F485564

General Info

Members Datasets Scaffolds Average Seq Length
914 436 857 204

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_11439498|Ga0105242_114394981
Length 200
Sequence MPQGVPAVVPEDGLTTRQRRNRPLLVVHTGEMKGKSTAAFGMALRAWNQGWPVGVFQFVKSAKWRVGEETALKVLGESGEGGPVTWHKMGEGWSWTRKQGSDEDHAENGREGWEQIKRDLQAETYRFLVLDEFTYLLKWGWLDIDDVVDALVNRPGTQHVVITGRDAHPRLIEIADLVMETTKVKHPMDAGQKGQRGIEW

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
6 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
7 2643221641 Nocardioides sp. Root122 Isolate Unclassified
8 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
9 2643221692 Nocardia sp. Root136 Isolate Unclassified
10 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
11 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
12 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
13 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
14 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
15 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
16 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
17 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
18 2739367898 Nocardioides sp. CF479 Isolate Unclassified
19 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
20 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
21 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
22 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
23 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
24 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
25 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
26 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
27 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
28 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
29 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
30 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
31 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
32 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
33 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
34 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
35 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
36 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
37 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
38 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
39 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
40 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
41 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
42 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
43 2922554459 Rhodococcus sp. 66b Isolate Unclassified
44 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
45 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
46 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
47 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
48 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
49 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
50 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
51 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
52 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
55 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
56 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
57 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
58 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
64 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
65 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
66 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
67 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
68 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
69 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
84 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
85 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
86 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
89 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
90 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
96 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
122 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
123 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
124 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
137 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
138 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
139 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
140 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
141 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
142 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
143 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
144 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
162 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
168 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
174 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
175 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
176 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
177 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
235 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
236 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
237 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
238 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
239 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
245 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
254 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
255 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
261 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
282 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
283 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
284 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
285 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
286 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
289 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
290 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
291 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
292 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
293 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
294 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
295 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
296 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
297 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
298 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
299 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
300 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
301 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
302 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
303 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
304 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
305 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
306 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
307 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
308 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
309 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
310 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
316 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
317 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
318 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
319 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
325 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
326 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
327 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
328 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
329 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
332 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
335 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
336 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
337 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
338 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
339 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
343 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
344 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
345 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
346 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
347 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
352 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
353 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
354 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
357 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
358 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
359 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
398 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
399 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
405 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
406 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
407 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
408 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
409 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
412 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
413 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
414 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
419 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
420 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
421 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
422 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
423 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
424 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
425 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
426 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
427 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
428 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
429 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
430 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
431 649633069 Micromonospora sp. L5 Isolate Unclassified
432 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
433 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
434 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
435 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
436 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.76
Metatranscriptomes 0
Isolates 6.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 7.22
Nodule 0.11
Rhizoplane 6.56
Rhizosphere 77.79
Stem 0
Stem Tuber 0.11
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1010094 3300000549 Bacteria 1133
2 LJQas_1016001 3300000549 Bacteria 876
3 JGI24740J21852_10038840 3300001979 Bacteria 1457
4 JGI24739J22299_10037256 3300001989 Bacteria 1639
5 JGI24739J22299_10067530 3300001989 Bacteria 1117
6 JGI24745J21846_1008834 3300002073 Bacteria 1138
7 JGI24738J21930_10057137 3300002075 Bacteria 799
8 JGI24744J21845_10008629 3300002077 Bacteria 2094
9 JGI25406J46586_10047522 3300003203 Bacteria 1462
10 Ga0055528_1049220 3300003790 Bacteria 865
11 Ga0055540_1000029 3300003792 Bacteria 179894
12 Ga0055540_1004283 3300003792 Bacteria 6521
13 Ga0055540_1007072 3300003792 Bacteria 4314
14 Ga0055540_1009166 3300003792 Bacteria 3459
15 JGI25405J52794_10014104 3300003911 Bacteria 1557
16 Ga0070658_10344057 3300005327 Bacteria 1276
17 Ga0070676_10023714 3300005328 Bacteria 3450
18 Ga0070683_100321097 3300005329 Bacteria 1474
19 Ga0070683_100523979 3300005329 Bacteria 1133
20 Ga0070690_100119435 3300005330 Bacteria 1768
21 Ga0068869_100004054 3300005334 Bacteria 9062
22 Ga0070666_10018396 3300005335 Bacteria 4492
23 Ga0070666_10346902 3300005335 Bacteria 1062
24 Ga0070682_100037437 3300005337 Bacteria 2970
25 Ga0070682_100281960 3300005337 Bacteria 1211
26 Ga0068868_100000265 3300005338 Bacteria 35343
27 Ga0068868_100138486 3300005338 Bacteria 1996
28 Ga0068868_100882161 3300005338 Bacteria 812
29 Ga0070660_100548992 3300005339 Bacteria 964
30 Ga0070691_10015258 3300005341 Bacteria 3529
31 Ga0070687_100014239 3300005343 Bacteria 3569
32 Ga0070661_100223735 3300005344 Bacteria 1444
33 Ga0070668_100001311 3300005347 Bacteria 17811
34 Ga0070668_100001483 3300005347 Bacteria 16934
35 Ga0070668_100203164 3300005347 Bacteria 1627
36 Ga0070669_100073997 3300005353 Bacteria 2525
37 Ga0070674_100000174 3300005356 Bacteria 30012
38 Ga0070674_100008181 3300005356 Bacteria 6210
39 Ga0070674_100035094 3300005356 Bacteria 3356
40 Ga0070688_100422975 3300005365 Bacteria 990
41 Ga0070659_100066082 3300005366 Bacteria 2865
42 Ga0070659_100341922 3300005366 Bacteria 1254
43 Ga0070667_100000598 3300005367 Bacteria 35201
44 Ga0070667_100031229 3300005367 Bacteria 4442
45 Ga0070667_100060330 3300005367 Bacteria 3209
46 Ga0070667_100112564 3300005367 Bacteria 2361
47 Ga0070667_100121679 3300005367 Bacteria 2270
48 Ga0070667_100473121 3300005367 Bacteria 1147
49 Ga0070667_100605382 3300005367 Bacteria 1010
50 Ga0070709_10000334 3300005434 Bacteria 29604
51 Ga0070709_10009601 3300005434 Bacteria 5343
52 Ga0070709_10059467 3300005434 Bacteria 2426
53 Ga0070714_100003331 3300005435 Bacteria 11979
54 Ga0070714_100003659 3300005435 Bacteria 11510
55 Ga0070714_100075426 3300005435 Bacteria 2926
56 Ga0070714_100238894 3300005435 Bacteria 1676
57 Ga0070714_100603973 3300005435 Bacteria 1054
58 Ga0070714_100763722 3300005435 Bacteria 935
59 Ga0070714_100786561 3300005435 Bacteria 921
60 Ga0070714_100923598 3300005435 Bacteria 848
61 Ga0070713_100049498 3300005436 Bacteria 3467
62 Ga0070710_10000333 3300005437 Bacteria 22538
63 Ga0070710_10008072 3300005437 Bacteria 5117
64 Ga0070710_10112108 3300005437 Bacteria 1640
65 Ga0070701_10008783 3300005438 Bacteria 4390
66 Ga0070701_10400747 3300005438 Bacteria 869
67 Ga0070711_100006447 3300005439 Bacteria 7075
68 Ga0070711_100006774 3300005439 Bacteria 6935
69 Ga0070711_100010763 3300005439 Bacteria 5671
70 Ga0070705_100022320 3300005440 Bacteria 3381
71 Ga0070700_100019837 3300005441 Bacteria 3885
72 Ga0070694_100025132 3300005444 Bacteria 3852
73 Ga0070694_100684766 3300005444 Bacteria 833
74 Ga0070708_100148498 3300005445 Bacteria 2179
75 Ga0070708_100588939 3300005445 Bacteria 1049
76 Ga0070663_100000604 3300005455 Bacteria 19198
77 Ga0070663_100175591 3300005455 Bacteria 1659
78 Ga0070678_100000417 3300005456 Bacteria 20087
79 Ga0070678_100180596 3300005456 Bacteria 1727
80 Ga0070662_100044297 3300005457 Bacteria 3187
81 Ga0068867_100001676 3300005459 Bacteria 15435
82 Ga0068867_100044588 3300005459 Bacteria 3249
83 Ga0070685_10013555 3300005466 Bacteria 4301
84 Ga0070707_100017252 3300005468 Bacteria 6786
85 Ga0070698_100025984 3300005471 Bacteria 6101
86 Ga0070698_100090683 3300005471 Bacteria 3039
87 Ga0070699_100576652 3300005518 Bacteria 1025
88 Ga0070684_100551280 3300005535 Bacteria 1070
89 Ga0070697_100039286 3300005536 Bacteria 3826
90 Ga0068853_100008214 3300005539 Bacteria 8380
91 Ga0068853_100026278 3300005539 Bacteria 4888
92 Ga0068853_100061462 3300005539 Bacteria 3249
93 Ga0070672_100079326 3300005543 Bacteria 2628
94 Ga0070686_100593379 3300005544 Bacteria 872
95 Ga0070695_100070067 3300005545 Bacteria 2293
96 Ga0070695_100124780 3300005545 Bacteria 1767
97 Ga0070696_100041771 3300005546 Bacteria 3169
98 Ga0070693_100006907 3300005547 Bacteria 5520
99 Ga0070665_100049121 3300005548 Bacteria 4233
100 Ga0070665_100356287 3300005548 Bacteria 1469
101 Ga0070665_100422571 3300005548 Bacteria 1341
102 Ga0070704_100004004 3300005549 Bacteria 8502
103 Ga0070704_100094608 3300005549 Bacteria 2236
104 Ga0070704_100244951 3300005549 Bacteria 1469
105 Ga0068855_100139807 3300005563 Bacteria 2761
106 Ga0068854_100000759 3300005578 Bacteria 19146
107 Ga0068854_100107361 3300005578 Bacteria 2101
108 Ga0068856_100019959 3300005614 Bacteria 6505
109 Ga0068856_101010482 3300005614 Bacteria 850
110 Ga0068856_101185980 3300005614 Bacteria 780
111 Ga0068852_100153467 3300005616 Bacteria 2144
112 Ga0068852_100365385 3300005616 Bacteria 1412
113 Ga0068852_100715465 3300005616 Bacteria 1012
114 Ga0068859_100000995 3300005617 Bacteria 29017
115 Ga0068864_100424164 3300005618 Bacteria 1268
116 Ga0068864_100988199 3300005618 Bacteria 834
117 Ga0068866_10000103 3300005718 Bacteria 36199
118 Ga0068861_100018456 3300005719 Bacteria 4970
119 Ga0068861_100615656 3300005719 Bacteria 998
120 Ga0068851_10170423 3300005834 Bacteria 1201
121 Ga0068863_100020574 3300005841 Bacteria 6307
122 Ga0068863_100080738 3300005841 Bacteria 3081
123 Ga0068863_100774120 3300005841 Bacteria 956
124 Ga0068858_100007072 3300005842 Bacteria 10894
125 Ga0068858_100091221 3300005842 Bacteria 2836
126 Ga0068858_100331437 3300005842 Bacteria 1456
127 Ga0068858_100412053 3300005842 Bacteria 1299
128 Ga0068860_100054492 3300005843 Bacteria 3801
129 Ga0068860_100256324 3300005843 Bacteria 1704
130 Ga0068860_100594257 3300005843 Bacteria 1112
131 Ga0068862_100160825 3300005844 Bacteria 2004
132 Ga0081455_10000018 3300005937 Bacteria 173683
133 Ga0081455_10001022 3300005937 Bacteria 35293
134 Ga0081538_10072677 3300005981 Bacteria 1884
135 Ga0081539_10000079 3300005985 Bacteria 223413
136 Ga0081539_10005436 3300005985 Bacteria 13001
137 Ga0070717_10099227 3300006028 Bacteria 2470
138 Ga0070717_10106319 3300006028 Bacteria 2389
139 Ga0070717_10113334 3300006028 Bacteria 2315
140 Ga0070717_10248449 3300006028 Bacteria 1571
141 Ga0070717_11114927 3300006028 Bacteria 718
142 Ga0075365_10002087 3300006038 Bacteria 9551
143 Ga0075365_10035217 3300006038 Bacteria 3237
144 Ga0075363_100000458 3300006048 Bacteria 12797
145 Ga0075363_100003272 3300006048 Bacteria 6855
146 Ga0075363_100051197 3300006048 Bacteria 2202
147 Ga0075363_100124081 3300006048 Bacteria 1444
148 Ga0075363_100134450 3300006048 Bacteria 1389
149 Ga0075364_10003823 3300006051 Bacteria 8620
150 Ga0075364_10025357 3300006051 Bacteria 3774
151 Ga0075364_10044523 3300006051 Bacteria 2886
152 Ga0075364_10057388 3300006051 Bacteria 2550
153 Ga0075364_10073048 3300006051 Bacteria 2261
154 Ga0075364_10194647 3300006051 Bacteria 1373
155 Ga0070715_10017160 3300006163 Bacteria 2735
156 Ga0070715_10027262 3300006163 Bacteria 2281
157 Ga0070715_10051830 3300006163 Bacteria 1768
158 Ga0070716_100009809 3300006173 Bacteria 4785
159 Ga0070716_100011606 3300006173 Bacteria 4438
160 Ga0070712_100000214 3300006175 Bacteria 32534
161 Ga0075362_10069700 3300006177 Bacteria 1604
162 Ga0075367_10009242 3300006178 Bacteria 5144
163 Ga0075367_10086407 3300006178 Bacteria 1904
164 Ga0075367_10165831 3300006178 Bacteria 1375
165 Ga0075369_10001785 3300006186 Bacteria 7486
166 Ga0075369_10011008 3300006186 Bacteria 3549
167 Ga0075369_10066167 3300006186 Bacteria 1585
168 Ga0075369_10086590 3300006186 Bacteria 1394
169 Ga0075369_10171546 3300006186 Bacteria 996
170 Ga0097621_100212032 3300006237 Bacteria 1685
171 Ga0075370_10088795 3300006353 Bacteria 1782
172 Ga0075370_10120692 3300006353 Bacteria 1526
173 Ga0075428_100002717 3300006844 Bacteria 19259
174 Ga0075428_100163155 3300006844 Bacteria 2418
175 Ga0075430_100240690 3300006846 Bacteria 1500
176 Ga0075430_100691681 3300006846 Bacteria 841
177 Ga0075431_100024200 3300006847 Bacteria 6219
178 Ga0075433_10038600 3300006852 Bacteria 4125
179 Ga0075434_100035227 3300006871 Bacteria 4947
180 Ga0075429_100536971 3300006880 Bacteria 1025
181 Ga0068865_100120631 3300006881 Bacteria 1949
182 Ga0075436_100037276 3300006914 Bacteria 3357
183 Ga0075436_100456604 3300006914 Bacteria 931
184 Ga0097620_100000995 3300006931 Bacteria 29017
185 Ga0075435_100017043 3300007076 Bacteria 5489
186 Ga0075435_100227444 3300007076 Bacteria 1585
187 Ga0105244_10148107 3300009036 Bacteria 1125
188 Ga0111539_10189282 3300009094 Bacteria 2402
189 Ga0105245_10003044 3300009098 Bacteria 15023
190 Ga0105245_10347954 3300009098 Bacteria 1467
191 Ga0105247_10000279 3300009101 Bacteria 46962
192 Ga0105247_10052827 3300009101 Bacteria 2506
193 Ga0105247_10406657 3300009101 Bacteria 971
194 Ga0105247_10512105 3300009101 Bacteria 876
195 Ga0114129_10007260 3300009147 Bacteria 15775
196 Ga0105243_10001443 3300009148 Bacteria 20907
197 Ga0105243_10002154 3300009148 Bacteria 16631
198 Ga0105243_10238446 3300009148 Bacteria 1617
199 Ga0105243_10364050 3300009148 Bacteria 1332
200 Ga0105241_10037293 3300009174 Bacteria 3661
201 Ga0105241_10073381 3300009174 Bacteria 2662
202 Ga0105241_10219295 3300009174 Bacteria 1598
203 Ga0105242_10000551 3300009176 Bacteria 29661
204 Ga0105242_10042392 3300009176 Bacteria 3675
205 Ga0105242_10392984 3300009176 Bacteria 1292
206 Ga0105242_11439498 3300009176 Bacteria 718
207 Ga0105248_10004599 3300009177 Bacteria 15277
208 Ga0105248_10443380 3300009177 Bacteria 1463
209 Ga0105237_10000346 3300009545 Bacteria 65318
210 Ga0105237_10006150 3300009545 Bacteria 13416
211 Ga0105237_10489244 3300009545 Bacteria 1237
212 Ga0105238_10273063 3300009551 Bacteria 1671
213 Ga0105238_11289461 3300009551 Bacteria 756
214 Ga0105249_10011764 3300009553 Bacteria 7693
215 Ga0105249_10029820 3300009553 Bacteria 4929
216 Ga0105249_10366864 3300009553 Bacteria 1463
217 Ga0105249_11401286 3300009553 Bacteria 771
218 Ga0105033_100617 3300009986 Bacteria 2757
219 Ga0105239_10005076 3300010375 Bacteria 15543
220 Ga0105239_10034589 3300010375 Bacteria 5549
221 Ga0105239_10036300 3300010375 Bacteria 5411
222 Ga0105239_10764427 3300010375 Bacteria 1106
223 Ga0105246_10344032 3300011119 Bacteria 1220
224 Ga0157369_10249592 3300013105 Bacteria 1852
225 Ga0157369_10317595 3300013105 Bacteria 1619
226 Ga0157369_10878623 3300013105 Bacteria 920
227 Ga0157369_10911272 3300013105 Bacteria 901
228 Ga0157369_11498374 3300013105 Bacteria 686
229 Ga0157374_10023753 3300013296 Bacteria 5488
230 Ga0157374_10157560 3300013296 Bacteria 2211
231 Ga0157378_10000675 3300013297 Bacteria 32100
232 Ga0157378_10214124 3300013297 Bacteria 1828
233 Ga0163162_10032288 3300013306 Bacteria 5199
234 Ga0163162_10101325 3300013306 Bacteria 2971
235 Ga0163162_10571855 3300013306 Bacteria 1257
236 Ga0157372_10007826 3300013307 Bacteria 11349
237 Ga0157372_10044097 3300013307 Bacteria 4941
238 Ga0157372_11062008 3300013307 Bacteria 937
239 Ga0157375_10006369 3300013308 Bacteria 10290
240 Ga0157375_10040117 3300013308 Bacteria 4511
241 Ga0157375_10207775 3300013308 Bacteria 2115
242 Ga0157375_11448868 3300013308 Bacteria 810
243 Ga0163163_10044957 3300014325 Bacteria 4334
244 Ga0163163_10304555 3300014325 Bacteria 1646
245 Ga0163163_10372889 3300014325 Bacteria 1484
246 Ga0163163_10482290 3300014325 Bacteria 1301
247 Ga0157380_10000918 3300014326 Bacteria 18557
248 Ga0157380_10315493 3300014326 Bacteria 1447
249 Ga0157380_11602997 3300014326 Bacteria 706
250 Ga0157377_10331632 3300014745 Bacteria 1014
251 Ga0157379_10000781 3300014968 Bacteria 25849
252 Ga0157379_10024136 3300014968 Bacteria 5396
253 Ga0157379_10302792 3300014968 Bacteria 1457
254 Ga0157376_11041991 3300014969 Bacteria 842
255 Ga0163161_10009107 3300017792 Bacteria 6861
256 Ga0163161_10032637 3300017792 Bacteria 3719
257 Ga0163161_10351008 3300017792 Bacteria 1173
258 Ga0213873_10000063 3300021358 Bacteria 23866
259 Ga0213874_10116766 3300021377 Bacteria 903
260 Ga0213876_10017707 3300021384 Bacteria 3759
261 Ga0213875_10000035 3300021388 Bacteria 167011
262 Ga0213875_10003836 3300021388 Bacteria 8440
263 Ga0213875_10033255 3300021388 Bacteria 2435
264 Ga0213875_10054084 3300021388 Bacteria 1880
265 Ga0209673_1034518 3300025273 Bacteria 1526
266 Ga0209673_1044436 3300025273 Bacteria 1230
267 Ga0209051_1000042 3300025303 Bacteria 308486
268 Ga0209051_1000374 3300025303 Bacteria 64311
269 Ga0209051_1001519 3300025303 Bacteria 19320
270 Ga0209051_1003476 3300025303 Bacteria 10320
271 Ga0207653_10183565 3300025885 Bacteria 783
272 Ga0207682_10211397 3300025893 Bacteria 895
273 Ga0207692_10000585 3300025898 Bacteria 12924
274 Ga0207692_10003576 3300025898 Bacteria 6083
275 Ga0207692_10004810 3300025898 Bacteria 5369
276 Ga0207692_10054924 3300025898 Bacteria 2036
277 Ga0207642_10007347 3300025899 Bacteria 3717
278 Ga0207710_10018095 3300025900 Bacteria 2995
279 Ga0207710_10048142 3300025900 Bacteria 1907
280 Ga0207688_10000373 3300025901 Bacteria 20896
281 Ga0207688_10004249 3300025901 Bacteria 7807
282 Ga0207688_10400472 3300025901 Bacteria 851
283 Ga0207680_10020508 3300025903 Bacteria 3560
284 Ga0207647_10033576 3300025904 Bacteria 3285
285 Ga0207647_10062996 3300025904 Bacteria 2257
286 Ga0207685_10006954 3300025905 Bacteria 3119
287 Ga0207699_10002424 3300025906 Bacteria 8815
288 Ga0207699_10013929 3300025906 Bacteria 4131
289 Ga0207699_10032210 3300025906 Bacteria 2952
290 Ga0207645_10026352 3300025907 Bacteria 3758
291 Ga0207645_10043446 3300025907 Bacteria 2877
292 Ga0207643_10180298 3300025908 Bacteria 1278
293 Ga0207705_10253843 3300025909 Bacteria 1341
294 Ga0207684_10031066 3300025910 Bacteria 4545
295 Ga0207684_10883775 3300025910 Bacteria 752
296 Ga0207654_10565504 3300025911 Bacteria 809
297 Ga0207671_10394168 3300025914 Bacteria 1101
298 Ga0207671_10584017 3300025914 Bacteria 891
299 Ga0207671_10666905 3300025914 Bacteria 828
300 Ga0207693_10000320 3300025915 Bacteria 44589
301 Ga0207693_10001428 3300025915 Bacteria 21168
302 Ga0207693_10089329 3300025915 Bacteria 2414
303 Ga0207663_10003778 3300025916 Bacteria 7468
304 Ga0207663_10006672 3300025916 Bacteria 5933
305 Ga0207663_10018259 3300025916 Bacteria 3927
306 Ga0207657_10223298 3300025919 Bacteria 1508
307 Ga0207649_10749053 3300025920 Bacteria 760
308 Ga0207646_10005394 3300025922 Bacteria 13452
309 Ga0207646_10025079 3300025922 Bacteria 5457
310 Ga0207646_10190271 3300025922 Bacteria 1853
311 Ga0207681_10035825 3300025923 Bacteria 3272
312 Ga0207687_10004442 3300025927 Bacteria 9356
313 Ga0207687_10024421 3300025927 Bacteria 4039
314 Ga0207687_10144450 3300025927 Bacteria 1809
315 Ga0207700_10001255 3300025928 Bacteria 14442
316 Ga0207700_10006885 3300025928 Bacteria 6912
317 Ga0207700_10429890 3300025928 Bacteria 1161
318 Ga0207664_10001996 3300025929 Bacteria 13433
319 Ga0207664_10037167 3300025929 Bacteria 3766
320 Ga0207664_10249456 3300025929 Bacteria 1549
321 Ga0207664_10283243 3300025929 Bacteria 1455
322 Ga0207644_10271307 3300025931 Bacteria 1359
323 Ga0207690_10051719 3300025932 Bacteria 2749
324 Ga0207690_10211267 3300025932 Bacteria 1480
325 Ga0207686_10004529 3300025934 Bacteria 7446
326 Ga0207686_10150115 3300025934 Bacteria 1621
327 Ga0207709_10004979 3300025935 Bacteria 7603
328 Ga0207709_10029606 3300025935 Bacteria 3178
329 Ga0207709_10078961 3300025935 Bacteria 2114
330 Ga0207669_10000415 3300025937 Bacteria 18644
331 Ga0207669_10005935 3300025937 Bacteria 5531
332 Ga0207669_10130568 3300025937 Bacteria 1725
333 Ga0207669_10644949 3300025937 Bacteria 865
334 Ga0207665_10002591 3300025939 Bacteria 12157
335 Ga0207665_10008073 3300025939 Bacteria 6946
336 Ga0207665_10009047 3300025939 Bacteria 6538
337 Ga0207665_10337164 3300025939 Bacteria 1135
338 Ga0207691_10044894 3300025940 Bacteria 4065
339 Ga0207711_10014333 3300025941 Bacteria 6584
340 Ga0207711_10248501 3300025941 Bacteria 1633
341 Ga0207689_10013143 3300025942 Bacteria 7065
342 Ga0207689_10029001 3300025942 Bacteria 4626
343 Ga0207689_10641045 3300025942 Bacteria 895
344 Ga0207661_10248691 3300025944 Bacteria 1580
345 Ga0207661_10293526 3300025944 Bacteria 1456
346 Ga0207712_10010146 3300025961 Bacteria 5973
347 Ga0207712_10163227 3300025961 Bacteria 1734
348 Ga0207712_10972768 3300025961 Bacteria 752
349 Ga0207712_11149452 3300025961 Bacteria 692
350 Ga0207668_10002762 3300025972 Bacteria 10260
351 Ga0207668_10003021 3300025972 Bacteria 9863
352 Ga0207668_10054525 3300025972 Bacteria 2775
353 Ga0207668_10137406 3300025972 Bacteria 1874
354 Ga0207668_10379033 3300025972 Bacteria 1190
355 Ga0207640_10008533 3300025981 Bacteria 5692
356 Ga0207640_10046753 3300025981 Bacteria 2787
357 Ga0207640_10373906 3300025981 Bacteria 1153
358 Ga0207658_10014616 3300025986 Bacteria 5377
359 Ga0207658_10018357 3300025986 Bacteria 4830
360 Ga0207658_10053842 3300025986 Bacteria 2975
361 Ga0207658_10153397 3300025986 Bacteria 1879
362 Ga0207677_10000663 3300026023 Bacteria 20484
363 Ga0207677_10009341 3300026023 Bacteria 5517
364 Ga0207677_10358222 3300026023 Bacteria 1224
365 Ga0207703_10002809 3300026035 Bacteria 14858
366 Ga0207703_10096660 3300026035 Bacteria 2494
367 Ga0207703_10330915 3300026035 Bacteria 1397
368 Ga0207639_10004866 3300026041 Bacteria 9046
369 Ga0207639_10014636 3300026041 Bacteria 5525
370 Ga0207639_10015203 3300026041 Bacteria 5424
371 Ga0207678_10001872 3300026067 Bacteria 19200
372 Ga0207708_10006741 3300026075 Bacteria 8498
373 Ga0207708_10063763 3300026075 Bacteria 2815
374 Ga0207702_10233520 3300026078 Bacteria 1720
375 Ga0207702_10451667 3300026078 Bacteria 1247
376 Ga0207702_11032885 3300026078 Bacteria 816
377 Ga0207641_10021583 3300026088 Bacteria 5290
378 Ga0207641_10744970 3300026088 Bacteria 967
379 Ga0207648_10000451 3300026089 Bacteria 45574
380 Ga0207648_10032515 3300026089 Bacteria 4605
381 Ga0207676_10341955 3300026095 Bacteria 1381
382 Ga0207676_11586523 3300026095 Bacteria 652
383 Ga0207674_10195609 3300026116 Bacteria 1972
384 Ga0207674_11317247 3300026116 Bacteria 692
385 Ga0207675_100046810 3300026118 Bacteria 4041
386 Ga0207675_100225491 3300026118 Bacteria 1806
387 Ga0207675_100450772 3300026118 Bacteria 1275
388 Ga0207683_10000665 3300026121 Bacteria 31567
389 Ga0207683_10198252 3300026121 Bacteria 1824
390 Ga0207683_10228141 3300026121 Bacteria 1698
391 Ga0207698_10253715 3300026142 Bacteria 1611
392 Ga0207698_10429749 3300026142 Bacteria 1269
393 Ga0207698_10464869 3300026142 Bacteria 1224
394 Ga0207698_10555905 3300026142 Bacteria 1126
395 Ga0268266_10049546 3300028379 Bacteria 3602
396 Ga0268266_10360498 3300028379 Bacteria 1368
397 Ga0268266_10390928 3300028379 Bacteria 1313
398 Ga0268265_10014656 3300028380 Bacteria 5344
399 Ga0268264_10037712 3300028381 Bacteria 3986
400 Ga0307511_10000566 3300030521 Bacteria 39711
401 Ga0307512_10006564 3300030522 Bacteria 11755
402 Ga0316176_1012104 3300030732 Bacteria 664
403 Ga0314311_1258134 3300030733 Bacteria 1975
404 Ga0316180_1128025 3300030736 Bacteria 2439
405 Ga0265327_10001323 3300031251 Bacteria 32234
406 Ga0307513_10246364 3300031456 Bacteria 1587
407 Ga0316579_10001613 3300031691 Bacteria 8257
408 Ga0307405_10064106 3300031731 Bacteria 2334
409 Ga0307405_10288443 3300031731 Bacteria 1239
410 Ga0307413_10276707 3300031824 Bacteria 1260
411 Ga0307413_10439279 3300031824 Bacteria 1033
412 Ga0307518_10003613 3300031838 Bacteria 11119
413 Ga0307410_10031492 3300031852 Bacteria 3404
414 Ga0307410_10138016 3300031852 Bacteria 1800
415 Ga0307410_10188891 3300031852 Bacteria 1565
416 Ga0307410_10384950 3300031852 Bacteria 1129
417 Ga0307410_10466197 3300031852 Bacteria 1033
418 Ga0307410_11189804 3300031852 Bacteria 664
419 Ga0307406_10029420 3300031901 Bacteria 3327
420 Ga0307406_10083793 3300031901 Bacteria 2127
421 Ga0307406_10088571 3300031901 Bacteria 2077
422 Ga0307406_10642170 3300031901 Bacteria 880
423 Ga0307407_10015424 3300031903 Bacteria 3777
424 Ga0307407_10015889 3300031903 Bacteria 3735
425 Ga0307407_10077346 3300031903 Bacteria 2001
426 Ga0307409_100000890 3300031995 Bacteria 13833
427 Ga0307409_100027223 3300031995 Bacteria 4048
428 Ga0307409_100068214 3300031995 Bacteria 2812
429 Ga0307409_100146602 3300031995 Bacteria 2042
430 Ga0307409_100159334 3300031995 Bacteria 1971
431 Ga0307409_100750093 3300031995 Bacteria 980
432 Ga0307409_100865216 3300031995 Bacteria 915
433 Ga0307416_100008353 3300032002 Bacteria 6672
434 Ga0307416_100025070 3300032002 Bacteria 4366
435 Ga0307416_100037053 3300032002 Bacteria 3748
436 Ga0307416_100228270 3300032002 Bacteria 1792
437 Ga0307416_100352925 3300032002 Bacteria 1489
438 Ga0307416_101674564 3300032002 Bacteria 741
439 Ga0307414_10112296 3300032004 Bacteria 2077
440 Ga0307411_10018624 3300032005 Bacteria 3989
441 Ga0307411_10020002 3300032005 Bacteria 3883
442 Ga0307411_10052939 3300032005 Bacteria 2657
443 Ga0307411_10255418 3300032005 Bacteria 1381
444 Ga0307415_100006738 3300032126 Bacteria 6226
445 Ga0307415_100026832 3300032126 Bacteria 3640
446 Ga0307415_100032961 3300032126 Bacteria 3357
447 Ga0307415_100217652 3300032126 Bacteria 1529
448 Ga0307415_100346995 3300032126 Bacteria 1248
449 Ga0307415_100378607 3300032126 Bacteria 1201
450 Ga0307507_10018641 3300033179 Bacteria 7872
451 Ga0307507_10021576 3300033179 Bacteria 7159
452 Ga0307510_10072348 3300033180 Bacteria 3426
453 Ga0373934_0032629 3300035086 Bacteria 2043
454 Ga0373934_0047700 3300035086 Bacteria 1694
455 Ga0373923_0077215 3300035111 Bacteria 1439
456 Ga0373936_0010764 3300035113 Bacteria 3454
457 Ga0373953_0011454 3300035117 Bacteria 3112
458 Ga0373954_0210004 3300035118 Bacteria 957
459 Ga0373956_0001711 3300035119 Bacteria 9046
460 Ga0373956_0006002 3300035119 Bacteria 4860
461 Ga0373957_0022968 3300035120 Bacteria 2226
462 Ga0373957_0052314 3300035120 Bacteria 1564
463 Ga0373943_0086625 3300035170 Bacteria 1615
464 Ga0373943_0151258 3300035170 Bacteria 1258
465 Ga0373955_0023762 3300035172 Bacteria 3127
466 Ga0373955_0024251 3300035172 Bacteria 3100
467 Ga0373924_0003322 3300035410 Bacteria 5519
468 Ga0373924_0019176 3300035410 Bacteria 2647
469 Ga0373931_0030544 3300035691 Bacteria 2774
470 Ga0373935_0028303 3300035692 Bacteria 3463
471 Ga0373935_0246031 3300035692 Bacteria 1250
472 Ga0373927_0272272 3300035695 Bacteria 1113
473 Ga0373933_0008266 3300035724 Bacteria 5681
474 Ga0373933_0044704 3300035724 Bacteria 2624
475 Ga0373933_0135582 3300035724 Bacteria 1551
476 Ga0373947_0021007 3300035725 Bacteria 3777
477 Ga0373947_0419322 3300035725 Bacteria 904
478 Ga0373937_0010056 3300036401 Bacteria 8249
479 Ga0373937_0059354 3300036401 Bacteria 3516
480 Ga0373925_0024766 3300037068 Bacteria 4383
481 Ga0373925_0113795 3300037068 Bacteria 2093
482 Ga0395899_0399109 3300037312 Bacteria 910
483 Ga0395900_0037820 3300037418 Bacteria 4975
484 Ga0395900_0529576 3300037418 Bacteria 1125
485 Ga0395900_1074167 3300037418 Bacteria 723
486 Ga0395898_0072849 3300037466 Bacteria 3318
487 Ga0395898_0394238 3300037466 Bacteria 1320
488 Ga0395905_0220771 3300037471 Bacteria 1774
489 Ga0436364_0031584 3300037853 Bacteria 12016
490 Ga0436364_0265237 3300037853 Bacteria 1683
491 Ga0436364_0527483 3300037853 Bacteria 79221
492 Ga0436364_0624094 3300037853 Bacteria 124588
493 Ga0436364_1363663 3300037853 Bacteria 4012
494 Ga0395901_0256391 3300038443 Bacteria 1821
495 Ga0436365_0982045 3300039437 Bacteria 3677
496 Ga0436363_0032393 3300039450 Bacteria 1843
497 Ga0436363_0483576 3300039450 Bacteria 883
498 Ga0436363_1321026 3300039450 Bacteria 4211
499 Ga0436362_0543778 3300039453 Bacteria 67112
500 Ga0439438_023674 3300041405 Bacteria 1689
501 Ga0439461_0006406 3300041410 Bacteria 2049
502 Ga0439466_0013024 3300041411 Bacteria 3050
503 Ga0439465_0020383 3300041413 Bacteria 2076
504 Ga0439465_0032187 3300041413 Bacteria 1673
505 Ga0439465_0046111 3300041413 Bacteria 1418
506 Ga0451789_0324757 3300041443 Bacteria 1202
507 Ga0451807_0054841 3300041486 Bacteria 907
508 Ga0439431_0000413 3300041997 Bacteria 9011
509 Ga0439431_0007569 3300041997 Bacteria 2424
510 Ga0439442_063750 3300042002 Bacteria 782
511 Ga0439445_0000656 3300042004 Bacteria 7127
512 Ga0439448_0049574 3300042005 Bacteria 1372
513 Ga0439449_0041958 3300042007 Bacteria 1701
514 Ga0439446_0028899 3300042156 Bacteria 1598
515 Ga0439434_0001156 3300042435 Bacteria 7635
516 Ga0439434_0008638 3300042435 Bacteria 2991
517 Ga0439459_0037393 3300042438 Bacteria 1017
518 Ga0466969_0044502 3300044656 Bacteria 2207
519 Ga0466969_0046065 3300044656 Bacteria 2163
520 Ga0466969_0073548 3300044656 Bacteria 1640
521 Ga0466969_0213361 3300044656 Bacteria 879
522 Ga0466972_0005719 3300044658 Bacteria 6231
523 Ga0466972_0007727 3300044658 Bacteria 5398
524 Ga0466972_0015169 3300044658 Bacteria 3851
525 Ga0466972_0019114 3300044658 Bacteria 3426
526 Ga0466972_0036310 3300044658 Bacteria 2411
527 Ga0466972_0046845 3300044658 Bacteria 2092
528 Ga0466972_0076962 3300044658 Bacteria 1589
529 Ga0466965_0002402 3300044683 Bacteria 7937
530 Ga0466965_0006143 3300044683 Bacteria 5430
531 Ga0466965_0031269 3300044683 Bacteria 2596
532 Ga0466965_0032994 3300044683 Bacteria 2529
533 Ga0466965_0081314 3300044683 Bacteria 1638
534 Ga0466965_0117701 3300044683 Bacteria 1370
535 Ga0466965_0121137 3300044683 Bacteria 1351
536 Ga0466965_0150633 3300044683 Bacteria 1216
537 Ga0466965_0310385 3300044683 Bacteria 857
538 Ga0466965_0362175 3300044683 Bacteria 796
539 Ga0466966_0004435 3300044684 Bacteria 9251
540 Ga0466966_0015419 3300044684 Bacteria 5052
541 Ga0466966_0019872 3300044684 Bacteria 4417
542 Ga0466966_0049069 3300044684 Bacteria 2689
543 Ga0466966_0085741 3300044684 Bacteria 1958
544 Ga0466966_0146110 3300044684 Bacteria 1443
545 Ga0466966_0258438 3300044684 Bacteria 1049
546 Ga0466961_0002286 3300044693 Bacteria 11901
547 Ga0466961_0005880 3300044693 Bacteria 7772
548 Ga0466961_0009342 3300044693 Bacteria 6246
549 Ga0466961_0010478 3300044693 Bacteria 5913
550 Ga0466961_0076271 3300044693 Bacteria 2125
551 Ga0466961_0164279 3300044693 Bacteria 1383
552 Ga0466963_0000039 3300044694 Bacteria 42354
553 Ga0466963_0043452 3300044694 Bacteria 2955
554 Ga0466963_0171075 3300044694 Bacteria 1514
555 Ga0466963_0209066 3300044694 Bacteria 1365
556 Ga0466963_0350736 3300044694 Bacteria 1039
557 Ga0466963_0410506 3300044694 Bacteria 955
558 Ga0466963_0550318 3300044694 Bacteria 815
559 Ga0466963_0573530 3300044694 Bacteria 797
560 Ga0466963_0715622 3300044694 Bacteria 706
561 Ga0466964_0151553 3300044706 Bacteria 1075
562 Ga0466964_0185531 3300044706 Bacteria 989
563 Ga0466971_0010029 3300044719 Bacteria 4137
564 Ga0466971_0023941 3300044719 Bacteria 2723
565 Ga0466971_0115944 3300044719 Bacteria 1238
566 Ga0466968_0001265 3300044735 Bacteria 8999
567 Ga0466968_0075816 3300044735 Bacteria 1471
568 Ga0466968_0087887 3300044735 Bacteria 1373
569 Ga0466968_0191112 3300044735 Bacteria 955
570 Ga0466970_0061591 3300044765 Bacteria 2011
571 Ga0466970_0066315 3300044765 Bacteria 1937
572 Ga0466970_0106941 3300044765 Bacteria 1526
573 Ga0466970_0108350 3300044765 Bacteria 1516
574 Ga0466970_0133175 3300044765 Bacteria 1366
575 Ga0466970_0184306 3300044765 Bacteria 1159
576 Ga0466970_0278769 3300044765 Bacteria 940
577 Ga0466957_0001339 3300044842 Bacteria 12861
578 Ga0466957_0007088 3300044842 Bacteria 6339
579 Ga0466957_0011435 3300044842 Bacteria 5122
580 Ga0466957_0039535 3300044842 Bacteria 2846
581 Ga0466957_0057363 3300044842 Bacteria 2383
582 Ga0466957_0271628 3300044842 Bacteria 1132
583 Ga0466957_0291647 3300044842 Bacteria 1094
584 Ga0466957_0382962 3300044842 Bacteria 959
585 Ga0466957_0516765 3300044842 Bacteria 829
586 Ga0466957_0808085 3300044842 Bacteria 666
587 Ga0466960_0000545 3300044901 Bacteria 12952
588 Ga0466960_0009414 3300044901 Bacteria 4027
589 Ga0466960_0043927 3300044901 Bacteria 2128
590 Ga0466960_0074025 3300044901 Bacteria 1701
591 Ga0466960_0074522 3300044901 Bacteria 1696
592 Ga0466960_0148616 3300044901 Bacteria 1250
593 Ga0466960_0413912 3300044901 Bacteria 778
594 Ga0466960_0451110 3300044901 Bacteria 747
595 Ga0466959_0012175 3300045049 Bacteria 6207
596 Ga0466959_0052106 3300045049 Bacteria 2999
597 Ga0466959_0063775 3300045049 Bacteria 2675
598 Ga0466959_0076887 3300045049 Bacteria 2410
599 Ga0466959_0097627 3300045049 Bacteria 2105
600 Ga0466959_0218634 3300045049 Bacteria 1322
601 Ga0466959_0306126 3300045049 Bacteria 1088
602 Ga0466959_0310199 3300045049 Bacteria 1079
603 Ga0466959_0505813 3300045049 Bacteria 816
604 Ga0466958_0000286 3300045836 Bacteria 19669
605 Ga0466958_0003205 3300045836 Bacteria 8445
606 Ga0466958_0005390 3300045836 Bacteria 6876
607 Ga0466958_0006613 3300045836 Bacteria 6321
608 Ga0466958_0139801 3300045836 Bacteria 1524
609 Ga0466958_0261149 3300045836 Bacteria 1108
610 Ga0466958_0529274 3300045836 Bacteria 765
611 Ga0466967_0001907 3300045976 Bacteria 12597
612 Ga0466967_0028779 3300045976 Bacteria 4643
613 Ga0466967_0049993 3300045976 Bacteria 3659
614 Ga0466967_0051985 3300045976 Bacteria 3594
615 Ga0466967_0058549 3300045976 Bacteria 3406
616 Ga0466967_0070645 3300045976 Bacteria 3124
617 Ga0466967_0122015 3300045976 Bacteria 2409
618 Ga0466967_0171974 3300045976 Bacteria 2039
619 Ga0466967_0235862 3300045976 Bacteria 1743
620 Ga0466967_0291819 3300045976 Bacteria 1567
621 Ga0466967_0408224 3300045976 Bacteria 1322
622 Ga0466967_0675615 3300045976 Bacteria 1022
623 Ga0466967_0767672 3300045976 Bacteria 956
624 Ga0466967_0870101 3300045976 Bacteria 896
625 Ga0466967_0935787 3300045976 Bacteria 862
626 Ga0466967_0980453 3300045976 Bacteria 841
627 Ga0466967_1253284 3300045976 Bacteria 739
628 Ga0495592_0174105 3300046454 Bacteria 1471
629 Ga0495592_0300444 3300046454 Bacteria 1043
630 Ga0495592_0347987 3300046454 Bacteria 951
631 Ga0495629_0004354 3300046459 Bacteria 10616
632 Ga0495629_0016513 3300046459 Bacteria 5300
633 Ga0495638_0000781 3300046460 Bacteria 33599
634 Ga0495641_0029861 3300046461 Bacteria 2621
635 Ga0495651_0036671 3300046462 Bacteria 3816
636 Ga0495651_0100244 3300046462 Bacteria 2158
637 Ga0495582_0077907 3300046473 Bacteria 1838
638 Ga0495639_0100598 3300046475 Bacteria 1364
639 Ga0495662_0001293 3300046476 Bacteria 12380
640 Ga0495664_0065710 3300046477 Bacteria 2162
641 Ga0495594_0329653 3300046499 Bacteria 869
642 Ga0495607_0007731 3300046501 Bacteria 7404
643 Ga0495583_0052849 3300046506 Bacteria 1846
644 Ga0495608_0056806 3300046511 Bacteria 2583
645 Ga0495618_0004580 3300046514 Bacteria 8477
646 Ga0495618_0236657 3300046514 Bacteria 1149
647 Ga0495618_0243915 3300046514 Bacteria 1129
648 Ga0495628_0035741 3300046516 Bacteria 3991
649 Ga0495628_0450822 3300046516 Bacteria 934
650 Ga0495648_0006523 3300046524 Bacteria 9504
651 Ga0495666_0048666 3300046526 Bacteria 2041
652 Ga0495642_0142816 3300046528 Bacteria 1034
653 Ga0495652_0076982 3300046529 Bacteria 2766
654 Ga0495665_0002875 3300046531 Bacteria 9304
655 Ga0495665_0138816 3300046531 Bacteria 1271
656 Ga0495640_0015684 3300046533 Bacteria 5691
657 Ga0495586_0024940 3300046535 Bacteria 3198
658 Ga0495587_0187551 3300046536 Bacteria 1171
659 Ga0495645_0005175 3300046543 Bacteria 8935
660 Ga0495645_0103761 3300046543 Bacteria 2020
661 Ga0495633_0292144 3300046558 Bacteria 741
662 Ga0495667_0388733 3300046559 Bacteria 879
663 Ga0495656_0170912 3300046615 Bacteria 1063
664 Ga0495668_0047758 3300046616 Bacteria 2376
665 Ga0495668_0272729 3300046616 Bacteria 927
666 Ga0495668_0302883 3300046616 Bacteria 876
667 Ga0495634_0170891 3300046642 Bacteria 1366
668 Ga0495625_0384398 3300046660 Bacteria 880
669 Ga0495635_0107164 3300046663 Bacteria 1909
670 Ga0495635_0317246 3300046663 Bacteria 1043
671 Ga0495588_0017865 3300046674 Bacteria 3452
672 Ga0495588_0095747 3300046674 Bacteria 1557
673 Ga0495657_0006898 3300046675 Bacteria 8825
674 Ga0495657_0246710 3300046675 Bacteria 1076
675 Ga0495599_0479115 3300046678 Bacteria 734
676 Ga0495623_0066225 3300046679 Bacteria 2257
677 Ga0495623_0115713 3300046679 Bacteria 1620
678 Ga0495658_0057359 3300046683 Bacteria 2224
679 Ga0495658_0072652 3300046683 Bacteria 2001
680 Ga0495613_0042705 3300046689 Bacteria 3354
681 Ga0495624_0027392 3300046690 Bacteria 3732
682 Ga0495581_0003604 3300047315 Bacteria 8912
683 Ga0495581_0058051 3300047315 Bacteria 2234
684 Ga0495604_0191960 3300047317 Bacteria 1422
685 Ga0495674_0011955 3300047319 Bacteria 8185
686 Ga0495674_0086909 3300047319 Bacteria 2676
687 Ga0495674_0201168 3300047319 Bacteria 1652
688 Ga0495672_0007843 3300047320 Bacteria 7972
689 Ga0495676_0042610 3300047321 Bacteria 3724
690 Ga0495676_0136072 3300047321 Bacteria 1767
691 Ga0495680_0064078 3300047322 Bacteria 2819
692 Ga0495683_0000352 3300047323 Bacteria 38035
693 Ga0495675_0017905 3300047444 Bacteria 4491
694 Ga0495677_0253894 3300047445 Bacteria 688
695 Ga0495673_0003082 3300047469 Bacteria 11203
696 Ga0495684_0043000 3300047471 Bacteria 3458
697 Ga0495593_0026581 3300047673 Bacteria 3194
698 Ga0495593_0070183 3300047673 Bacteria 1821
699 Ga0495602_0012428 3300048088 Bacteria 8754
700 Ga0495602_0114175 3300048088 Bacteria 2187
701 Ga0495602_0184954 3300048088 Bacteria 1603
702 Ga0496100_0000489 3300048903 Bacteria 19075
703 Ga0496100_0041990 3300048903 Bacteria 2918
704 Ga0496100_0060667 3300048903 Bacteria 2489
705 Ga0496100_0181756 3300048903 Bacteria 1521
706 Ga0496101_0000791 3300048904 Bacteria 18709
707 Ga0496101_0017960 3300048904 Bacteria 4801
708 Ga0496101_0023846 3300048904 Bacteria 4230
709 Ga0496101_0116066 3300048904 Bacteria 2020
710 Ga0496102_0000018 3300048905 Bacteria 266847
711 Ga0496102_0042256 3300048905 Bacteria 4131
712 Ga0496102_0126905 3300048905 Bacteria 2385
713 Ga0496102_0226117 3300048905 Bacteria 1764
714 Ga0496102_0229005 3300048905 Bacteria 1752
715 Ga0496102_0474060 3300048905 Bacteria 1173
716 Ga0496103_0000325 3300048906 Bacteria 43734
717 Ga0496103_0008653 3300048906 Bacteria 6044
718 Ga0496104_0001001 3300048907 Bacteria 24162
719 Ga0496104_0009497 3300048907 Bacteria 8657
720 Ga0496104_0052984 3300048907 Bacteria 3833
721 Ga0496104_0168081 3300048907 Bacteria 2103
722 Ga0496104_0441808 3300048907 Bacteria 1213
723 Ga0496104_0463873 3300048907 Bacteria 1178
724 Ga0496105_0024467 3300048908 Bacteria 4906
725 Ga0496105_0758613 3300048908 Bacteria 740
726 Ga0496106_0001362 3300048909 Bacteria 18293
727 Ga0496106_0010104 3300048909 Bacteria 6971
728 Ga0496106_0063859 3300048909 Bacteria 2799
729 Ga0496107_0072604 3300048910 Bacteria 2502
730 Ga0496107_0097029 3300048910 Bacteria 2157
731 Ga0496107_0560919 3300048910 Bacteria 845
732 Ga0496108_0000124 3300048911 Bacteria 76319
733 Ga0496108_0000188 3300048911 Bacteria 57492
734 Ga0496108_0018062 3300048911 Bacteria 5769
735 Ga0496108_0029885 3300048911 Bacteria 4516
736 Ga0496108_0156438 3300048911 Bacteria 1969
737 Ga0496108_0332535 3300048911 Bacteria 1325
738 Ga0496109_0019629 3300048912 Bacteria 5962
739 Ga0496109_0113296 3300048912 Bacteria 2523
740 Ga0496109_0157633 3300048912 Bacteria 2126
741 Ga0496109_0251111 3300048912 Bacteria 1666
742 Ga0496109_0340986 3300048912 Bacteria 1415
743 Ga0496110_0086875 3300048913 Bacteria 2793
744 Ga0496111_0144079 3300048914 Bacteria 1766
745 Ga0496111_0831283 3300048914 Bacteria 667
746 Ga0496112_0014679 3300048915 Bacteria 7281
747 Ga0496112_0057326 3300048915 Bacteria 3835
748 Ga0496112_0096756 3300048915 Bacteria 2922
749 Ga0496112_0134896 3300048915 Bacteria 2439
750 Ga0496112_0211883 3300048915 Bacteria 1894
751 Ga0496112_0223687 3300048915 Bacteria 1838
752 Ga0496113_0020167 3300048916 Bacteria 4681
753 Ga0496113_0063520 3300048916 Bacteria 2790
754 Ga0496114_0001466 3300048917 Bacteria 17949
755 Ga0496114_0019207 3300048917 Bacteria 5537
756 Ga0496114_0031850 3300048917 Bacteria 4338
757 Ga0496115_0002019 3300048918 Bacteria 14508
758 Ga0496115_0022276 3300048918 Bacteria 4907
759 Ga0496115_0036400 3300048918 Bacteria 3897
760 Ga0496116_0000272 3300048919 Bacteria 89950
761 Ga0496117_0000291 3300048920 Bacteria 89991
762 Ga0496117_0319657 3300048920 Bacteria 814
763 Ga0496118_0000278 3300048921 Bacteria 89984
764 Ga0496119_0000336 3300048922 Bacteria 65760
765 Ga0496119_0001512 3300048922 Bacteria 27802
766 Ga0496120_0013763 3300048923 Bacteria 5428
767 Ga0496120_0060628 3300048923 Bacteria 2115
768 Ga0496121_0005186 3300048924 Bacteria 16888
769 Ga0496122_0000239 3300048925 Bacteria 123074
770 Ga0496123_0280703 3300048926 Bacteria 805
771 Ga0496124_0040012 3300048927 Bacteria 4058
772 Ga0496125_0024739 3300048928 Bacteria 5514
773 Ga0496125_0094464 3300048928 Bacteria 2227
774 Ga0496125_0118307 3300048928 Bacteria 1898
775 Ga0496125_0188739 3300048928 Bacteria 1364
776 Ga0496126_0000036 3300048929 Bacteria 354901
777 Ga0496126_0000107 3300048929 Bacteria 197579
778 Ga0496126_0021145 3300048929 Bacteria 6362
779 Ga0501032_0001098 3300049569 Bacteria 21615
780 Ga0501034_0001976 3300049571 Bacteria 25980
781 Ga0501034_0016261 3300049571 Bacteria 7636
782 Ga0501034_0034971 3300049571 Bacteria 5096
783 Ga0501036_0000289 3300049572 Bacteria 34814
784 Ga0501036_0026027 3300049572 Bacteria 4937
785 Ga0501037_0000809 3300049573 Bacteria 23425
786 Ga0501038_0006905 3300049574 Bacteria 10486
787 Ga0501039_0001201 3300049575 Bacteria 19012
788 Ga0501039_0050992 3300049575 Bacteria 3203
789 Ga0501042_0005896 3300049578 Bacteria 7921
790 Ga0501043_0000873 3300049579 Bacteria 26725
791 Ga0501043_0002541 3300049579 Bacteria 15427
792 Ga0501047_0000142 3300049581 Bacteria 87761
793 Ga0501047_0008474 3300049581 Bacteria 9701
794 Ga0501067_0037300 3300049583 Bacteria 2700
795 Ga0501070_0003906 3300049586 Bacteria 12861
796 Ga0501070_0143993 3300049586 Bacteria 1968
797 Ga0501070_0483512 3300049586 Bacteria 996
798 Ga0501070_0925005 3300049586 Bacteria 679
799 Ga0501073_0017528 3300049589 Bacteria 5186
800 Ga0501076_0537016 3300049592 Bacteria 964
801 Ga0501079_0501176 3300049741 Bacteria 955
802 Ga0501080_0178548 3300049742 Bacteria 1955
803 Ga0501044_0003752 3300049823 Bacteria 17076
804 Ga0501044_0051694 3300049823 Bacteria 4236
805 Ga0501045_0303357 3300049824 Bacteria 1189
806 nmdc:mga03683_38352_c1 3300050489 Bacteria 1956
807 nmdc:mga03n38_133659_c1 3300050490 Bacteria 1232
808 nmdc:mga03n38_1752_c1 3300050490 Bacteria 6418
809 nmdc:mga03n38_35530_c1 3300050490 Bacteria 2136
810 nmdc:mga03n38_7137_c1 3300050490 Bacteria 3934
811 nmdc:mga00v17_1490_c1 3300050491 Bacteria 12242
812 nmdc:mga00v17_172852_c1 3300050491 Bacteria 1393
813 nmdc:mga00v17_18458_c1 3300050491 Bacteria 3962
814 nmdc:mga00v17_203885_c1 3300050491 Bacteria 1279
815 nmdc:mga00v17_214165_c1 3300050491 Bacteria 1247
816 nmdc:mga00v17_228715_c1 3300050491 Bacteria 1205
817 nmdc:mga00v17_28088_c1 3300050491 Bacteria 3292
818 nmdc:mga00v17_29197_c1 3300050491 Bacteria 3235
819 nmdc:mga00v17_381715_c1 3300050491 Bacteria 916
820 nmdc:mga0yw44_393542_c1 3300050492 Bacteria 936
821 nmdc:mga0yw44_617850_c1 3300050492 Bacteria 736
822 nmdc:mga0yw44_95490_c1 3300050492 Bacteria 1886
823 nmdc:mga06z11_10362_c1 3300050494 Bacteria 3969
824 nmdc:mga06z11_184271_c1 3300050494 Bacteria 1205
825 nmdc:mga07m45_118973_c1 3300050496 Bacteria 1525
826 nmdc:mga07m45_4098_c1 3300050496 Bacteria 7111
827 nmdc:mga07m45_57592_c1 3300050496 Bacteria 2197
828 nmdc:mga07m45_83898_c1 3300050496 Bacteria 1821
829 nmdc:mga05p37_243430_c2 3300050507 Bacteria 990
830 nmdc:mga09592_287873_c1 3300050508 Bacteria 1424
831 nmdc:mga09592_509866_c1 3300050508 Bacteria 1035
832 nmdc:mga0qj67_51785_c1 3300050509 Bacteria 3247
833 nmdc:mga0qj67_7847_c1 3300050509 Bacteria 7884
834 nmdc:mga06r32_77496_c1 3300050510 Bacteria 3229
835 nmdc:mga08y16_112101_c1 3300050511 Bacteria 2839
836 nmdc:mga0n895_102216_c1 3300050512 Bacteria 2877
837 nmdc:mga0rr50_460952_c1 3300050513 Bacteria 1078
838 nmdc:mga08x19_18639_c1 3300050514 Bacteria 4253
839 nmdc:mga0a205_208355_c1 3300050515 Bacteria 1844
840 nmdc:mga0a205_852427_c1 3300050515 Bacteria 758
841 nmdc:mga0sz30_11049_c1 3300050516 Bacteria 3473
842 nmdc:mga0sz30_2051_c1 3300050516 Bacteria 7198
843 nmdc:mga0sz30_2244_c1 3300050516 Bacteria 6915
844 Ga0495601_0145041 3300053077 Bacteria 1549
845 Ga0495612_0011557 3300053078 Bacteria 3556
846 Ga0495595_0185885 3300053084 Bacteria 1031
847 Ga0495619_0006007 3300053085 Bacteria 7690
848 Ga0495619_0072282 3300053085 Bacteria 2310
849 Ga0500646_0001656 3300053090 Bacteria 5887
850 Ga0500641_0060980 3300053096 Bacteria 1570
851 Ga0500556_0197697 3300053104 Bacteria 794
852 Ga0500588_0049260 3300053146 Bacteria 1306
853 Ga0500616_0128861 3300053153 Bacteria 1198
854 Ga0466962_0005148 3300061719 Bacteria 6290
855 Ga0466962_0036499 3300061719 Bacteria 2352
856 Ga0466962_0063046 3300061719 Bacteria 1770
857 Ga0466962_0158012 3300061719 Bacteria 1101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100603973 Ga0070714_1006039732 191
2 3300005618 Ga0068864_100988199 Ga0068864_1009881991 191
3 3300006028 Ga0070717_10106319 Ga0070717_101063192 191
4 3300035692 Ga0373935_0246031 Ga0373935_0246031_133_747 191
5 3300035724 Ga0373933_0135582 Ga0373933_0135582_36_650 191
6 3300036401 Ga0373937_0059354 Ga0373937_0059354_2872_3486 191
7 3300037068 Ga0373925_0113795 Ga0373925_0113795_1438_2052 191
8 3300046514 Ga0495618_0243915 Ga0495618_0243915_119_733 191
9 3300046529 Ga0495652_0076982 Ga0495652_0076982_1639_2253 191
10 3300046543 Ga0495645_0103761 Ga0495645_0103761_172_786 191
11 3300046663 Ga0495635_0107164 Ga0495635_0107164_288_902 191
12 3300046678 Ga0495599_0479115 Ga0495599_0479115_96_710 191
13 3300047319 Ga0495674_0011955 Ga0495674_0011955_2386_3000 191
14 3300047321 Ga0495676_0136072 Ga0495676_0136072_484_1098 191
15 3300048088 Ga0495602_0184954 Ga0495602_0184954_474_1088 191
16 3300050491 nmdc:mga00v17_381715_c1 nmdc:mga00v17_381715_c1_101_676 191
17 3300048914 Ga0496111_0831283 Ga0496111_0831283_71_655 194
18 iso_pu_bacteria 2870782633 2870785047 195
19 3300048908 Ga0496105_0758613 Ga0496105_0758613_20_610 196
20 3300049741 Ga0501079_0501176 Ga0501079_0501176_214_804 196
21 iso_pu_bacteria 8056060235 8056061828 196
22 3300031691 Ga0316579_10001613 Ga0316579_100016136 197
23 3300044684 Ga0466966_0015419 Ga0466966_0015419_1017_1610 197
24 3300044694 Ga0466963_0000039 Ga0466963_0000039_21752_22345 197
25 3300044719 Ga0466971_0010029 Ga0466971_0010029_2913_3506 197
26 3300044842 Ga0466957_0001339 Ga0466957_0001339_5789_6382 197
27 3300045049 Ga0466959_0012175 Ga0466959_0012175_584_1177 197
28 3300045836 Ga0466958_0000286 Ga0466958_0000286_8155_8748 197
29 3300061719 Ga0466962_0005148 Ga0466962_0005148_4242_4835 197
30 3300048908 Ga0496105_0024467 Ga0496105_0024467_1502_2098 198
31 3300048918 Ga0496115_0022276 Ga0496115_0022276_1629_2225 198
32 3300044694 Ga0466963_0410506 Ga0466963_0410506_331_945 199
33 3300045976 Ga0466967_1253284 Ga0466967_1253284_57_656 199
34 3300006844 Ga0075428_100163155 Ga0075428_1001631552 200
35 3300009176 Ga0105242_11439498 Ga0105242_114394981 200
36 3300048911 Ga0496108_0000124 Ga0496108_0000124_2336_2938 200
37 3300049571 Ga0501034_0016261 Ga0501034_0016261_5179_5781 200
38 3300049572 Ga0501036_0000289 Ga0501036_0000289_17550_18152 200
39 3300049574 Ga0501038_0006905 Ga0501038_0006905_503_1105 200
40 3300049575 Ga0501039_0050992 Ga0501039_0050992_455_1057 200
41 3300049578 Ga0501042_0005896 Ga0501042_0005896_1635_2237 200
42 3300049579 Ga0501043_0000873 Ga0501043_0000873_15049_15651 200
43 3300049581 Ga0501047_0008474 Ga0501047_0008474_2358_2960 200
44 3300049592 Ga0501076_0537016 Ga0501076_0537016_120_722 200
45 3300049823 Ga0501044_0051694 Ga0501044_0051694_660_1262 200
46 3300049824 Ga0501045_0303357 Ga0501045_0303357_48_650 200
47 iso_pu_bacteria 2501939600 2501943020 200
48 iso_pu_bacteria 2547132424 2548697779 200
49 iso_pu_bacteria 2551306166 2552109393 200
50 iso_pu_bacteria 2565956761 2566996507 200
51 iso_pu_bacteria 2585427649 2586063510 200
52 iso_pu_bacteria 2622736605 2623501290 200
53 iso_pu_bacteria 2643221641 2644228301 200
54 iso_pu_bacteria 2643221687 2644486375 200
55 iso_pu_bacteria 2643221692 2644512924 200
56 iso_pu_bacteria 2643221715 2644637343 200
57 iso_pu_bacteria 2731639228 2731907766 200
58 iso_pu_bacteria 2738541264 2738666626 200
59 iso_pu_bacteria 2738541308 2738891262 200
60 iso_pu_bacteria 2738541356 2739145470 200
61 iso_pu_bacteria 2738543005 2739205401 200
62 iso_pu_bacteria 2739367898 2740165786 200
63 iso_pu_bacteria 2751185734 2753070819 200
64 iso_pu_bacteria 2784132109 2784472301 200
65 iso_pu_bacteria 2799112218 2799184430 200
66 iso_pu_bacteria 2808606522 2809587332 200
67 iso_pu_bacteria 2816332139 2816504324 200
68 iso_pu_bacteria 2842134933 2842138366 200
69 iso_pu_bacteria 2856858025 2856863813 200
70 iso_pu_bacteria 2870721527 2870726604 200
71 iso_pu_bacteria 2891554331 2891555610 200
72 iso_pu_bacteria 2899359706 2899361598 200
73 iso_pu_bacteria 2902810491 2902815463 200
74 iso_pu_bacteria 2902837492 2902840208 200
75 iso_pu_bacteria 2915768154 2915774935 200
76 iso_pu_bacteria 2917736166 2917738706 200
77 iso_pu_bacteria 2919713450 2919716030 200
78 iso_pu_bacteria 2922554459 2922555690 200
79 iso_pu_bacteria 2929212328 2929215026 200
80 iso_pu_bacteria 2932398195 2932399882 200
81 iso_pu_bacteria 2939582691 2939587389 200
82 iso_pu_bacteria 649633069 649814459 200
83 iso_pu_bacteria 8003314358 8003324235 200
84 iso_pu_bacteria 8047710418 8047718108 200
85 iso_pu_bacteria 8054472261 8054473064 200
86 iso_pu_bacteria 8056207758 8056212087 200
87 3300009148 Ga0105243_10002154 Ga0105243_1000215414 202
88 3300025935 Ga0207709_10004979 Ga0207709_100049796 202
89 iso_pu_bacteria 2738543011 2739238797 202
90 iso_pu_bacteria 2738543034 2739362155 202
91 iso_pu_bacteria 2744054611 2744956039 202
92 iso_pu_bacteria 2889300758 2889301072 202
93 iso_pu_bacteria 2904765812 2904770063 202
94 iso_pu_bacteria 2904770941 2904771088 202
95 iso_pu_bacteria 2908811453 2908815132 202
96 iso_pu_bacteria 2919420072 2919424385 202
97 iso_pu_bacteria 2919432681 2919436778 202
98 iso_pu_bacteria 2939743619 2939744590 202
99 iso_pu_bacteria 2956939328 2956940411 202
100 iso_pu_bacteria 2974315732 2974317306 202
101 iso_pu_bacteria 2984523437 2984525513 202
102 iso_pu_bacteria 3001119090 3001121833 202
103 3300005937 Ga0081455_10001022 Ga0081455_1000102222 203
104 3300000549 LJQas_1010094 LJQas_10100942 204
105 3300000549 LJQas_1016001 LJQas_10160012 204
106 3300001979 JGI24740J21852_10038840 JGI24740J21852_100388402 204
107 3300001989 JGI24739J22299_10037256 JGI24739J22299_100372562 204
108 3300001989 JGI24739J22299_10067530 JGI24739J22299_100675302 204
109 3300002073 JGI24745J21846_1008834 JGI24745J21846_10088342 204
110 3300002075 JGI24738J21930_10057137 JGI24738J21930_100571372 204
111 3300002077 JGI24744J21845_10008629 JGI24744J21845_100086292 204
112 3300003203 JGI25406J46586_10047522 JGI25406J46586_100475222 204
113 3300003790 Ga0055528_1049220 Ga0055528_10492202 204
114 3300003792 Ga0055540_1000029 Ga0055540_1000029119 204
115 3300003792 Ga0055540_1004283 Ga0055540_10042834 204
116 3300003792 Ga0055540_1007072 Ga0055540_10070723 204
117 3300003792 Ga0055540_1009166 Ga0055540_10091662 204
118 3300003911 JGI25405J52794_10014104 JGI25405J52794_100141041 204
119 3300005327 Ga0070658_10344057 Ga0070658_103440572 204
120 3300005328 Ga0070676_10023714 Ga0070676_100237142 204
121 3300005329 Ga0070683_100321097 Ga0070683_1003210972 204
122 3300005329 Ga0070683_100523979 Ga0070683_1005239792 204
123 3300005330 Ga0070690_100119435 Ga0070690_1001194352 204
124 3300005334 Ga0068869_100004054 Ga0068869_1000040545 204
125 3300005335 Ga0070666_10018396 Ga0070666_100183964 204
126 3300005335 Ga0070666_10346902 Ga0070666_103469021 204
127 3300005337 Ga0070682_100037437 Ga0070682_1000374373 204
128 3300005337 Ga0070682_100281960 Ga0070682_1002819602 204
129 3300005338 Ga0068868_100000265 Ga0068868_10000026517 204
130 3300005338 Ga0068868_100138486 Ga0068868_1001384862 204
131 3300005338 Ga0068868_100882161 Ga0068868_1008821611 204
132 3300005339 Ga0070660_100548992 Ga0070660_1005489922 204
133 3300005341 Ga0070691_10015258 Ga0070691_100152583 204
134 3300005343 Ga0070687_100014239 Ga0070687_1000142393 204
135 3300005344 Ga0070661_100223735 Ga0070661_1002237352 204
136 3300005347 Ga0070668_100001311 Ga0070668_10000131114 204
137 3300005347 Ga0070668_100001483 Ga0070668_10000148312 204
138 3300005347 Ga0070668_100203164 Ga0070668_1002031642 204
139 3300005353 Ga0070669_100073997 Ga0070669_1000739972 204
140 3300005356 Ga0070674_100000174 Ga0070674_10000017421 204
141 3300005356 Ga0070674_100008181 Ga0070674_1000081815 204
142 3300005356 Ga0070674_100035094 Ga0070674_1000350942 204
143 3300005365 Ga0070688_100422975 Ga0070688_1004229752 204
144 3300005366 Ga0070659_100066082 Ga0070659_1000660822 204
145 3300005366 Ga0070659_100341922 Ga0070659_1003419222 204
146 3300005367 Ga0070667_100000598 Ga0070667_10000059815 204
147 3300005367 Ga0070667_100031229 Ga0070667_1000312292 204
148 3300005367 Ga0070667_100060330 Ga0070667_1000603302 204
149 3300005367 Ga0070667_100112564 Ga0070667_1001125642 204
150 3300005367 Ga0070667_100121679 Ga0070667_1001216792 204
151 3300005367 Ga0070667_100473121 Ga0070667_1004731212 204
152 3300005367 Ga0070667_100605382 Ga0070667_1006053822 204
153 3300005434 Ga0070709_10000334 Ga0070709_1000033411 204
154 3300005434 Ga0070709_10009601 Ga0070709_100096012 204
155 3300005434 Ga0070709_10059467 Ga0070709_100594672 204
156 3300005435 Ga0070714_100003331 Ga0070714_1000033316 204
157 3300005435 Ga0070714_100003659 Ga0070714_1000036599 204
158 3300005435 Ga0070714_100075426 Ga0070714_1000754262 204
159 3300005435 Ga0070714_100238894 Ga0070714_1002388942 204
160 3300005435 Ga0070714_100763722 Ga0070714_1007637222 204
161 3300005435 Ga0070714_100786561 Ga0070714_1007865612 204
162 3300005435 Ga0070714_100923598 Ga0070714_1009235982 204
163 3300005436 Ga0070713_100049498 Ga0070713_1000494981 204
164 3300005437 Ga0070710_10000333 Ga0070710_1000033310 204
165 3300005437 Ga0070710_10008072 Ga0070710_100080722 204
166 3300005437 Ga0070710_10112108 Ga0070710_101121082 204
167 3300005438 Ga0070701_10008783 Ga0070701_100087834 204
168 3300005438 Ga0070701_10400747 Ga0070701_104007472 204
169 3300005439 Ga0070711_100006447 Ga0070711_1000064474 204
170 3300005439 Ga0070711_100006774 Ga0070711_1000067743 204
171 3300005439 Ga0070711_100010763 Ga0070711_1000107633 204
172 3300005440 Ga0070705_100022320 Ga0070705_1000223202 204
173 3300005441 Ga0070700_100019837 Ga0070700_1000198372 204
174 3300005444 Ga0070694_100025132 Ga0070694_1000251322 204
175 3300005444 Ga0070694_100684766 Ga0070694_1006847661 204
176 3300005445 Ga0070708_100148498 Ga0070708_1001484983 204
177 3300005445 Ga0070708_100588939 Ga0070708_1005889392 204
178 3300005455 Ga0070663_100000604 Ga0070663_1000006043 204
179 3300005455 Ga0070663_100175591 Ga0070663_1001755912 204
180 3300005456 Ga0070678_100000417 Ga0070678_10000041713 204
181 3300005456 Ga0070678_100180596 Ga0070678_1001805962 204
182 3300005457 Ga0070662_100044297 Ga0070662_1000442971 204
183 3300005459 Ga0068867_100001676 Ga0068867_1000016764 204
184 3300005459 Ga0068867_100044588 Ga0068867_1000445882 204
185 3300005466 Ga0070685_10013555 Ga0070685_100135553 204
186 3300005468 Ga0070707_100017252 Ga0070707_1000172522 204
187 3300005471 Ga0070698_100025984 Ga0070698_1000259845 204
188 3300005471 Ga0070698_100090683 Ga0070698_1000906832 204
189 3300005518 Ga0070699_100576652 Ga0070699_1005766522 204
190 3300005535 Ga0070684_100551280 Ga0070684_1005512802 204
191 3300005536 Ga0070697_100039286 Ga0070697_1000392862 204
192 3300005539 Ga0068853_100008214 Ga0068853_1000082145 204
193 3300005539 Ga0068853_100026278 Ga0068853_1000262784 204
194 3300005539 Ga0068853_100061462 Ga0068853_1000614622 204
195 3300005543 Ga0070672_100079326 Ga0070672_1000793262 204
196 3300005544 Ga0070686_100593379 Ga0070686_1005933791 204
197 3300005545 Ga0070695_100070067 Ga0070695_1000700672 204
198 3300005545 Ga0070695_100124780 Ga0070695_1001247802 204
199 3300005546 Ga0070696_100041771 Ga0070696_1000417712 204
200 3300005547 Ga0070693_100006907 Ga0070693_1000069073 204
201 3300005548 Ga0070665_100049121 Ga0070665_1000491211 204
202 3300005548 Ga0070665_100356287 Ga0070665_1003562872 204
203 3300005548 Ga0070665_100422571 Ga0070665_1004225712 204
204 3300005549 Ga0070704_100004004 Ga0070704_1000040047 204
205 3300005549 Ga0070704_100094608 Ga0070704_1000946082 204
206 3300005549 Ga0070704_100244951 Ga0070704_1002449511 204
207 3300005563 Ga0068855_100139807 Ga0068855_1001398072 204
208 3300005578 Ga0068854_100000759 Ga0068854_10000075910 204
209 3300005578 Ga0068854_100107361 Ga0068854_1001073612 204
210 3300005614 Ga0068856_100019959 Ga0068856_1000199592 204
211 3300005614 Ga0068856_101010482 Ga0068856_1010104822 204
212 3300005614 Ga0068856_101185980 Ga0068856_1011859802 204
213 3300005616 Ga0068852_100153467 Ga0068852_1001534672 204
214 3300005616 Ga0068852_100365385 Ga0068852_1003653852 204
215 3300005616 Ga0068852_100715465 Ga0068852_1007154651 204
216 3300005617 Ga0068859_100000995 Ga0068859_10000099511 204
217 3300005618 Ga0068864_100424164 Ga0068864_1004241642 204
218 3300005718 Ga0068866_10000103 Ga0068866_1000010313 204
219 3300005719 Ga0068861_100018456 Ga0068861_1000184564 204
220 3300005719 Ga0068861_100615656 Ga0068861_1006156562 204
221 3300005834 Ga0068851_10170423 Ga0068851_101704232 204
222 3300005841 Ga0068863_100020574 Ga0068863_1000205744 204
223 3300005841 Ga0068863_100080738 Ga0068863_1000807382 204
224 3300005841 Ga0068863_100774120 Ga0068863_1007741202 204
225 3300005842 Ga0068858_100007072 Ga0068858_1000070729 204
226 3300005842 Ga0068858_100091221 Ga0068858_1000912213 204
227 3300005842 Ga0068858_100331437 Ga0068858_1003314372 204
228 3300005842 Ga0068858_100412053 Ga0068858_1004120532 204
229 3300005843 Ga0068860_100054492 Ga0068860_1000544923 204
230 3300005843 Ga0068860_100256324 Ga0068860_1002563241 204
231 3300005843 Ga0068860_100594257 Ga0068860_1005942572 204
232 3300005844 Ga0068862_100160825 Ga0068862_1001608252 204
233 3300005937 Ga0081455_10000018 Ga0081455_1000001876 204
234 3300005981 Ga0081538_10072677 Ga0081538_100726772 204
235 3300005985 Ga0081539_10000079 Ga0081539_10000079162 204
236 3300005985 Ga0081539_10005436 Ga0081539_100054368 204
237 3300006028 Ga0070717_10099227 Ga0070717_100992272 204
238 3300006028 Ga0070717_10113334 Ga0070717_101133341 204
239 3300006028 Ga0070717_10248449 Ga0070717_102484492 204
240 3300006028 Ga0070717_11114927 Ga0070717_111149272 204
241 3300006038 Ga0075365_10002087 Ga0075365_100020874 204
242 3300006038 Ga0075365_10035217 Ga0075365_100352172 204
243 3300006048 Ga0075363_100000458 Ga0075363_1000004582 204
244 3300006048 Ga0075363_100003272 Ga0075363_1000032725 204
245 3300006048 Ga0075363_100051197 Ga0075363_1000511972 204
246 3300006048 Ga0075363_100124081 Ga0075363_1001240812 204
247 3300006048 Ga0075363_100134450 Ga0075363_1001344502 204
248 3300006051 Ga0075364_10003823 Ga0075364_100038232 204
249 3300006051 Ga0075364_10025357 Ga0075364_100253574 204
250 3300006051 Ga0075364_10044523 Ga0075364_100445232 204
251 3300006051 Ga0075364_10057388 Ga0075364_100573882 204
252 3300006051 Ga0075364_10073048 Ga0075364_100730482 204
253 3300006051 Ga0075364_10194647 Ga0075364_101946472 204
254 3300006163 Ga0070715_10017160 Ga0070715_100171602 204
255 3300006163 Ga0070715_10027262 Ga0070715_100272622 204
256 3300006163 Ga0070715_10051830 Ga0070715_100518302 204
257 3300006173 Ga0070716_100009809 Ga0070716_1000098093 204
258 3300006173 Ga0070716_100011606 Ga0070716_1000116063 204
259 3300006175 Ga0070712_100000214 Ga0070712_1000002144 204
260 3300006177 Ga0075362_10069700 Ga0075362_100697002 204
261 3300006178 Ga0075367_10009242 Ga0075367_100092424 204
262 3300006178 Ga0075367_10086407 Ga0075367_100864072 204
263 3300006178 Ga0075367_10165831 Ga0075367_101658312 204
264 3300006186 Ga0075369_10001785 Ga0075369_100017854 204
265 3300006186 Ga0075369_10011008 Ga0075369_100110084 204
266 3300006186 Ga0075369_10066167 Ga0075369_100661672 204
267 3300006186 Ga0075369_10086590 Ga0075369_100865902 204
268 3300006186 Ga0075369_10171546 Ga0075369_101715462 204
269 3300006237 Ga0097621_100212032 Ga0097621_1002120322 204
270 3300006353 Ga0075370_10088795 Ga0075370_100887952 204
271 3300006353 Ga0075370_10120692 Ga0075370_101206922 204
272 3300006844 Ga0075428_100002717 Ga0075428_10000271711 204
273 3300006846 Ga0075430_100240690 Ga0075430_1002406902 204
274 3300006846 Ga0075430_100691681 Ga0075430_1006916812 204
275 3300006847 Ga0075431_100024200 Ga0075431_1000242002 204
276 3300006852 Ga0075433_10038600 Ga0075433_100386001 204
277 3300006871 Ga0075434_100035227 Ga0075434_1000352273 204
278 3300006880 Ga0075429_100536971 Ga0075429_1005369712 204
279 3300006881 Ga0068865_100120631 Ga0068865_1001206312 204
280 3300006914 Ga0075436_100037276 Ga0075436_1000372762 204
281 3300006914 Ga0075436_100456604 Ga0075436_1004566042 204
282 3300006931 Ga0097620_100000995 Ga0097620_10000099514 204
283 3300007076 Ga0075435_100017043 Ga0075435_1000170432 204
284 3300007076 Ga0075435_100227444 Ga0075435_1002274442 204
285 3300009036 Ga0105244_10148107 Ga0105244_101481071 204
286 3300009094 Ga0111539_10189282 Ga0111539_101892822 204
287 3300009098 Ga0105245_10003044 Ga0105245_100030445 204
288 3300009098 Ga0105245_10347954 Ga0105245_103479542 204
289 3300009101 Ga0105247_10000279 Ga0105247_1000027912 204
290 3300009101 Ga0105247_10052827 Ga0105247_100528272 204
291 3300009101 Ga0105247_10406657 Ga0105247_104066572 204
292 3300009101 Ga0105247_10512105 Ga0105247_105121052 204
293 3300009147 Ga0114129_10007260 Ga0114129_1000726011 204
294 3300009148 Ga0105243_10001443 Ga0105243_1000144318 204
295 3300009148 Ga0105243_10238446 Ga0105243_102384462 204
296 3300009148 Ga0105243_10364050 Ga0105243_103640502 204
297 3300009174 Ga0105241_10037293 Ga0105241_100372931 204
298 3300009174 Ga0105241_10073381 Ga0105241_100733812 204
299 3300009174 Ga0105241_10219295 Ga0105241_102192952 204
300 3300009176 Ga0105242_10000551 Ga0105242_1000055114 204
301 3300009176 Ga0105242_10042392 Ga0105242_100423922 204
302 3300009176 Ga0105242_10392984 Ga0105242_103929841 204
303 3300009177 Ga0105248_10004599 Ga0105248_1000459915 204
304 3300009177 Ga0105248_10443380 Ga0105248_104433801 204
305 3300009545 Ga0105237_10000346 Ga0105237_100003469 204
306 3300009545 Ga0105237_10006150 Ga0105237_100061502 204
307 3300009545 Ga0105237_10489244 Ga0105237_104892442 204
308 3300009551 Ga0105238_10273063 Ga0105238_102730632 204
309 3300009551 Ga0105238_11289461 Ga0105238_112894611 204
310 3300009553 Ga0105249_10011764 Ga0105249_100117647 204
311 3300009553 Ga0105249_10029820 Ga0105249_100298203 204
312 3300009553 Ga0105249_10366864 Ga0105249_103668642 204
313 3300009553 Ga0105249_11401286 Ga0105249_114012862 204
314 3300009986 Ga0105033_100617 Ga0105033_1006173 204
315 3300010375 Ga0105239_10005076 Ga0105239_1000507614 204
316 3300010375 Ga0105239_10034589 Ga0105239_100345894 204
317 3300010375 Ga0105239_10036300 Ga0105239_100363002 204
318 3300010375 Ga0105239_10764427 Ga0105239_107644272 204
319 3300011119 Ga0105246_10344032 Ga0105246_103440322 204
320 3300013105 Ga0157369_10249592 Ga0157369_102495922 204
321 3300013105 Ga0157369_10317595 Ga0157369_103175952 204
322 3300013105 Ga0157369_10878623 Ga0157369_108786232 204
323 3300013105 Ga0157369_10911272 Ga0157369_109112721 204
324 3300013105 Ga0157369_11498374 Ga0157369_114983741 204
325 3300013296 Ga0157374_10023753 Ga0157374_100237534 204
326 3300013296 Ga0157374_10157560 Ga0157374_101575602 204
327 3300013297 Ga0157378_10000675 Ga0157378_100006753 204
328 3300013297 Ga0157378_10214124 Ga0157378_102141243 204
329 3300013306 Ga0163162_10032288 Ga0163162_100322883 204
330 3300013306 Ga0163162_10101325 Ga0163162_101013252 204
331 3300013306 Ga0163162_10571855 Ga0163162_105718552 204
332 3300013307 Ga0157372_10007826 Ga0157372_100078265 204
333 3300013307 Ga0157372_10044097 Ga0157372_100440972 204
334 3300013307 Ga0157372_11062008 Ga0157372_110620082 204
335 3300013308 Ga0157375_10006369 Ga0157375_100063694 204
336 3300013308 Ga0157375_10040117 Ga0157375_100401174 204
337 3300013308 Ga0157375_10207775 Ga0157375_102077752 204
338 3300013308 Ga0157375_11448868 Ga0157375_114488681 204
339 3300014325 Ga0163163_10044957 Ga0163163_100449572 204
340 3300014325 Ga0163163_10304555 Ga0163163_103045552 204
341 3300014325 Ga0163163_10372889 Ga0163163_103728892 204
342 3300014325 Ga0163163_10482290 Ga0163163_104822902 204
343 3300014326 Ga0157380_10000918 Ga0157380_100009185 204
344 3300014326 Ga0157380_10315493 Ga0157380_103154932 204
345 3300014326 Ga0157380_11602997 Ga0157380_116029971 204
346 3300014745 Ga0157377_10331632 Ga0157377_103316322 204
347 3300014968 Ga0157379_10000781 Ga0157379_1000078110 204
348 3300014968 Ga0157379_10024136 Ga0157379_100241364 204
349 3300014968 Ga0157379_10302792 Ga0157379_103027921 204
350 3300014969 Ga0157376_11041991 Ga0157376_110419912 204
351 3300017792 Ga0163161_10009107 Ga0163161_100091076 204
352 3300017792 Ga0163161_10032637 Ga0163161_100326375 204
353 3300017792 Ga0163161_10351008 Ga0163161_103510082 204
354 3300021358 Ga0213873_10000063 Ga0213873_100000639 204
355 3300021377 Ga0213874_10116766 Ga0213874_101167662 204
356 3300021384 Ga0213876_10017707 Ga0213876_100177072 204
357 3300021388 Ga0213875_10000035 Ga0213875_1000003525 204
358 3300021388 Ga0213875_10003836 Ga0213875_100038366 204
359 3300021388 Ga0213875_10033255 Ga0213875_100332552 204
360 3300021388 Ga0213875_10054084 Ga0213875_100540842 204
361 3300025273 Ga0209673_1034518 Ga0209673_10345182 204
362 3300025273 Ga0209673_1044436 Ga0209673_10444362 204
363 3300025303 Ga0209051_1000042 Ga0209051_1000042264 204
364 3300025303 Ga0209051_1000374 Ga0209051_100037455 204
365 3300025303 Ga0209051_1001519 Ga0209051_100151914 204
366 3300025303 Ga0209051_1003476 Ga0209051_10034767 204
367 3300025885 Ga0207653_10183565 Ga0207653_101835652 204
368 3300025893 Ga0207682_10211397 Ga0207682_102113971 204
369 3300025898 Ga0207692_10000585 Ga0207692_1000058510 204
370 3300025898 Ga0207692_10003576 Ga0207692_100035763 204
371 3300025898 Ga0207692_10004810 Ga0207692_100048103 204
372 3300025898 Ga0207692_10054924 Ga0207692_100549242 204
373 3300025899 Ga0207642_10007347 Ga0207642_100073471 204
374 3300025900 Ga0207710_10018095 Ga0207710_100180952 204
375 3300025900 Ga0207710_10048142 Ga0207710_100481422 204
376 3300025901 Ga0207688_10000373 Ga0207688_1000037313 204
377 3300025901 Ga0207688_10004249 Ga0207688_100042497 204
378 3300025901 Ga0207688_10400472 Ga0207688_104004722 204
379 3300025903 Ga0207680_10020508 Ga0207680_100205081 204
380 3300025904 Ga0207647_10033576 Ga0207647_100335762 204
381 3300025904 Ga0207647_10062996 Ga0207647_100629962 204
382 3300025905 Ga0207685_10006954 Ga0207685_100069542 204
383 3300025906 Ga0207699_10002424 Ga0207699_100024244 204
384 3300025906 Ga0207699_10013929 Ga0207699_100139292 204
385 3300025906 Ga0207699_10032210 Ga0207699_100322102 204
386 3300025907 Ga0207645_10026352 Ga0207645_100263524 204
387 3300025907 Ga0207645_10043446 Ga0207645_100434462 204
388 3300025908 Ga0207643_10180298 Ga0207643_101802983 204
389 3300025909 Ga0207705_10253843 Ga0207705_102538432 204
390 3300025910 Ga0207684_10031066 Ga0207684_100310664 204
391 3300025910 Ga0207684_10883775 Ga0207684_108837752 204
392 3300025911 Ga0207654_10565504 Ga0207654_105655041 204
393 3300025914 Ga0207671_10394168 Ga0207671_103941682 204
394 3300025914 Ga0207671_10584017 Ga0207671_105840171 204
395 3300025914 Ga0207671_10666905 Ga0207671_106669051 204
396 3300025915 Ga0207693_10000320 Ga0207693_1000032032 204
397 3300025915 Ga0207693_10001428 Ga0207693_100014283 204
398 3300025915 Ga0207693_10089329 Ga0207693_100893293 204
399 3300025916 Ga0207663_10003778 Ga0207663_100037785 204
400 3300025916 Ga0207663_10006672 Ga0207663_100066725 204
401 3300025916 Ga0207663_10018259 Ga0207663_100182592 204
402 3300025919 Ga0207657_10223298 Ga0207657_102232982 204
403 3300025920 Ga0207649_10749053 Ga0207649_107490532 204
404 3300025922 Ga0207646_10005394 Ga0207646_100053942 204
405 3300025922 Ga0207646_10025079 Ga0207646_100250792 204
406 3300025922 Ga0207646_10190271 Ga0207646_101902712 204
407 3300025923 Ga0207681_10035825 Ga0207681_100358253 204
408 3300025927 Ga0207687_10004442 Ga0207687_100044428 204
409 3300025927 Ga0207687_10024421 Ga0207687_100244213 204
410 3300025927 Ga0207687_10144450 Ga0207687_101444502 204
411 3300025928 Ga0207700_10001255 Ga0207700_100012556 204
412 3300025928 Ga0207700_10006885 Ga0207700_100068851 204
413 3300025928 Ga0207700_10429890 Ga0207700_104298901 204
414 3300025929 Ga0207664_10001996 Ga0207664_100019964 204
415 3300025929 Ga0207664_10037167 Ga0207664_100371673 204
416 3300025929 Ga0207664_10249456 Ga0207664_102494562 204
417 3300025929 Ga0207664_10283243 Ga0207664_102832432 204
418 3300025931 Ga0207644_10271307 Ga0207644_102713071 204
419 3300025932 Ga0207690_10051719 Ga0207690_100517191 204
420 3300025932 Ga0207690_10211267 Ga0207690_102112672 204
421 3300025934 Ga0207686_10004529 Ga0207686_100045293 204
422 3300025934 Ga0207686_10150115 Ga0207686_101501151 204
423 3300025935 Ga0207709_10029606 Ga0207709_100296063 204
424 3300025935 Ga0207709_10078961 Ga0207709_100789612 204
425 3300025937 Ga0207669_10000415 Ga0207669_100004159 204
426 3300025937 Ga0207669_10005935 Ga0207669_100059352 204
427 3300025937 Ga0207669_10130568 Ga0207669_101305682 204
428 3300025937 Ga0207669_10644949 Ga0207669_106449492 204
429 3300025939 Ga0207665_10002591 Ga0207665_100025918 204
430 3300025939 Ga0207665_10008073 Ga0207665_100080733 204
431 3300025939 Ga0207665_10009047 Ga0207665_100090473 204
432 3300025939 Ga0207665_10337164 Ga0207665_103371641 204
433 3300025940 Ga0207691_10044894 Ga0207691_100448942 204
434 3300025941 Ga0207711_10014333 Ga0207711_100143336 204
435 3300025941 Ga0207711_10248501 Ga0207711_102485011 204
436 3300025942 Ga0207689_10013143 Ga0207689_100131433 204
437 3300025942 Ga0207689_10029001 Ga0207689_100290012 204
438 3300025942 Ga0207689_10641045 Ga0207689_106410451 204
439 3300025944 Ga0207661_10248691 Ga0207661_102486912 204
440 3300025944 Ga0207661_10293526 Ga0207661_102935262 204
441 3300025961 Ga0207712_10010146 Ga0207712_100101464 204
442 3300025961 Ga0207712_10163227 Ga0207712_101632272 204
443 3300025961 Ga0207712_10972768 Ga0207712_109727682 204
444 3300025961 Ga0207712_11149452 Ga0207712_111494521 204
445 3300025972 Ga0207668_10002762 Ga0207668_100027624 204
446 3300025972 Ga0207668_10003021 Ga0207668_100030217 204
447 3300025972 Ga0207668_10054525 Ga0207668_100545252 204
448 3300025972 Ga0207668_10137406 Ga0207668_101374062 204
449 3300025972 Ga0207668_10379033 Ga0207668_103790332 204
450 3300025981 Ga0207640_10008533 Ga0207640_100085334 204
451 3300025981 Ga0207640_10046753 Ga0207640_100467532 204
452 3300025981 Ga0207640_10373906 Ga0207640_103739062 204
453 3300025986 Ga0207658_10014616 Ga0207658_100146162 204
454 3300025986 Ga0207658_10018357 Ga0207658_100183574 204
455 3300025986 Ga0207658_10053842 Ga0207658_100538423 204
456 3300025986 Ga0207658_10153397 Ga0207658_101533972 204
457 3300026023 Ga0207677_10000663 Ga0207677_1000066318 204
458 3300026023 Ga0207677_10009341 Ga0207677_100093414 204
459 3300026023 Ga0207677_10358222 Ga0207677_103582222 204
460 3300026035 Ga0207703_10002809 Ga0207703_1000280911 204
461 3300026035 Ga0207703_10096660 Ga0207703_100966601 204
462 3300026035 Ga0207703_10330915 Ga0207703_103309152 204
463 3300026041 Ga0207639_10004866 Ga0207639_100048664 204
464 3300026041 Ga0207639_10014636 Ga0207639_100146362 204
465 3300026041 Ga0207639_10015203 Ga0207639_100152032 204
466 3300026067 Ga0207678_10001872 Ga0207678_100018723 204
467 3300026075 Ga0207708_10006741 Ga0207708_100067412 204
468 3300026075 Ga0207708_10063763 Ga0207708_100637632 204
469 3300026078 Ga0207702_10233520 Ga0207702_102335202 204
470 3300026078 Ga0207702_10451667 Ga0207702_104516672 204
471 3300026078 Ga0207702_11032885 Ga0207702_110328852 204
472 3300026088 Ga0207641_10021583 Ga0207641_100215832 204
473 3300026088 Ga0207641_10744970 Ga0207641_107449702 204
474 3300026089 Ga0207648_10000451 Ga0207648_1000045134 204
475 3300026089 Ga0207648_10032515 Ga0207648_100325152 204
476 3300026095 Ga0207676_10341955 Ga0207676_103419552 204
477 3300026095 Ga0207676_11586523 Ga0207676_115865231 204
478 3300026116 Ga0207674_10195609 Ga0207674_101956093 204
479 3300026116 Ga0207674_11317247 Ga0207674_113172471 204
480 3300026118 Ga0207675_100046810 Ga0207675_1000468104 204
481 3300026118 Ga0207675_100225491 Ga0207675_1002254912 204
482 3300026118 Ga0207675_100450772 Ga0207675_1004507722 204
483 3300026121 Ga0207683_10000665 Ga0207683_1000066521 204
484 3300026121 Ga0207683_10198252 Ga0207683_101982522 204
485 3300026121 Ga0207683_10228141 Ga0207683_102281412 204
486 3300026142 Ga0207698_10253715 Ga0207698_102537152 204
487 3300026142 Ga0207698_10429749 Ga0207698_104297492 204
488 3300026142 Ga0207698_10464869 Ga0207698_104648692 204
489 3300026142 Ga0207698_10555905 Ga0207698_105559052 204
490 3300028379 Ga0268266_10049546 Ga0268266_100495462 204
491 3300028379 Ga0268266_10360498 Ga0268266_103604982 204
492 3300028379 Ga0268266_10390928 Ga0268266_103909282 204
493 3300028380 Ga0268265_10014656 Ga0268265_100146561 204
494 3300028381 Ga0268264_10037712 Ga0268264_100377121 204
495 3300030521 Ga0307511_10000566 Ga0307511_1000056625 204
496 3300030522 Ga0307512_10006564 Ga0307512_100065644 204
497 3300030732 Ga0316176_1012104 Ga0316176_10121041 204
498 3300030733 Ga0314311_1258134 Ga0314311_12581342 204
499 3300030736 Ga0316180_1128025 Ga0316180_11280252 204
500 3300031251 Ga0265327_10001323 Ga0265327_100013234 204
501 3300031456 Ga0307513_10246364 Ga0307513_102463642 204
502 3300031731 Ga0307405_10064106 Ga0307405_100641062 204
503 3300031731 Ga0307405_10288443 Ga0307405_102884432 204
504 3300031824 Ga0307413_10276707 Ga0307413_102767072 204
505 3300031824 Ga0307413_10439279 Ga0307413_104392792 204
506 3300031838 Ga0307518_10003613 Ga0307518_100036134 204
507 3300031852 Ga0307410_10031492 Ga0307410_100314925 204
508 3300031852 Ga0307410_10138016 Ga0307410_101380162 204
509 3300031852 Ga0307410_10188891 Ga0307410_101888912 204
510 3300031852 Ga0307410_10384950 Ga0307410_103849502 204
511 3300031852 Ga0307410_10466197 Ga0307410_104661972 204
512 3300031852 Ga0307410_11189804 Ga0307410_111898041 204
513 3300031901 Ga0307406_10029420 Ga0307406_100294202 204
514 3300031901 Ga0307406_10083793 Ga0307406_100837932 204
515 3300031901 Ga0307406_10088571 Ga0307406_100885712 204
516 3300031901 Ga0307406_10642170 Ga0307406_106421702 204
517 3300031903 Ga0307407_10015424 Ga0307407_100154242 204
518 3300031903 Ga0307407_10015889 Ga0307407_100158892 204
519 3300031903 Ga0307407_10077346 Ga0307407_100773462 204
520 3300031995 Ga0307409_100000890 Ga0307409_10000089010 204
521 3300031995 Ga0307409_100027223 Ga0307409_1000272232 204
522 3300031995 Ga0307409_100068214 Ga0307409_1000682142 204
523 3300031995 Ga0307409_100146602 Ga0307409_1001466022 204
524 3300031995 Ga0307409_100159334 Ga0307409_1001593342 204
525 3300031995 Ga0307409_100750093 Ga0307409_1007500932 204
526 3300031995 Ga0307409_100865216 Ga0307409_1008652162 204
527 3300032002 Ga0307416_100008353 Ga0307416_1000083537 204
528 3300032002 Ga0307416_100025070 Ga0307416_1000250702 204
529 3300032002 Ga0307416_100037053 Ga0307416_1000370532 204
530 3300032002 Ga0307416_100228270 Ga0307416_1002282702 204
531 3300032002 Ga0307416_100352925 Ga0307416_1003529252 204
532 3300032002 Ga0307416_101674564 Ga0307416_1016745641 204
533 3300032004 Ga0307414_10112296 Ga0307414_101122962 204
534 3300032005 Ga0307411_10018624 Ga0307411_100186242 204
535 3300032005 Ga0307411_10020002 Ga0307411_100200023 204
536 3300032005 Ga0307411_10052939 Ga0307411_100529392 204
537 3300032005 Ga0307411_10255418 Ga0307411_102554182 204
538 3300032126 Ga0307415_100006738 Ga0307415_1000067382 204
539 3300032126 Ga0307415_100026832 Ga0307415_1000268323 204
540 3300032126 Ga0307415_100032961 Ga0307415_1000329614 204
541 3300032126 Ga0307415_100217652 Ga0307415_1002176521 204
542 3300032126 Ga0307415_100346995 Ga0307415_1003469952 204
543 3300032126 Ga0307415_100378607 Ga0307415_1003786072 204
544 3300033179 Ga0307507_10018641 Ga0307507_100186417 204
545 3300033179 Ga0307507_10021576 Ga0307507_100215762 204
546 3300033180 Ga0307510_10072348 Ga0307510_100723483 204
547 3300035086 Ga0373934_0032629 Ga0373934_0032629_975_1589 204
548 3300035086 Ga0373934_0047700 Ga0373934_0047700_738_1352 204
549 3300035111 Ga0373923_0077215 Ga0373923_0077215_215_829 204
550 3300035113 Ga0373936_0010764 Ga0373936_0010764_2205_2819 204
551 3300035117 Ga0373953_0011454 Ga0373953_0011454_87_701 204
552 3300035118 Ga0373954_0210004 Ga0373954_0210004_133_747 204
553 3300035119 Ga0373956_0001711 Ga0373956_0001711_3256_3870 204
554 3300035119 Ga0373956_0006002 Ga0373956_0006002_3654_4268 204
555 3300035120 Ga0373957_0022968 Ga0373957_0022968_1020_1634 204
556 3300035120 Ga0373957_0052314 Ga0373957_0052314_798_1412 204
557 3300035170 Ga0373943_0086625 Ga0373943_0086625_696_1310 204
558 3300035170 Ga0373943_0151258 Ga0373943_0151258_473_1087 204
559 3300035172 Ga0373955_0023762 Ga0373955_0023762_1453_2067 204
560 3300035172 Ga0373955_0024251 Ga0373955_0024251_87_701 204
561 3300035410 Ga0373924_0003322 Ga0373924_0003322_4691_5305 204
562 3300035410 Ga0373924_0019176 Ga0373924_0019176_1444_2058 204
563 3300035691 Ga0373931_0030544 Ga0373931_0030544_1797_2411 204
564 3300035692 Ga0373935_0028303 Ga0373935_0028303_1203_1817 204
565 3300035695 Ga0373927_0272272 Ga0373927_0272272_31_645 204
566 3300035724 Ga0373933_0008266 Ga0373933_0008266_2740_3354 204
567 3300035724 Ga0373933_0044704 Ga0373933_0044704_187_801 204
568 3300035725 Ga0373947_0021007 Ga0373947_0021007_2102_2716 204
569 3300035725 Ga0373947_0419322 Ga0373947_0419322_214_828 204
570 3300036401 Ga0373937_0010056 Ga0373937_0010056_4277_4891 204
571 3300037068 Ga0373925_0024766 Ga0373925_0024766_43_657 204
572 3300037312 Ga0395899_0399109 Ga0395899_0399109_72_686 204
573 3300037418 Ga0395900_0037820 Ga0395900_0037820_2338_2952 204
574 3300037418 Ga0395900_0529576 Ga0395900_0529576_197_811 204
575 3300037418 Ga0395900_1074167 Ga0395900_1074167_15_629 204
576 3300037466 Ga0395898_0072849 Ga0395898_0072849_324_938 204
577 3300037466 Ga0395898_0394238 Ga0395898_0394238_285_980 204
578 3300037471 Ga0395905_0220771 Ga0395905_0220771_935_1549 204
579 3300037853 Ga0436364_0031584 Ga0436364_0031584_8809_9423 204
580 3300037853 Ga0436364_0265237 Ga0436364_0265237_718_1332 204
581 3300037853 Ga0436364_0527483 Ga0436364_0527483_9987_10601 204
582 3300037853 Ga0436364_0624094 Ga0436364_0624094_80701_81315 204
583 3300037853 Ga0436364_1363663 Ga0436364_1363663_1181_1798 204
584 3300038443 Ga0395901_0256391 Ga0395901_0256391_1091_1705 204
585 3300039437 Ga0436365_0982045 Ga0436365_0982045_1252_1866 204
586 3300039450 Ga0436363_0032393 Ga0436363_0032393_1040_1654 204
587 3300039450 Ga0436363_0483576 Ga0436363_0483576_54_668 204
588 3300039450 Ga0436363_1321026 Ga0436363_1321026_2288_2902 204
589 3300039453 Ga0436362_0543778 Ga0436362_0543778_66344_66958 204
590 3300041405 Ga0439438_023674 Ga0439438_023674_908_1522 204
591 3300041410 Ga0439461_0006406 Ga0439461_0006406_1190_1804 204
592 3300041411 Ga0439466_0013024 Ga0439466_0013024_548_1162 204
593 3300041413 Ga0439465_0020383 Ga0439465_0020383_412_1026 204
594 3300041413 Ga0439465_0032187 Ga0439465_0032187_221_835 204
595 3300041413 Ga0439465_0046111 Ga0439465_0046111_719_1333 204
596 3300041443 Ga0451789_0324757 Ga0451789_0324757_506_1120 204
597 3300041486 Ga0451807_0054841 Ga0451807_0054841_144_758 204
598 3300041997 Ga0439431_0000413 Ga0439431_0000413_1968_2582 204
599 3300041997 Ga0439431_0007569 Ga0439431_0007569_853_1467 204
600 3300042002 Ga0439442_063750 Ga0439442_063750_132_746 204
601 3300042004 Ga0439445_0000656 Ga0439445_0000656_4889_5503 204
602 3300042005 Ga0439448_0049574 Ga0439448_0049574_154_768 204
603 3300042007 Ga0439449_0041958 Ga0439449_0041958_854_1468 204
604 3300042156 Ga0439446_0028899 Ga0439446_0028899_111_725 204
605 3300042435 Ga0439434_0001156 Ga0439434_0001156_6618_7232 204
606 3300042435 Ga0439434_0008638 Ga0439434_0008638_426_1040 204
607 3300042438 Ga0439459_0037393 Ga0439459_0037393_42_656 204
608 3300044656 Ga0466969_0044502 Ga0466969_0044502_348_962 204
609 3300044656 Ga0466969_0046065 Ga0466969_0046065_299_916 204
610 3300044656 Ga0466969_0073548 Ga0466969_0073548_523_1137 204
611 3300044656 Ga0466969_0213361 Ga0466969_0213361_146_760 204
612 3300044658 Ga0466972_0005719 Ga0466972_0005719_1258_1872 204
613 3300044658 Ga0466972_0007727 Ga0466972_0007727_4402_5016 204
614 3300044658 Ga0466972_0015169 Ga0466972_0015169_1555_2169 204
615 3300044658 Ga0466972_0019114 Ga0466972_0019114_1328_1942 204
616 3300044658 Ga0466972_0036310 Ga0466972_0036310_177_791 204
617 3300044658 Ga0466972_0046845 Ga0466972_0046845_179_793 204
618 3300044658 Ga0466972_0076962 Ga0466972_0076962_521_1135 204
619 3300044683 Ga0466965_0002402 Ga0466965_0002402_6714_7328 204
620 3300044683 Ga0466965_0006143 Ga0466965_0006143_350_964 204
621 3300044683 Ga0466965_0031269 Ga0466965_0031269_418_1032 204
622 3300044683 Ga0466965_0032994 Ga0466965_0032994_1405_2019 204
623 3300044683 Ga0466965_0081314 Ga0466965_0081314_771_1385 204
624 3300044683 Ga0466965_0117701 Ga0466965_0117701_502_1116 204
625 3300044683 Ga0466965_0121137 Ga0466965_0121137_689_1303 204
626 3300044683 Ga0466965_0150633 Ga0466965_0150633_565_1179 204
627 3300044683 Ga0466965_0310385 Ga0466965_0310385_114_728 204
628 3300044683 Ga0466965_0362175 Ga0466965_0362175_87_701 204
629 3300044684 Ga0466966_0004435 Ga0466966_0004435_1742_2356 204
630 3300044684 Ga0466966_0019872 Ga0466966_0019872_3568_4182 204
631 3300044684 Ga0466966_0049069 Ga0466966_0049069_1877_2491 204
632 3300044684 Ga0466966_0085741 Ga0466966_0085741_199_813 204
633 3300044684 Ga0466966_0146110 Ga0466966_0146110_520_1134 204
634 3300044684 Ga0466966_0258438 Ga0466966_0258438_238_852 204
635 3300044693 Ga0466961_0002286 Ga0466961_0002286_7999_8613 204
636 3300044693 Ga0466961_0005880 Ga0466961_0005880_5334_5948 204
637 3300044693 Ga0466961_0009342 Ga0466961_0009342_862_1476 204
638 3300044693 Ga0466961_0010478 Ga0466961_0010478_495_1109 204
639 3300044693 Ga0466961_0076271 Ga0466961_0076271_1306_1920 204
640 3300044693 Ga0466961_0164279 Ga0466961_0164279_489_1103 204
641 3300044694 Ga0466963_0043452 Ga0466963_0043452_343_957 204
642 3300044694 Ga0466963_0171075 Ga0466963_0171075_44_658 204
643 3300044694 Ga0466963_0209066 Ga0466963_0209066_519_1133 204
644 3300044694 Ga0466963_0350736 Ga0466963_0350736_380_994 204
645 3300044694 Ga0466963_0550318 Ga0466963_0550318_71_685 204
646 3300044694 Ga0466963_0573530 Ga0466963_0573530_81_695 204
647 3300044694 Ga0466963_0715622 Ga0466963_0715622_45_659 204
648 3300044706 Ga0466964_0151553 Ga0466964_0151553_49_663 204
649 3300044706 Ga0466964_0185531 Ga0466964_0185531_90_704 204
650 3300044719 Ga0466971_0023941 Ga0466971_0023941_468_1082 204
651 3300044719 Ga0466971_0115944 Ga0466971_0115944_550_1164 204
652 3300044735 Ga0466968_0001265 Ga0466968_0001265_510_1124 204
653 3300044735 Ga0466968_0075816 Ga0466968_0075816_283_897 204
654 3300044735 Ga0466968_0087887 Ga0466968_0087887_84_698 204
655 3300044735 Ga0466968_0191112 Ga0466968_0191112_108_722 204
656 3300044765 Ga0466970_0061591 Ga0466970_0061591_817_1431 204
657 3300044765 Ga0466970_0066315 Ga0466970_0066315_932_1546 204
658 3300044765 Ga0466970_0106941 Ga0466970_0106941_58_672 204
659 3300044765 Ga0466970_0108350 Ga0466970_0108350_75_689 204
660 3300044765 Ga0466970_0133175 Ga0466970_0133175_281_895 204
661 3300044765 Ga0466970_0184306 Ga0466970_0184306_500_1114 204
662 3300044765 Ga0466970_0278769 Ga0466970_0278769_86_700 204
663 3300044842 Ga0466957_0007088 Ga0466957_0007088_3295_3909 204
664 3300044842 Ga0466957_0011435 Ga0466957_0011435_3011_3625 204
665 3300044842 Ga0466957_0039535 Ga0466957_0039535_161_775 204
666 3300044842 Ga0466957_0057363 Ga0466957_0057363_944_1558 204
667 3300044842 Ga0466957_0271628 Ga0466957_0271628_151_765 204
668 3300044842 Ga0466957_0291647 Ga0466957_0291647_315_929 204
669 3300044842 Ga0466957_0382962 Ga0466957_0382962_84_698 204
670 3300044842 Ga0466957_0516765 Ga0466957_0516765_205_819 204
671 3300044842 Ga0466957_0808085 Ga0466957_0808085_30_644 204
672 3300044901 Ga0466960_0000545 Ga0466960_0000545_11879_12493 204
673 3300044901 Ga0466960_0009414 Ga0466960_0009414_1443_2057 204
674 3300044901 Ga0466960_0043927 Ga0466960_0043927_283_897 204
675 3300044901 Ga0466960_0074025 Ga0466960_0074025_997_1611 204
676 3300044901 Ga0466960_0074522 Ga0466960_0074522_525_1139 204
677 3300044901 Ga0466960_0148616 Ga0466960_0148616_31_645 204
678 3300044901 Ga0466960_0413912 Ga0466960_0413912_121_735 204
679 3300044901 Ga0466960_0451110 Ga0466960_0451110_36_650 204
680 3300045049 Ga0466959_0052106 Ga0466959_0052106_500_1114 204
681 3300045049 Ga0466959_0063775 Ga0466959_0063775_1219_1833 204
682 3300045049 Ga0466959_0076887 Ga0466959_0076887_1157_1771 204
683 3300045049 Ga0466959_0097627 Ga0466959_0097627_201_815 204
684 3300045049 Ga0466959_0218634 Ga0466959_0218634_539_1156 204
685 3300045049 Ga0466959_0306126 Ga0466959_0306126_51_665 204
686 3300045049 Ga0466959_0310199 Ga0466959_0310199_51_665 204
687 3300045049 Ga0466959_0505813 Ga0466959_0505813_117_731 204
688 3300045836 Ga0466958_0003205 Ga0466958_0003205_4089_4703 204
689 3300045836 Ga0466958_0005390 Ga0466958_0005390_5780_6394 204
690 3300045836 Ga0466958_0006613 Ga0466958_0006613_3739_4353 204
691 3300045836 Ga0466958_0139801 Ga0466958_0139801_704_1318 204
692 3300045836 Ga0466958_0261149 Ga0466958_0261149_80_694 204
693 3300045836 Ga0466958_0529274 Ga0466958_0529274_28_642 204
694 3300045976 Ga0466967_0001907 Ga0466967_0001907_3008_3622 204
695 3300045976 Ga0466967_0028779 Ga0466967_0028779_2041_2655 204
696 3300045976 Ga0466967_0049993 Ga0466967_0049993_1803_2417 204
697 3300045976 Ga0466967_0051985 Ga0466967_0051985_1517_2131 204
698 3300045976 Ga0466967_0058549 Ga0466967_0058549_1801_2415 204
699 3300045976 Ga0466967_0070645 Ga0466967_0070645_1816_2430 204
700 3300045976 Ga0466967_0122015 Ga0466967_0122015_1353_1967 204
701 3300045976 Ga0466967_0171974 Ga0466967_0171974_699_1313 204
702 3300045976 Ga0466967_0235862 Ga0466967_0235862_946_1560 204
703 3300045976 Ga0466967_0291819 Ga0466967_0291819_904_1518 204
704 3300045976 Ga0466967_0408224 Ga0466967_0408224_33_647 204
705 3300045976 Ga0466967_0675615 Ga0466967_0675615_68_682 204
706 3300045976 Ga0466967_0767672 Ga0466967_0767672_276_890 204
707 3300045976 Ga0466967_0870101 Ga0466967_0870101_272_886 204
708 3300045976 Ga0466967_0935787 Ga0466967_0935787_197_811 204
709 3300045976 Ga0466967_0980453 Ga0466967_0980453_83_697 204
710 3300046454 Ga0495592_0174105 Ga0495592_0174105_711_1325 204
711 3300046454 Ga0495592_0300444 Ga0495592_0300444_87_701 204
712 3300046454 Ga0495592_0347987 Ga0495592_0347987_21_635 204
713 3300046459 Ga0495629_0004354 Ga0495629_0004354_8644_9258 204
714 3300046459 Ga0495629_0016513 Ga0495629_0016513_3430_4044 204
715 3300046460 Ga0495638_0000781 Ga0495638_0000781_3332_3946 204
716 3300046461 Ga0495641_0029861 Ga0495641_0029861_1545_2159 204
717 3300046462 Ga0495651_0036671 Ga0495651_0036671_2482_3096 204
718 3300046462 Ga0495651_0100244 Ga0495651_0100244_335_949 204
719 3300046473 Ga0495582_0077907 Ga0495582_0077907_988_1602 204
720 3300046475 Ga0495639_0100598 Ga0495639_0100598_535_1149 204
721 3300046476 Ga0495662_0001293 Ga0495662_0001293_11392_12006 204
722 3300046477 Ga0495664_0065710 Ga0495664_0065710_215_829 204
723 3300046499 Ga0495594_0329653 Ga0495594_0329653_45_659 204
724 3300046501 Ga0495607_0007731 Ga0495607_0007731_3967_4581 204
725 3300046506 Ga0495583_0052849 Ga0495583_0052849_121_735 204
726 3300046511 Ga0495608_0056806 Ga0495608_0056806_1359_1973 204
727 3300046514 Ga0495618_0004580 Ga0495618_0004580_3831_4445 204
728 3300046514 Ga0495618_0236657 Ga0495618_0236657_279_893 204
729 3300046516 Ga0495628_0035741 Ga0495628_0035741_1901_2515 204
730 3300046516 Ga0495628_0450822 Ga0495628_0450822_99_713 204
731 3300046524 Ga0495648_0006523 Ga0495648_0006523_7722_8336 204
732 3300046526 Ga0495666_0048666 Ga0495666_0048666_504_1118 204
733 3300046528 Ga0495642_0142816 Ga0495642_0142816_273_887 204
734 3300046531 Ga0495665_0002875 Ga0495665_0002875_1165_1779 204
735 3300046531 Ga0495665_0138816 Ga0495665_0138816_601_1215 204
736 3300046533 Ga0495640_0015684 Ga0495640_0015684_2459_3073 204
737 3300046535 Ga0495586_0024940 Ga0495586_0024940_848_1462 204
738 3300046536 Ga0495587_0187551 Ga0495587_0187551_343_957 204
739 3300046543 Ga0495645_0005175 Ga0495645_0005175_1359_1973 204
740 3300046558 Ga0495633_0292144 Ga0495633_0292144_64_678 204
741 3300046559 Ga0495667_0388733 Ga0495667_0388733_162_776 204
742 3300046615 Ga0495656_0170912 Ga0495656_0170912_161_775 204
743 3300046616 Ga0495668_0047758 Ga0495668_0047758_569_1183 204
744 3300046616 Ga0495668_0272729 Ga0495668_0272729_187_801 204
745 3300046616 Ga0495668_0302883 Ga0495668_0302883_173_787 204
746 3300046642 Ga0495634_0170891 Ga0495634_0170891_373_987 204
747 3300046660 Ga0495625_0384398 Ga0495625_0384398_220_834 204
748 3300046663 Ga0495635_0317246 Ga0495635_0317246_87_701 204
749 3300046674 Ga0495588_0017865 Ga0495588_0017865_2545_3159 204
750 3300046674 Ga0495588_0095747 Ga0495588_0095747_230_844 204
751 3300046675 Ga0495657_0006898 Ga0495657_0006898_2410_3024 204
752 3300046675 Ga0495657_0246710 Ga0495657_0246710_176_790 204
753 3300046679 Ga0495623_0066225 Ga0495623_0066225_1359_1973 204
754 3300046679 Ga0495623_0115713 Ga0495623_0115713_101_715 204
755 3300046683 Ga0495658_0057359 Ga0495658_0057359_744_1358 204
756 3300046683 Ga0495658_0072652 Ga0495658_0072652_926_1540 204
757 3300046689 Ga0495613_0042705 Ga0495613_0042705_1722_2336 204
758 3300046690 Ga0495624_0027392 Ga0495624_0027392_2178_2792 204
759 3300047315 Ga0495581_0003604 Ga0495581_0003604_2385_2999 204
760 3300047315 Ga0495581_0058051 Ga0495581_0058051_1208_1822 204
761 3300047317 Ga0495604_0191960 Ga0495604_0191960_524_1138 204
762 3300047319 Ga0495674_0086909 Ga0495674_0086909_215_829 204
763 3300047319 Ga0495674_0201168 Ga0495674_0201168_466_1080 204
764 3300047320 Ga0495672_0007843 Ga0495672_0007843_927_1541 204
765 3300047321 Ga0495676_0042610 Ga0495676_0042610_1774_2388 204
766 3300047322 Ga0495680_0064078 Ga0495680_0064078_1595_2209 204
767 3300047323 Ga0495683_0000352 Ga0495683_0000352_12791_13405 204
768 3300047444 Ga0495675_0017905 Ga0495675_0017905_3354_3968 204
769 3300047445 Ga0495677_0253894 Ga0495677_0253894_60_674 204
770 3300047469 Ga0495673_0003082 Ga0495673_0003082_5817_6431 204
771 3300047471 Ga0495684_0043000 Ga0495684_0043000_1247_1861 204
772 3300047673 Ga0495593_0026581 Ga0495593_0026581_882_1496 204
773 3300047673 Ga0495593_0070183 Ga0495593_0070183_94_708 204
774 3300048088 Ga0495602_0012428 Ga0495602_0012428_3831_4445 204
775 3300048088 Ga0495602_0114175 Ga0495602_0114175_1359_1973 204
776 3300048903 Ga0496100_0000489 Ga0496100_0000489_18300_18914 204
777 3300048903 Ga0496100_0041990 Ga0496100_0041990_42_656 204
778 3300048903 Ga0496100_0060667 Ga0496100_0060667_1472_2086 204
779 3300048903 Ga0496100_0181756 Ga0496100_0181756_217_831 204
780 3300048904 Ga0496101_0000791 Ga0496101_0000791_770_1384 204
781 3300048904 Ga0496101_0017960 Ga0496101_0017960_73_687 204
782 3300048904 Ga0496101_0023846 Ga0496101_0023846_982_1596 204
783 3300048904 Ga0496101_0116066 Ga0496101_0116066_589_1203 204
784 3300048905 Ga0496102_0000018 Ga0496102_0000018_223160_223774 204
785 3300048905 Ga0496102_0042256 Ga0496102_0042256_2557_3171 204
786 3300048905 Ga0496102_0126905 Ga0496102_0126905_807_1421 204
787 3300048905 Ga0496102_0226117 Ga0496102_0226117_782_1396 204
788 3300048905 Ga0496102_0229005 Ga0496102_0229005_645_1259 204
789 3300048905 Ga0496102_0474060 Ga0496102_0474060_339_953 204
790 3300048906 Ga0496103_0000325 Ga0496103_0000325_17601_18215 204
791 3300048906 Ga0496103_0008653 Ga0496103_0008653_4695_5309 204
792 3300048907 Ga0496104_0001001 Ga0496104_0001001_18915_19529 204
793 3300048907 Ga0496104_0009497 Ga0496104_0009497_6884_7498 204
794 3300048907 Ga0496104_0052984 Ga0496104_0052984_2715_3329 204
795 3300048907 Ga0496104_0168081 Ga0496104_0168081_706_1320 204
796 3300048907 Ga0496104_0441808 Ga0496104_0441808_183_797 204
797 3300048907 Ga0496104_0463873 Ga0496104_0463873_513_1127 204
798 3300048909 Ga0496106_0001362 Ga0496106_0001362_5013_5627 204
799 3300048909 Ga0496106_0010104 Ga0496106_0010104_4677_5291 204
800 3300048909 Ga0496106_0063859 Ga0496106_0063859_657_1271 204
801 3300048910 Ga0496107_0072604 Ga0496107_0072604_1827_2441 204
802 3300048910 Ga0496107_0097029 Ga0496107_0097029_83_697 204
803 3300048910 Ga0496107_0560919 Ga0496107_0560919_218_832 204
804 3300048911 Ga0496108_0000188 Ga0496108_0000188_4256_4870 204
805 3300048911 Ga0496108_0018062 Ga0496108_0018062_3493_4107 204
806 3300048911 Ga0496108_0029885 Ga0496108_0029885_3850_4464 204
807 3300048911 Ga0496108_0156438 Ga0496108_0156438_1249_1863 204
808 3300048911 Ga0496108_0332535 Ga0496108_0332535_623_1237 204
809 3300048912 Ga0496109_0019629 Ga0496109_0019629_4126_4740 204
810 3300048912 Ga0496109_0113296 Ga0496109_0113296_1419_2033 204
811 3300048912 Ga0496109_0157633 Ga0496109_0157633_957_1571 204
812 3300048912 Ga0496109_0251111 Ga0496109_0251111_921_1535 204
813 3300048912 Ga0496109_0340986 Ga0496109_0340986_18_632 204
814 3300048913 Ga0496110_0086875 Ga0496110_0086875_1363_1977 204
815 3300048914 Ga0496111_0144079 Ga0496111_0144079_228_842 204
816 3300048915 Ga0496112_0014679 Ga0496112_0014679_1194_1808 204
817 3300048915 Ga0496112_0057326 Ga0496112_0057326_2809_3423 204
818 3300048915 Ga0496112_0096756 Ga0496112_0096756_2033_2647 204
819 3300048915 Ga0496112_0134896 Ga0496112_0134896_926_1540 204
820 3300048915 Ga0496112_0211883 Ga0496112_0211883_351_965 204
821 3300048915 Ga0496112_0223687 Ga0496112_0223687_361_975 204
822 3300048916 Ga0496113_0020167 Ga0496113_0020167_3951_4565 204
823 3300048916 Ga0496113_0063520 Ga0496113_0063520_1006_1620 204
824 3300048917 Ga0496114_0001466 Ga0496114_0001466_44_658 204
825 3300048917 Ga0496114_0019207 Ga0496114_0019207_4835_5449 204
826 3300048917 Ga0496114_0031850 Ga0496114_0031850_1101_1715 204
827 3300048918 Ga0496115_0002019 Ga0496115_0002019_3651_4265 204
828 3300048918 Ga0496115_0036400 Ga0496115_0036400_1747_2361 204
829 3300048919 Ga0496116_0000272 Ga0496116_0000272_43070_43684 204
830 3300048920 Ga0496117_0000291 Ga0496117_0000291_46306_46920 204
831 3300048920 Ga0496117_0319657 Ga0496117_0319657_86_700 204
832 3300048921 Ga0496118_0000278 Ga0496118_0000278_46284_46898 204
833 3300048922 Ga0496119_0000336 Ga0496119_0000336_54886_55500 204
834 3300048922 Ga0496119_0001512 Ga0496119_0001512_4775_5389 204
835 3300048923 Ga0496120_0013763 Ga0496120_0013763_4025_4639 204
836 3300048923 Ga0496120_0060628 Ga0496120_0060628_749_1363 204
837 3300048924 Ga0496121_0005186 Ga0496121_0005186_10606_11220 204
838 3300048925 Ga0496122_0000239 Ga0496122_0000239_120928_121542 204
839 3300048926 Ga0496123_0280703 Ga0496123_0280703_58_672 204
840 3300048927 Ga0496124_0040012 Ga0496124_0040012_2635_3249 204
841 3300048928 Ga0496125_0024739 Ga0496125_0024739_3346_3960 204
842 3300048928 Ga0496125_0094464 Ga0496125_0094464_785_1399 204
843 3300048928 Ga0496125_0118307 Ga0496125_0118307_1090_1704 204
844 3300048928 Ga0496125_0188739 Ga0496125_0188739_217_831 204
845 3300048929 Ga0496126_0000036 Ga0496126_0000036_95746_96360 204
846 3300048929 Ga0496126_0000107 Ga0496126_0000107_46291_46905 204
847 3300048929 Ga0496126_0021145 Ga0496126_0021145_609_1223 204
848 3300049569 Ga0501032_0001098 Ga0501032_0001098_15394_16008 204
849 3300049571 Ga0501034_0001976 Ga0501034_0001976_20863_21477 204
850 3300049571 Ga0501034_0034971 Ga0501034_0034971_3056_3670 204
851 3300049572 Ga0501036_0026027 Ga0501036_0026027_1311_1925 204
852 3300049573 Ga0501037_0000809 Ga0501037_0000809_5736_6350 204
853 3300049575 Ga0501039_0001201 Ga0501039_0001201_15068_15682 204
854 3300049579 Ga0501043_0002541 Ga0501043_0002541_10571_11185 204
855 3300049581 Ga0501047_0000142 Ga0501047_0000142_26967_27581 204
856 3300049583 Ga0501067_0037300 Ga0501067_0037300_1432_2046 204
857 3300049586 Ga0501070_0003906 Ga0501070_0003906_2921_3535 204
858 3300049586 Ga0501070_0143993 Ga0501070_0143993_1006_1620 204
859 3300049586 Ga0501070_0483512 Ga0501070_0483512_54_668 204
860 3300049586 Ga0501070_0925005 Ga0501070_0925005_14_628 204
861 3300049589 Ga0501073_0017528 Ga0501073_0017528_4471_5085 204
862 3300049742 Ga0501080_0178548 Ga0501080_0178548_1122_1736 204
863 3300049823 Ga0501044_0003752 Ga0501044_0003752_13176_13790 204
864 3300050489 nmdc:mga03683_38352_c1 nmdc:mga03683_38352_c1_1020_1634 204
865 3300050490 nmdc:mga03n38_133659_c1 nmdc:mga03n38_133659_c1_70_684 204
866 3300050490 nmdc:mga03n38_1752_c1 nmdc:mga03n38_1752_c1_1123_1737 204
867 3300050490 nmdc:mga03n38_35530_c1 nmdc:mga03n38_35530_c1_1165_1779 204
868 3300050490 nmdc:mga03n38_7137_c1 nmdc:mga03n38_7137_c1_34_648 204
869 3300050491 nmdc:mga00v17_1490_c1 nmdc:mga00v17_1490_c1_5409_6023 204
870 3300050491 nmdc:mga00v17_172852_c1 nmdc:mga00v17_172852_c1_696_1310 204
871 3300050491 nmdc:mga00v17_18458_c1 nmdc:mga00v17_18458_c1_899_1513 204
872 3300050491 nmdc:mga00v17_203885_c1 nmdc:mga00v17_203885_c1_203_817 204
873 3300050491 nmdc:mga00v17_214165_c1 nmdc:mga00v17_214165_c1_47_661 204
874 3300050491 nmdc:mga00v17_228715_c1 nmdc:mga00v17_228715_c1_357_971 204
875 3300050491 nmdc:mga00v17_28088_c1 nmdc:mga00v17_28088_c1_1265_1879 204
876 3300050491 nmdc:mga00v17_29197_c1 nmdc:mga00v17_29197_c1_1576_2190 204
877 3300050492 nmdc:mga0yw44_393542_c1 nmdc:mga0yw44_393542_c1_120_734 204
878 3300050492 nmdc:mga0yw44_617850_c1 nmdc:mga0yw44_617850_c1_17_631 204
879 3300050492 nmdc:mga0yw44_95490_c1 nmdc:mga0yw44_95490_c1_760_1374 204
880 3300050494 nmdc:mga06z11_10362_c1 nmdc:mga06z11_10362_c1_803_1417 204
881 3300050494 nmdc:mga06z11_184271_c1 nmdc:mga06z11_184271_c1_324_938 204
882 3300050496 nmdc:mga07m45_118973_c1 nmdc:mga07m45_118973_c1_681_1295 204
883 3300050496 nmdc:mga07m45_4098_c1 nmdc:mga07m45_4098_c1_5180_5794 204
884 3300050496 nmdc:mga07m45_57592_c1 nmdc:mga07m45_57592_c1_424_1038 204
885 3300050496 nmdc:mga07m45_83898_c1 nmdc:mga07m45_83898_c1_16_630 204
886 3300050507 nmdc:mga05p37_243430_c2 nmdc:mga05p37_243430_c2_30_644 204
887 3300050508 nmdc:mga09592_287873_c1 nmdc:mga09592_287873_c1_18_632 204
888 3300050508 nmdc:mga09592_509866_c1 nmdc:mga09592_509866_c1_132_746 204
889 3300050509 nmdc:mga0qj67_51785_c1 nmdc:mga0qj67_51785_c1_2153_2767 204
890 3300050509 nmdc:mga0qj67_7847_c1 nmdc:mga0qj67_7847_c1_58_672 204
891 3300050510 nmdc:mga06r32_77496_c1 nmdc:mga06r32_77496_c1_2165_2779 204
892 3300050511 nmdc:mga08y16_112101_c1 nmdc:mga08y16_112101_c1_1410_2024 204
893 3300050512 nmdc:mga0n895_102216_c1 nmdc:mga0n895_102216_c1_1937_2551 204
894 3300050513 nmdc:mga0rr50_460952_c1 nmdc:mga0rr50_460952_c1_210_824 204
895 3300050514 nmdc:mga08x19_18639_c1 nmdc:mga08x19_18639_c1_1511_2125 204
896 3300050515 nmdc:mga0a205_208355_c1 nmdc:mga0a205_208355_c1_1081_1695 204
897 3300050515 nmdc:mga0a205_852427_c1 nmdc:mga0a205_852427_c1_47_661 204
898 3300050516 nmdc:mga0sz30_11049_c1 nmdc:mga0sz30_11049_c1_2812_3426 204
899 3300050516 nmdc:mga0sz30_2051_c1 nmdc:mga0sz30_2051_c1_431_1045 204
900 3300050516 nmdc:mga0sz30_2244_c1 nmdc:mga0sz30_2244_c1_6052_6666 204
901 3300053077 Ga0495601_0145041 Ga0495601_0145041_849_1463 204
902 3300053078 Ga0495612_0011557 Ga0495612_0011557_955_1569 204
903 3300053084 Ga0495595_0185885 Ga0495595_0185885_87_701 204
904 3300053085 Ga0495619_0006007 Ga0495619_0006007_4732_5346 204
905 3300053085 Ga0495619_0072282 Ga0495619_0072282_345_959 204
906 3300053090 Ga0500646_0001656 Ga0500646_0001656_2601_3215 204
907 3300053096 Ga0500641_0060980 Ga0500641_0060980_597_1211 204
908 3300053104 Ga0500556_0197697 Ga0500556_0197697_85_699 204
909 3300053146 Ga0500588_0049260 Ga0500588_0049260_503_1117 204
910 3300053153 Ga0500616_0128861 Ga0500616_0128861_326_940 204
911 3300061719 Ga0466962_0036499 Ga0466962_0036499_1111_1725 204
912 3300061719 Ga0466962_0063046 Ga0466962_0063046_767_1381 204
913 3300061719 Ga0466962_0158012 Ga0466962_0158012_290_904 204
914 iso_pu_bacteria 2899370129 2899371273 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02572

CobA_CobO_BtuR

ATP:corrinoid adenosyltransferase BtuR/CobO/CobP

21

200

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.8862 22 190
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.8798 22 204
1g64-assembly1.cif.gz_B the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex 0.8787 21 204
4hut-assembly1.cif.gz_B structure of atp:co(i)rrinoid adenosyltransferase (coba) from salmonella enterica in complex with four and five-coordinate cob(ii)alamin and atp 0.8749 22 204
1g5r-assembly1.cif.gz_A the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form 0.8703 22 190
ID Description Score Start End Superfamily
af_I6Y1V6_9_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9545 9 204 3.40.50.300
af_I6Y1V6_9_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9357 9 204 3.40.50.300
1g64A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8815 22 204 3.40.50.300
1g64B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8787 21 204 3.40.50.300
1g64A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8766 22 204 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A655A6I8-F1-model_v4 Cob(I)alamin adenosyltransferase CobO (EC 2.5.1.17) 0.9535 22 204 GO:0005524
GO:0008817
GO:0009236
AF-A0A0E3H640-F1-model_v4 deleted 0.9489 1 204
AF-A0A0E3H640-F1-model_v4 deleted 0.9444 1 204
AF-A0A1E4I237-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase 0.9419 44 204 GO:0005524
GO:0008817
GO:0009236
AF-A0A7W1HNV8-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase (EC 2.5.1.17) 0.9392 20 204 GO:0005524
GO:0008817
GO:0009236

Feature Viewer

pLDDT pTM Quality
87.39 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map