496113_0000952 3300048916 Bacteria 15412
896 Ga0496113_0002337 3300048916 Bacteria 10968
897 Ga0496113_0043374 3300048916 Bacteria 3328
898 Ga0496113_0076728 3300048916 Bacteria 2553
899 Ga0496114_0000016 3300048917 Bacteria 274656
900 Ga0496114_0045920 3300048917 Bacteria 3629
901 Ga0496114_0064680 3300048917 Bacteria 3063
902 Ga0496114_0070248 3300048917 Bacteria 2941
903 Ga0496115_0002137 3300048918 Bacteria 14132
904 Ga0496115_0032897 3300048918 Bacteria 4093
905 Ga0496124_0143824 3300048927 Bacteria 1879
906 Ga0495678_026911 3300049459 Bacteria 2447
907 Ga0501068_0048562 3300049584 Bacteria 2563
908 Ga0501069_0091265 3300049585 Bacteria 1723
909 Ga0501080_0125756 3300049742 Bacteria 2375
910 nmdc:mga09592_47337_c1 3300050508 Bacteria 3624
911 nmdc:mga06r32_17134_c1 3300050510 Bacteria 6613
912 nmdc:mga08y16_11359_c1 3300050511 Bacteria 9357
913 Ga0500594_0000879 3300053118 Bacteria 6437
914 Ga0500658_0000105 3300053134 Bacteria 38951
915 Ga0466962_0012045 3300061719 Bacteria 4160
916 Ga0466962_0036357 3300061719 Bacteria 2357
917 2512644477 2512564014 Bacteria 4639632
918 2919709485 2919709256 Bacteria 4318106
919 JGI24740J21852_10006304
920 JGI24740J21852_10000089
921 JGI24740J21852_10006169
922 JGI24739J22299_10000097
923 JGI24739J22299_10000510
924 JGI24739J22299_10002839
925 JGI24739J22299_10008448
926 JGI24739J22299_10013584
927 JGI24739J22299_10020380
928 JGI24737J22298_10000037
929 JGI24737J22298_10000930
930 JGI24737J22298_10002268
931 JGI24737J22298_10024358
932 JGI24737J22298_10032738
933 JGI24735J21928_10006140
934 JGI24735J21928_10015026
935 JGI24738J21930_10000023
936 JGI24744J21845_10001585
937 Ga0070658_10013086
938 Ga0070658_10030124
939 Ga0070658_10041747
940 Ga0070658_10084357
941 Ga0070658_10128082
942 Ga0070676_10001215
943 Ga0070676_10015404
944 Ga0070676_10016027
945 Ga0070683_100101781
946 Ga0070683_100126397
947 Ga0070683_100153466
948 Ga0070690_100060744
949 Ga0070670_100003109
950 Ga0070670_100003400
951 Ga0070670_100013225
952 Ga0070670_100019277
953 Ga0070670_100049493
954 Ga0070670_100094360
955 Ga0070670_100145947
956 Ga0070670_100194280
957 Ga0070677_10002149
958 Ga0070677_10011735
959 Ga0068869_100002765
960 Ga0070666_10000779
961 Ga0070666_10004292
962 Ga0070666_10016691
963 Ga0070666_10045105
964 Ga0070666_10059795
965 Ga0070680_100000683
966 Ga0070680_100005956
967 Ga0070682_100022704
968 Ga0070682_100037625
969 Ga0068868_100000259
970 Ga0068868_100015245
971 Ga0070660_100002456
972 Ga0070660_100010742
973 Ga0070660_100048545
974 Ga0070660_100059145
975 Ga0070660_100077842
976 Ga0070660_100098870
977 Ga0070660_100100038
978 Ga0070689_100028985
979 Ga0070661_100000187
980 Ga0070661_100022566
981 Ga0070661_100037714
982 Ga0070661_100053706
983 Ga0070661_100065878
984 Ga0070661_100067473
985 Ga0070661_100101598
986 Ga0070661_100104672
987 Ga0070661_100129845
988 Ga0070661_100144504
989 Ga0070692_10005107
990 Ga0070692_10062598
991 Ga0070668_100001011
992 Ga0070668_100197675
993 Ga0070669_100000174
994 Ga0070669_100016812
995 Ga0070669_100032524
996 Ga0070669_100080852
997 Ga0070669_100122251
998 Ga0070675_100002370
999 Ga0070675_100005311
1000 Ga0070675_100023558
1001 Ga0070671_100000051
1002 Ga0070671_100007591
1003 Ga0070671_100029886
1004 Ga0070671_100139013
1005 Ga0070674_100011997
1006 Ga0070674_100014374
1007 Ga0070674_100026956
1008 Ga0070674_100054822
1009 Ga0070674_100054931
1010 Ga0070673_100000337
1011 Ga0070673_100003346
1012 Ga0070673_100005138
1013 Ga0070673_100007992
1014 Ga0070673_100011602
1015 Ga0070673_100011732
1016 Ga0070673_100030159
1017 Ga0070659_100000191
1018 Ga0070659_100000674
1019 Ga0070659_100001559
1020 Ga0070659_100003926
1021 Ga0070659_100024740
1022 Ga0070659_100061929
1023 Ga0070659_100068906
1024 Ga0070659_100071425
1025 Ga0070659_100087728
1026 Ga0070667_100002108
1027 Ga0070667_100003559
1028 Ga0070667_100006890
1029 Ga0070667_100011927
1030 Ga0070667_100019048
1031 Ga0070667_100056394
1032 Ga0070667_100058351
1033 Ga0070667_100065494
1034 Ga0070667_100167725
1035 Ga0070667_100176266
1036 Ga0070714_100012808
1037 Ga0070714_100030038
1038 Ga0070714_100207450
1039 Ga0070713_100032969
1040 Ga0070713_100150447
1041 Ga0070694_100005641
1042 Ga0070663_100000754
1043 Ga0070663_100005688
1044 Ga0070663_100045617
1045 Ga0070663_100062643
1046 Ga0070663_100077876
1047 Ga0070663_100175873
1048 Ga0070678_100001121
1049 Ga0070662_100000012
1050 Ga0070662_100001658
1051 Ga0070662_100004959
1052 Ga0070662_100008261
1053 Ga0070662_100044464
1054 Ga0070662_100058911
1055 Ga0070662_100061068
1056 Ga0070662_100101962
1057 Ga0070662_100127982
1058 Ga0070681_10095326
1059 Ga0068867_100004031
1060 Ga0068867_100006572
1061 Ga0068867_100016133
1062 Ga0068867_100022766
1063 Ga0070679_100193151
1064 Ga0070679_100213501
1065 Ga0070684_100003278
1066 Ga0070684_100009174
1067 Ga0070684_100021129
1068 Ga0070684_100061789
1069 Ga0068853_100000032
1070 Ga0068853_100000811
1071 Ga0068853_100023014
1072 Ga0068853_100025405
1073 Ga0068853_100050345
1074 Ga0068853_100057859
1075 Ga0068853_100067619
1076 Ga0068853_100130701
1077 Ga0068853_100138960
1078 Ga0068853_100179786
1079 Ga0070672_100000945
1080 Ga0070672_100015335
1081 Ga0070672_100020977
1082 Ga0070672_100057134
1083 Ga0070686_100050166
1084 Ga0070696_100009397
1085 Ga0070696_100022125
1086 Ga0070693_100000332
1087 Ga0070693_100022677
1088 Ga0070693_100124508
1089 Ga0070665_100003604
1090 Ga0070665_100021059
1091 Ga0070665_100031747
1092 Ga0070665_100034781
1093 Ga0070665_100044349
1094 Ga0070665_100222921
1095 Ga0068855_100000591
1096 Ga0068855_100003900
1097 Ga0068855_100032731
1098 Ga0068855_100034640
1099 Ga0068855_100058967
1100 Ga0068855_100134864
1101 Ga0070664_100000187
1102 Ga0070664_100001469
1103 Ga0070664_100005323
1104 Ga0070664_100006520
1105 Ga0070664_100015366
1106 Ga0070664_100020615
1107 Ga0070664_100056593
1108 Ga0070664_100283300
1109 Ga0068857_100004021
1110 Ga0068857_100006668
1111 Ga0068857_100008116
1112 Ga0068857_100012300
1113 Ga0068857_100039164
1114 Ga0068857_100058302
1115 Ga0068854_100003701
1116 Ga0068854_100009237
1117 Ga0068854_100016964
1118 Ga0068854_100141518
1119 Ga0068854_100178955
1120 Ga0068854_100187076
1121 Ga0068856_100000291
1122 Ga0068856_100013426
1123 Ga0068852_100000906
1124 Ga0068852_100000992
1125 Ga0068852_100001448
1126 Ga0068852_100032401
1127 Ga0068852_100073062
1128 Ga0068852_100078193
1129 Ga0068852_100262857
1130 Ga0068859_100000104
1131 Ga0068859_100002786
1132 Ga0068859_100106974
1133 Ga0068864_100001558
1134 Ga0068864_100002633
1135 Ga0068864_100003198
1136 Ga0068864_100023399
1137 Ga0068864_100027341
1138 Ga0068864_100095184
1139 Ga0068866_10009481
1140 Ga0068861_100145653
1141 Ga0068851_10017422
1142 Ga0068863_100001970
1143 Ga0068863_100002317
1144 Ga0068863_100004174
1145 Ga0068863_100011841
1146 Ga0068863_100025271
1147 Ga0068863_100109773
1148 Ga0068863_100111507
1149 Ga0068858_100000620
1150 Ga0068858_100000655
1151 Ga0068858_100019464
1152 Ga0068858_100019548
1153 Ga0068858_100088363
1154 Ga0068858_100094676
1155 Ga0068858_100320682
1156 Ga0068860_100003524
1157 Ga0068860_100012707
1158 Ga0068860_100013576
1159 Ga0068860_100052681
1160 Ga0068860_100072430
1161 Ga0068860_100195285
1162 Ga0068860_100279796
1163 Ga0068862_100018353
1164 Ga0068862_100030744
1165 Ga0068862_100045476
1166 Ga0068862_100087891
1167 Ga0068862_100095436
1168 Ga0081539_10021962
1169 Ga0097621_100001388
1170 Ga0097621_100009124
1171 Ga0097621_100125899
1172 Ga0068871_100002654
1173 Ga0068871_100007505
1174 Ga0068871_100148182
1175 Ga0075428_100227991
1176 Ga0075431_100010494
1177 Ga0075429_100209751
1178 Ga0068865_100001550
1179 Ga0068865_100015551
1180 Ga0097620_100000104
1181 Ga0097620_100002786
1182 Ga0097620_100106979
1183 Ga0105240_10048201
1184 Ga0105240_10064113
1185 Ga0105240_10168840
1186 Ga0111539_10014979
1187 Ga0105245_10000229
1188 Ga0105245_10019606
1189 Ga0105245_10023282
1190 Ga0105245_10230738
1191 Ga0105243_10008878
1192 Ga0105243_10017247
1193 Ga0105241_10047772
1194 Ga0105241_10186897
1195 Ga0105242_10024170
1196 Ga0105248_10000083
1197 Ga0105248_10000790
1198 Ga0105248_10002811
1199 Ga0105248_10003127
1200 Ga0105248_10007296
1201 Ga0105248_10023083
1202 Ga0105248_10037899
1203 Ga0105248_10052041
1204 Ga0105248_10070165
1205 Ga0105248_10097313
1206 Ga0105248_10119412
1207 Ga0105248_10220789
1208 Ga0105248_10460116
1209 Ga0105238_10024793
1210 Ga0105238_10049820
1211 Ga0105249_10029817
1212 Ga0105249_10061411
1213 Ga0105239_10052783
1214 Ga0105239_10168916
1215 Ga0105239_10224192
1216 Ga0105246_10006237
1217 Ga0105246_10133612
1218 Ga0157373_10030008
1219 Ga0157373_10036160
1220 Ga0157373_10040009
1221 Ga0157373_10066122
1222 Ga0157371_10000756
1223 Ga0157371_10011263
1224 Ga0157371_10017090
1225 Ga0157371_10024460
1226 Ga0157371_10035280
1227 Ga0157371_10081466
1228 Ga0157371_10091598
1229 Ga0157371_10148579
1230 Ga0157370_10037177
1231 Ga0157370_10115742
1232 Ga0157370_10138211
1233 Ga0157370_10233529
1234 Ga0157369_10001725
1235 Ga0157369_10019245
1236 Ga0157369_10042284
1237 Ga0157369_10049116
1238 Ga0157369_10060266
1239 Ga0157369_10071633
1240 Ga0157369_10099786
1241 Ga0157369_10127123
1242 Ga0157369_10131964
1243 Ga0157374_10019076
1244 Ga0157374_10062500
1245 Ga0157378_10000154
1246 Ga0157378_10031009
1247 Ga0157378_10033181
1248 Ga0163162_10000768
1249 Ga0163162_10014072
1250 Ga0163162_10023881
1251 Ga0163162_10058003
1252 Ga0157372_10031057
1253 Ga0157372_10102783
1254 Ga0157375_10020583
1255 Ga0157375_10198226
1256 Ga0163163_10000307
1257 Ga0163163_10001064
1258 Ga0163163_10006906
1259 Ga0163163_10125121
1260 Ga0157380_10055583
1261 Ga0157380_10091614
1262 Ga0157379_10009025
1263 Ga0157379_10062287
1264 Ga0157379_10208048
1265 Ga0157379_10311258
1266 Ga0157379_10330901
1267 Ga0206354_10179513
1268 Ga0206353_11072419
1269 Ga0213876_10032249
1270 Ga0209147_100479
1271 Ga0207697_10000187
1272 Ga0207656_10001253
1273 Ga0207656_10006606
1274 Ga0207682_10000542
1275 Ga0207682_10004204
1276 Ga0207710_10020204
1277 Ga0207688_10000595
1278 Ga0207688_10009345
1279 Ga0207688_10124924
1280 Ga0207680_10001410
1281 Ga0207680_10002649
1282 Ga0207647_10000090
1283 Ga0207647_10000850
1284 Ga0207647_10003312
1285 Ga0207647_10012986
1286 Ga0207647_10019826
1287 Ga0207647_10054221
1288 Ga0207647_10061475
1289 Ga0207699_10115758
1290 Ga0207645_10000470
1291 Ga0207645_10020823
1292 Ga0207645_10034022
1293 Ga0207645_10046178
1294 Ga0207645_10062660
1295 Ga0207643_10022975
1296 Ga0207705_10000072
1297 Ga0207705_10003597
1298 Ga0207705_10004771
1299 Ga0207705_10010411
1300 Ga0207705_10016507
1301 Ga0207705_10020167
1302 Ga0207705_10023019
1303 Ga0207705_10027693
1304 Ga0207705_10036709
1305 Ga0207705_10077679
1306 Ga0207695_10014730
1307 Ga0207695_10234805
1308 Ga0207671_10063933
1309 Ga0207660_10000438
1310 Ga0207660_10000522
1311 Ga0207660_10001960
1312 Ga0207660_10074374
1313 Ga0207657_10000176
1314 Ga0207657_10002682
1315 Ga0207657_10002813
1316 Ga0207657_10003875
1317 Ga0207657_10005081
1318 Ga0207657_10007866
1319 Ga0207657_10008375
1320 Ga0207657_10011747
1321 Ga0207657_10015470
1322 Ga0207657_10018127
1323 Ga0207657_10020043
1324 Ga0207657_10024081
1325 Ga0207657_10042145
1326 Ga0207657_10059810
1327 Ga0207657_10077586
1328 Ga0207657_10089498
1329 Ga0207657_10129877
1330 Ga0207649_10000810
1331 Ga0207649_10004374
1332 Ga0207649_10011041
1333 Ga0207649_10027276
1334 Ga0207649_10059800
1335 Ga0207649_10104891
1336 Ga0207649_10112963
1337 Ga0207652_10003111
1338 Ga0207652_10172169
1339 Ga0207681_10002744
1340 Ga0207681_10004355
1341 Ga0207681_10026711
1342 Ga0207681_10027534
1343 Ga0207681_10041331
1344 Ga0207681_10049244
1345 Ga0207681_10095134
1346 Ga0207694_10118591
1347 Ga0207650_10007357
1348 Ga0207650_10016751
1349 Ga0207650_10045049
1350 Ga0207650_10057067
1351 Ga0207650_10072157
1352 Ga0207650_10108280
1353 Ga0207650_10129228
1354 Ga0207650_10165338
1355 Ga0207687_10001063
1356 Ga0207687_10012657
1357 Ga0207664_10018146
1358 Ga0207664_10075385
1359 Ga0207664_10106496
1360 Ga0207664_10134278
1361 Ga0207664_10163061
1362 Ga0207644_10000052
1363 Ga0207644_10000243
1364 Ga0207644_10000996
1365 Ga0207644_10004635
1366 Ga0207644_10057686
1367 Ga0207644_10131874
1368 Ga0207644_10276566
1369 Ga0207690_10000245
1370 Ga0207690_10001351
1371 Ga0207690_10002842
1372 Ga0207690_10005573
1373 Ga0207690_10010331
1374 Ga0207690_10048730
1375 Ga0207690_10060295
1376 Ga0207690_10073307
1377 Ga0207690_10077399
1378 Ga0207690_10138994
1379 Ga0207690_10163049
1380 Ga0207690_10226029
1381 Ga0207706_10000041
1382 Ga0207706_10001429
1383 Ga0207706_10002285
1384 Ga0207706_10003596
1385 Ga0207706_10007215
1386 Ga0207706_10020396
1387 Ga0207706_10039525
1388 Ga0207706_10049283
1389 Ga0207706_10062833
1390 Ga0207706_10086216
1391 Ga0207706_10088204
1392 Ga0207706_10136268
1393 Ga0207706_10159076
1394 Ga0207706_10159430
1395 Ga0207669_10003142
1396 Ga0207669_10028589
1397 Ga0207704_10028647
1398 Ga0207691_10000045
1399 Ga0207691_10010000
1400 Ga0207691_10013011
1401 Ga0207691_10016113
1402 Ga0207691_10023185
1403 Ga0207691_10026944
1404 Ga0207691_10028922
1405 Ga0207691_10052135
1406 Ga0207691_10287550
1407 Ga0207711_10000420
1408 Ga0207711_10001243
1409 Ga0207711_10001677
1410 Ga0207711_10002858
1411 Ga0207711_10003863
1412 Ga0207711_10011832
1413 Ga0207711_10020951
1414 Ga0207711_10063127
1415 Ga0207711_10069412
1416 Ga0207711_10109055
1417 Ga0207689_10000226
1418 Ga0207689_10032840
1419 Ga0207689_10033251
1420 Ga0207689_10038228
1421 Ga0207689_10246733
1422 Ga0207661_10000953
1423 Ga0207661_10005783
1424 Ga0207661_10069612
1425 Ga0207679_10000243
1426 Ga0207679_10004152
1427 Ga0207679_10008060
1428 Ga0207679_10008266
1429 Ga0207679_10015168
1430 Ga0207679_10023965
1431 Ga0207679_10034407
1432 Ga0207679_10067901
1433 Ga0207679_10078551
1434 Ga0207679_10125049
1435 Ga0207679_10125364
1436 Ga0207667_10006092
1437 Ga0207667_10012505
1438 Ga0207667_10030940
1439 Ga0207667_10063553
1440 Ga0207667_10067839
1441 Ga0207651_10000201
1442 Ga0207651_10004324
1443 Ga0207651_10076238
1444 Ga0207651_10097259
1445 Ga0207651_10173946
1446 Ga0207712_10009916
1447 Ga0207712_10026646
1448 Ga0207668_10000050
1449 Ga0207668_10039013
1450 Ga0207668_10195822
1451 Ga0207640_10001049
1452 Ga0207640_10006685
1453 Ga0207640_10021861
1454 Ga0207640_10048700
1455 Ga0207640_10053283
1456 Ga0207658_10008518
1457 Ga0207658_10008814
1458 Ga0207658_10013696
1459 Ga0207658_10054504
1460 Ga0207658_10066062
1461 Ga0207658_10074708
1462 Ga0207677_10000529
1463 Ga0207677_10003117
1464 Ga0207677_10036446
1465 Ga0207677_10045385
1466 Ga0207703_10002105
1467 Ga0207703_10015019
1468 Ga0207703_10037440
1469 Ga0207703_10041155
1470 Ga0207639_10000074
1471 Ga0207639_10000222
1472 Ga0207639_10006140
1473 Ga0207639_10013902
1474 Ga0207639_10052643
1475 Ga0207678_10004795
1476 Ga0207678_10017001
1477 Ga0207678_10020292
1478 Ga0207678_10050871
1479 Ga0207678_10071150
1480 Ga0207678_10162007
1481 Ga0207678_10168086
1482 Ga0207702_10000074
1483 Ga0207702_10033679
1484 Ga0207702_10036578
1485 Ga0207702_10039551
1486 Ga0207702_10047297
1487 Ga0207702_10120067
1488 Ga0207702_10139448
1489 Ga0207702_10182501
1490 Ga0207641_10000502
1491 Ga0207641_10006363
1492 Ga0207641_10027068
1493 Ga0207641_10046446
1494 Ga0207648_10002102
1495 Ga0207648_10002999
1496 Ga0207648_10008748
1497 Ga0207648_10016503
1498 Ga0207676_10000694
1499 Ga0207676_10001193
1500 Ga0207676_10009498
1501 Ga0207676_10012915
1502 Ga0207676_10134216
1503 Ga0207674_10000086
1504 Ga0207674_10000531
1505 Ga0207674_10002528
1506 Ga0207674_10002589
1507 Ga0207674_10004106
1508 Ga0207674_10006741
1509 Ga0207674_10006868
1510 Ga0207674_10031906
1511 Ga0207674_10057626
1512 Ga0207674_10070494
1513 Ga0207674_10338475
1514 Ga0207683_10028597
1515 Ga0207683_10044169
1516 Ga0207683_10067903
1517 Ga0207683_10084865
1518 Ga0207683_10092731
1519 Ga0207683_10123481
1520 Ga0207698_10000739
1521 Ga0207698_10000892
1522 Ga0207698_10003349
1523 Ga0207698_10005568
1524 Ga0207698_10013037
1525 Ga0207698_10021502
1526 Ga0207698_10096816
1527 Ga0207698_10128030
1528 Ga0207698_10294621
1529 Ga0209974_10018950
1530 Ga0207428_10184565
1531 Ga0268266_10001810
1532 Ga0268266_10004494
1533 Ga0268266_10005157
1534 Ga0268266_10041470
1535 Ga0268266_10047364
1536 Ga0268265_10014335
1537 Ga0268265_10016185
1538 Ga0268265_10016776
1539 Ga0268265_10031403
1540 Ga0268265_10072162
1541 Ga0268265_10157648
1542 Ga0268265_10289618
1543 Ga0268264_10000410
1544 Ga0268264_10000418
1545 Ga0268264_10021320
1546 Ga0268264_10067611
1547 Ga0268264_10097514
1548 Ga0268264_10158922
1549 Ga0268264_10165034
1550 Ga0307408_100004452
1551 Ga0307408_100068309
1552 Ga0307408_100071226
1553 Ga0307405_10000240
1554 Ga0307405_10004019
1555 Ga0307405_10019782
1556 Ga0307405_10025754
1557 Ga0307405_10068883
1558 Ga0307405_10153301
1559 Ga0307413_10002654
1560 Ga0307413_10003433
1561 Ga0307413_10156648
1562 Ga0307410_10001596
1563 Ga0307410_10005046
1564 Ga0307410_10019296
1565 Ga0307410_10022266
1566 Ga0307410_10022617
1567 Ga0307410_10031327
1568 Ga0307410_10034961
1569 Ga0307410_10095027
1570 Ga0307410_10107552
1571 Ga0307410_10217312
1572 Ga0307406_10009950
1573 Ga0307406_10050593
1574 Ga0307407_10012141
1575 Ga0307407_10053853
1576 Ga0307407_10080377
1577 Ga0307412_10033278
1578 Ga0307412_10079479
1579 Ga0307412_10092624
1580 Ga0307409_100009484
1581 Ga0307409_100011467
1582 Ga0307409_100025333
1583 Ga0307409_100030714
1584 Ga0307409_100046276
1585 Ga0307409_100047390
1586 Ga0307409_100117737
1587 Ga0307409_100137884
1588 Ga0307409_100184753
1589 Ga0307416_100001974
1590 Ga0307416_100003230
1591 Ga0307416_100014929
1592 Ga0307416_100029232
1593 Ga0307416_100079674
1594 Ga0307416_100142943
1595 Ga0307416_100183898
1596 Ga0307416_100201445
1597 Ga0307416_100205419
1598 Ga0307416_100365269
1599 Ga0307414_10002750
1600 Ga0307414_10004382
1601 Ga0307414_10006719
1602 Ga0307414_10020483
1603 Ga0307414_10051521
1604 Ga0307414_10070129
1605 Ga0307414_10096343
1606 Ga0307411_10000656
1607 Ga0307411_10009146
1608 Ga0307411_10016425
1609 Ga0307411_10018606
1610 Ga0307411_10027393
1611 Ga0307411_10032660
1612 Ga0307411_10073441
1613 Ga0307415_100000898
1614 Ga0307415_100003980
1615 Ga0307415_100016712
1616 Ga0307415_100035303
1617 Ga0307415_100085376
1618 Ga0307415_100146846
1619 Ga0307415_100218855
1620 Ga0373938_0006502
1621 Ga0373931_0005016
1622 Ga0373937_0030959
1623 Ga0395899_0000302
1624 Ga0395899_0002732
1625 Ga0395899_0006423
1626 Ga0395899_0016118
1627 Ga0395899_0017806
1628 Ga0395899_0032366
1629 Ga0395899_0101310
1630 Ga0395899_0155691
1631 Ga0395900_0000997
1632 Ga0395900_0002684
1633 Ga0395900_0002957
1634 Ga0395900_0005624
1635 Ga0395900_0011036
1636 Ga0395900_0012743
1637 Ga0395900_0017664
1638 Ga0395900_0047146
1639 Ga0395900_0051521
1640 Ga0395900_0051661
1641 Ga0395900_0089574
1642 Ga0395900_0104726
1643 Ga0395900_0105296
1644 Ga0395900_0107014
1645 Ga0395900_0149419
1646 Ga0395900_0256429
1647 Ga0395900_0289726
1648 Ga0395900_0327148
1649 Ga0395898_0000054
1650 Ga0395898_0001674
1651 Ga0395898_0003637
1652 Ga0395898_0005758
1653 Ga0395898_0010562
1654 Ga0395898_0049338
1655 Ga0395898_0051691
1656 Ga0395898_0081030
1657 Ga0395898_0094178
1658 Ga0395898_0210265
1659 Ga0395898_0279848
1660 Ga0395898_0306838
1661 Ga0395905_0000046
1662 Ga0395905_0000226
1663 Ga0395905_0001164
1664 Ga0395905_0002780
1665 Ga0395905_0003670
1666 Ga0395905_0004090
1667 Ga0395905_0004740
1668 Ga0395905_0010087
1669 Ga0395905_0014783
1670 Ga0395905_0017301
1671 Ga0395905_0025080
1672 Ga0395905_0031707
1673 Ga0395905_0035069
1674 Ga0395905_0035158
1675 Ga0395905_0055100
1676 Ga0395905_0075621
1677 Ga0395905_0076846
1678 Ga0395905_0080875
1679 Ga0395905_0092447
1680 Ga0395905_0101738
1681 Ga0395905_0143256
1682 Ga0395905_0164049
1683 Ga0395905_0175787
1684 Ga0395905_0265055
1685 Ga0395905_0282963
1686 Ga0395901_0000086
1687 Ga0395901_0000516
1688 Ga0395901_0002142
1689 Ga0395901_0002161
1690 Ga0395901_0003908
1691 Ga0395901_0007579
1692 Ga0395901_0012496
1693 Ga0395901_0016592
1694 Ga0395901_0018539
1695 Ga0395901_0027652
1696 Ga0395901_0046720
1697 Ga0395901_0061759
1698 Ga0395901_0062494
1699 Ga0395901_0096413
1700 Ga0395901_0124867
1701 Ga0395901_0135353
1702 Ga0395901_0135865
1703 Ga0395901_0155812
1704 Ga0395901_0166724
1705 Ga0395901_0206503
1706 Ga0395901_0209214
1707 Ga0395901_0218821
1708 Ga0436365_1575011
1709 Ga0439445_0003273
1710 Ga0439445_0006896
1711 Ga0439448_0000627
1712 Ga0439432_006474
1713 Ga0439449_0010549
1714 Ga0450920_011865
1715 Ga0450889_000026
1716 Ga0439458_0000006
1717 Ga0439458_0000616
1718 Ga0439464_0000987
1719 Ga0466969_0083052
1720 Ga0466965_0112191
1721 Ga0466961_0078365
1722 Ga0466963_0005313
1723 Ga0466963_0017251
1724 Ga0466963_0019822
1725 Ga0466963_0043986
1726 Ga0466963_0093648
1727 Ga0466963_0129034
1728 Ga0466964_0014906
1729 Ga0466957_0006177
1730 Ga0466958_0003422
1731 Ga0466958_0080974
1732 Ga0466967_0002800
1733 Ga0466967_0042416
1734 Ga0466967_0078587
1735 Ga0466967_0094188
1736 Ga0466967_0134941
1737 Ga0466967_0263330
1738 Ga0466967_0271798
1739 Ga0466967_0279869
1740 Ga0466967_0375552
1741 Ga0495617_003366
1742 Ga0495627_000024
1743 Ga0495627_011988
1744 Ga0495584_0019967
1745 Ga0495610_0000053
1746 Ga0495610_0038364
1747 Ga0495632_0000076
1748 Ga0495632_0017315
1749 Ga0495637_0000219
1750 Ga0495637_0002782
1751 Ga0495643_0000009
1752 Ga0495648_0016089
1753 Ga0495663_0000023
1754 Ga0495642_0012290
1755 Ga0495633_0000190
1756 Ga0495633_0000397
1757 Ga0495633_0010756
1758 Ga0495633_0064509
1759 Ga0495668_0007775
1760 Ga0495668_0025770
1761 Ga0495669_0000089
1762 Ga0495669_0001170
1763 Ga0495669_0002980
1764 Ga0495669_0006331
1765 Ga0495669_0037351
1766 Ga0495669_0041035
1767 Ga0495671_0000013
1768 Ga0495671_0015883
1769 Ga0495681_0000015
1770 Ga0495686_0016172
1771 Ga0495686_0048010
1772 Ga0496100_0022281
1773 Ga0496100_0055664
1774 Ga0496101_0000256
1775 Ga0496101_0088028
1776 Ga0496101_0199092
1777 Ga0496102_0066653
1778 Ga0496102_0146074
1779 Ga0496103_0013742
1780 Ga0496104_0022966
1781 Ga0496106_0011259
1782 Ga0496106_0078849
1783 Ga0496107_0009349
1784 Ga0496107_0044572
1785 Ga0496107_0055370
1786 Ga0496107_0092695
1787 Ga0496108_0000673
1788 Ga0496108_0001159
1789 Ga0496108_0027555
1790 Ga0496108_0176312
1791 Ga0496108_0256897
1792 Ga0496109_0000610
1793 Ga0496109_0000775
1794 Ga0496109_0022187
1795 Ga0496109_0076127
1796 Ga0496110_0001683
1797 Ga0496110_0005805
1798 Ga0496110_0012933
1799 Ga0496110_0015197
1800 Ga0496110_0026654
1801 Ga0496111_0000247
1802 Ga0496111_0068779
1803 Ga0496111_0162363
1804 Ga0496112_0000369
1805 Ga0496112_0004014
1806 Ga0496112_0017268
1807 Ga0496112_0019860
1808 Ga0496112_0073509
1809 Ga0496112_0104900
1810 Ga0496112_0138612
1811 Ga0496112_0267583
1812 Ga0496113_0000242
1813 Ga0496113_0000952
1814 Ga0496113_0002337
1815 Ga0496113_0043374
1816 Ga0496113_0076728
1817 Ga0496114_0000016
1818 Ga0496114_0045920
1819 Ga0496114_0064680
1820 Ga0496114_0070248
1821 Ga0496115_0002137
1822 Ga0496115_0032897
1823 Ga0496124_0143824
1824 Ga0495678_026911
1825 Ga0501068_0048562
1826 Ga0501069_0091265
1827 Ga0501080_0125756
1828 nmdc:mga09592_47337_c1
1829 nmdc:mga06r32_17134_c1
1830 nmdc:mga08y16_11359_c1
1831 Ga0500594_0000879
1832 Ga0500658_0000105
1833 Ga0466962_0012045
1834 Ga0466962_0036357
1835 2512644477
1836 2919709485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

16

148

0.91

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

338

415

0.82

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

187

337

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qkj-assembly1.cif.gz_A egtb from chloracidobacterium thermophilum, a type ii sulfoxide synthase in complex with n,n,n-trimethyl-histidine 0.8695 10 396
6o6l-assembly1.cif.gz_C the structure of egtb(cabther) in complex with hercynine 0.8693 10 396
6o6m-assembly1.cif.gz_B the structure of egtb (cabther) 0.8671 10 396
6o6m-assembly1.cif.gz_C the structure of egtb (cabther) 0.8656 10 396
6o6l-assembly1.cif.gz_D the structure of egtb(cabther) in complex with hercynine 0.8525 10 396
ID Description Score Start End Superfamily
af_O69671_154_424_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8075 171 395 3.90.1580.10
af_O94632_506_773_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7695 169 395 3.90.1580.10
af_Q8BHC0_41_132_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7546 269 303 3.10.100.10
af_A4I4F2_219_492_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7358 168 396 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6882 180 396 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A2N3D1T6-F1-model_v4 Ergothioneine biosynthesis protein EgtB 0.9357 282 396
AF-A0A7Y2A8D1-F1-model_v4 SUMF1/EgtB/PvdO family nonheme iron enzyme 0.9323 250 392
AF-A0A7W1HDX5-F1-model_v4 SUMF1/EgtB/PvdO family nonheme iron enzyme 0.9303 256 392
AF-A0A4Q2XKL6-F1-model_v4 deleted 0.9293 295 396
AF-A0A2N3D1T6-F1-model_v4 Ergothioneine biosynthesis protein EgtB 0.9281 282 396

Map