F485496

General Info

Members Datasets Scaffolds Average Seq Length
912 396 912 279

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10071205|Ga0065712_100712054
Length 306
Sequence MPAARGVTNERGKPIAMSSWLLLTVNSVTFGGLLFLLSAGFSLIFGLMRIPNLTHGSLFMLGAYIGATFVGGMLGITFDFWLAALFAALLVAAFGAVLERFLLRQLPGQQLAQVLVTLGVSFIAADFCLMVWGGDPINVASPKGLSGFLRVGPLVVPYYRLTIIVIAVIVAIALWLLLDRTRLGAMIRAGVDDPDMARVVGIRVSRLFTIVFALGAGLAAFAGIIGGPMLSAYPGLDQDMLPLALVVVILGGTGSLLGSFVXSIIIGFIYNFGQAMLPELAYFVLFLPMLLVLLLRPQGLFGRHVP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
128 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
231 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
237 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
238 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
239 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
240 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
241 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
242 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
246 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
273 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
278 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
315 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
372 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
373 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
374 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
389 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
390 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
391 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
392 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
393 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
394 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
395 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0.11
Rhizoplane 5.81
Rhizosphere 92.21
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214800757 2209111006 Bacteria 10991
2 ARcpr5oldR_c000270 3300000041 Bacteria 8047
3 ARcpr5yngRDRAFT_c000228 3300000043 Bacteria 8489
4 ARSoilOldRDRAFT_c000005 3300000044 Bacteria 61735
5 ARCol0yngRDRAFT_1000214 3300000652 Bacteria 9796
6 JGI24752J21851_1000784 3300001976 Bacteria 4278
7 JGI24747J21853_1003687 3300001978 Bacteria 1334
8 JGI24739J22299_10003989 3300001989 Bacteria 5651
9 JGI24737J22298_10000343 3300001990 Bacteria 15615
10 JGI24743J22301_10021555 3300001991 Bacteria 1232
11 JGI24750J21931_1000168 3300002070 Bacteria 10890
12 JGI24745J21846_1000151 3300002073 Bacteria 5494
13 JGI24035J26624_1000065 3300002126 Bacteria 8340
14 JGI24034J26672_10001763 3300002239 Bacteria 2915
15 JGI24742J22300_10000257 3300002244 Bacteria 7900
16 JGI25153J46596_10001449 3300003215 Bacteria 14192
17 Ga0065716_1002539 3300005277 Bacteria 1697
18 Ga0065712_10071205 3300005290 Bacteria 5416
19 Ga0065712_10082435 3300005290 Bacteria 2916
20 Ga0065715_10003092 3300005293 Bacteria 6327
21 Ga0065715_10139107 3300005293 Bacteria 1882
22 Ga0070658_10010555 3300005327 Bacteria 7402
23 Ga0070658_10145431 3300005327 Bacteria 1982
24 Ga0070658_10334573 3300005327 Bacteria 1294
25 Ga0070676_10002063 3300005328 Bacteria 10216
26 Ga0070676_10009281 3300005328 Bacteria 5318
27 Ga0070676_10038494 3300005328 Bacteria 2763
28 Ga0070676_10171792 3300005328 Bacteria 1403
29 Ga0070683_100001967 3300005329 Bacteria 16094
30 Ga0070683_100042152 3300005329 Bacteria 4202
31 Ga0070690_100000854 3300005330 Bacteria 15470
32 Ga0070690_100013139 3300005330 Bacteria 4887
33 Ga0070690_100026597 3300005330 Bacteria 3570
34 Ga0070670_100004470 3300005331 Bacteria 11712
35 Ga0070670_100138997 3300005331 Bacteria 2100
36 Ga0070677_10000911 3300005333 Bacteria 9676
37 Ga0068869_100002063 3300005334 Bacteria 12079
38 Ga0068869_100468608 3300005334 Bacteria 1047
39 Ga0070666_10017947 3300005335 Bacteria 4541
40 Ga0070666_10029521 3300005335 Bacteria 3606
41 Ga0070680_100003747 3300005336 Bacteria 11362
42 Ga0070680_100005559 3300005336 Bacteria 9541
43 Ga0070680_100018993 3300005336 Bacteria 5440
44 Ga0070680_100033893 3300005336 Bacteria 4118
45 Ga0070680_100221375 3300005336 Bacteria 1598
46 Ga0070680_100233548 3300005336 Bacteria 1554
47 Ga0070682_100003321 3300005337 Bacteria 8923
48 Ga0070682_100048658 3300005337 Bacteria 2640
49 Ga0070682_100178814 3300005337 Bacteria 1480
50 Ga0068868_100001518 3300005338 Bacteria 15922
51 Ga0068868_100016754 3300005338 Bacteria 5449
52 Ga0068868_100052438 3300005338 Bacteria 3211
53 Ga0070660_100001923 3300005339 Bacteria 14314
54 Ga0070660_100010402 3300005339 Bacteria 6578
55 Ga0070660_100022813 3300005339 Bacteria 4635
56 Ga0070660_100115004 3300005339 Bacteria 2144
57 Ga0070689_100001902 3300005340 Bacteria 13496
58 Ga0070689_100003987 3300005340 Bacteria 9921
59 Ga0070689_100027712 3300005340 Bacteria 4273
60 Ga0070691_10001508 3300005341 Bacteria 10000
61 Ga0070691_10019887 3300005341 Bacteria 3099
62 Ga0070687_100000581 3300005343 Bacteria 12175
63 Ga0070687_100002166 3300005343 Bacteria 7262
64 Ga0070687_100019986 3300005343 Bacteria 3125
65 Ga0070661_100002173 3300005344 Bacteria 13503
66 Ga0070692_10000022 3300005345 Bacteria 31371
67 Ga0070668_100007861 3300005347 Bacteria 7918
68 Ga0070668_100233335 3300005347 Bacteria 1522
69 Ga0070669_100005226 3300005353 Bacteria 9383
70 Ga0070669_100019391 3300005353 Bacteria 4857
71 Ga0070675_100001735 3300005354 Bacteria 16095
72 Ga0070671_100001490 3300005355 Bacteria 17502
73 Ga0070671_100148084 3300005355 Bacteria 1982
74 Ga0070671_100516024 3300005355 Bacteria 1029
75 Ga0070674_100010186 3300005356 Bacteria 5666
76 Ga0070674_100153912 3300005356 Bacteria 1738
77 Ga0070673_100002359 3300005364 Bacteria 11478
78 Ga0070673_100035233 3300005364 Bacteria 3793
79 Ga0070673_100053689 3300005364 Bacteria 3167
80 Ga0070673_100301922 3300005364 Bacteria 1410
81 Ga0070688_100000196 3300005365 Bacteria 32063
82 Ga0070688_100008636 3300005365 Bacteria 5544
83 Ga0070688_100008930 3300005365 Bacteria 5457
84 Ga0070659_100001661 3300005366 Bacteria 15993
85 Ga0070659_100013492 3300005366 Bacteria 6082
86 Ga0070667_100001157 3300005367 Bacteria 23956
87 Ga0070667_100041199 3300005367 Bacteria 3874
88 Ga0070703_10003849 3300005406 Bacteria 4250
89 Ga0070703_10052760 3300005406 Bacteria 1305
90 Ga0070709_10012677 3300005434 Bacteria 4721
91 Ga0070709_10026420 3300005434 Bacteria 3441
92 Ga0070709_10098427 3300005434 Bacteria 1944
93 Ga0070709_10150204 3300005434 Bacteria 1609
94 Ga0070709_10254314 3300005434 Bacteria 1267
95 Ga0070714_100010967 3300005435 Bacteria 7178
96 Ga0070714_100211552 3300005435 Bacteria 1778
97 Ga0070714_100512959 3300005435 Bacteria 1144
98 Ga0070713_100002801 3300005436 Bacteria 11398
99 Ga0070713_100015520 3300005436 Bacteria 5700
100 Ga0070713_100024112 3300005436 Bacteria 4734
101 Ga0070710_10004196 3300005437 Bacteria 6834
102 Ga0070710_10007560 3300005437 Bacteria 5263
103 Ga0070710_10028417 3300005437 Bacteria 2991
104 Ga0070710_10052553 3300005437 Bacteria 2292
105 Ga0070701_10001517 3300005438 Bacteria 8603
106 Ga0070701_10116682 3300005438 Bacteria 1499
107 Ga0070711_100016320 3300005439 Bacteria 4716
108 Ga0070711_100099733 3300005439 Bacteria 2111
109 Ga0070711_100150321 3300005439 Bacteria 1755
110 Ga0070711_100169732 3300005439 Bacteria 1662
111 Ga0070711_100366611 3300005439 Bacteria 1161
112 Ga0070705_100003506 3300005440 Bacteria 7675
113 Ga0070705_100029174 3300005440 Bacteria 3031
114 Ga0070700_100001358 3300005441 Bacteria 12161
115 Ga0070708_100052232 3300005445 Bacteria 3624
116 Ga0070708_100327919 3300005445 Bacteria 1442
117 Ga0070663_100015910 3300005455 Bacteria 4870
118 Ga0070678_100019756 3300005456 Bacteria 4402
119 Ga0070678_100028197 3300005456 Bacteria 3825
120 Ga0070678_100079831 3300005456 Bacteria 2476
121 Ga0070662_100002117 3300005457 Bacteria 12175
122 Ga0070662_100073764 3300005457 Bacteria 2522
123 Ga0070681_10000884 3300005458 Bacteria 25290
124 Ga0070681_10005194 3300005458 Bacteria 12568
125 Ga0070681_10010872 3300005458 Bacteria 8996
126 Ga0070681_10031579 3300005458 Bacteria 5316
127 Ga0070681_10071764 3300005458 Bacteria 3427
128 Ga0070681_10361388 3300005458 Bacteria 1362
129 Ga0070681_10481520 3300005458 Bacteria 1154
130 Ga0068867_100000744 3300005459 Bacteria 21853
131 Ga0068867_100008460 3300005459 Bacteria 7259
132 Ga0070685_10007166 3300005466 Bacteria 5694
133 Ga0070685_10010537 3300005466 Bacteria 4805
134 Ga0070706_100276197 3300005467 Bacteria 1568
135 Ga0070707_100314025 3300005468 Bacteria 1523
136 Ga0070679_100009711 3300005530 Bacteria 9102
137 Ga0070679_100079455 3300005530 Bacteria 3269
138 Ga0070679_100109883 3300005530 Bacteria 2743
139 Ga0070679_100154418 3300005530 Bacteria 2271
140 Ga0070679_100378451 3300005530 Bacteria 1362
141 Ga0070679_100594616 3300005530 Bacteria 1050
142 Ga0070684_100001760 3300005535 Bacteria 15798
143 Ga0070684_100015270 3300005535 Bacteria 6249
144 Ga0070684_100018534 3300005535 Bacteria 5737
145 Ga0070684_100397342 3300005535 Bacteria 1271
146 Ga0070697_100170653 3300005536 Bacteria 1841
147 Ga0068853_100005867 3300005539 Bacteria 9678
148 Ga0068853_100009738 3300005539 Bacteria 7752
149 Ga0068853_100081713 3300005539 Bacteria 2830
150 Ga0070672_100001256 3300005543 Bacteria 15606
151 Ga0070686_100000931 3300005544 Bacteria 16827
152 Ga0070686_100038445 3300005544 Bacteria 2975
153 Ga0070686_100064466 3300005544 Bacteria 2377
154 Ga0070695_100001091 3300005545 Bacteria 14845
155 Ga0070695_100006266 3300005545 Bacteria 7028
156 Ga0070696_100003841 3300005546 Bacteria 10031
157 Ga0070696_100011088 3300005546 Bacteria 6032
158 Ga0070693_100001091 3300005547 Bacteria 12175
159 Ga0070693_100038707 3300005547 Bacteria 2667
160 Ga0070693_100063071 3300005547 Bacteria 2159
161 Ga0070665_100370643 3300005548 Bacteria 1439
162 Ga0070704_100000586 3300005549 Bacteria 17523
163 Ga0068855_100012952 3300005563 Bacteria 10061
164 Ga0068855_100029487 3300005563 Bacteria 6558
165 Ga0068855_100042633 3300005563 Bacteria 5376
166 Ga0068855_100082057 3300005563 Bacteria 3737
167 Ga0070664_100007278 3300005564 Bacteria 8922
168 Ga0070664_100077740 3300005564 Bacteria 2854
169 Ga0068857_100037356 3300005577 Bacteria 4302
170 Ga0068857_100168071 3300005577 Bacteria 1992
171 Ga0068854_100005058 3300005578 Bacteria 8305
172 Ga0068854_100065614 3300005578 Bacteria 2640
173 Ga0068856_100002589 3300005614 Bacteria 18625
174 Ga0068856_100186030 3300005614 Bacteria 2091
175 Ga0068856_100186780 3300005614 Bacteria 2086
176 Ga0068856_100189691 3300005614 Bacteria 2069
177 Ga0070702_100001481 3300005615 Bacteria 9638
178 Ga0068852_100001321 3300005616 Bacteria 16607
179 Ga0068852_100188954 3300005616 Bacteria 1942
180 Ga0068859_100003378 3300005617 Bacteria 16230
181 Ga0068859_100006249 3300005617 Bacteria 12090
182 Ga0068859_100125502 3300005617 Bacteria 2635
183 Ga0068859_100226901 3300005617 Bacteria 1956
184 Ga0068859_100479684 3300005617 Bacteria 1339
185 Ga0068864_100005368 3300005618 Bacteria 10498
186 Ga0068864_100033385 3300005618 Bacteria 4375
187 Ga0068866_10001827 3300005718 Bacteria 8951
188 Ga0068866_10003791 3300005718 Bacteria 6200
189 Ga0068861_100004442 3300005719 Bacteria 9412
190 Ga0068861_100051085 3300005719 Bacteria 3137
191 Ga0068870_10001047 3300005840 Bacteria 10938
192 Ga0068863_100004482 3300005841 Bacteria 13773
193 Ga0068863_100046817 3300005841 Bacteria 4105
194 Ga0068863_100259042 3300005841 Bacteria 1681
195 Ga0068858_100002675 3300005842 Bacteria 17941
196 Ga0068858_100025282 3300005842 Bacteria 5526
197 Ga0068860_100008474 3300005843 Bacteria 10247
198 Ga0068860_100015436 3300005843 Bacteria 7462
199 Ga0068860_100036815 3300005843 Bacteria 4686
200 Ga0068862_100001659 3300005844 Bacteria 20231
201 Ga0081540_1001075 3300005983 Bacteria 24254
202 Ga0081540_1028851 3300005983 Bacteria 3104
203 Ga0081539_10010901 3300005985 Bacteria 7299
204 Ga0070717_10020314 3300006028 Bacteria 5221
205 Ga0075432_10032913 3300006058 Bacteria 1796
206 Ga0070716_100002129 3300006173 Bacteria 9093
207 Ga0070716_100076563 3300006173 Bacteria 1983
208 Ga0070712_100011749 3300006175 Bacteria 5565
209 Ga0070712_100077390 3300006175 Bacteria 2398
210 Ga0070712_100360171 3300006175 Bacteria 1192
211 Ga0097621_100000432 3300006237 Bacteria 29159
212 Ga0097621_100003548 3300006237 Bacteria 10774
213 Ga0097621_100060177 3300006237 Bacteria 3112
214 Ga0097621_100170040 3300006237 Bacteria 1878
215 Ga0068871_100002403 3300006358 Bacteria 12772
216 Ga0068871_100012965 3300006358 Bacteria 6172
217 Ga0075428_100006289 3300006844 Bacteria 13200
218 Ga0075428_100201448 3300006844 Bacteria 2152
219 Ga0075430_100000312 3300006846 Bacteria 34556
220 Ga0075431_100007548 3300006847 Bacteria 10828
221 Ga0075433_10000328 3300006852 Bacteria 29209
222 Ga0075433_10006826 3300006852 Bacteria 9048
223 Ga0075433_10010986 3300006852 Bacteria 7281
224 Ga0075433_10205078 3300006852 Bacteria 1753
225 Ga0075434_100000482 3300006871 Bacteria 29922
226 Ga0075434_100002518 3300006871 Bacteria 16154
227 Ga0075434_100051855 3300006871 Bacteria 4076
228 Ga0075434_100288436 3300006871 Bacteria 1661
229 Ga0075429_100001514 3300006880 Bacteria 19140
230 Ga0068865_100000989 3300006881 Bacteria 16275
231 Ga0068865_100017724 3300006881 Bacteria 4584
232 Ga0075436_100026247 3300006914 Bacteria 4010
233 Ga0097620_100003378 3300006931 Bacteria 16230
234 Ga0097620_100006249 3300006931 Bacteria 12090
235 Ga0097620_100125498 3300006931 Bacteria 2635
236 Ga0097620_100226901 3300006931 Bacteria 1956
237 Ga0097620_100479745 3300006931 Bacteria 1339
238 Ga0075435_100007820 3300007076 Bacteria 7647
239 Ga0075435_100025200 3300007076 Bacteria 4627
240 Ga0075435_100048841 3300007076 Bacteria 3401
241 Ga0105251_10012487 3300009011 Bacteria 4803
242 Ga0105250_10052453 3300009092 Bacteria 1636
243 Ga0105240_10077191 3300009093 Bacteria 4105
244 Ga0105240_10110217 3300009093 Bacteria 3332
245 Ga0105240_10208342 3300009093 Bacteria 2286
246 Ga0105240_10431148 3300009093 Bacteria 1479
247 Ga0105240_10545184 3300009093 Bacteria 1284
248 Ga0111539_10001938 3300009094 Bacteria 27600
249 Ga0111539_10006634 3300009094 Bacteria 14909
250 Ga0111539_10024894 3300009094 Bacteria 7339
251 Ga0111539_10084249 3300009094 Bacteria 3738
252 Ga0105245_10000534 3300009098 Bacteria 34896
253 Ga0105245_10001271 3300009098 Bacteria 22781
254 Ga0105245_10351569 3300009098 Bacteria 1460
255 Ga0105247_10004338 3300009101 Bacteria 9064
256 Ga0105247_10048562 3300009101 Bacteria 2607
257 Ga0105247_10055194 3300009101 Bacteria 2452
258 Ga0114129_10007064 3300009147 Bacteria 15979
259 Ga0114129_10013293 3300009147 Bacteria 11731
260 Ga0105243_10002870 3300009148 Bacteria 14286
261 Ga0105243_10011971 3300009148 Bacteria 6557
262 Ga0105243_10126450 3300009148 Bacteria 2163
263 Ga0105243_10216616 3300009148 Bacteria 1690
264 Ga0105241_10002371 3300009174 Bacteria 14157
265 Ga0105241_10023086 3300009174 Bacteria 4611
266 Ga0105241_10027062 3300009174 Bacteria 4268
267 Ga0105241_10268296 3300009174 Bacteria 1453
268 Ga0105242_10003152 3300009176 Bacteria 12875
269 Ga0105242_10028950 3300009176 Bacteria 4414
270 Ga0105248_10003614 3300009177 Bacteria 17151
271 Ga0105248_10051773 3300009177 Bacteria 4607
272 Ga0105248_10112739 3300009177 Bacteria 3067
273 Ga0105237_10044779 3300009545 Bacteria 4455
274 Ga0105237_10201002 3300009545 Bacteria 1993
275 Ga0105238_10040585 3300009551 Bacteria 4715
276 Ga0105238_10053026 3300009551 Bacteria 4076
277 Ga0105238_10073363 3300009551 Bacteria 3417
278 Ga0105249_10001017 3300009553 Bacteria 24807
279 Ga0105249_10029951 3300009553 Bacteria 4917
280 Ga0123342_1000455 3300009766 Bacteria 64500
281 Ga0099796_10061734 3300010159 Bacteria 1330
282 Ga0105239_10017653 3300010375 Bacteria 7892
283 Ga0105239_10069833 3300010375 Bacteria 3858
284 Ga0105239_10668525 3300010375 Bacteria 1187
285 Ga0105246_10007846 3300011119 Bacteria 6548
286 Ga0105246_10070968 3300011119 Bacteria 2451
287 Ga0105246_10190093 3300011119 Bacteria 1589
288 Ga0157337_1001599 3300012483 Bacteria 1191
289 Ga0157341_1000733 3300012494 Bacteria 1769
290 Ga0157373_10089296 3300013100 Bacteria 2170
291 Ga0157371_10034311 3300013102 Bacteria 3640
292 Ga0157371_10061309 3300013102 Bacteria 2667
293 Ga0157370_10011104 3300013104 Bacteria 9443
294 Ga0157369_10047309 3300013105 Bacteria 4672
295 Ga0157369_10049987 3300013105 Bacteria 4530
296 Ga0157374_10004819 3300013296 Bacteria 11325
297 Ga0157378_10042017 3300013297 Bacteria 4056
298 Ga0163162_10003671 3300013306 Bacteria 14720
299 Ga0163162_10028781 3300013306 Bacteria 5499
300 Ga0157372_10045137 3300013307 Bacteria 4887
301 Ga0157372_10078105 3300013307 Bacteria 3740
302 Ga0157372_10137183 3300013307 Bacteria 2818
303 Ga0157375_10001417 3300013308 Bacteria 20618
304 Ga0157375_10025426 3300013308 Bacteria 5501
305 Ga0157375_10201737 3300013308 Bacteria 2145
306 Ga0163163_10019563 3300014325 Bacteria 6360
307 Ga0163163_10039219 3300014325 Bacteria 4622
308 Ga0157380_10007707 3300014326 Bacteria 7660
309 Ga0182008_10089735 3300014497 Bacteria 1515
310 Ga0157377_10000458 3300014745 Bacteria 17574
311 Ga0157379_10003079 3300014968 Bacteria 14099
312 Ga0157379_10062633 3300014968 Bacteria 3326
313 Ga0157376_10004629 3300014969 Bacteria 9584
314 Ga0163161_10002260 3300017792 Bacteria 13806
315 Ga0207666_1000030 3300025271 Bacteria 31103
316 Ga0207666_1000322 3300025271 Bacteria 6680
317 Ga0207673_1003710 3300025290 Bacteria 1799
318 Ga0209758_1001765 3300025297 Bacteria 23988
319 Ga0207697_10000225 3300025315 Bacteria 30578
320 Ga0207697_10003133 3300025315 Bacteria 8253
321 Ga0207653_10002351 3300025885 Bacteria 6027
322 Ga0207653_10022395 3300025885 Bacteria 2007
323 Ga0207682_10000009 3300025893 Bacteria 86366
324 Ga0207692_10002474 3300025898 Bacteria 7091
325 Ga0207692_10016538 3300025898 Bacteria 3270
326 Ga0207692_10039844 3300025898 Bacteria 2315
327 Ga0207692_10154140 3300025898 Bacteria 1318
328 Ga0207642_10001175 3300025899 Bacteria 8067
329 Ga0207710_10017761 3300025900 Bacteria 3019
330 Ga0207710_10025504 3300025900 Bacteria 2551
331 Ga0207688_10000060 3300025901 Bacteria 40194
332 Ga0207688_10027494 3300025901 Bacteria 3129
333 Ga0207680_10009851 3300025903 Bacteria 4758
334 Ga0207680_10036845 3300025903 Bacteria 2819
335 Ga0207647_10000172 3300025904 Bacteria 51724
336 Ga0207647_10007789 3300025904 Bacteria 7711
337 Ga0207699_10004490 3300025906 Bacteria 6667
338 Ga0207699_10013160 3300025906 Bacteria 4225
339 Ga0207699_10041381 3300025906 Bacteria 2661
340 Ga0207645_10001556 3300025907 Bacteria 18769
341 Ga0207645_10167069 3300025907 Bacteria 1441
342 Ga0207643_10000244 3300025908 Bacteria 37860
343 Ga0207705_10034529 3300025909 Bacteria 3616
344 Ga0207684_10122547 3300025910 Bacteria 2229
345 Ga0207707_10006429 3300025912 Bacteria 10265
346 Ga0207707_10025856 3300025912 Bacteria 5134
347 Ga0207695_10061716 3300025913 Bacteria 3873
348 Ga0207695_10087008 3300025913 Bacteria 3149
349 Ga0207671_10113869 3300025914 Bacteria 2061
350 Ga0207671_10124502 3300025914 Bacteria 1973
351 Ga0207693_10004633 3300025915 Bacteria 11602
352 Ga0207693_10005817 3300025915 Bacteria 10232
353 Ga0207693_10021327 3300025915 Bacteria 5149
354 Ga0207693_10051174 3300025915 Bacteria 3242
355 Ga0207663_10007441 3300025916 Bacteria 5678
356 Ga0207663_10031199 3300025916 Bacteria 3151
357 Ga0207663_10402436 3300025916 Bacteria 1047
358 Ga0207660_10000179 3300025917 Bacteria 40457
359 Ga0207660_10006590 3300025917 Bacteria 7538
360 Ga0207660_10024675 3300025917 Bacteria 4073
361 Ga0207660_10102635 3300025917 Bacteria 2138
362 Ga0207660_10125248 3300025917 Bacteria 1950
363 Ga0207660_10151366 3300025917 Bacteria 1783
364 Ga0207662_10000025 3300025918 Bacteria 70078
365 Ga0207662_10003619 3300025918 Bacteria 7986
366 Ga0207662_10040739 3300025918 Bacteria 2731
367 Ga0207657_10006380 3300025919 Bacteria 12245
368 Ga0207657_10018063 3300025919 Bacteria 6747
369 Ga0207657_10038325 3300025919 Bacteria 4268
370 Ga0207657_10040159 3300025919 Bacteria 4149
371 Ga0207649_10000693 3300025920 Bacteria 22200
372 Ga0207649_10079162 3300025920 Bacteria 2122
373 Ga0207652_10002825 3300025921 Bacteria 14578
374 Ga0207652_10007586 3300025921 Bacteria 8736
375 Ga0207652_10010905 3300025921 Bacteria 7325
376 Ga0207652_10037589 3300025921 Bacteria 4098
377 Ga0207652_10057175 3300025921 Bacteria 3359
378 Ga0207681_10001707 3300025923 Bacteria 14116
379 Ga0207681_10075201 3300025923 Bacteria 2368
380 Ga0207694_10019609 3300025924 Bacteria 5114
381 Ga0207694_10237291 3300025924 Bacteria 1490
382 Ga0207694_10440235 3300025924 Bacteria 1087
383 Ga0207650_10035875 3300025925 Bacteria 3604
384 Ga0207650_10042870 3300025925 Bacteria 3319
385 Ga0207659_10000283 3300025926 Bacteria 30879
386 Ga0207659_10186717 3300025926 Bacteria 1647
387 Ga0207687_10002275 3300025927 Bacteria 13067
388 Ga0207687_10002373 3300025927 Bacteria 12788
389 Ga0207687_10003040 3300025927 Bacteria 11370
390 Ga0207687_10234463 3300025927 Bacteria 1451
391 Ga0207700_10005221 3300025928 Bacteria 7740
392 Ga0207700_10258449 3300025928 Unclassified 1490
393 Ga0207664_10018705 3300025929 Bacteria 5107
394 Ga0207664_10027330 3300025929 Bacteria 4324
395 Ga0207664_10040856 3300025929 Bacteria 3610
396 Ga0207664_10052000 3300025929 Bacteria 3238
397 Ga0207664_10080480 3300025929 Bacteria 2648
398 Ga0207664_10171390 3300025929 Bacteria 1858
399 Ga0207644_10008220 3300025931 Bacteria 6834
400 Ga0207644_10016312 3300025931 Bacteria 4997
401 Ga0207690_10002627 3300025932 Bacteria 10817
402 Ga0207706_10000734 3300025933 Bacteria 34159
403 Ga0207706_10013528 3300025933 Bacteria 7416
404 Ga0207706_10519887 3300025933 Bacteria 1026
405 Ga0207686_10003173 3300025934 Bacteria 8849
406 Ga0207686_10054173 3300025934 Bacteria 2512
407 Ga0207709_10003573 3300025935 Bacteria 9192
408 Ga0207709_10051102 3300025935 Bacteria 2532
409 Ga0207670_10002092 3300025936 Bacteria 10434
410 Ga0207670_10006340 3300025936 Bacteria 6554
411 Ga0207670_10028166 3300025936 Bacteria 3562
412 Ga0207670_10052750 3300025936 Bacteria 2736
413 Ga0207669_10000204 3300025937 Bacteria 27121
414 Ga0207704_10000130 3300025938 Bacteria 41287
415 Ga0207665_10000605 3300025939 Bacteria 24109
416 Ga0207665_10062868 3300025939 Bacteria 2520
417 Ga0207665_10101584 3300025939 Bacteria 2008
418 Ga0207691_10000309 3300025940 Bacteria 48592
419 Ga0207691_10040902 3300025940 Bacteria 4282
420 Ga0207711_10003739 3300025941 Bacteria 13120
421 Ga0207711_10012929 3300025941 Bacteria 6934
422 Ga0207711_10056517 3300025941 Bacteria 3373
423 Ga0207711_10342954 3300025941 Bacteria 1383
424 Ga0207689_10000893 3300025942 Bacteria 28654
425 Ga0207689_10012479 3300025942 Bacteria 7259
426 Ga0207689_10519408 3300025942 Bacteria 999
427 Ga0207661_10002361 3300025944 Bacteria 12991
428 Ga0207661_10510291 3300025944 Bacteria 1099
429 Ga0207679_10000128 3300025945 Bacteria 61823
430 Ga0207679_10095705 3300025945 Bacteria 2309
431 Ga0207667_10035043 3300025949 Bacteria 5386
432 Ga0207667_10084560 3300025949 Bacteria 3285
433 Ga0207651_10003176 3300025960 Bacteria 8017
434 Ga0207651_10056641 3300025960 Bacteria 2699
435 Ga0207712_10003532 3300025961 Bacteria 9858
436 Ga0207668_10002246 3300025972 Bacteria 11262
437 Ga0207640_10003873 3300025981 Bacteria 8078
438 Ga0207640_10097227 3300025981 Bacteria 2055
439 Ga0207640_10118214 3300025981 Bacteria 1893
440 Ga0207658_10005965 3300025986 Bacteria 8324
441 Ga0207658_10087707 3300025986 Bacteria 2403
442 Ga0207677_10003185 3300026023 Bacteria 8663
443 Ga0207677_10026509 3300026023 Bacteria 3637
444 Ga0207703_10010286 3300026035 Bacteria 7327
445 Ga0207703_10016763 3300026035 Bacteria 5716
446 Ga0207703_10169031 3300026035 Bacteria 1922
447 Ga0207678_10000759 3300026067 Bacteria 29491
448 Ga0207708_10000391 3300026075 Bacteria 34446
449 Ga0207708_10007940 3300026075 Bacteria 7865
450 Ga0207702_10026447 3300026078 Bacteria 4817
451 Ga0207702_10137279 3300026078 Bacteria 2208
452 Ga0207702_10137575 3300026078 Bacteria 2206
453 Ga0207702_10187011 3300026078 Bacteria 1911
454 Ga0207641_10008773 3300026088 Bacteria 8349
455 Ga0207641_10042207 3300026088 Bacteria 3825
456 Ga0207641_10466935 3300026088 Bacteria 1222
457 Ga0207648_10000862 3300026089 Bacteria 34173
458 Ga0207648_10013532 3300026089 Bacteria 7585
459 Ga0207676_10007810 3300026095 Bacteria 7610
460 Ga0207676_10046219 3300026095 Bacteria 3367
461 Ga0207676_10230196 3300026095 Bacteria 1656
462 Ga0207674_10000806 3300026116 Bacteria 40763
463 Ga0207674_10071472 3300026116 Bacteria 3486
464 Ga0207675_100000637 3300026118 Bacteria 34408
465 Ga0207675_100022012 3300026118 Bacteria 5934
466 Ga0207675_100141843 3300026118 Bacteria 2283
467 Ga0207683_10000330 3300026121 Bacteria 43106
468 Ga0207683_10004948 3300026121 Bacteria 11462
469 Ga0207683_10027674 3300026121 Bacteria 4898
470 Ga0207698_10003712 3300026142 Bacteria 9233
471 Ga0207698_10609436 3300026142 Bacteria 1077
472 Ga0209982_1024857 3300027552 Bacteria 930
473 Ga0210002_1004342 3300027617 Bacteria 2107
474 Ga0209971_1010514 3300027682 Bacteria 2192
475 Ga0209998_10001194 3300027717 Bacteria 6412
476 Ga0209974_10002570 3300027876 Bacteria 6593
477 Ga0207428_10000164 3300027907 Bacteria 91968
478 Ga0207428_10000815 3300027907 Bacteria 35204
479 Ga0207428_10028987 3300027907 Bacteria 4593
480 Ga0268266_10003098 3300028379 Bacteria 16939
481 Ga0268266_10325574 3300028379 Bacteria 1439
482 Ga0268265_10029530 3300028380 Bacteria 3936
483 Ga0268264_10005408 3300028381 Bacteria 10815
484 Ga0268264_10011667 3300028381 Bacteria 7245
485 Ga0268264_10060114 3300028381 Bacteria 3185
486 Ga0268264_10066354 3300028381 Bacteria 3043
487 Ga0265337_1003126 3300028556 Bacteria 7295
488 Ga0265338_10004795 3300028800 Bacteria 18074
489 Ga0265338_10008257 3300028800 Bacteria 12676
490 Ga0265330_10035525 3300031235 Bacteria 2223
491 Ga0265325_10000474 3300031241 Bacteria 29121
492 Ga0265325_10001518 3300031241 Bacteria 16310
493 Ga0265325_10003355 3300031241 Bacteria 10511
494 Ga0265325_10005419 3300031241 Bacteria 7873
495 Ga0265325_10062342 3300031241 Bacteria 1889
496 Ga0265325_10066896 3300031241 Bacteria 1811
497 Ga0265325_10156220 3300031241 Bacteria 1076
498 Ga0265340_10045716 3300031247 Bacteria 2137
499 Ga0265339_10020454 3300031249 Bacteria 3866
500 Ga0265316_10229918 3300031344 Bacteria 1366
501 Ga0265316_10350671 3300031344 Bacteria 1068
502 Ga0265313_10000251 3300031595 Bacteria 58545
503 Ga0265313_10015134 3300031595 Bacteria 4514
504 Ga0265313_10038015 3300031595 Bacteria 2401
505 Ga0265313_10067483 3300031595 Bacteria 1654
506 Ga0265314_10007418 3300031711 Bacteria 9510
507 Ga0265314_10016261 3300031711 Bacteria 5886
508 Ga0265314_10071938 3300031711 Bacteria 2312
509 Ga0265342_10000321 3300031712 Bacteria 54074
510 Ga0265342_10014775 3300031712 Bacteria 5171
511 Ga0373930_0022536 3300034816 Bacteria 1246
512 Ga0373950_0000743 3300034818 Bacteria 4051
513 Ga0373958_0000470 3300034819 Bacteria 4945
514 Ga0373958_0018017 3300034819 Bacteria 1276
515 Ga0373959_0031410 3300034820 Bacteria 1074
516 Ga0373938_0001451 3300034957 Bacteria 3794
517 Ga0373926_0026193 3300035083 Bacteria 2038
518 Ga0373928_0001031 3300035084 Bacteria 5485
519 Ga0373928_0008518 3300035084 Bacteria 1992
520 Ga0373929_0000454 3300035085 Bacteria 7780
521 Ga0373929_0001366 3300035085 Bacteria 4674
522 Ga0373929_0004285 3300035085 Bacteria 2561
523 Ga0373934_0040680 3300035086 Bacteria 1834
524 Ga0373940_0070103 3300035088 Bacteria 1019
525 Ga0373949_0004409 3300035090 Bacteria 3230
526 Ga0373951_0007587 3300035091 Bacteria 2462
527 Ga0373951_0011872 3300035091 Bacteria 1958
528 Ga0373951_0089852 3300035091 Unclassified 805
529 Ga0373932_0002234 3300035112 Bacteria 4970
530 Ga0373932_0004396 3300035112 Bacteria 3336
531 Ga0373936_0009043 3300035113 Bacteria 3759
532 Ga0373936_0014538 3300035113 Bacteria 3012
533 Ga0373939_0002253 3300035114 Bacteria 4565
534 Ga0373939_0014179 3300035114 Bacteria 2063
535 Ga0373939_0030504 3300035114 Bacteria 1551
536 Ga0373941_0008307 3300035115 Bacteria 2573
537 Ga0373941_0009490 3300035115 Bacteria 2453
538 Ga0373941_0062304 3300035115 Bacteria 1217
539 Ga0373945_0020760 3300035116 Bacteria 2252
540 Ga0373953_0052171 3300035117 Bacteria 1655
541 Ga0373954_0038269 3300035118 Bacteria 2231
542 Ga0373954_0081094 3300035118 Bacteria 1550
543 Ga0373956_0075834 3300035119 Bacteria 1538
544 Ga0373960_0008151 3300035121 Bacteria 2505
545 Ga0373960_0023248 3300035121 Bacteria 1667
546 Ga0373960_0033869 3300035121 Bacteria 1442
547 Ga0373943_0040024 3300035170 Bacteria 2261
548 Ga0373946_0007213 3300035171 Bacteria 4057
549 Ga0373946_0015949 3300035171 Bacteria 2857
550 Ga0373955_0015722 3300035172 Bacteria 3712
551 Ga0373942_0001422 3300035207 Bacteria 6170
552 Ga0373942_0010380 3300035207 Bacteria 2191
553 Ga0373961_0005463 3300035241 Bacteria 3053
554 Ga0373961_0026055 3300035241 Bacteria 1595
555 Ga0373961_0088786 3300035241 Bacteria 984
556 Ga0373962_0000508 3300035242 Bacteria 8667
557 Ga0373962_0001559 3300035242 Bacteria 5437
558 Ga0373962_0001607 3300035242 Bacteria 5363
559 Ga0373924_0068203 3300035410 Bacteria 1497
560 Ga0373931_0002659 3300035691 Bacteria 7949
561 Ga0373931_0010579 3300035691 Bacteria 4436
562 Ga0373931_0038830 3300035691 Bacteria 2492
563 Ga0373931_0256913 3300035691 Bacteria 1064
564 Ga0373935_0026597 3300035692 Bacteria 3573
565 Ga0373935_0129704 3300035692 Bacteria 1693
566 Ga0373935_0207252 3300035692 Bacteria 1357
567 Ga0373927_0000755 3300035695 Bacteria 24701
568 Ga0373927_0008778 3300035695 Bacteria 6792
569 Ga0373927_0028473 3300035695 Bacteria 3644
570 Ga0373927_0232028 3300035695 Bacteria 1213
571 Ga0373933_0013479 3300035724 Bacteria 4532
572 Ga0373933_0015863 3300035724 Bacteria 4205
573 Ga0373933_0019168 3300035724 Bacteria 3859
574 Ga0373933_0091510 3300035724 Bacteria 1877
575 Ga0373933_0175147 3300035724 Bacteria 1366
576 Ga0373947_0000280 3300035725 Bacteria 28900
577 Ga0373947_0001444 3300035725 Bacteria 14616
578 Ga0373947_0004394 3300035725 Bacteria 8267
579 Ga0373947_0182370 3300035725 Bacteria 1367
580 Ga0373947_0362426 3300035725 Bacteria 974
581 Ga0373937_0000638 3300036401 Bacteria 30717
582 Ga0373937_0011341 3300036401 Bacteria 7819
583 Ga0373937_0018638 3300036401 Bacteria 6201
584 Ga0373937_0022165 3300036401 Bacteria 5707
585 Ga0373937_0026630 3300036401 Bacteria 5224
586 Ga0373937_0088424 3300036401 Bacteria 2868
587 Ga0373937_0224537 3300036401 Bacteria 1768
588 Ga0373925_0001680 3300037068 Bacteria 18618
589 Ga0373925_0001685 3300037068 Bacteria 18592
590 Ga0373925_0094854 3300037068 Bacteria 2285
591 Ga0373925_0241991 3300037068 Bacteria 1445
592 Ga0395899_0014949 3300037312 Bacteria 5920
593 Ga0395899_0047001 3300037312 Bacteria 3214
594 Ga0395900_0005653 3300037418 Bacteria 13077
595 Ga0395900_0010121 3300037418 Bacteria 9645
596 Ga0395900_0030631 3300037418 Bacteria 5525
597 Ga0395900_0188644 3300037418 Bacteria 2092
598 Ga0395898_0007938 3300037466 Bacteria 11260
599 Ga0395898_0024721 3300037466 Bacteria 6056
600 Ga0395898_0136209 3300037466 Unclassified 2351
601 Ga0395905_0132996 3300037471 Bacteria 2340
602 Ga0395905_0203644 3300037471 Bacteria 1855
603 Ga0395901_0014282 3300038443 Bacteria 8084
604 Ga0395901_0019396 3300038443 Bacteria 6953
605 Ga0395901_0122316 3300038443 Unclassified 2735
606 Ga0395901_0730518 3300038443 Bacteria 985
607 Ga0436365_0583672 3300039437 Bacteria 1481
608 Ga0439448_0119386 3300042005 Bacteria 904
609 Ga0439444_0006674 3300042437 Unclassified 1751
610 Ga0439464_0031250 3300042439 Unclassified 1494
611 Ga0466966_0160390 3300044684 Bacteria 1369
612 Ga0466961_0083853 3300044693 Bacteria 2016
613 Ga0466963_0113375 3300044694 Bacteria 1862
614 Ga0466971_0111305 3300044719 Bacteria 1264
615 Ga0466957_0013670 3300044842 Bacteria 4713
616 Ga0466957_0140114 3300044842 Bacteria 1557
617 Ga0466959_0061748 3300045049 Bacteria 2725
618 Ga0451576_0335539 3300045051 Bacteria 1582
619 Ga0466958_0012989 3300045836 Bacteria 4731
620 Ga0466958_0040988 3300045836 Bacteria 2784
621 Ga0466967_0123342 3300045976 Bacteria 2397
622 Ga0495592_0007395 3300046454 Bacteria 8220
623 Ga0495592_0041123 3300046454 Bacteria 3465
624 Ga0495592_0181371 3300046454 Bacteria 1434
625 Ga0495603_0095348 3300046455 Bacteria 1738
626 Ga0495629_0006959 3300046459 Bacteria 8343
627 Ga0495629_0021267 3300046459 Bacteria 4629
628 Ga0495629_0056626 3300046459 Bacteria 2741
629 Ga0495629_0077627 3300046459 Bacteria 2318
630 Ga0495641_0029079 3300046461 Bacteria 2666
631 Ga0495641_0033581 3300046461 Bacteria 2434
632 Ga0495651_0024292 3300046462 Bacteria 4717
633 Ga0495651_0025083 3300046462 Bacteria 4639
634 Ga0495651_0025567 3300046462 Bacteria 4597
635 Ga0495651_0052129 3300046462 Bacteria 3152
636 Ga0495653_0021634 3300046463 Bacteria 5209
637 Ga0495653_0055985 3300046463 Bacteria 3008
638 Ga0495580_0200889 3300046472 Bacteria 1373
639 Ga0495582_0001012 3300046473 Bacteria 15762
640 Ga0495639_0008822 3300046475 Bacteria 4325
641 Ga0495639_0011150 3300046475 Bacteria 3871
642 Ga0495639_0096103 3300046475 Bacteria 1395
643 Ga0495662_0004427 3300046476 Bacteria 7051
644 Ga0495662_0004939 3300046476 Bacteria 6673
645 Ga0495664_0000142 3300046477 Bacteria 35911
646 Ga0495664_0051587 3300046477 Bacteria 2442
647 Ga0495664_0113787 3300046477 Unclassified 1634
648 Ga0495594_0017400 3300046499 Bacteria 3798
649 Ga0495594_0087375 3300046499 Bacteria 1745
650 Ga0495608_0000890 3300046511 Bacteria 20925
651 Ga0495608_0007116 3300046511 Bacteria 7914
652 Ga0495608_0036752 3300046511 Bacteria 3296
653 Ga0495608_0092521 3300046511 Unclassified 1954
654 Ga0495608_0107436 3300046511 Bacteria 1796
655 Ga0495618_0004574 3300046514 Bacteria 8487
656 Ga0495618_0008801 3300046514 Bacteria 6095
657 Ga0495618_0075296 3300046514 Bacteria 2150
658 Ga0495628_0001326 3300046516 Bacteria 22701
659 Ga0495628_0019247 3300046516 Bacteria 5646
660 Ga0495630_0008519 3300046517 Bacteria 7361
661 Ga0495652_0016089 3300046529 Bacteria 6691
662 Ga0495652_0034110 3300046529 Bacteria 4437
663 Ga0495652_0042653 3300046529 Bacteria 3911
664 Ga0495652_0127068 3300046529 Bacteria 2024
665 Ga0495652_0208525 3300046529 Bacteria 1477
666 Ga0495665_0065393 3300046531 Unclassified 1919
667 Ga0495640_0021107 3300046533 Bacteria 4786
668 Ga0495640_0023436 3300046533 Bacteria 4496
669 Ga0495640_0074445 3300046533 Bacteria 2271
670 Ga0495640_0198046 3300046533 Bacteria 1274
671 Ga0495587_0002800 3300046536 Bacteria 11657
672 Ga0495587_0010617 3300046536 Bacteria 5851
673 Ga0495645_0003190 3300046543 Bacteria 11112
674 Ga0495645_0006461 3300046543 Bacteria 8134
675 Ga0495645_0038315 3300046543 Bacteria 3496
676 Ga0495667_0003101 3300046559 Bacteria 11146
677 Ga0495667_0006161 3300046559 Bacteria 8123
678 Ga0495634_0014591 3300046642 Bacteria 5660
679 Ga0495634_0030445 3300046642 Bacteria 3727
680 Ga0495634_0036439 3300046642 Bacteria 3365
681 Ga0495634_0078321 3300046642 Bacteria 2165
682 Ga0495635_0001521 3300046663 Bacteria 15539
683 Ga0495635_0003053 3300046663 Bacteria 11507
684 Ga0495635_0042556 3300046663 Bacteria 3136
685 Ga0495635_0045531 3300046663 Bacteria 3028
686 Ga0495635_0117622 3300046663 Bacteria 1814
687 Ga0495588_0056472 3300046674 Bacteria 2027
688 Ga0495657_0010806 3300046675 Bacteria 6856
689 Ga0495657_0062234 3300046675 Bacteria 2466
690 Ga0495657_0074092 3300046675 Bacteria 2216
691 Ga0495657_0146741 3300046675 Bacteria 1467
692 Ga0495599_0002450 3300046678 Bacteria 10814
693 Ga0495599_0069359 3300046678 Bacteria 2200
694 Ga0495623_0012154 3300046679 Bacteria 5578
695 Ga0495646_0018416 3300046680 Bacteria 4423
696 Ga0495646_0098846 3300046680 Bacteria 1675
697 Ga0495646_0228983 3300046680 Bacteria 1002
698 Ga0495647_0026191 3300046681 Bacteria 2134
699 Ga0495647_0039863 3300046681 Bacteria 1782
700 Ga0495658_0001393 3300046683 Bacteria 12686
701 Ga0495658_0006997 3300046683 Bacteria 5565
702 Ga0495658_0007101 3300046683 Bacteria 5532
703 Ga0495658_0039547 3300046683 Bacteria 2617
704 Ga0495613_0046256 3300046689 Bacteria 3218
705 Ga0495613_0064268 3300046689 Bacteria 2684
706 Ga0495613_0134523 3300046689 Bacteria 1769
707 Ga0495624_0003675 3300046690 Bacteria 11335
708 Ga0495600_0006458 3300046809 Bacteria 7140
709 Ga0495600_0016856 3300046809 Bacteria 4644
710 Ga0495600_0065329 3300046809 Bacteria 2379
711 Ga0495600_0113886 3300046809 Bacteria 1761
712 Ga0495581_0009511 3300047315 Bacteria 5625
713 Ga0495581_0024911 3300047315 Bacteria 3466
714 Ga0495581_0113186 3300047315 Bacteria 1578
715 Ga0495604_0008196 3300047317 Bacteria 8267
716 Ga0495604_0014298 3300047317 Bacteria 6328
717 Ga0495604_0051376 3300047317 Bacteria 3196
718 Ga0495674_0009624 3300047319 Bacteria 9181
719 Ga0495674_0037656 3300047319 Bacteria 4346
720 Ga0495674_0049606 3300047319 Bacteria 3708
721 Ga0495674_0072205 3300047319 Bacteria 2977
722 Ga0495674_0078136 3300047319 Bacteria 2844
723 Ga0495674_0078820 3300047319 Bacteria 2830
724 Ga0495674_0114264 3300047319 Bacteria 2286
725 Ga0495676_0014561 3300047321 Bacteria 7037
726 Ga0495676_0056886 3300047321 Bacteria 3090
727 Ga0495676_0058280 3300047321 Unclassified 3039
728 Ga0495676_0157485 3300047321 Bacteria 1610
729 Ga0495680_0002550 3300047322 Bacteria 18591
730 Ga0495680_0003862 3300047322 Bacteria 14507
731 Ga0495680_0005190 3300047322 Bacteria 12288
732 Ga0495680_0022019 3300047322 Bacteria 5323
733 Ga0495680_0201533 3300047322 Bacteria 1427
734 Ga0495675_0001936 3300047444 Bacteria 12346
735 Ga0495675_0038166 3300047444 Bacteria 3059
736 Ga0495684_0000825 3300047471 Bacteria 25064
737 Ga0495593_0009164 3300047673 Bacteria 5738
738 Ga0495602_0000557 3300048088 Bacteria 34744
739 Ga0495602_0006781 3300048088 Bacteria 12021
740 Ga0495602_0048936 3300048088 Bacteria 3792
741 Ga0495602_0118618 3300048088 Bacteria 2134
742 Ga0496100_0001536 3300048903 Bacteria 11327
743 Ga0496100_0025862 3300048903 Bacteria 3592
744 Ga0496100_0080887 3300048903 Bacteria 2193
745 Ga0496101_0003663 3300048904 Bacteria 9587
746 Ga0496101_0040181 3300048904 Bacteria 3331
747 Ga0496101_0206108 3300048904 Bacteria 1522
748 Ga0496102_0009528 3300048905 Bacteria 8349
749 Ga0496102_0047873 3300048905 Bacteria 3887
750 Ga0496102_0057142 3300048905 Bacteria 3561
751 Ga0496102_0064445 3300048905 Bacteria 3356
752 Ga0496102_0167467 3300048905 Bacteria 2068
753 Ga0496103_0002198 3300048906 Bacteria 12364
754 Ga0496103_0053084 3300048906 Bacteria 2512
755 Ga0496104_0001510 3300048907 Bacteria 20080
756 Ga0496104_0069971 3300048907 Bacteria 3336
757 Ga0496104_0380997 3300048907 Bacteria 1323
758 Ga0496104_0581024 3300048907 Bacteria 1031
759 Ga0496105_0169121 3300048908 Bacteria 1792
760 Ga0496105_0177188 3300048908 Bacteria 1746
761 Ga0496105_0384982 3300048908 Bacteria 1115
762 Ga0496105_0467075 3300048908 Bacteria 994
763 Ga0496106_0003156 3300048909 Bacteria 12301
764 Ga0496107_0013279 3300048910 Bacteria 5756
765 Ga0496107_0015892 3300048910 Bacteria 5280
766 Ga0496107_0076900 3300048910 Bacteria 2431
767 Ga0496107_0113263 3300048910 Bacteria 1995
768 Ga0496107_0336677 3300048910 Bacteria 1123
769 Ga0496108_0010429 3300048911 Bacteria 7545
770 Ga0496108_0022171 3300048911 Bacteria 5221
771 Ga0496108_0718223 3300048911 Bacteria 866
772 Ga0496109_0001830 3300048912 Bacteria 17639
773 Ga0496109_0029186 3300048912 Bacteria 4939
774 Ga0496109_0162424 3300048912 Bacteria 2093
775 Ga0496109_0609158 3300048912 Bacteria 1028
776 Ga0496110_0011657 3300048913 Bacteria 7207
777 Ga0496110_0140912 3300048913 Bacteria 2180
778 Ga0496110_0459960 3300048913 Bacteria 1159
779 Ga0496111_0003917 3300048914 Bacteria 9330
780 Ga0496111_0016641 3300048914 Bacteria 5070
781 Ga0496112_0020297 3300048915 Bacteria 6294
782 Ga0496113_0014156 3300048916 Bacteria 5432
783 Ga0496113_0051395 3300048916 Bacteria 3076
784 Ga0496113_0125007 3300048916 Bacteria 2013
785 Ga0496113_0301715 3300048916 Bacteria 1282
786 Ga0496113_0406480 3300048916 Bacteria 1093
787 Ga0496114_0003256 3300048917 Bacteria 12462
788 Ga0496114_0006422 3300048917 Bacteria 9258
789 Ga0496114_0024627 3300048917 Bacteria 4913
790 Ga0496114_0080685 3300048917 Bacteria 2747
791 Ga0496115_0007434 3300048918 Bacteria 8061
792 Ga0496115_0024141 3300048918 Bacteria 4724
793 Ga0496115_0140356 3300048918 Bacteria 1993
794 Ga0496115_0399410 3300048918 Bacteria 1115
795 Ga0496126_0016363 3300048929 Bacteria 7420
796 Ga0501031_0009007 3300049568 Bacteria 6495
797 Ga0501032_0008203 3300049569 Bacteria 7612
798 Ga0501032_0085558 3300049569 Bacteria 2096
799 Ga0501033_0002756 3300049570 Bacteria 14722
800 Ga0501034_0003212 3300049571 Bacteria 18732
801 Ga0501034_0020441 3300049571 Bacteria 6760
802 Ga0501034_0392728 3300049571 Bacteria 1311
803 Ga0501034_0538010 3300049571 Bacteria 1078
804 Ga0501036_0001549 3300049572 Bacteria 17772
805 Ga0501037_0001941 3300049573 Bacteria 14964
806 Ga0501037_0091349 3300049573 Bacteria 2202
807 Ga0501038_0007422 3300049574 Bacteria 10116
808 Ga0501038_0165033 3300049574 Bacteria 1797
809 Ga0501038_0324056 3300049574 Bacteria 1205
810 Ga0501039_0019836 3300049575 Bacteria 5153
811 Ga0501039_0431439 3300049575 Bacteria 1035
812 Ga0501043_0006170 3300049579 Bacteria 9626
813 Ga0501046_0003854 3300049580 Bacteria 13721
814 Ga0501047_0075851 3300049581 Bacteria 3235
815 Ga0501047_0154330 3300049581 Bacteria 2170
816 Ga0501048_0003364 3300049582 Bacteria 12161
817 Ga0501048_0313013 3300049582 Bacteria 1118
818 Ga0501067_0017214 3300049583 Bacteria 3995
819 Ga0501068_0293072 3300049584 Bacteria 1041
820 Ga0501069_0001642 3300049585 Bacteria 11103
821 Ga0501069_0035480 3300049585 Bacteria 2748
822 Ga0501069_0260584 3300049585 Bacteria 1012
823 Ga0501070_0017501 3300049586 Bacteria 6016
824 Ga0501070_0018859 3300049586 Bacteria 5787
825 Ga0501070_0089422 3300049586 Bacteria 2548
826 Ga0501070_0119679 3300049586 Bacteria 2176
827 Ga0501070_0286600 3300049586 Bacteria 1343
828 Ga0501070_0485513 3300049586 Bacteria 993
829 Ga0501072_0018965 3300049588 Bacteria 5310
830 Ga0501072_0091811 3300049588 Bacteria 2411
831 Ga0501073_0011148 3300049589 Bacteria 6573
832 Ga0501073_0182783 3300049589 Bacteria 1451
833 Ga0501074_0005415 3300049590 Bacteria 9182
834 Ga0501074_0118145 3300049590 Bacteria 1897
835 Ga0501075_0092855 3300049591 Bacteria 2291
836 Ga0501076_0247579 3300049592 Bacteria 1458
837 Ga0501077_0125185 3300049593 Bacteria 1629
838 Ga0501079_0476957 3300049741 Bacteria 980
839 Ga0501080_0013428 3300049742 Bacteria 7535
840 Ga0501080_0145493 3300049742 Bacteria 2191
841 Ga0501080_0358848 3300049742 Bacteria 1315
842 Ga0501083_0003165 3300049744 Bacteria 11456
843 Ga0501083_0020293 3300049744 Bacteria 4624
844 Ga0501083_0042163 3300049744 Bacteria 3095
845 Ga0501083_0072513 3300049744 Bacteria 2289
846 Ga0501035_0001156 3300049822 Bacteria 27546
847 Ga0501035_0091047 3300049822 Bacteria 2684
848 Ga0501044_0035396 3300049823 Bacteria 5228
849 Ga0501044_0087078 3300049823 Bacteria 3155
850 Ga0501044_0107087 3300049823 Bacteria 2807
851 Ga0501044_0112450 3300049823 Bacteria 2730
852 Ga0501045_0371417 3300049824 Bacteria 1064
853 nmdc:mga00v17_21508_c1 3300050491 Bacteria 3709
854 nmdc:mga0yw44_10119_c1 3300050492 Bacteria 4804
855 nmdc:mga0yw44_19226_c1 3300050492 Bacteria 3761
856 nmdc:mga06z11_59567_c1 3300050494 Bacteria 1985
857 nmdc:mga04h51_12828_c1 3300050495 Bacteria 2361
858 nmdc:mga05p37_151_c1 3300050507 Bacteria 65585
859 nmdc:mga05p37_26718_c1 3300050507 Bacteria 7020
860 nmdc:mga09592_2557_c1 3300050508 Bacteria 14723
861 nmdc:mga0qj67_2949_c1 3300050509 Bacteria 12202
862 nmdc:mga06r32_592_c1 3300050510 Bacteria 31540
863 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
864 nmdc:mga08y16_17668_c1 3300050511 Bacteria 7514
865 nmdc:mga0n895_107446_c1 3300050512 Bacteria 2804
866 nmdc:mga0n895_337_c1 3300050512 Bacteria 31380
867 nmdc:mga0n895_37367_c1 3300050512 Bacteria 4697
868 nmdc:mga0n895_406_c1 3300050512 Bacteria 28847
869 nmdc:mga0rr50_110886_c1 3300050513 Bacteria 2171
870 nmdc:mga0rr50_1965_c1 3300050513 Bacteria 11416
871 nmdc:mga0rr50_43524_c1 3300050513 Bacteria 3287
872 nmdc:mga08x19_222292_c1 3300050514 Bacteria 1298
873 nmdc:mga0a205_197136_c1 3300050515 Bacteria 1904
874 nmdc:mga0a205_2351_c1 3300050515 Bacteria 16691
875 nmdc:mga0a205_277689_c1 3300050515 Bacteria 1551
876 nmdc:mga0a205_3783_c1 3300050515 Bacteria 13548
877 nmdc:mga0a205_65337_c2 3300050515 Bacteria 3082
878 nmdc:mga0a205_89700_c2 3300050515 Bacteria 2141
879 Ga0495601_0000620 3300053077 Bacteria 18909
880 Ga0495601_0001180 3300053077 Bacteria 14281
881 Ga0495601_0008334 3300053077 Bacteria 6120
882 Ga0495601_0008578 3300053077 Bacteria 6038
883 Ga0495601_0014203 3300053077 Bacteria 4799
884 Ga0495601_0014668 3300053077 Bacteria 4725
885 Ga0495601_0097942 3300053077 Bacteria 1892
886 Ga0495601_0196715 3300053077 Bacteria 1318
887 Ga0495612_0000683 3300053078 Bacteria 13678
888 Ga0495612_0004892 3300053078 Bacteria 5542
889 Ga0495612_0016524 3300053078 Bacteria 2956
890 Ga0495595_0000357 3300053084 Bacteria 17350
891 Ga0495595_0000749 3300053084 Bacteria 12324
892 Ga0495595_0002379 3300053084 Bacteria 7334
893 Ga0495595_0013757 3300053084 Bacteria 3423
894 Ga0495595_0018125 3300053084 Bacteria 3039
895 Ga0495595_0022224 3300053084 Bacteria 2782
896 Ga0495619_0000048 3300053085 Bacteria 102117
897 Ga0495619_0000256 3300053085 Bacteria 38697
898 Ga0495619_0000663 3300053085 Bacteria 22537
899 Ga0495619_0008411 3300053085 Bacteria 6527
900 Ga0495619_0010178 3300053085 Bacteria 5924
901 Ga0495619_0013279 3300053085 Bacteria 5190
902 Ga0495619_0023342 3300053085 Bacteria 3965
903 Ga0495619_0023705 3300053085 Bacteria 3934
904 Ga0500643_001301 3300053087 Bacteria 14696
905 Ga0500644_0005965 3300053088 Bacteria 3099
906 Ga0500651_0077762 3300053093 Bacteria 2059
907 Ga0500650_0013749 3300053098 Bacteria 3404
908 Ga0500595_000003 3300053119 Bacteria 419332
909 Ga0500577_0123562 3300053142 Bacteria 1079
910 Ga0500616_0000002 3300053153 Bacteria 1611257
911 Ga0500645_000217 3300053730 Bacteria 43911
912 Ga0501082_0070012 3300060353 Bacteria 3021

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035091 Ga0373951_0089852 Ga0373951_0089852_46_789 237
2 3300048908 Ga0496105_0384982 Ga0496105_0384982_349_1092 237
3 3300048918 Ga0496115_0140356 Ga0496115_0140356_1227_1970 237
4 3300048929 Ga0496126_0016363 Ga0496126_0016363_2560_3423 237
5 3300049581 Ga0501047_0154330 Ga0501047_0154330_253_1107 238
6 3300048911 Ga0496108_0022171 Ga0496108_0022171_4420_5199 244
7 3300028800 Ga0265338_10008257 Ga0265338_100082573 246
8 3300031235 Ga0265330_10035525 Ga0265330_100355252 246
9 3300031241 Ga0265325_10156220 Ga0265325_101562202 246
10 3300031712 Ga0265342_10014775 Ga0265342_100147754 246
11 3300038443 Ga0395901_0730518 Ga0395901_0730518_106_969 246
12 3300005336 Ga0070680_100233548 Ga0070680_1002335481 247
13 3300005337 Ga0070682_100178814 Ga0070682_1001788141 247
14 3300042005 Ga0439448_0119386 Ga0439448_0119386_149_892 247
15 3300053077 Ga0495601_0196715 Ga0495601_0196715_10_777 247
16 3300035724 Ga0373933_0013479 Ga0373933_0013479_3131_3994 248
17 3300037312 Ga0395899_0014949 Ga0395899_0014949_482_1354 248
18 3300037312 Ga0395899_0047001 Ga0395899_0047001_806_1678 248
19 3300037418 Ga0395900_0005653 Ga0395900_0005653_9406_10278 248
20 3300037418 Ga0395900_0010121 Ga0395900_0010121_8260_9132 248
21 3300037418 Ga0395900_0188644 Ga0395900_0188644_444_1316 248
22 3300037466 Ga0395898_0007938 Ga0395898_0007938_4213_5085 248
23 3300037466 Ga0395898_0136209 Ga0395898_0136209_1003_1875 248
24 3300038443 Ga0395901_0019396 Ga0395901_0019396_1795_2667 248
25 3300038443 Ga0395901_0122316 Ga0395901_0122316_600_1472 248
26 3300035170 Ga0373943_0040024 Ga0373943_0040024_20_799 249
27 3300046531 Ga0495665_0065393 Ga0495665_0065393_23_802 249
28 3300048910 Ga0496107_0113263 Ga0496107_0113263_963_1826 249
29 3300048913 Ga0496110_0459960 Ga0496110_0459960_16_795 249
30 3300005530 Ga0070679_100594616 Ga0070679_1005946161 250
31 3300036401 Ga0373937_0224537 Ga0373937_0224537_529_1392 250
32 3300049584 Ga0501068_0293072 Ga0501068_0293072_250_1029 251
33 3300050492 nmdc:mga0yw44_19226_c1 nmdc:mga0yw44_19226_c1_1666_2544 252
34 3300053084 Ga0495595_0018125 Ga0495595_0018125_368_1231 255
35 3300053085 Ga0495619_0010178 Ga0495619_0010178_3239_4102 255
36 3300035113 Ga0373936_0014538 Ga0373936_0014538_635_1495 256
37 3300037471 Ga0395905_0203644 Ga0395905_0203644_948_1808 256
38 3300049571 Ga0501034_0020441 Ga0501034_0020441_2511_3383 257
39 3300049586 Ga0501070_0286600 Ga0501070_0286600_140_1012 257
40 3300037471 Ga0395905_0132996 Ga0395905_0132996_586_1446 259
41 3300048911 Ga0496108_0718223 Ga0496108_0718223_10_789 259
42 3300035242 Ga0373962_0001607 Ga0373962_0001607_1994_2854 261
43 3300035083 Ga0373926_0026193 Ga0373926_0026193_290_1162 262
44 3300035113 Ga0373936_0009043 Ga0373936_0009043_309_1181 262
45 3300035116 Ga0373945_0020760 Ga0373945_0020760_723_1595 262
46 3300035695 Ga0373927_0000755 Ga0373927_0000755_4803_5675 262
47 3300035725 Ga0373947_0001444 Ga0373947_0001444_4832_5704 262
48 3300037068 Ga0373925_0001685 Ga0373925_0001685_4967_5839 262
49 3300046459 Ga0495629_0077627 Ga0495629_0077627_869_1741 262
50 3300046463 Ga0495653_0021634 Ga0495653_0021634_2709_3581 262
51 3300046472 Ga0495580_0200889 Ga0495580_0200889_378_1250 262
52 3300046476 Ga0495662_0004427 Ga0495662_0004427_1279_2151 262
53 3300046477 Ga0495664_0000142 Ga0495664_0000142_30705_31577 262
54 3300046514 Ga0495618_0008801 Ga0495618_0008801_4475_5347 262
55 3300046529 Ga0495652_0016089 Ga0495652_0016089_82_954 262
56 3300046533 Ga0495640_0021107 Ga0495640_0021107_2863_3735 262
57 3300046543 Ga0495645_0038315 Ga0495645_0038315_2463_3335 262
58 3300046642 Ga0495634_0014591 Ga0495634_0014591_131_1003 262
59 3300046663 Ga0495635_0001521 Ga0495635_0001521_3888_4760 262
60 3300046680 Ga0495646_0228983 Ga0495646_0228983_115_987 262
61 3300046683 Ga0495658_0039547 Ga0495658_0039547_1303_2175 262
62 3300046689 Ga0495613_0134523 Ga0495613_0134523_558_1430 262
63 3300046690 Ga0495624_0003675 Ga0495624_0003675_5622_6494 262
64 3300047315 Ga0495581_0009511 Ga0495581_0009511_2745_3617 262
65 3300047319 Ga0495674_0009624 Ga0495674_0009624_487_1359 262
66 3300047321 Ga0495676_0056886 Ga0495676_0056886_1092_1964 262
67 3300047322 Ga0495680_0201533 Ga0495680_0201533_95_967 262
68 3300053077 Ga0495601_0008334 Ga0495601_0008334_487_1359 262
69 3300053078 Ga0495612_0016524 Ga0495612_0016524_2062_2934 262
70 3300053085 Ga0495619_0000663 Ga0495619_0000663_515_1387 262
71 3300006237 Ga0097621_100170040 Ga0097621_1001700402 263
72 3300026078 Ga0207702_10187011 Ga0207702_101870112 263
73 3300028800 Ga0265338_10004795 Ga0265338_1000479513 263
74 3300046475 Ga0495639_0096103 Ga0495639_0096103_23_886 263
75 3300046642 Ga0495634_0036439 Ga0495634_0036439_394_1266 263
76 3300037068 Ga0373925_0094854 Ga0373925_0094854_732_1595 265
77 3300047315 Ga0495581_0113186 Ga0495581_0113186_431_1294 265
78 3300047319 Ga0495674_0078820 Ga0495674_0078820_1558_2421 265
79 3300047321 Ga0495676_0157485 Ga0495676_0157485_58_921 265
80 3300053077 Ga0495601_0097942 Ga0495601_0097942_416_1279 265
81 3300006175 Ga0070712_100360171 Ga0070712_1003601712 267
82 3300006844 Ga0075428_100201448 Ga0075428_1002014482 267
83 3300006852 Ga0075433_10010986 Ga0075433_100109862 267
84 3300007076 Ga0075435_100025200 Ga0075435_1000252003 267
85 3300009147 Ga0114129_10007064 Ga0114129_1000706414 267
86 3300048905 Ga0496102_0167467 Ga0496102_0167467_26_850 267
87 3300048912 Ga0496109_0609158 Ga0496109_0609158_189_1013 267
88 3300050513 nmdc:mga0rr50_43524_c1 nmdc:mga0rr50_43524_c1_2146_3018 267
89 3300050515 nmdc:mga0a205_65337_c2 nmdc:mga0a205_65337_c2_1561_2433 267
90 3300005458 Ga0070681_10005194 Ga0070681_1000519411 268
91 3300009093 Ga0105240_10208342 Ga0105240_102083422 268
92 3300013104 Ga0157370_10011104 Ga0157370_100111044 268
93 3300025912 Ga0207707_10006429 Ga0207707_100064297 268
94 3300025917 Ga0207660_10102635 Ga0207660_101026352 268
95 3300025921 Ga0207652_10010905 Ga0207652_100109054 268
96 3300049588 Ga0501072_0091811 Ga0501072_0091811_17_838 268
97 3300005434 Ga0070709_10254314 Ga0070709_102543142 269
98 3300025917 Ga0207660_10151366 Ga0207660_101513662 269
99 3300031711 Ga0265314_10007418 Ga0265314_100074187 269
100 3300048908 Ga0496105_0467075 Ga0496105_0467075_12_866 269
101 3300005530 Ga0070679_100154418 Ga0070679_1001544182 270
102 3300050512 nmdc:mga0n895_107446_c1 nmdc:mga0n895_107446_c1_1138_2010 270
103 3300005434 Ga0070709_10150204 Ga0070709_101502041 271
104 3300005435 Ga0070714_100211552 Ga0070714_1002115522 271
105 3300005436 Ga0070713_100002801 Ga0070713_10000280111 271
106 3300005437 Ga0070710_10052553 Ga0070710_100525531 271
107 3300005439 Ga0070711_100099733 Ga0070711_1000997332 271
108 3300005439 Ga0070711_100169732 Ga0070711_1001697322 271
109 3300005614 Ga0068856_100186030 Ga0068856_1001860302 271
110 3300005614 Ga0068856_100189691 Ga0068856_1001896912 271
111 3300006175 Ga0070712_100011749 Ga0070712_1000117493 271
112 3300006175 Ga0070712_100077390 Ga0070712_1000773902 271
113 3300006852 Ga0075433_10205078 Ga0075433_102050782 271
114 3300006871 Ga0075434_100051855 Ga0075434_1000518555 271
115 3300006914 Ga0075436_100026247 Ga0075436_1000262472 271
116 3300014497 Ga0182008_10089735 Ga0182008_100897352 271
117 3300025898 Ga0207692_10039844 Ga0207692_100398442 271
118 3300025915 Ga0207693_10021327 Ga0207693_100213275 271
119 3300025915 Ga0207693_10051174 Ga0207693_100511744 271
120 3300025928 Ga0207700_10258449 Ga0207700_102584492 271
121 3300025929 Ga0207664_10080480 Ga0207664_100804802 271
122 3300025929 Ga0207664_10171390 Ga0207664_101713902 271
123 3300026078 Ga0207702_10137279 Ga0207702_101372792 271
124 3300035410 Ga0373924_0068203 Ga0373924_0068203_540_1400 271
125 3300035692 Ga0373935_0129704 Ga0373935_0129704_798_1658 271
126 3300035724 Ga0373933_0019168 Ga0373933_0019168_2007_2867 271
127 3300036401 Ga0373937_0000638 Ga0373937_0000638_9644_10504 271
128 3300036401 Ga0373937_0011341 Ga0373937_0011341_6787_7647 271
129 3300046454 Ga0495592_0041123 Ga0495592_0041123_2541_3401 271
130 3300046462 Ga0495651_0024292 Ga0495651_0024292_1360_2220 271
131 3300046477 Ga0495664_0051587 Ga0495664_0051587_479_1339 271
132 3300046511 Ga0495608_0000890 Ga0495608_0000890_4238_5098 271
133 3300046511 Ga0495608_0007116 Ga0495608_0007116_6654_7514 271
134 3300046533 Ga0495640_0198046 Ga0495640_0198046_65_925 271
135 3300046536 Ga0495587_0002800 Ga0495587_0002800_4407_5267 271
136 3300046543 Ga0495645_0006461 Ga0495645_0006461_6670_7530 271
137 3300046559 Ga0495667_0003101 Ga0495667_0003101_5029_5889 271
138 3300046663 Ga0495635_0117622 Ga0495635_0117622_246_1106 271
139 3300046675 Ga0495657_0146741 Ga0495657_0146741_356_1216 271
140 3300046680 Ga0495646_0098846 Ga0495646_0098846_755_1615 271
141 3300047317 Ga0495604_0008196 Ga0495604_0008196_2668_3528 271
142 3300047319 Ga0495674_0049606 Ga0495674_0049606_1215_2075 271
143 3300047444 Ga0495675_0001936 Ga0495675_0001936_6774_7634 271
144 3300048088 Ga0495602_0000557 Ga0495602_0000557_27038_27898 271
145 3300048907 Ga0496104_0380997 Ga0496104_0380997_264_1124 271
146 3300048913 Ga0496110_0140912 Ga0496110_0140912_1241_2101 271
147 3300050514 nmdc:mga08x19_222292_c1 nmdc:mga08x19_222292_c1_276_1136 271
148 3300050515 nmdc:mga0a205_89700_c2 nmdc:mga0a205_89700_c2_378_1238 271
149 3300053077 Ga0495601_0001180 Ga0495601_0001180_6667_7527 271
150 3300053078 Ga0495612_0004892 Ga0495612_0004892_2072_2932 271
151 3300053085 Ga0495619_0008411 Ga0495619_0008411_2674_3534 271
152 3300005439 Ga0070711_100016320 Ga0070711_1000163205 272
153 3300005458 Ga0070681_10481520 Ga0070681_104815202 272
154 3300025916 Ga0207663_10007441 Ga0207663_100074415 272
155 3300025933 Ga0207706_10519887 Ga0207706_105198871 272
156 3300031241 Ga0265325_10005419 Ga0265325_100054198 272
157 3300031249 Ga0265339_10020454 Ga0265339_100204542 272
158 3300031344 Ga0265316_10229918 Ga0265316_102299182 272
159 3300031595 Ga0265313_10015134 Ga0265313_100151344 272
160 3300050491 nmdc:mga00v17_21508_c1 nmdc:mga00v17_21508_c1_1495_2382 272
161 3300050492 nmdc:mga0yw44_10119_c1 nmdc:mga0yw44_10119_c1_2979_3866 272
162 3300050494 nmdc:mga06z11_59567_c1 nmdc:mga06z11_59567_c1_821_1708 272
163 3300050495 nmdc:mga04h51_12828_c1 nmdc:mga04h51_12828_c1_315_1202 272
164 3300005338 Ga0068868_100016754 Ga0068868_1000167544 273
165 3300005364 Ga0070673_100053689 Ga0070673_1000536894 273
166 3300005547 Ga0070693_100063071 Ga0070693_1000630711 273
167 3300005617 Ga0068859_100479684 Ga0068859_1004796842 273
168 3300005841 Ga0068863_100259042 Ga0068863_1002590422 273
169 3300005983 Ga0081540_1001075 Ga0081540_100107521 273
170 3300006237 Ga0097621_100060177 Ga0097621_1000601772 273
171 3300006931 Ga0097620_100479745 Ga0097620_1004797452 273
172 3300009098 Ga0105245_10001271 Ga0105245_100012712 273
173 3300009148 Ga0105243_10126450 Ga0105243_101264502 273
174 3300009177 Ga0105248_10112739 Ga0105248_101127391 273
175 3300009545 Ga0105237_10201002 Ga0105237_102010021 273
176 3300009551 Ga0105238_10040585 Ga0105238_100405853 273
177 3300025924 Ga0207694_10019609 Ga0207694_100196093 273
178 3300025927 Ga0207687_10002275 Ga0207687_1000227511 273
179 3300025941 Ga0207711_10342954 Ga0207711_103429542 273
180 3300025942 Ga0207689_10519408 Ga0207689_105194081 273
181 3300025960 Ga0207651_10056641 Ga0207651_100566412 273
182 3300026023 Ga0207677_10026509 Ga0207677_100265094 273
183 3300026118 Ga0207675_100141843 Ga0207675_1001418433 273
184 3300005468 Ga0070707_100314025 Ga0070707_1003140251 274
185 3300012483 Ga0157337_1001599 Ga0157337_10015991 274
186 3300044694 Ga0466963_0113375 Ga0466963_0113375_594_1499 274
187 3300044842 Ga0466957_0140114 Ga0466957_0140114_332_1237 274
188 3300001976 JGI24752J21851_1000784 JGI24752J21851_10007845 275
189 3300001978 JGI24747J21853_1003687 JGI24747J21853_10036872 275
190 3300001989 JGI24739J22299_10003989 JGI24739J22299_100039891 275
191 3300001990 JGI24737J22298_10000343 JGI24737J22298_100003436 275
192 3300001991 JGI24743J22301_10021555 JGI24743J22301_100215551 275
193 3300002070 JGI24750J21931_1000168 JGI24750J21931_10001687 275
194 3300002073 JGI24745J21846_1000151 JGI24745J21846_10001513 275
195 3300002126 JGI24035J26624_1000065 JGI24035J26624_10000655 275
196 3300002239 JGI24034J26672_10001763 JGI24034J26672_100017631 275
197 3300002244 JGI24742J22300_10000257 JGI24742J22300_100002577 275
198 3300005290 Ga0065712_10082435 Ga0065712_100824354 275
199 3300005293 Ga0065715_10139107 Ga0065715_101391072 275
200 3300005328 Ga0070676_10002063 Ga0070676_100020633 275
201 3300005329 Ga0070683_100001967 Ga0070683_1000019675 275
202 3300005330 Ga0070690_100000854 Ga0070690_10000085414 275
203 3300005331 Ga0070670_100004470 Ga0070670_1000044705 275
204 3300005333 Ga0070677_10000911 Ga0070677_100009115 275
205 3300005334 Ga0068869_100002063 Ga0068869_1000020635 275
206 3300005335 Ga0070666_10017947 Ga0070666_100179472 275
207 3300005336 Ga0070680_100003747 Ga0070680_1000037479 275
208 3300005337 Ga0070682_100003321 Ga0070682_1000033217 275
209 3300005338 Ga0068868_100001518 Ga0068868_1000015187 275
210 3300005339 Ga0070660_100001923 Ga0070660_10000192314 275
211 3300005340 Ga0070689_100001902 Ga0070689_10000190212 275
212 3300005341 Ga0070691_10001508 Ga0070691_100015087 275
213 3300005343 Ga0070687_100000581 Ga0070687_10000058110 275
214 3300005344 Ga0070661_100002173 Ga0070661_10000217310 275
215 3300005345 Ga0070692_10000022 Ga0070692_1000002224 275
216 3300005347 Ga0070668_100007861 Ga0070668_1000078616 275
217 3300005353 Ga0070669_100005226 Ga0070669_1000052267 275
218 3300005354 Ga0070675_100001735 Ga0070675_10000173514 275
219 3300005355 Ga0070671_100001490 Ga0070671_1000014905 275
220 3300005356 Ga0070674_100010186 Ga0070674_1000101863 275
221 3300005364 Ga0070673_100002359 Ga0070673_1000023599 275
222 3300005365 Ga0070688_100000196 Ga0070688_1000001968 275
223 3300005366 Ga0070659_100001661 Ga0070659_1000016614 275
224 3300005367 Ga0070667_100001157 Ga0070667_10000115723 275
225 3300005406 Ga0070703_10003849 Ga0070703_100038492 275
226 3300005438 Ga0070701_10001517 Ga0070701_100015175 275
227 3300005440 Ga0070705_100003506 Ga0070705_1000035063 275
228 3300005441 Ga0070700_100001358 Ga0070700_10000135811 275
229 3300005445 Ga0070708_100052232 Ga0070708_1000522321 275
230 3300005455 Ga0070663_100015910 Ga0070663_1000159102 275
231 3300005456 Ga0070678_100028197 Ga0070678_1000281974 275
232 3300005457 Ga0070662_100002117 Ga0070662_1000021174 275
233 3300005458 Ga0070681_10000884 Ga0070681_1000088413 275
234 3300005459 Ga0068867_100000744 Ga0068867_1000007449 275
235 3300005466 Ga0070685_10010537 Ga0070685_100105372 275
236 3300005467 Ga0070706_100276197 Ga0070706_1002761972 275
237 3300005530 Ga0070679_100009711 Ga0070679_1000097117 275
238 3300005535 Ga0070684_100001760 Ga0070684_1000017608 275
239 3300005536 Ga0070697_100170653 Ga0070697_1001706532 275
240 3300005539 Ga0068853_100005867 Ga0068853_1000058677 275
241 3300005543 Ga0070672_100001256 Ga0070672_10000125614 275
242 3300005544 Ga0070686_100000931 Ga0070686_10000093116 275
243 3300005544 Ga0070686_100038445 Ga0070686_1000384451 275
244 3300005545 Ga0070695_100001091 Ga0070695_1000010913 275
245 3300005546 Ga0070696_100003841 Ga0070696_1000038419 275
246 3300005547 Ga0070693_100001091 Ga0070693_10000109110 275
247 3300005548 Ga0070665_100370643 Ga0070665_1003706432 275
248 3300005549 Ga0070704_100000586 Ga0070704_1000005866 275
249 3300005564 Ga0070664_100007278 Ga0070664_1000072785 275
250 3300005564 Ga0070664_100077740 Ga0070664_1000777402 275
251 3300005578 Ga0068854_100005058 Ga0068854_1000050584 275
252 3300005614 Ga0068856_100002589 Ga0068856_1000025899 275
253 3300005615 Ga0070702_100001481 Ga0070702_10000148110 275
254 3300005616 Ga0068852_100001321 Ga0068852_1000013215 275
255 3300005617 Ga0068859_100003378 Ga0068859_1000033784 275
256 3300005618 Ga0068864_100005368 Ga0068864_1000053685 275
257 3300005718 Ga0068866_10001827 Ga0068866_100018278 275
258 3300005719 Ga0068861_100004442 Ga0068861_1000044427 275
259 3300005840 Ga0068870_10001047 Ga0068870_100010477 275
260 3300005841 Ga0068863_100004482 Ga0068863_10000448211 275
261 3300005842 Ga0068858_100002675 Ga0068858_10000267516 275
262 3300005843 Ga0068860_100008474 Ga0068860_10000847410 275
263 3300005844 Ga0068862_100001659 Ga0068862_1000016596 275
264 3300006237 Ga0097621_100000432 Ga0097621_10000043226 275
265 3300006358 Ga0068871_100002403 Ga0068871_10000240311 275
266 3300006852 Ga0075433_10006826 Ga0075433_100068262 275
267 3300006871 Ga0075434_100000482 Ga0075434_10000048225 275
268 3300006871 Ga0075434_100288436 Ga0075434_1002884362 275
269 3300006881 Ga0068865_100000989 Ga0068865_1000009895 275
270 3300006931 Ga0097620_100003378 Ga0097620_1000033784 275
271 3300007076 Ga0075435_100048841 Ga0075435_1000488414 275
272 3300009092 Ga0105250_10052453 Ga0105250_100524532 275
273 3300009093 Ga0105240_10431148 Ga0105240_104311482 275
274 3300009094 Ga0111539_10001938 Ga0111539_100019384 275
275 3300009098 Ga0105245_10000534 Ga0105245_1000053426 275
276 3300009101 Ga0105247_10004338 Ga0105247_100043385 275
277 3300009101 Ga0105247_10048562 Ga0105247_100485622 275
278 3300009148 Ga0105243_10002870 Ga0105243_100028702 275
279 3300009174 Ga0105241_10002371 Ga0105241_100023717 275
280 3300009176 Ga0105242_10003152 Ga0105242_1000315211 275
281 3300009177 Ga0105248_10003614 Ga0105248_1000361412 275
282 3300009177 Ga0105248_10051773 Ga0105248_100517733 275
283 3300009553 Ga0105249_10001017 Ga0105249_1000101711 275
284 3300010375 Ga0105239_10017653 Ga0105239_100176535 275
285 3300011119 Ga0105246_10007846 Ga0105246_100078464 275
286 3300013100 Ga0157373_10089296 Ga0157373_100892962 275
287 3300013296 Ga0157374_10004819 Ga0157374_100048197 275
288 3300013297 Ga0157378_10042017 Ga0157378_100420172 275
289 3300013306 Ga0163162_10003671 Ga0163162_100036715 275
290 3300013307 Ga0157372_10045137 Ga0157372_100451375 275
291 3300013308 Ga0157375_10001417 Ga0157375_1000141715 275
292 3300014325 Ga0163163_10019563 Ga0163163_100195635 275
293 3300014325 Ga0163163_10039219 Ga0163163_100392194 275
294 3300014326 Ga0157380_10007707 Ga0157380_100077075 275
295 3300014745 Ga0157377_10000458 Ga0157377_1000045810 275
296 3300014968 Ga0157379_10003079 Ga0157379_1000307911 275
297 3300014968 Ga0157379_10062633 Ga0157379_100626332 275
298 3300014969 Ga0157376_10004629 Ga0157376_100046293 275
299 3300017792 Ga0163161_10002260 Ga0163161_1000226011 275
300 3300025271 Ga0207666_1000030 Ga0207666_10000307 275
301 3300025290 Ga0207673_1003710 Ga0207673_10037102 275
302 3300025315 Ga0207697_10000225 Ga0207697_100002259 275
303 3300025885 Ga0207653_10002351 Ga0207653_100023516 275
304 3300025893 Ga0207682_10000009 Ga0207682_1000000940 275
305 3300025899 Ga0207642_10001175 Ga0207642_100011754 275
306 3300025900 Ga0207710_10025504 Ga0207710_100255042 275
307 3300025901 Ga0207688_10000060 Ga0207688_1000006025 275
308 3300025903 Ga0207680_10009851 Ga0207680_100098515 275
309 3300025904 Ga0207647_10000172 Ga0207647_100001727 275
310 3300025907 Ga0207645_10001556 Ga0207645_1000155611 275
311 3300025908 Ga0207643_10000244 Ga0207643_1000024425 275
312 3300025910 Ga0207684_10122547 Ga0207684_101225472 275
313 3300025913 Ga0207695_10087008 Ga0207695_100870082 275
314 3300025914 Ga0207671_10113869 Ga0207671_101138692 275
315 3300025917 Ga0207660_10000179 Ga0207660_1000017915 275
316 3300025918 Ga0207662_10000025 Ga0207662_1000002539 275
317 3300025919 Ga0207657_10006380 Ga0207657_1000638010 275
318 3300025920 Ga0207649_10000693 Ga0207649_1000069320 275
319 3300025921 Ga0207652_10002825 Ga0207652_1000282513 275
320 3300025923 Ga0207681_10001707 Ga0207681_100017076 275
321 3300025925 Ga0207650_10042870 Ga0207650_100428702 275
322 3300025926 Ga0207659_10000283 Ga0207659_1000028326 275
323 3300025927 Ga0207687_10002373 Ga0207687_1000237311 275
324 3300025931 Ga0207644_10016312 Ga0207644_100163126 275
325 3300025932 Ga0207690_10002627 Ga0207690_100026276 275
326 3300025933 Ga0207706_10000734 Ga0207706_1000073425 275
327 3300025934 Ga0207686_10003173 Ga0207686_100031736 275
328 3300025935 Ga0207709_10003573 Ga0207709_100035735 275
329 3300025936 Ga0207670_10002092 Ga0207670_100020927 275
330 3300025937 Ga0207669_10000204 Ga0207669_1000020426 275
331 3300025938 Ga0207704_10000130 Ga0207704_1000013022 275
332 3300025940 Ga0207691_10000309 Ga0207691_100003099 275
333 3300025941 Ga0207711_10003739 Ga0207711_100037395 275
334 3300025941 Ga0207711_10056517 Ga0207711_100565174 275
335 3300025942 Ga0207689_10000893 Ga0207689_1000089325 275
336 3300025944 Ga0207661_10002361 Ga0207661_100023616 275
337 3300025945 Ga0207679_10000128 Ga0207679_100001286 275
338 3300025945 Ga0207679_10095705 Ga0207679_100957053 275
339 3300025960 Ga0207651_10003176 Ga0207651_100031764 275
340 3300025961 Ga0207712_10003532 Ga0207712_100035322 275
341 3300025972 Ga0207668_10002246 Ga0207668_100022468 275
342 3300025981 Ga0207640_10003873 Ga0207640_100038737 275
343 3300025986 Ga0207658_10005965 Ga0207658_100059656 275
344 3300026023 Ga0207677_10003185 Ga0207677_100031855 275
345 3300026035 Ga0207703_10010286 Ga0207703_100102864 275
346 3300026035 Ga0207703_10169031 Ga0207703_101690312 275
347 3300026067 Ga0207678_10000759 Ga0207678_1000075925 275
348 3300026075 Ga0207708_10000391 Ga0207708_1000039125 275
349 3300026078 Ga0207702_10026447 Ga0207702_100264475 275
350 3300026088 Ga0207641_10008773 Ga0207641_100087735 275
351 3300026089 Ga0207648_10000862 Ga0207648_1000086225 275
352 3300026095 Ga0207676_10046219 Ga0207676_100462194 275
353 3300026116 Ga0207674_10000806 Ga0207674_1000080615 275
354 3300026118 Ga0207675_100000637 Ga0207675_1000006379 275
355 3300026121 Ga0207683_10000330 Ga0207683_100003305 275
356 3300026142 Ga0207698_10003712 Ga0207698_100037125 275
357 3300027552 Ga0209982_1024857 Ga0209982_10248571 275
358 3300027617 Ga0210002_1004342 Ga0210002_10043422 275
359 3300027876 Ga0209974_10002570 Ga0209974_100025706 275
360 3300027907 Ga0207428_10000164 Ga0207428_1000016471 275
361 3300028379 Ga0268266_10325574 Ga0268266_103255742 275
362 3300028380 Ga0268265_10029530 Ga0268265_100295303 275
363 3300028381 Ga0268264_10005408 Ga0268264_100054086 275
364 3300028381 Ga0268264_10066354 Ga0268264_100663542 275
365 3300034816 Ga0373930_0022536 Ga0373930_0022536_43_915 275
366 3300035085 Ga0373929_0000454 Ga0373929_0000454_3226_4098 275
367 3300035088 Ga0373940_0070103 Ga0373940_0070103_20_892 275
368 3300035090 Ga0373949_0004409 Ga0373949_0004409_310_1182 275
369 3300035091 Ga0373951_0007587 Ga0373951_0007587_1015_1887 275
370 3300035112 Ga0373932_0002234 Ga0373932_0002234_783_1655 275
371 3300035114 Ga0373939_0014179 Ga0373939_0014179_172_1044 275
372 3300035121 Ga0373960_0008151 Ga0373960_0008151_1332_2204 275
373 3300035207 Ga0373942_0010380 Ga0373942_0010380_217_1089 275
374 3300035241 Ga0373961_0088786 Ga0373961_0088786_58_930 275
375 3300035242 Ga0373962_0001559 Ga0373962_0001559_3266_4138 275
376 3300035691 Ga0373931_0002659 Ga0373931_0002659_4429_5301 275
377 3300039437 Ga0436365_0583672 Ga0436365_0583672_300_1163 275
378 3300046683 Ga0495658_0007101 Ga0495658_0007101_3466_4338 275
379 3300048903 Ga0496100_0001536 Ga0496100_0001536_1441_2313 275
380 3300048904 Ga0496101_0003663 Ga0496101_0003663_4549_5421 275
381 3300048905 Ga0496102_0009528 Ga0496102_0009528_3653_4525 275
382 3300048906 Ga0496103_0002198 Ga0496103_0002198_7177_8049 275
383 3300048909 Ga0496106_0003156 Ga0496106_0003156_257_1129 275
384 3300048910 Ga0496107_0015892 Ga0496107_0015892_438_1310 275
385 3300048911 Ga0496108_0010429 Ga0496108_0010429_5365_6237 275
386 3300048912 Ga0496109_0001830 Ga0496109_0001830_11079_11951 275
387 3300048913 Ga0496110_0011657 Ga0496110_0011657_2970_3842 275
388 3300048915 Ga0496112_0020297 Ga0496112_0020297_1228_2100 275
389 3300048916 Ga0496113_0014156 Ga0496113_0014156_4012_4884 275
390 3300048917 Ga0496114_0006422 Ga0496114_0006422_7773_8645 275
391 3300048918 Ga0496115_0024141 Ga0496115_0024141_3838_4710 275
392 3300050511 nmdc:mga08y16_108_c1 nmdc:mga08y16_108_c1_24270_25142 275
393 3300050512 nmdc:mga0n895_406_c1 nmdc:mga0n895_406_c1_12640_13512 275
394 3300050513 nmdc:mga0rr50_110886_c1 nmdc:mga0rr50_110886_c1_1159_2031 275
395 3300050515 nmdc:mga0a205_3783_c1 nmdc:mga0a205_3783_c1_5041_5913 275
396 3300013307 Ga0157372_10078105 Ga0157372_100781052 276
397 3300025949 Ga0207667_10084560 Ga0207667_100845602 276
398 3300044719 Ga0466971_0111305 Ga0466971_0111305_115_987 276
399 3300048907 Ga0496104_0069971 Ga0496104_0069971_1134_1994 276
400 3300048910 Ga0496107_0336677 Ga0496107_0336677_198_1058 276
401 3300005985 Ga0081539_10010901 Ga0081539_100109013 277
402 3300035084 Ga0373928_0001031 Ga0373928_0001031_4137_5009 277
403 3300048905 Ga0496102_0064445 Ga0496102_0064445_611_1483 277
404 3300049582 Ga0501048_0313013 Ga0501048_0313013_71_931 277
405 3300049591 Ga0501075_0092855 Ga0501075_0092855_1257_2117 277
406 3300049592 Ga0501076_0247579 Ga0501076_0247579_434_1294 277
407 3300049593 Ga0501077_0125185 Ga0501077_0125185_204_1064 277
408 3300049741 Ga0501079_0476957 Ga0501079_0476957_77_937 277
409 3300049742 Ga0501080_0145493 Ga0501080_0145493_42_902 277
410 3300005435 Ga0070714_100512959 Ga0070714_1005129592 278
411 3300005563 Ga0068855_100012952 Ga0068855_1000129524 278
412 3300025929 Ga0207664_10027330 Ga0207664_100273303 278
413 3300035725 Ga0373947_0182370 Ga0373947_0182370_342_1205 278
414 3300005437 Ga0070710_10028417 Ga0070710_100284172 279
415 3300009766 Ga0123342_1000455 Ga0123342_10004558 279
416 3300025898 Ga0207692_10154140 Ga0207692_101541402 279
417 3300005327 Ga0070658_10334573 Ga0070658_103345732 280
418 3300005328 Ga0070676_10009281 Ga0070676_100092814 280
419 3300005331 Ga0070670_100138997 Ga0070670_1001389972 280
420 3300005335 Ga0070666_10029521 Ga0070666_100295213 280
421 3300005337 Ga0070682_100048658 Ga0070682_1000486582 280
422 3300005338 Ga0068868_100052438 Ga0068868_1000524382 280
423 3300005339 Ga0070660_100010402 Ga0070660_1000104024 280
424 3300005343 Ga0070687_100019986 Ga0070687_1000199862 280
425 3300005356 Ga0070674_100153912 Ga0070674_1001539122 280
426 3300005364 Ga0070673_100035233 Ga0070673_1000352334 280
427 3300005365 Ga0070688_100008636 Ga0070688_1000086366 280
428 3300005367 Ga0070667_100041199 Ga0070667_1000411993 280
429 3300005434 Ga0070709_10012677 Ga0070709_100126772 280
430 3300005434 Ga0070709_10098427 Ga0070709_100984271 280
431 3300005435 Ga0070714_100010967 Ga0070714_1000109674 280
432 3300005436 Ga0070713_100015520 Ga0070713_1000155202 280
433 3300005436 Ga0070713_100024112 Ga0070713_1000241123 280
434 3300005437 Ga0070710_10004196 Ga0070710_100041967 280
435 3300005439 Ga0070711_100366611 Ga0070711_1003666112 280
436 3300005466 Ga0070685_10007166 Ga0070685_100071662 280
437 3300005535 Ga0070684_100397342 Ga0070684_1003973421 280
438 3300005544 Ga0070686_100064466 Ga0070686_1000644662 280
439 3300005577 Ga0068857_100168071 Ga0068857_1001680712 280
440 3300005614 Ga0068856_100186780 Ga0068856_1001867802 280
441 3300005617 Ga0068859_100125502 Ga0068859_1001255022 280
442 3300005618 Ga0068864_100033385 Ga0068864_1000333852 280
443 3300005718 Ga0068866_10003791 Ga0068866_100037914 280
444 3300005841 Ga0068863_100046817 Ga0068863_1000468173 280
445 3300005842 Ga0068858_100025282 Ga0068858_1000252825 280
446 3300005843 Ga0068860_100015436 Ga0068860_1000154367 280
447 3300005983 Ga0081540_1028851 Ga0081540_10288512 280
448 3300006028 Ga0070717_10020314 Ga0070717_100203142 280
449 3300006058 Ga0075432_10032913 Ga0075432_100329131 280
450 3300006173 Ga0070716_100002129 Ga0070716_1000021294 280
451 3300006173 Ga0070716_100076563 Ga0070716_1000765632 280
452 3300006237 Ga0097621_100003548 Ga0097621_1000035487 280
453 3300006358 Ga0068871_100012965 Ga0068871_1000129656 280
454 3300006844 Ga0075428_100006289 Ga0075428_1000062896 280
455 3300006846 Ga0075430_100000312 Ga0075430_10000031228 280
456 3300006847 Ga0075431_100007548 Ga0075431_1000075486 280
457 3300006852 Ga0075433_10000328 Ga0075433_1000032827 280
458 3300006871 Ga0075434_100002518 Ga0075434_1000025183 280
459 3300006880 Ga0075429_100001514 Ga0075429_1000015146 280
460 3300006931 Ga0097620_100125498 Ga0097620_1001254982 280
461 3300007076 Ga0075435_100007820 Ga0075435_1000078203 280
462 3300009011 Ga0105251_10012487 Ga0105251_100124875 280
463 3300009094 Ga0111539_10006634 Ga0111539_100066343 280
464 3300009147 Ga0114129_10013293 Ga0114129_100132933 280
465 3300009148 Ga0105243_10011971 Ga0105243_100119713 280
466 3300009174 Ga0105241_10027062 Ga0105241_100270624 280
467 3300009176 Ga0105242_10028950 Ga0105242_100289503 280
468 3300009551 Ga0105238_10053026 Ga0105238_100530262 280
469 3300011119 Ga0105246_10190093 Ga0105246_101900932 280
470 3300013307 Ga0157372_10137183 Ga0157372_101371832 280
471 3300025898 Ga0207692_10002474 Ga0207692_100024746 280
472 3300025898 Ga0207692_10016538 Ga0207692_100165383 280
473 3300025900 Ga0207710_10017761 Ga0207710_100177613 280
474 3300025901 Ga0207688_10027494 Ga0207688_100274943 280
475 3300025903 Ga0207680_10036845 Ga0207680_100368452 280
476 3300025906 Ga0207699_10004490 Ga0207699_100044903 280
477 3300025906 Ga0207699_10013160 Ga0207699_100131602 280
478 3300025915 Ga0207693_10005817 Ga0207693_100058175 280
479 3300025916 Ga0207663_10031199 Ga0207663_100311992 280
480 3300025916 Ga0207663_10402436 Ga0207663_104024361 280
481 3300025918 Ga0207662_10040739 Ga0207662_100407392 280
482 3300025919 Ga0207657_10038325 Ga0207657_100383252 280
483 3300025920 Ga0207649_10079162 Ga0207649_100791622 280
484 3300025924 Ga0207694_10237291 Ga0207694_102372912 280
485 3300025925 Ga0207650_10035875 Ga0207650_100358752 280
486 3300025927 Ga0207687_10003040 Ga0207687_100030406 280
487 3300025928 Ga0207700_10005221 Ga0207700_100052215 280
488 3300025929 Ga0207664_10040856 Ga0207664_100408562 280
489 3300025929 Ga0207664_10052000 Ga0207664_100520003 280
490 3300025931 Ga0207644_10008220 Ga0207644_100082206 280
491 3300025935 Ga0207709_10051102 Ga0207709_100511022 280
492 3300025936 Ga0207670_10028166 Ga0207670_100281662 280
493 3300025939 Ga0207665_10000605 Ga0207665_1000060519 280
494 3300025939 Ga0207665_10101584 Ga0207665_101015842 280
495 3300025941 Ga0207711_10012929 Ga0207711_100129293 280
496 3300025942 Ga0207689_10012479 Ga0207689_100124794 280
497 3300025986 Ga0207658_10087707 Ga0207658_100877072 280
498 3300026035 Ga0207703_10016763 Ga0207703_100167635 280
499 3300026078 Ga0207702_10137575 Ga0207702_101375752 280
500 3300026088 Ga0207641_10042207 Ga0207641_100422073 280
501 3300026095 Ga0207676_10007810 Ga0207676_100078106 280
502 3300026116 Ga0207674_10071472 Ga0207674_100714724 280
503 3300026121 Ga0207683_10004948 Ga0207683_100049482 280
504 3300026142 Ga0207698_10609436 Ga0207698_106094361 280
505 3300027907 Ga0207428_10000815 Ga0207428_1000081540 280
506 3300028379 Ga0268266_10003098 Ga0268266_100030983 280
507 3300028381 Ga0268264_10011667 Ga0268264_100116674 280
508 3300031241 Ga0265325_10000474 Ga0265325_1000047411 280
509 3300031241 Ga0265325_10062342 Ga0265325_100623422 280
510 3300031711 Ga0265314_10071938 Ga0265314_100719382 280
511 3300031712 Ga0265342_10000321 Ga0265342_100003213 280
512 3300035084 Ga0373928_0008518 Ga0373928_0008518_909_1781 280
513 3300035114 Ga0373939_0002253 Ga0373939_0002253_2186_3058 280
514 3300035115 Ga0373941_0008307 Ga0373941_0008307_789_1661 280
515 3300035171 Ga0373946_0007213 Ga0373946_0007213_2234_3106 280
516 3300035241 Ga0373961_0026055 Ga0373961_0026055_673_1545 280
517 3300035691 Ga0373931_0256913 Ga0373931_0256913_132_1004 280
518 3300035692 Ga0373935_0026597 Ga0373935_0026597_1643_2515 280
519 3300035695 Ga0373927_0008778 Ga0373927_0008778_2909_3781 280
520 3300035695 Ga0373927_0028473 Ga0373927_0028473_1647_2519 280
521 3300035725 Ga0373947_0000280 Ga0373947_0000280_24080_24952 280
522 3300035725 Ga0373947_0004394 Ga0373947_0004394_1772_2644 280
523 3300036401 Ga0373937_0018638 Ga0373937_0018638_3257_4129 280
524 3300036401 Ga0373937_0088424 Ga0373937_0088424_1662_2534 280
525 3300037068 Ga0373925_0001680 Ga0373925_0001680_12773_13645 280
526 3300037418 Ga0395900_0030631 Ga0395900_0030631_3344_4201 280
527 3300037466 Ga0395898_0024721 Ga0395898_0024721_3344_4201 280
528 3300038443 Ga0395901_0014282 Ga0395901_0014282_6764_7621 280
529 3300046455 Ga0495603_0095348 Ga0495603_0095348_478_1350 280
530 3300046459 Ga0495629_0006959 Ga0495629_0006959_1805_2677 280
531 3300046459 Ga0495629_0021267 Ga0495629_0021267_199_1071 280
532 3300046461 Ga0495641_0029079 Ga0495641_0029079_1209_2081 280
533 3300046461 Ga0495641_0033581 Ga0495641_0033581_915_1787 280
534 3300046462 Ga0495651_0025083 Ga0495651_0025083_2379_3251 280
535 3300046463 Ga0495653_0055985 Ga0495653_0055985_25_897 280
536 3300046473 Ga0495582_0001012 Ga0495582_0001012_1242_2114 280
537 3300046475 Ga0495639_0008822 Ga0495639_0008822_518_1390 280
538 3300046475 Ga0495639_0011150 Ga0495639_0011150_1787_2659 280
539 3300046476 Ga0495662_0004939 Ga0495662_0004939_1187_2059 280
540 3300046499 Ga0495594_0017400 Ga0495594_0017400_1801_2673 280
541 3300046499 Ga0495594_0087375 Ga0495594_0087375_43_915 280
542 3300046511 Ga0495608_0092521 Ga0495608_0092521_88_960 280
543 3300046514 Ga0495618_0004574 Ga0495618_0004574_5676_6548 280
544 3300046514 Ga0495618_0075296 Ga0495618_0075296_857_1729 280
545 3300046517 Ga0495630_0008519 Ga0495630_0008519_4701_5573 280
546 3300046529 Ga0495652_0042653 Ga0495652_0042653_1237_2109 280
547 3300046529 Ga0495652_0127068 Ga0495652_0127068_342_1214 280
548 3300046533 Ga0495640_0023436 Ga0495640_0023436_2367_3239 280
549 3300046533 Ga0495640_0074445 Ga0495640_0074445_850_1722 280
550 3300046642 Ga0495634_0030445 Ga0495634_0030445_467_1339 280
551 3300046642 Ga0495634_0078321 Ga0495634_0078321_57_929 280
552 3300046663 Ga0495635_0042556 Ga0495635_0042556_1680_2552 280
553 3300046663 Ga0495635_0045531 Ga0495635_0045531_1804_2676 280
554 3300046674 Ga0495588_0056472 Ga0495588_0056472_927_1799 280
555 3300046675 Ga0495657_0062234 Ga0495657_0062234_465_1337 280
556 3300046681 Ga0495647_0026191 Ga0495647_0026191_26_898 280
557 3300046681 Ga0495647_0039863 Ga0495647_0039863_670_1542 280
558 3300046683 Ga0495658_0001393 Ga0495658_0001393_5448_6320 280
559 3300046683 Ga0495658_0006997 Ga0495658_0006997_3513_4385 280
560 3300046689 Ga0495613_0046256 Ga0495613_0046256_1043_1915 280
561 3300046689 Ga0495613_0064268 Ga0495613_0064268_362_1234 280
562 3300046809 Ga0495600_0016856 Ga0495600_0016856_1768_2640 280
563 3300046809 Ga0495600_0113886 Ga0495600_0113886_151_1023 280
564 3300047315 Ga0495581_0024911 Ga0495581_0024911_2557_3429 280
565 3300047317 Ga0495604_0051376 Ga0495604_0051376_51_923 280
566 3300047319 Ga0495674_0037656 Ga0495674_0037656_2243_3115 280
567 3300047319 Ga0495674_0078136 Ga0495674_0078136_155_1027 280
568 3300047321 Ga0495676_0014561 Ga0495676_0014561_2090_2962 280
569 3300047321 Ga0495676_0058280 Ga0495676_0058280_942_1814 280
570 3300047322 Ga0495680_0002550 Ga0495680_0002550_9130_10002 280
571 3300047322 Ga0495680_0005190 Ga0495680_0005190_6339_7211 280
572 3300047322 Ga0495680_0022019 Ga0495680_0022019_1069_1941 280
573 3300047471 Ga0495684_0000825 Ga0495684_0000825_10993_11865 280
574 3300047673 Ga0495593_0009164 Ga0495593_0009164_4632_5504 280
575 3300048088 Ga0495602_0118618 Ga0495602_0118618_581_1453 280
576 3300048903 Ga0496100_0080887 Ga0496100_0080887_957_1829 280
577 3300048905 Ga0496102_0057142 Ga0496102_0057142_2581_3453 280
578 3300048914 Ga0496111_0016641 Ga0496111_0016641_1839_2711 280
579 3300048916 Ga0496113_0125007 Ga0496113_0125007_313_1185 280
580 3300048916 Ga0496113_0301715 Ga0496113_0301715_376_1248 280
581 3300048917 Ga0496114_0080685 Ga0496114_0080685_1846_2718 280
582 3300049590 Ga0501074_0118145 Ga0501074_0118145_742_1614 280
583 3300049823 Ga0501044_0107087 Ga0501044_0107087_1816_2688 280
584 3300050507 nmdc:mga05p37_151_c1 nmdc:mga05p37_151_c1_1617_2489 280
585 3300050507 nmdc:mga05p37_26718_c1 nmdc:mga05p37_26718_c1_5024_5896 280
586 3300050508 nmdc:mga09592_2557_c1 nmdc:mga09592_2557_c1_4431_5303 280
587 3300050509 nmdc:mga0qj67_2949_c1 nmdc:mga0qj67_2949_c1_1946_2818 280
588 3300050510 nmdc:mga06r32_592_c1 nmdc:mga06r32_592_c1_2315_3187 280
589 3300050511 nmdc:mga08y16_17668_c1 nmdc:mga08y16_17668_c1_1977_2849 280
590 3300050512 nmdc:mga0n895_337_c1 nmdc:mga0n895_337_c1_21936_22808 280
591 3300050512 nmdc:mga0n895_37367_c1 nmdc:mga0n895_37367_c1_2212_3084 280
592 3300050513 nmdc:mga0rr50_1965_c1 nmdc:mga0rr50_1965_c1_5379_6251 280
593 3300050515 nmdc:mga0a205_197136_c1 nmdc:mga0a205_197136_c1_862_1734 280
594 3300050515 nmdc:mga0a205_2351_c1 nmdc:mga0a205_2351_c1_4666_5538 280
595 3300053077 Ga0495601_0014668 Ga0495601_0014668_1258_2130 280
596 3300053084 Ga0495595_0000357 Ga0495595_0000357_4890_5762 280
597 3300053084 Ga0495595_0013757 Ga0495595_0013757_2065_2937 280
598 3300053085 Ga0495619_0000048 Ga0495619_0000048_26480_27352 280
599 3300053085 Ga0495619_0000256 Ga0495619_0000256_3757_4629 280
600 3300053085 Ga0495619_0023705 Ga0495619_0023705_1258_2130 280
601 3300005329 Ga0070683_100042152 Ga0070683_1000421522 281
602 3300005434 Ga0070709_10026420 Ga0070709_100264201 281
603 3300005437 Ga0070710_10007560 Ga0070710_100075603 281
604 3300005439 Ga0070711_100150321 Ga0070711_1001503211 281
605 3300005535 Ga0070684_100015270 Ga0070684_1000152704 281
606 3300005539 Ga0068853_100081713 Ga0068853_1000817131 281
607 3300005563 Ga0068855_100029487 Ga0068855_1000294872 281
608 3300009093 Ga0105240_10077191 Ga0105240_100771912 281
609 3300009174 Ga0105241_10023086 Ga0105241_100230862 281
610 3300009551 Ga0105238_10073363 Ga0105238_100733632 281
611 3300010375 Ga0105239_10668525 Ga0105239_106685252 281
612 3300013102 Ga0157371_10061309 Ga0157371_100613092 281
613 3300013105 Ga0157369_10047309 Ga0157369_100473094 281
614 3300025915 Ga0207693_10004633 Ga0207693_100046337 281
615 3300025924 Ga0207694_10440235 Ga0207694_104402352 281
616 3300031241 Ga0265325_10001518 Ga0265325_1000151817 281
617 3300031241 Ga0265325_10003355 Ga0265325_100033555 281
618 3300031595 Ga0265313_10038015 Ga0265313_100380152 281
619 3300031595 Ga0265313_10067483 Ga0265313_100674832 281
620 3300046678 Ga0495599_0002450 Ga0495599_0002450_246_1115 281
621 3300053098 Ga0500650_0013749 Ga0500650_0013749_803_1675 281
622 3300005334 Ga0068869_100468608 Ga0068869_1004686081 282
623 3300026088 Ga0207641_10466935 Ga0207641_104669352 282
624 3300031241 Ga0265325_10066896 Ga0265325_100668962 282
625 3300031711 Ga0265314_10016261 Ga0265314_100162614 282
626 3300035117 Ga0373953_0052171 Ga0373953_0052171_423_1295 282
627 3300035118 Ga0373954_0038269 Ga0373954_0038269_1140_2012 282
628 3300035695 Ga0373927_0232028 Ga0373927_0232028_201_1073 282
629 3300035724 Ga0373933_0091510 Ga0373933_0091510_463_1335 282
630 3300035724 Ga0373933_0175147 Ga0373933_0175147_21_893 282
631 3300036401 Ga0373937_0022165 Ga0373937_0022165_1764_2636 282
632 3300046454 Ga0495592_0007395 Ga0495592_0007395_7177_8049 282
633 3300046462 Ga0495651_0025567 Ga0495651_0025567_308_1180 282
634 3300046477 Ga0495664_0113787 Ga0495664_0113787_411_1283 282
635 3300046511 Ga0495608_0036752 Ga0495608_0036752_2367_3239 282
636 3300046516 Ga0495628_0001326 Ga0495628_0001326_11938_12810 282
637 3300046529 Ga0495652_0034110 Ga0495652_0034110_201_1073 282
638 3300046543 Ga0495645_0003190 Ga0495645_0003190_325_1197 282
639 3300046559 Ga0495667_0006161 Ga0495667_0006161_4723_5595 282
640 3300046663 Ga0495635_0003053 Ga0495635_0003053_6504_7376 282
641 3300046675 Ga0495657_0010806 Ga0495657_0010806_5580_6452 282
642 3300046675 Ga0495657_0074092 Ga0495657_0074092_852_1724 282
643 3300046679 Ga0495623_0012154 Ga0495623_0012154_1935_2807 282
644 3300046680 Ga0495646_0018416 Ga0495646_0018416_1033_1905 282
645 3300046809 Ga0495600_0006458 Ga0495600_0006458_2760_3632 282
646 3300047317 Ga0495604_0014298 Ga0495604_0014298_2481_3353 282
647 3300047319 Ga0495674_0114264 Ga0495674_0114264_1240_2112 282
648 3300047322 Ga0495680_0003862 Ga0495680_0003862_3947_4819 282
649 3300047444 Ga0495675_0038166 Ga0495675_0038166_1899_2771 282
650 3300048088 Ga0495602_0006781 Ga0495602_0006781_5879_6751 282
651 3300053077 Ga0495601_0000620 Ga0495601_0000620_8132_9004 282
652 3300053078 Ga0495612_0000683 Ga0495612_0000683_7316_8188 282
653 3300053084 Ga0495595_0000749 Ga0495595_0000749_8983_9855 282
654 3300053087 Ga0500643_001301 Ga0500643_001301_4436_5308 282
655 3300053088 Ga0500644_0005965 Ga0500644_0005965_218_1090 282
656 3300053093 Ga0500651_0077762 Ga0500651_0077762_926_1798 282
657 3300053119 Ga0500595_000003 Ga0500595_000003_163882_164754 282
658 3300053153 Ga0500616_0000002 Ga0500616_0000002_1350591_1351463 282
659 3300053730 Ga0500645_000217 Ga0500645_000217_3995_4867 282
660 3300003215 JGI25153J46596_10001449 JGI25153J46596_100014496 283
661 3300005328 Ga0070676_10171792 Ga0070676_101717922 283
662 3300005330 Ga0070690_100013139 Ga0070690_1000131393 283
663 3300005336 Ga0070680_100221375 Ga0070680_1002213752 283
664 3300005340 Ga0070689_100003987 Ga0070689_1000039877 283
665 3300005347 Ga0070668_100233335 Ga0070668_1002333352 283
666 3300005355 Ga0070671_100516024 Ga0070671_1005160241 283
667 3300005365 Ga0070688_100008930 Ga0070688_1000089302 283
668 3300005456 Ga0070678_100019756 Ga0070678_1000197564 283
669 3300005617 Ga0068859_100226901 Ga0068859_1002269012 283
670 3300006931 Ga0097620_100226901 Ga0097620_1002269012 283
671 3300009094 Ga0111539_10084249 Ga0111539_100842492 283
672 3300009101 Ga0105247_10055194 Ga0105247_100551942 283
673 3300010159 Ga0099796_10061734 Ga0099796_100617342 283
674 3300013308 Ga0157375_10201737 Ga0157375_102017372 283
675 3300025297 Ga0209758_1001765 Ga0209758_100176524 283
676 3300025906 Ga0207699_10041381 Ga0207699_100413812 283
677 3300025907 Ga0207645_10167069 Ga0207645_101670692 283
678 3300025926 Ga0207659_10186717 Ga0207659_101867172 283
679 3300025927 Ga0207687_10234463 Ga0207687_102344632 283
680 3300025934 Ga0207686_10054173 Ga0207686_100541732 283
681 3300025936 Ga0207670_10006340 Ga0207670_100063402 283
682 3300025939 Ga0207665_10062868 Ga0207665_100628682 283
683 3300026095 Ga0207676_10230196 Ga0207676_102301962 283
684 3300026121 Ga0207683_10027674 Ga0207683_100276745 283
685 3300034819 Ga0373958_0018017 Ga0373958_0018017_67_939 283
686 3300035085 Ga0373929_0004285 Ga0373929_0004285_1523_2395 283
687 3300035114 Ga0373939_0030504 Ga0373939_0030504_36_908 283
688 3300035115 Ga0373941_0062304 Ga0373941_0062304_272_1144 283
689 3300035121 Ga0373960_0033869 Ga0373960_0033869_373_1245 283
690 3300035171 Ga0373946_0015949 Ga0373946_0015949_1694_2566 283
691 3300035691 Ga0373931_0010579 Ga0373931_0010579_1652_2524 283
692 3300035692 Ga0373935_0207252 Ga0373935_0207252_463_1335 283
693 3300037068 Ga0373925_0241991 Ga0373925_0241991_510_1382 283
694 3300045976 Ga0466967_0123342 Ga0466967_0123342_390_1262 283
695 3300046454 Ga0495592_0181371 Ga0495592_0181371_511_1383 283
696 3300046459 Ga0495629_0056626 Ga0495629_0056626_1742_2614 283
697 3300046516 Ga0495628_0019247 Ga0495628_0019247_2406_3278 283
698 3300046678 Ga0495599_0069359 Ga0495599_0069359_210_1082 283
699 3300046809 Ga0495600_0065329 Ga0495600_0065329_531_1403 283
700 3300047319 Ga0495674_0072205 Ga0495674_0072205_1788_2660 283
701 3300048903 Ga0496100_0025862 Ga0496100_0025862_33_905 283
702 3300048904 Ga0496101_0040181 Ga0496101_0040181_1873_2745 283
703 3300048906 Ga0496103_0053084 Ga0496103_0053084_1300_2172 283
704 3300048907 Ga0496104_0001510 Ga0496104_0001510_3139_4011 283
705 3300048908 Ga0496105_0169121 Ga0496105_0169121_21_893 283
706 3300048908 Ga0496105_0177188 Ga0496105_0177188_686_1558 283
707 3300048910 Ga0496107_0076900 Ga0496107_0076900_1517_2389 283
708 3300048912 Ga0496109_0029186 Ga0496109_0029186_1179_2051 283
709 3300048914 Ga0496111_0003917 Ga0496111_0003917_7013_7885 283
710 3300048916 Ga0496113_0406480 Ga0496113_0406480_200_1072 283
711 3300048917 Ga0496114_0003256 Ga0496114_0003256_1873_2745 283
712 3300048917 Ga0496114_0024627 Ga0496114_0024627_1044_1916 283
713 3300048918 Ga0496115_0007434 Ga0496115_0007434_6643_7515 283
714 3300048918 Ga0496115_0399410 Ga0496115_0399410_221_1093 283
715 3300049585 Ga0501069_0260584 Ga0501069_0260584_118_990 283
716 3300049742 Ga0501080_0358848 Ga0501080_0358848_200_1072 283
717 3300049744 Ga0501083_0072513 Ga0501083_0072513_532_1404 283
718 3300053077 Ga0495601_0008578 Ga0495601_0008578_3394_4266 283
719 3300053084 Ga0495595_0022224 Ga0495595_0022224_739_1611 283
720 3300053085 Ga0495619_0023342 Ga0495619_0023342_1292_2164 283
721 3300053142 Ga0500577_0123562 Ga0500577_0123562_113_985 283
722 3300005327 Ga0070658_10145431 Ga0070658_101454312 284
723 3300005336 Ga0070680_100005559 Ga0070680_1000055597 284
724 3300005458 Ga0070681_10010872 Ga0070681_100108724 284
725 3300005458 Ga0070681_10361388 Ga0070681_103613882 284
726 3300025917 Ga0207660_10006590 Ga0207660_100065906 284
727 3300025921 Ga0207652_10037589 Ga0207652_100375892 284
728 3300031344 Ga0265316_10350671 Ga0265316_103506711 284
729 3300035086 Ga0373934_0040680 Ga0373934_0040680_875_1747 284
730 3300035118 Ga0373954_0081094 Ga0373954_0081094_561_1433 284
731 3300035119 Ga0373956_0075834 Ga0373956_0075834_42_914 284
732 3300035172 Ga0373955_0015722 Ga0373955_0015722_711_1583 284
733 3300035724 Ga0373933_0015863 Ga0373933_0015863_778_1650 284
734 3300035725 Ga0373947_0362426 Ga0373947_0362426_74_946 284
735 3300036401 Ga0373937_0026630 Ga0373937_0026630_1391_2263 284
736 3300046462 Ga0495651_0052129 Ga0495651_0052129_1364_2236 284
737 3300046511 Ga0495608_0107436 Ga0495608_0107436_602_1474 284
738 3300046529 Ga0495652_0208525 Ga0495652_0208525_452_1324 284
739 3300046536 Ga0495587_0010617 Ga0495587_0010617_4536_5408 284
740 3300048088 Ga0495602_0048936 Ga0495602_0048936_971_1843 284
741 3300053077 Ga0495601_0014203 Ga0495601_0014203_1250_2122 284
742 3300053084 Ga0495595_0002379 Ga0495595_0002379_1733_2605 284
743 3300053085 Ga0495619_0013279 Ga0495619_0013279_2785_3657 284
744 3300005456 Ga0070678_100079831 Ga0070678_1000798312 285
745 3300044684 Ga0466966_0160390 Ga0466966_0160390_139_1011 285
746 3300044693 Ga0466961_0083853 Ga0466961_0083853_1112_1984 285
747 3300045049 Ga0466959_0061748 Ga0466959_0061748_89_961 285
748 3300045836 Ga0466958_0012989 Ga0466958_0012989_3520_4392 285
749 3300049568 Ga0501031_0009007 Ga0501031_0009007_2457_3329 285
750 3300049569 Ga0501032_0008203 Ga0501032_0008203_2773_3645 285
751 3300049570 Ga0501033_0002756 Ga0501033_0002756_1435_2307 285
752 3300049571 Ga0501034_0003212 Ga0501034_0003212_11475_12347 285
753 3300049572 Ga0501036_0001549 Ga0501036_0001549_13539_14411 285
754 3300049573 Ga0501037_0001941 Ga0501037_0001941_2619_3491 285
755 3300049574 Ga0501038_0007422 Ga0501038_0007422_3795_4667 285
756 3300049575 Ga0501039_0019836 Ga0501039_0019836_3538_4410 285
757 3300049579 Ga0501043_0006170 Ga0501043_0006170_6571_7443 285
758 3300049580 Ga0501046_0003854 Ga0501046_0003854_10801_11673 285
759 3300049581 Ga0501047_0075851 Ga0501047_0075851_2184_3056 285
760 3300049582 Ga0501048_0003364 Ga0501048_0003364_479_1351 285
761 3300049583 Ga0501067_0017214 Ga0501067_0017214_1578_2450 285
762 3300049585 Ga0501069_0001642 Ga0501069_0001642_9299_10171 285
763 3300049586 Ga0501070_0017501 Ga0501070_0017501_2184_3056 285
764 3300049586 Ga0501070_0485513 Ga0501070_0485513_44_916 285
765 3300049589 Ga0501073_0011148 Ga0501073_0011148_3563_4435 285
766 3300049590 Ga0501074_0005415 Ga0501074_0005415_5578_6450 285
767 3300049742 Ga0501080_0013428 Ga0501080_0013428_3268_4140 285
768 3300049744 Ga0501083_0003165 Ga0501083_0003165_2368_3240 285
769 3300049822 Ga0501035_0091047 Ga0501035_0091047_378_1250 285
770 3300049823 Ga0501044_0035396 Ga0501044_0035396_1452_2324 285
771 3300049823 Ga0501044_0112450 Ga0501044_0112450_193_1065 285
772 3300049824 Ga0501045_0371417 Ga0501045_0371417_162_1034 285
773 3300060353 Ga0501082_0070012 Ga0501082_0070012_10_882 285
774 3300025929 Ga0207664_10018705 Ga0207664_100187052 286
775 3300028381 Ga0268264_10060114 Ga0268264_100601142 286
776 2209111006 2214800757 2213830073 290
777 3300000041 ARcpr5oldR_c000270 ARcpr5oldR_0002705 290
778 3300000043 ARcpr5yngRDRAFT_c000228 ARcpr5yngRDRAFT_0002285 290
779 3300000044 ARSoilOldRDRAFT_c000005 ARSoilOldRDRAFT_00000533 290
780 3300000652 ARCol0yngRDRAFT_1000214 ARCol0yngRDRAFT_10002147 290
781 3300005277 Ga0065716_1002539 Ga0065716_10025392 290
782 3300005290 Ga0065712_10071205 Ga0065712_100712054 290
783 3300005293 Ga0065715_10003092 Ga0065715_100030924 290
784 3300005327 Ga0070658_10010555 Ga0070658_100105553 290
785 3300005328 Ga0070676_10038494 Ga0070676_100384942 290
786 3300005330 Ga0070690_100026597 Ga0070690_1000265972 290
787 3300005336 Ga0070680_100018993 Ga0070680_1000189936 290
788 3300005336 Ga0070680_100033893 Ga0070680_1000338934 290
789 3300005339 Ga0070660_100022813 Ga0070660_1000228134 290
790 3300005339 Ga0070660_100115004 Ga0070660_1001150042 290
791 3300005340 Ga0070689_100027712 Ga0070689_1000277124 290
792 3300005341 Ga0070691_10019887 Ga0070691_100198872 290
793 3300005343 Ga0070687_100002166 Ga0070687_1000021668 290
794 3300005353 Ga0070669_100019391 Ga0070669_1000193915 290
795 3300005355 Ga0070671_100148084 Ga0070671_1001480842 290
796 3300005364 Ga0070673_100301922 Ga0070673_1003019221 290
797 3300005366 Ga0070659_100013492 Ga0070659_1000134924 290
798 3300005406 Ga0070703_10052760 Ga0070703_100527602 290
799 3300005438 Ga0070701_10116682 Ga0070701_101166822 290
800 3300005440 Ga0070705_100029174 Ga0070705_1000291742 290
801 3300005445 Ga0070708_100327919 Ga0070708_1003279192 290
802 3300005457 Ga0070662_100073764 Ga0070662_1000737642 290
803 3300005458 Ga0070681_10031579 Ga0070681_100315795 290
804 3300005458 Ga0070681_10071764 Ga0070681_100717644 290
805 3300005459 Ga0068867_100008460 Ga0068867_1000084605 290
806 3300005530 Ga0070679_100079455 Ga0070679_1000794553 290
807 3300005530 Ga0070679_100109883 Ga0070679_1001098833 290
808 3300005530 Ga0070679_100378451 Ga0070679_1003784512 290
809 3300005535 Ga0070684_100018534 Ga0070684_1000185343 290
810 3300005539 Ga0068853_100009738 Ga0068853_1000097385 290
811 3300005545 Ga0070695_100006266 Ga0070695_1000062665 290
812 3300005546 Ga0070696_100011088 Ga0070696_1000110884 290
813 3300005547 Ga0070693_100038707 Ga0070693_1000387072 290
814 3300005563 Ga0068855_100042633 Ga0068855_1000426334 290
815 3300005563 Ga0068855_100082057 Ga0068855_1000820572 290
816 3300005577 Ga0068857_100037356 Ga0068857_1000373562 290
817 3300005578 Ga0068854_100065614 Ga0068854_1000656144 290
818 3300005616 Ga0068852_100188954 Ga0068852_1001889542 290
819 3300005617 Ga0068859_100006249 Ga0068859_1000062496 290
820 3300005719 Ga0068861_100051085 Ga0068861_1000510852 290
821 3300005843 Ga0068860_100036815 Ga0068860_1000368152 290
822 3300006881 Ga0068865_100017724 Ga0068865_1000177242 290
823 3300006931 Ga0097620_100006249 Ga0097620_1000062498 290
824 3300009093 Ga0105240_10110217 Ga0105240_101102173 290
825 3300009093 Ga0105240_10545184 Ga0105240_105451842 290
826 3300009094 Ga0111539_10024894 Ga0111539_100248943 290
827 3300009098 Ga0105245_10351569 Ga0105245_103515692 290
828 3300009148 Ga0105243_10216616 Ga0105243_102166162 290
829 3300009174 Ga0105241_10268296 Ga0105241_102682962 290
830 3300009545 Ga0105237_10044779 Ga0105237_100447794 290
831 3300009553 Ga0105249_10029951 Ga0105249_100299513 290
832 3300010375 Ga0105239_10069833 Ga0105239_100698334 290
833 3300011119 Ga0105246_10070968 Ga0105246_100709682 290
834 3300012494 Ga0157341_1000733 Ga0157341_10007332 290
835 3300013102 Ga0157371_10034311 Ga0157371_100343112 290
836 3300013105 Ga0157369_10049987 Ga0157369_100499872 290
837 3300013306 Ga0163162_10028781 Ga0163162_100287815 290
838 3300013308 Ga0157375_10025426 Ga0157375_100254264 290
839 3300025271 Ga0207666_1000322 Ga0207666_10003224 290
840 3300025315 Ga0207697_10003133 Ga0207697_100031335 290
841 3300025885 Ga0207653_10022395 Ga0207653_100223952 290
842 3300025904 Ga0207647_10007789 Ga0207647_100077895 290
843 3300025909 Ga0207705_10034529 Ga0207705_100345294 290
844 3300025912 Ga0207707_10025856 Ga0207707_100258564 290
845 3300025913 Ga0207695_10061716 Ga0207695_100617163 290
846 3300025914 Ga0207671_10124502 Ga0207671_101245022 290
847 3300025917 Ga0207660_10024675 Ga0207660_100246752 290
848 3300025917 Ga0207660_10125248 Ga0207660_101252482 290
849 3300025918 Ga0207662_10003619 Ga0207662_100036199 290
850 3300025919 Ga0207657_10018063 Ga0207657_100180636 290
851 3300025919 Ga0207657_10040159 Ga0207657_100401592 290
852 3300025921 Ga0207652_10007586 Ga0207652_100075866 290
853 3300025921 Ga0207652_10057175 Ga0207652_100571753 290
854 3300025923 Ga0207681_10075201 Ga0207681_100752012 290
855 3300025933 Ga0207706_10013528 Ga0207706_100135285 290
856 3300025936 Ga0207670_10052750 Ga0207670_100527501 290
857 3300025940 Ga0207691_10040902 Ga0207691_100409023 290
858 3300025944 Ga0207661_10510291 Ga0207661_105102912 290
859 3300025949 Ga0207667_10035043 Ga0207667_100350433 290
860 3300025981 Ga0207640_10097227 Ga0207640_100972272 290
861 3300025981 Ga0207640_10118214 Ga0207640_101182142 290
862 3300026075 Ga0207708_10007940 Ga0207708_100079405 290
863 3300026089 Ga0207648_10013532 Ga0207648_100135325 290
864 3300026118 Ga0207675_100022012 Ga0207675_1000220123 290
865 3300027682 Ga0209971_1010514 Ga0209971_10105142 290
866 3300027717 Ga0209998_10001194 Ga0209998_100011945 290
867 3300027907 Ga0207428_10028987 Ga0207428_100289873 290
868 3300028556 Ga0265337_1003126 Ga0265337_10031265 290
869 3300031247 Ga0265340_10045716 Ga0265340_100457163 290
870 3300031595 Ga0265313_10000251 Ga0265313_100002515 290
871 3300034818 Ga0373950_0000743 Ga0373950_0000743_2829_3701 290
872 3300034819 Ga0373958_0000470 Ga0373958_0000470_3267_4139 290
873 3300034820 Ga0373959_0031410 Ga0373959_0031410_129_1001 290
874 3300034957 Ga0373938_0001451 Ga0373938_0001451_313_1185 290
875 3300035085 Ga0373929_0001366 Ga0373929_0001366_3261_4133 290
876 3300035091 Ga0373951_0011872 Ga0373951_0011872_412_1284 290
877 3300035112 Ga0373932_0004396 Ga0373932_0004396_282_1154 290
878 3300035115 Ga0373941_0009490 Ga0373941_0009490_550_1422 290
879 3300035121 Ga0373960_0023248 Ga0373960_0023248_666_1538 290
880 3300035207 Ga0373942_0001422 Ga0373942_0001422_2527_3399 290
881 3300035241 Ga0373961_0005463 Ga0373961_0005463_1408_2280 290
882 3300035242 Ga0373962_0000508 Ga0373962_0000508_4610_5482 290
883 3300035691 Ga0373931_0038830 Ga0373931_0038830_1409_2281 290
884 3300042437 Ga0439444_0006674 Ga0439444_0006674_357_1229 290
885 3300042439 Ga0439464_0031250 Ga0439464_0031250_549_1421 290
886 3300044842 Ga0466957_0013670 Ga0466957_0013670_3231_4103 290
887 3300045051 Ga0451576_0335539 Ga0451576_0335539_360_1232 290
888 3300045836 Ga0466958_0040988 Ga0466958_0040988_1843_2715 290
889 3300048904 Ga0496101_0206108 Ga0496101_0206108_413_1285 290
890 3300048905 Ga0496102_0047873 Ga0496102_0047873_50_922 290
891 3300048907 Ga0496104_0581024 Ga0496104_0581024_23_895 290
892 3300048910 Ga0496107_0013279 Ga0496107_0013279_1129_2001 290
893 3300048912 Ga0496109_0162424 Ga0496109_0162424_285_1157 290
894 3300048916 Ga0496113_0051395 Ga0496113_0051395_1279_2151 290
895 3300049569 Ga0501032_0085558 Ga0501032_0085558_297_1169 290
896 3300049571 Ga0501034_0392728 Ga0501034_0392728_15_887 290
897 3300049571 Ga0501034_0538010 Ga0501034_0538010_192_1064 290
898 3300049573 Ga0501037_0091349 Ga0501037_0091349_581_1453 290
899 3300049574 Ga0501038_0165033 Ga0501038_0165033_93_965 290
900 3300049574 Ga0501038_0324056 Ga0501038_0324056_136_1008 290
901 3300049575 Ga0501039_0431439 Ga0501039_0431439_38_910 290
902 3300049585 Ga0501069_0035480 Ga0501069_0035480_1337_2209 290
903 3300049586 Ga0501070_0018859 Ga0501070_0018859_3265_4137 290
904 3300049586 Ga0501070_0089422 Ga0501070_0089422_1033_1905 290
905 3300049586 Ga0501070_0119679 Ga0501070_0119679_269_1141 290
906 3300049588 Ga0501072_0018965 Ga0501072_0018965_3844_4716 290
907 3300049589 Ga0501073_0182783 Ga0501073_0182783_515_1387 290
908 3300049744 Ga0501083_0020293 Ga0501083_0020293_3207_4079 290
909 3300049744 Ga0501083_0042163 Ga0501083_0042163_1022_1894 290
910 3300049822 Ga0501035_0001156 Ga0501035_0001156_18631_19503 290
911 3300049823 Ga0501044_0087078 Ga0501044_0087078_659_1531 290
912 3300050515 nmdc:mga0a205_277689_c1 nmdc:mga0a205_277689_c1_560_1432 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

23

293

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5539 7 273
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.5457 7 279
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5418 7 279
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5405 7 279
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.532 7 259
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8566 8 277 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8208 8 277 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8195 8 277 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8186 9 277 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8147 9 277 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A7Z9K6A8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9507 1 244 GO:0005886
GO:0006865
GO:0022857
AF-A0A537JDJ2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9496 9 211 GO:0005886
GO:0006865
GO:0022857
AF-A0A535E139-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9474 9 230 GO:0005886
GO:0006865
GO:0022857
AF-A0A1F7P391-F1-model_v4 ABC transporter permease 0.943 1 276 GO:0005886
GO:0006865
GO:0022857
AF-A0A7Z9K6A8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.943 1 244 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
83.89 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map