F485496
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 912 | 396 | 912 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10071205|Ga0065712_100712054 |
| Length | 306 |
| Sequence | MPAARGVTNERGKPIAMSSWLLLTVNSVTFGGLLFLLSAGFSLIFGLMRIPNLTHGSLFMLGAYIGATFVGGMLGITFDFWLAALFAALLVAAFGAVLERFLLRQLPGQQLAQVLVTLGVSFIAADFCLMVWGGDPINVASPKGLSGFLRVGPLVVPYYRLTIIVIAVIVAIALWLLLDRTRLGAMIRAGVDDPDMARVVGIRVSRLFTIVFALGAGLAAFAGIIGGPMLSAYPGLDQDMLPLALVVVILGGTGSLLGSFVXSIIIGFIYNFGQAMLPELAYFVLFLPMLLVLLLRPQGLFGRHVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 128 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 257 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 273 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 276 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 277 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 278 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 389 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 391 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 392 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 394 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.64 |
| Nodule | 0.11 |
| Rhizoplane | 5.81 |
| Rhizosphere | 92.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214800757 | 2209111006 | Bacteria | 10991 |
| 2 | ARcpr5oldR_c000270 | 3300000041 | Bacteria | 8047 |
| 3 | ARcpr5yngRDRAFT_c000228 | 3300000043 | Bacteria | 8489 |
| 4 | ARSoilOldRDRAFT_c000005 | 3300000044 | Bacteria | 61735 |
| 5 | ARCol0yngRDRAFT_1000214 | 3300000652 | Bacteria | 9796 |
| 6 | JGI24752J21851_1000784 | 3300001976 | Bacteria | 4278 |
| 7 | JGI24747J21853_1003687 | 3300001978 | Bacteria | 1334 |
| 8 | JGI24739J22299_10003989 | 3300001989 | Bacteria | 5651 |
| 9 | JGI24737J22298_10000343 | 3300001990 | Bacteria | 15615 |
| 10 | JGI24743J22301_10021555 | 3300001991 | Bacteria | 1232 |
| 11 | JGI24750J21931_1000168 | 3300002070 | Bacteria | 10890 |
| 12 | JGI24745J21846_1000151 | 3300002073 | Bacteria | 5494 |
| 13 | JGI24035J26624_1000065 | 3300002126 | Bacteria | 8340 |
| 14 | JGI24034J26672_10001763 | 3300002239 | Bacteria | 2915 |
| 15 | JGI24742J22300_10000257 | 3300002244 | Bacteria | 7900 |
| 16 | JGI25153J46596_10001449 | 3300003215 | Bacteria | 14192 |
| 17 | Ga0065716_1002539 | 3300005277 | Bacteria | 1697 |
| 18 | Ga0065712_10071205 | 3300005290 | Bacteria | 5416 |
| 19 | Ga0065712_10082435 | 3300005290 | Bacteria | 2916 |
| 20 | Ga0065715_10003092 | 3300005293 | Bacteria | 6327 |
| 21 | Ga0065715_10139107 | 3300005293 | Bacteria | 1882 |
| 22 | Ga0070658_10010555 | 3300005327 | Bacteria | 7402 |
| 23 | Ga0070658_10145431 | 3300005327 | Bacteria | 1982 |
| 24 | Ga0070658_10334573 | 3300005327 | Bacteria | 1294 |
| 25 | Ga0070676_10002063 | 3300005328 | Bacteria | 10216 |
| 26 | Ga0070676_10009281 | 3300005328 | Bacteria | 5318 |
| 27 | Ga0070676_10038494 | 3300005328 | Bacteria | 2763 |
| 28 | Ga0070676_10171792 | 3300005328 | Bacteria | 1403 |
| 29 | Ga0070683_100001967 | 3300005329 | Bacteria | 16094 |
| 30 | Ga0070683_100042152 | 3300005329 | Bacteria | 4202 |
| 31 | Ga0070690_100000854 | 3300005330 | Bacteria | 15470 |
| 32 | Ga0070690_100013139 | 3300005330 | Bacteria | 4887 |
| 33 | Ga0070690_100026597 | 3300005330 | Bacteria | 3570 |
| 34 | Ga0070670_100004470 | 3300005331 | Bacteria | 11712 |
| 35 | Ga0070670_100138997 | 3300005331 | Bacteria | 2100 |
| 36 | Ga0070677_10000911 | 3300005333 | Bacteria | 9676 |
| 37 | Ga0068869_100002063 | 3300005334 | Bacteria | 12079 |
| 38 | Ga0068869_100468608 | 3300005334 | Bacteria | 1047 |
| 39 | Ga0070666_10017947 | 3300005335 | Bacteria | 4541 |
| 40 | Ga0070666_10029521 | 3300005335 | Bacteria | 3606 |
| 41 | Ga0070680_100003747 | 3300005336 | Bacteria | 11362 |
| 42 | Ga0070680_100005559 | 3300005336 | Bacteria | 9541 |
| 43 | Ga0070680_100018993 | 3300005336 | Bacteria | 5440 |
| 44 | Ga0070680_100033893 | 3300005336 | Bacteria | 4118 |
| 45 | Ga0070680_100221375 | 3300005336 | Bacteria | 1598 |
| 46 | Ga0070680_100233548 | 3300005336 | Bacteria | 1554 |
| 47 | Ga0070682_100003321 | 3300005337 | Bacteria | 8923 |
| 48 | Ga0070682_100048658 | 3300005337 | Bacteria | 2640 |
| 49 | Ga0070682_100178814 | 3300005337 | Bacteria | 1480 |
| 50 | Ga0068868_100001518 | 3300005338 | Bacteria | 15922 |
| 51 | Ga0068868_100016754 | 3300005338 | Bacteria | 5449 |
| 52 | Ga0068868_100052438 | 3300005338 | Bacteria | 3211 |
| 53 | Ga0070660_100001923 | 3300005339 | Bacteria | 14314 |
| 54 | Ga0070660_100010402 | 3300005339 | Bacteria | 6578 |
| 55 | Ga0070660_100022813 | 3300005339 | Bacteria | 4635 |
| 56 | Ga0070660_100115004 | 3300005339 | Bacteria | 2144 |
| 57 | Ga0070689_100001902 | 3300005340 | Bacteria | 13496 |
| 58 | Ga0070689_100003987 | 3300005340 | Bacteria | 9921 |
| 59 | Ga0070689_100027712 | 3300005340 | Bacteria | 4273 |
| 60 | Ga0070691_10001508 | 3300005341 | Bacteria | 10000 |
| 61 | Ga0070691_10019887 | 3300005341 | Bacteria | 3099 |
| 62 | Ga0070687_100000581 | 3300005343 | Bacteria | 12175 |
| 63 | Ga0070687_100002166 | 3300005343 | Bacteria | 7262 |
| 64 | Ga0070687_100019986 | 3300005343 | Bacteria | 3125 |
| 65 | Ga0070661_100002173 | 3300005344 | Bacteria | 13503 |
| 66 | Ga0070692_10000022 | 3300005345 | Bacteria | 31371 |
| 67 | Ga0070668_100007861 | 3300005347 | Bacteria | 7918 |
| 68 | Ga0070668_100233335 | 3300005347 | Bacteria | 1522 |
| 69 | Ga0070669_100005226 | 3300005353 | Bacteria | 9383 |
| 70 | Ga0070669_100019391 | 3300005353 | Bacteria | 4857 |
| 71 | Ga0070675_100001735 | 3300005354 | Bacteria | 16095 |
| 72 | Ga0070671_100001490 | 3300005355 | Bacteria | 17502 |
| 73 | Ga0070671_100148084 | 3300005355 | Bacteria | 1982 |
| 74 | Ga0070671_100516024 | 3300005355 | Bacteria | 1029 |
| 75 | Ga0070674_100010186 | 3300005356 | Bacteria | 5666 |
| 76 | Ga0070674_100153912 | 3300005356 | Bacteria | 1738 |
| 77 | Ga0070673_100002359 | 3300005364 | Bacteria | 11478 |
| 78 | Ga0070673_100035233 | 3300005364 | Bacteria | 3793 |
| 79 | Ga0070673_100053689 | 3300005364 | Bacteria | 3167 |
| 80 | Ga0070673_100301922 | 3300005364 | Bacteria | 1410 |
| 81 | Ga0070688_100000196 | 3300005365 | Bacteria | 32063 |
| 82 | Ga0070688_100008636 | 3300005365 | Bacteria | 5544 |
| 83 | Ga0070688_100008930 | 3300005365 | Bacteria | 5457 |
| 84 | Ga0070659_100001661 | 3300005366 | Bacteria | 15993 |
| 85 | Ga0070659_100013492 | 3300005366 | Bacteria | 6082 |
| 86 | Ga0070667_100001157 | 3300005367 | Bacteria | 23956 |
| 87 | Ga0070667_100041199 | 3300005367 | Bacteria | 3874 |
| 88 | Ga0070703_10003849 | 3300005406 | Bacteria | 4250 |
| 89 | Ga0070703_10052760 | 3300005406 | Bacteria | 1305 |
| 90 | Ga0070709_10012677 | 3300005434 | Bacteria | 4721 |
| 91 | Ga0070709_10026420 | 3300005434 | Bacteria | 3441 |
| 92 | Ga0070709_10098427 | 3300005434 | Bacteria | 1944 |
| 93 | Ga0070709_10150204 | 3300005434 | Bacteria | 1609 |
| 94 | Ga0070709_10254314 | 3300005434 | Bacteria | 1267 |
| 95 | Ga0070714_100010967 | 3300005435 | Bacteria | 7178 |
| 96 | Ga0070714_100211552 | 3300005435 | Bacteria | 1778 |
| 97 | Ga0070714_100512959 | 3300005435 | Bacteria | 1144 |
| 98 | Ga0070713_100002801 | 3300005436 | Bacteria | 11398 |
| 99 | Ga0070713_100015520 | 3300005436 | Bacteria | 5700 |
| 100 | Ga0070713_100024112 | 3300005436 | Bacteria | 4734 |
| 101 | Ga0070710_10004196 | 3300005437 | Bacteria | 6834 |
| 102 | Ga0070710_10007560 | 3300005437 | Bacteria | 5263 |
| 103 | Ga0070710_10028417 | 3300005437 | Bacteria | 2991 |
| 104 | Ga0070710_10052553 | 3300005437 | Bacteria | 2292 |
| 105 | Ga0070701_10001517 | 3300005438 | Bacteria | 8603 |
| 106 | Ga0070701_10116682 | 3300005438 | Bacteria | 1499 |
| 107 | Ga0070711_100016320 | 3300005439 | Bacteria | 4716 |
| 108 | Ga0070711_100099733 | 3300005439 | Bacteria | 2111 |
| 109 | Ga0070711_100150321 | 3300005439 | Bacteria | 1755 |
| 110 | Ga0070711_100169732 | 3300005439 | Bacteria | 1662 |
| 111 | Ga0070711_100366611 | 3300005439 | Bacteria | 1161 |
| 112 | Ga0070705_100003506 | 3300005440 | Bacteria | 7675 |
| 113 | Ga0070705_100029174 | 3300005440 | Bacteria | 3031 |
| 114 | Ga0070700_100001358 | 3300005441 | Bacteria | 12161 |
| 115 | Ga0070708_100052232 | 3300005445 | Bacteria | 3624 |
| 116 | Ga0070708_100327919 | 3300005445 | Bacteria | 1442 |
| 117 | Ga0070663_100015910 | 3300005455 | Bacteria | 4870 |
| 118 | Ga0070678_100019756 | 3300005456 | Bacteria | 4402 |
| 119 | Ga0070678_100028197 | 3300005456 | Bacteria | 3825 |
| 120 | Ga0070678_100079831 | 3300005456 | Bacteria | 2476 |
| 121 | Ga0070662_100002117 | 3300005457 | Bacteria | 12175 |
| 122 | Ga0070662_100073764 | 3300005457 | Bacteria | 2522 |
| 123 | Ga0070681_10000884 | 3300005458 | Bacteria | 25290 |
| 124 | Ga0070681_10005194 | 3300005458 | Bacteria | 12568 |
| 125 | Ga0070681_10010872 | 3300005458 | Bacteria | 8996 |
| 126 | Ga0070681_10031579 | 3300005458 | Bacteria | 5316 |
| 127 | Ga0070681_10071764 | 3300005458 | Bacteria | 3427 |
| 128 | Ga0070681_10361388 | 3300005458 | Bacteria | 1362 |
| 129 | Ga0070681_10481520 | 3300005458 | Bacteria | 1154 |
| 130 | Ga0068867_100000744 | 3300005459 | Bacteria | 21853 |
| 131 | Ga0068867_100008460 | 3300005459 | Bacteria | 7259 |
| 132 | Ga0070685_10007166 | 3300005466 | Bacteria | 5694 |
| 133 | Ga0070685_10010537 | 3300005466 | Bacteria | 4805 |
| 134 | Ga0070706_100276197 | 3300005467 | Bacteria | 1568 |
| 135 | Ga0070707_100314025 | 3300005468 | Bacteria | 1523 |
| 136 | Ga0070679_100009711 | 3300005530 | Bacteria | 9102 |
| 137 | Ga0070679_100079455 | 3300005530 | Bacteria | 3269 |
| 138 | Ga0070679_100109883 | 3300005530 | Bacteria | 2743 |
| 139 | Ga0070679_100154418 | 3300005530 | Bacteria | 2271 |
| 140 | Ga0070679_100378451 | 3300005530 | Bacteria | 1362 |
| 141 | Ga0070679_100594616 | 3300005530 | Bacteria | 1050 |
| 142 | Ga0070684_100001760 | 3300005535 | Bacteria | 15798 |
| 143 | Ga0070684_100015270 | 3300005535 | Bacteria | 6249 |
| 144 | Ga0070684_100018534 | 3300005535 | Bacteria | 5737 |
| 145 | Ga0070684_100397342 | 3300005535 | Bacteria | 1271 |
| 146 | Ga0070697_100170653 | 3300005536 | Bacteria | 1841 |
| 147 | Ga0068853_100005867 | 3300005539 | Bacteria | 9678 |
| 148 | Ga0068853_100009738 | 3300005539 | Bacteria | 7752 |
| 149 | Ga0068853_100081713 | 3300005539 | Bacteria | 2830 |
| 150 | Ga0070672_100001256 | 3300005543 | Bacteria | 15606 |
| 151 | Ga0070686_100000931 | 3300005544 | Bacteria | 16827 |
| 152 | Ga0070686_100038445 | 3300005544 | Bacteria | 2975 |
| 153 | Ga0070686_100064466 | 3300005544 | Bacteria | 2377 |
| 154 | Ga0070695_100001091 | 3300005545 | Bacteria | 14845 |
| 155 | Ga0070695_100006266 | 3300005545 | Bacteria | 7028 |
| 156 | Ga0070696_100003841 | 3300005546 | Bacteria | 10031 |
| 157 | Ga0070696_100011088 | 3300005546 | Bacteria | 6032 |
| 158 | Ga0070693_100001091 | 3300005547 | Bacteria | 12175 |
| 159 | Ga0070693_100038707 | 3300005547 | Bacteria | 2667 |
| 160 | Ga0070693_100063071 | 3300005547 | Bacteria | 2159 |
| 161 | Ga0070665_100370643 | 3300005548 | Bacteria | 1439 |
| 162 | Ga0070704_100000586 | 3300005549 | Bacteria | 17523 |
| 163 | Ga0068855_100012952 | 3300005563 | Bacteria | 10061 |
| 164 | Ga0068855_100029487 | 3300005563 | Bacteria | 6558 |
| 165 | Ga0068855_100042633 | 3300005563 | Bacteria | 5376 |
| 166 | Ga0068855_100082057 | 3300005563 | Bacteria | 3737 |
| 167 | Ga0070664_100007278 | 3300005564 | Bacteria | 8922 |
| 168 | Ga0070664_100077740 | 3300005564 | Bacteria | 2854 |
| 169 | Ga0068857_100037356 | 3300005577 | Bacteria | 4302 |
| 170 | Ga0068857_100168071 | 3300005577 | Bacteria | 1992 |
| 171 | Ga0068854_100005058 | 3300005578 | Bacteria | 8305 |
| 172 | Ga0068854_100065614 | 3300005578 | Bacteria | 2640 |
| 173 | Ga0068856_100002589 | 3300005614 | Bacteria | 18625 |
| 174 | Ga0068856_100186030 | 3300005614 | Bacteria | 2091 |
| 175 | Ga0068856_100186780 | 3300005614 | Bacteria | 2086 |
| 176 | Ga0068856_100189691 | 3300005614 | Bacteria | 2069 |
| 177 | Ga0070702_100001481 | 3300005615 | Bacteria | 9638 |
| 178 | Ga0068852_100001321 | 3300005616 | Bacteria | 16607 |
| 179 | Ga0068852_100188954 | 3300005616 | Bacteria | 1942 |
| 180 | Ga0068859_100003378 | 3300005617 | Bacteria | 16230 |
| 181 | Ga0068859_100006249 | 3300005617 | Bacteria | 12090 |
| 182 | Ga0068859_100125502 | 3300005617 | Bacteria | 2635 |
| 183 | Ga0068859_100226901 | 3300005617 | Bacteria | 1956 |
| 184 | Ga0068859_100479684 | 3300005617 | Bacteria | 1339 |
| 185 | Ga0068864_100005368 | 3300005618 | Bacteria | 10498 |
| 186 | Ga0068864_100033385 | 3300005618 | Bacteria | 4375 |
| 187 | Ga0068866_10001827 | 3300005718 | Bacteria | 8951 |
| 188 | Ga0068866_10003791 | 3300005718 | Bacteria | 6200 |
| 189 | Ga0068861_100004442 | 3300005719 | Bacteria | 9412 |
| 190 | Ga0068861_100051085 | 3300005719 | Bacteria | 3137 |
| 191 | Ga0068870_10001047 | 3300005840 | Bacteria | 10938 |
| 192 | Ga0068863_100004482 | 3300005841 | Bacteria | 13773 |
| 193 | Ga0068863_100046817 | 3300005841 | Bacteria | 4105 |
| 194 | Ga0068863_100259042 | 3300005841 | Bacteria | 1681 |
| 195 | Ga0068858_100002675 | 3300005842 | Bacteria | 17941 |
| 196 | Ga0068858_100025282 | 3300005842 | Bacteria | 5526 |
| 197 | Ga0068860_100008474 | 3300005843 | Bacteria | 10247 |
| 198 | Ga0068860_100015436 | 3300005843 | Bacteria | 7462 |
| 199 | Ga0068860_100036815 | 3300005843 | Bacteria | 4686 |
| 200 | Ga0068862_100001659 | 3300005844 | Bacteria | 20231 |
| 201 | Ga0081540_1001075 | 3300005983 | Bacteria | 24254 |
| 202 | Ga0081540_1028851 | 3300005983 | Bacteria | 3104 |
| 203 | Ga0081539_10010901 | 3300005985 | Bacteria | 7299 |
| 204 | Ga0070717_10020314 | 3300006028 | Bacteria | 5221 |
| 205 | Ga0075432_10032913 | 3300006058 | Bacteria | 1796 |
| 206 | Ga0070716_100002129 | 3300006173 | Bacteria | 9093 |
| 207 | Ga0070716_100076563 | 3300006173 | Bacteria | 1983 |
| 208 | Ga0070712_100011749 | 3300006175 | Bacteria | 5565 |
| 209 | Ga0070712_100077390 | 3300006175 | Bacteria | 2398 |
| 210 | Ga0070712_100360171 | 3300006175 | Bacteria | 1192 |
| 211 | Ga0097621_100000432 | 3300006237 | Bacteria | 29159 |
| 212 | Ga0097621_100003548 | 3300006237 | Bacteria | 10774 |
| 213 | Ga0097621_100060177 | 3300006237 | Bacteria | 3112 |
| 214 | Ga0097621_100170040 | 3300006237 | Bacteria | 1878 |
| 215 | Ga0068871_100002403 | 3300006358 | Bacteria | 12772 |
| 216 | Ga0068871_100012965 | 3300006358 | Bacteria | 6172 |
| 217 | Ga0075428_100006289 | 3300006844 | Bacteria | 13200 |
| 218 | Ga0075428_100201448 | 3300006844 | Bacteria | 2152 |
| 219 | Ga0075430_100000312 | 3300006846 | Bacteria | 34556 |
| 220 | Ga0075431_100007548 | 3300006847 | Bacteria | 10828 |
| 221 | Ga0075433_10000328 | 3300006852 | Bacteria | 29209 |
| 222 | Ga0075433_10006826 | 3300006852 | Bacteria | 9048 |
| 223 | Ga0075433_10010986 | 3300006852 | Bacteria | 7281 |
| 224 | Ga0075433_10205078 | 3300006852 | Bacteria | 1753 |
| 225 | Ga0075434_100000482 | 3300006871 | Bacteria | 29922 |
| 226 | Ga0075434_100002518 | 3300006871 | Bacteria | 16154 |
| 227 | Ga0075434_100051855 | 3300006871 | Bacteria | 4076 |
| 228 | Ga0075434_100288436 | 3300006871 | Bacteria | 1661 |
| 229 | Ga0075429_100001514 | 3300006880 | Bacteria | 19140 |
| 230 | Ga0068865_100000989 | 3300006881 | Bacteria | 16275 |
| 231 | Ga0068865_100017724 | 3300006881 | Bacteria | 4584 |
| 232 | Ga0075436_100026247 | 3300006914 | Bacteria | 4010 |
| 233 | Ga0097620_100003378 | 3300006931 | Bacteria | 16230 |
| 234 | Ga0097620_100006249 | 3300006931 | Bacteria | 12090 |
| 235 | Ga0097620_100125498 | 3300006931 | Bacteria | 2635 |
| 236 | Ga0097620_100226901 | 3300006931 | Bacteria | 1956 |
| 237 | Ga0097620_100479745 | 3300006931 | Bacteria | 1339 |
| 238 | Ga0075435_100007820 | 3300007076 | Bacteria | 7647 |
| 239 | Ga0075435_100025200 | 3300007076 | Bacteria | 4627 |
| 240 | Ga0075435_100048841 | 3300007076 | Bacteria | 3401 |
| 241 | Ga0105251_10012487 | 3300009011 | Bacteria | 4803 |
| 242 | Ga0105250_10052453 | 3300009092 | Bacteria | 1636 |
| 243 | Ga0105240_10077191 | 3300009093 | Bacteria | 4105 |
| 244 | Ga0105240_10110217 | 3300009093 | Bacteria | 3332 |
| 245 | Ga0105240_10208342 | 3300009093 | Bacteria | 2286 |
| 246 | Ga0105240_10431148 | 3300009093 | Bacteria | 1479 |
| 247 | Ga0105240_10545184 | 3300009093 | Bacteria | 1284 |
| 248 | Ga0111539_10001938 | 3300009094 | Bacteria | 27600 |
| 249 | Ga0111539_10006634 | 3300009094 | Bacteria | 14909 |
| 250 | Ga0111539_10024894 | 3300009094 | Bacteria | 7339 |
| 251 | Ga0111539_10084249 | 3300009094 | Bacteria | 3738 |
| 252 | Ga0105245_10000534 | 3300009098 | Bacteria | 34896 |
| 253 | Ga0105245_10001271 | 3300009098 | Bacteria | 22781 |
| 254 | Ga0105245_10351569 | 3300009098 | Bacteria | 1460 |
| 255 | Ga0105247_10004338 | 3300009101 | Bacteria | 9064 |
| 256 | Ga0105247_10048562 | 3300009101 | Bacteria | 2607 |
| 257 | Ga0105247_10055194 | 3300009101 | Bacteria | 2452 |
| 258 | Ga0114129_10007064 | 3300009147 | Bacteria | 15979 |
| 259 | Ga0114129_10013293 | 3300009147 | Bacteria | 11731 |
| 260 | Ga0105243_10002870 | 3300009148 | Bacteria | 14286 |
| 261 | Ga0105243_10011971 | 3300009148 | Bacteria | 6557 |
| 262 | Ga0105243_10126450 | 3300009148 | Bacteria | 2163 |
| 263 | Ga0105243_10216616 | 3300009148 | Bacteria | 1690 |
| 264 | Ga0105241_10002371 | 3300009174 | Bacteria | 14157 |
| 265 | Ga0105241_10023086 | 3300009174 | Bacteria | 4611 |
| 266 | Ga0105241_10027062 | 3300009174 | Bacteria | 4268 |
| 267 | Ga0105241_10268296 | 3300009174 | Bacteria | 1453 |
| 268 | Ga0105242_10003152 | 3300009176 | Bacteria | 12875 |
| 269 | Ga0105242_10028950 | 3300009176 | Bacteria | 4414 |
| 270 | Ga0105248_10003614 | 3300009177 | Bacteria | 17151 |
| 271 | Ga0105248_10051773 | 3300009177 | Bacteria | 4607 |
| 272 | Ga0105248_10112739 | 3300009177 | Bacteria | 3067 |
| 273 | Ga0105237_10044779 | 3300009545 | Bacteria | 4455 |
| 274 | Ga0105237_10201002 | 3300009545 | Bacteria | 1993 |
| 275 | Ga0105238_10040585 | 3300009551 | Bacteria | 4715 |
| 276 | Ga0105238_10053026 | 3300009551 | Bacteria | 4076 |
| 277 | Ga0105238_10073363 | 3300009551 | Bacteria | 3417 |
| 278 | Ga0105249_10001017 | 3300009553 | Bacteria | 24807 |
| 279 | Ga0105249_10029951 | 3300009553 | Bacteria | 4917 |
| 280 | Ga0123342_1000455 | 3300009766 | Bacteria | 64500 |
| 281 | Ga0099796_10061734 | 3300010159 | Bacteria | 1330 |
| 282 | Ga0105239_10017653 | 3300010375 | Bacteria | 7892 |
| 283 | Ga0105239_10069833 | 3300010375 | Bacteria | 3858 |
| 284 | Ga0105239_10668525 | 3300010375 | Bacteria | 1187 |
| 285 | Ga0105246_10007846 | 3300011119 | Bacteria | 6548 |
| 286 | Ga0105246_10070968 | 3300011119 | Bacteria | 2451 |
| 287 | Ga0105246_10190093 | 3300011119 | Bacteria | 1589 |
| 288 | Ga0157337_1001599 | 3300012483 | Bacteria | 1191 |
| 289 | Ga0157341_1000733 | 3300012494 | Bacteria | 1769 |
| 290 | Ga0157373_10089296 | 3300013100 | Bacteria | 2170 |
| 291 | Ga0157371_10034311 | 3300013102 | Bacteria | 3640 |
| 292 | Ga0157371_10061309 | 3300013102 | Bacteria | 2667 |
| 293 | Ga0157370_10011104 | 3300013104 | Bacteria | 9443 |
| 294 | Ga0157369_10047309 | 3300013105 | Bacteria | 4672 |
| 295 | Ga0157369_10049987 | 3300013105 | Bacteria | 4530 |
| 296 | Ga0157374_10004819 | 3300013296 | Bacteria | 11325 |
| 297 | Ga0157378_10042017 | 3300013297 | Bacteria | 4056 |
| 298 | Ga0163162_10003671 | 3300013306 | Bacteria | 14720 |
| 299 | Ga0163162_10028781 | 3300013306 | Bacteria | 5499 |
| 300 | Ga0157372_10045137 | 3300013307 | Bacteria | 4887 |
| 301 | Ga0157372_10078105 | 3300013307 | Bacteria | 3740 |
| 302 | Ga0157372_10137183 | 3300013307 | Bacteria | 2818 |
| 303 | Ga0157375_10001417 | 3300013308 | Bacteria | 20618 |
| 304 | Ga0157375_10025426 | 3300013308 | Bacteria | 5501 |
| 305 | Ga0157375_10201737 | 3300013308 | Bacteria | 2145 |
| 306 | Ga0163163_10019563 | 3300014325 | Bacteria | 6360 |
| 307 | Ga0163163_10039219 | 3300014325 | Bacteria | 4622 |
| 308 | Ga0157380_10007707 | 3300014326 | Bacteria | 7660 |
| 309 | Ga0182008_10089735 | 3300014497 | Bacteria | 1515 |
| 310 | Ga0157377_10000458 | 3300014745 | Bacteria | 17574 |
| 311 | Ga0157379_10003079 | 3300014968 | Bacteria | 14099 |
| 312 | Ga0157379_10062633 | 3300014968 | Bacteria | 3326 |
| 313 | Ga0157376_10004629 | 3300014969 | Bacteria | 9584 |
| 314 | Ga0163161_10002260 | 3300017792 | Bacteria | 13806 |
| 315 | Ga0207666_1000030 | 3300025271 | Bacteria | 31103 |
| 316 | Ga0207666_1000322 | 3300025271 | Bacteria | 6680 |
| 317 | Ga0207673_1003710 | 3300025290 | Bacteria | 1799 |
| 318 | Ga0209758_1001765 | 3300025297 | Bacteria | 23988 |
| 319 | Ga0207697_10000225 | 3300025315 | Bacteria | 30578 |
| 320 | Ga0207697_10003133 | 3300025315 | Bacteria | 8253 |
| 321 | Ga0207653_10002351 | 3300025885 | Bacteria | 6027 |
| 322 | Ga0207653_10022395 | 3300025885 | Bacteria | 2007 |
| 323 | Ga0207682_10000009 | 3300025893 | Bacteria | 86366 |
| 324 | Ga0207692_10002474 | 3300025898 | Bacteria | 7091 |
| 325 | Ga0207692_10016538 | 3300025898 | Bacteria | 3270 |
| 326 | Ga0207692_10039844 | 3300025898 | Bacteria | 2315 |
| 327 | Ga0207692_10154140 | 3300025898 | Bacteria | 1318 |
| 328 | Ga0207642_10001175 | 3300025899 | Bacteria | 8067 |
| 329 | Ga0207710_10017761 | 3300025900 | Bacteria | 3019 |
| 330 | Ga0207710_10025504 | 3300025900 | Bacteria | 2551 |
| 331 | Ga0207688_10000060 | 3300025901 | Bacteria | 40194 |
| 332 | Ga0207688_10027494 | 3300025901 | Bacteria | 3129 |
| 333 | Ga0207680_10009851 | 3300025903 | Bacteria | 4758 |
| 334 | Ga0207680_10036845 | 3300025903 | Bacteria | 2819 |
| 335 | Ga0207647_10000172 | 3300025904 | Bacteria | 51724 |
| 336 | Ga0207647_10007789 | 3300025904 | Bacteria | 7711 |
| 337 | Ga0207699_10004490 | 3300025906 | Bacteria | 6667 |
| 338 | Ga0207699_10013160 | 3300025906 | Bacteria | 4225 |
| 339 | Ga0207699_10041381 | 3300025906 | Bacteria | 2661 |
| 340 | Ga0207645_10001556 | 3300025907 | Bacteria | 18769 |
| 341 | Ga0207645_10167069 | 3300025907 | Bacteria | 1441 |
| 342 | Ga0207643_10000244 | 3300025908 | Bacteria | 37860 |
| 343 | Ga0207705_10034529 | 3300025909 | Bacteria | 3616 |
| 344 | Ga0207684_10122547 | 3300025910 | Bacteria | 2229 |
| 345 | Ga0207707_10006429 | 3300025912 | Bacteria | 10265 |
| 346 | Ga0207707_10025856 | 3300025912 | Bacteria | 5134 |
| 347 | Ga0207695_10061716 | 3300025913 | Bacteria | 3873 |
| 348 | Ga0207695_10087008 | 3300025913 | Bacteria | 3149 |
| 349 | Ga0207671_10113869 | 3300025914 | Bacteria | 2061 |
| 350 | Ga0207671_10124502 | 3300025914 | Bacteria | 1973 |
| 351 | Ga0207693_10004633 | 3300025915 | Bacteria | 11602 |
| 352 | Ga0207693_10005817 | 3300025915 | Bacteria | 10232 |
| 353 | Ga0207693_10021327 | 3300025915 | Bacteria | 5149 |
| 354 | Ga0207693_10051174 | 3300025915 | Bacteria | 3242 |
| 355 | Ga0207663_10007441 | 3300025916 | Bacteria | 5678 |
| 356 | Ga0207663_10031199 | 3300025916 | Bacteria | 3151 |
| 357 | Ga0207663_10402436 | 3300025916 | Bacteria | 1047 |
| 358 | Ga0207660_10000179 | 3300025917 | Bacteria | 40457 |
| 359 | Ga0207660_10006590 | 3300025917 | Bacteria | 7538 |
| 360 | Ga0207660_10024675 | 3300025917 | Bacteria | 4073 |
| 361 | Ga0207660_10102635 | 3300025917 | Bacteria | 2138 |
| 362 | Ga0207660_10125248 | 3300025917 | Bacteria | 1950 |
| 363 | Ga0207660_10151366 | 3300025917 | Bacteria | 1783 |
| 364 | Ga0207662_10000025 | 3300025918 | Bacteria | 70078 |
| 365 | Ga0207662_10003619 | 3300025918 | Bacteria | 7986 |
| 366 | Ga0207662_10040739 | 3300025918 | Bacteria | 2731 |
| 367 | Ga0207657_10006380 | 3300025919 | Bacteria | 12245 |
| 368 | Ga0207657_10018063 | 3300025919 | Bacteria | 6747 |
| 369 | Ga0207657_10038325 | 3300025919 | Bacteria | 4268 |
| 370 | Ga0207657_10040159 | 3300025919 | Bacteria | 4149 |
| 371 | Ga0207649_10000693 | 3300025920 | Bacteria | 22200 |
| 372 | Ga0207649_10079162 | 3300025920 | Bacteria | 2122 |
| 373 | Ga0207652_10002825 | 3300025921 | Bacteria | 14578 |
| 374 | Ga0207652_10007586 | 3300025921 | Bacteria | 8736 |
| 375 | Ga0207652_10010905 | 3300025921 | Bacteria | 7325 |
| 376 | Ga0207652_10037589 | 3300025921 | Bacteria | 4098 |
| 377 | Ga0207652_10057175 | 3300025921 | Bacteria | 3359 |
| 378 | Ga0207681_10001707 | 3300025923 | Bacteria | 14116 |
| 379 | Ga0207681_10075201 | 3300025923 | Bacteria | 2368 |
| 380 | Ga0207694_10019609 | 3300025924 | Bacteria | 5114 |
| 381 | Ga0207694_10237291 | 3300025924 | Bacteria | 1490 |
| 382 | Ga0207694_10440235 | 3300025924 | Bacteria | 1087 |
| 383 | Ga0207650_10035875 | 3300025925 | Bacteria | 3604 |
| 384 | Ga0207650_10042870 | 3300025925 | Bacteria | 3319 |
| 385 | Ga0207659_10000283 | 3300025926 | Bacteria | 30879 |
| 386 | Ga0207659_10186717 | 3300025926 | Bacteria | 1647 |
| 387 | Ga0207687_10002275 | 3300025927 | Bacteria | 13067 |
| 388 | Ga0207687_10002373 | 3300025927 | Bacteria | 12788 |
| 389 | Ga0207687_10003040 | 3300025927 | Bacteria | 11370 |
| 390 | Ga0207687_10234463 | 3300025927 | Bacteria | 1451 |
| 391 | Ga0207700_10005221 | 3300025928 | Bacteria | 7740 |
| 392 | Ga0207700_10258449 | 3300025928 | Unclassified | 1490 |
| 393 | Ga0207664_10018705 | 3300025929 | Bacteria | 5107 |
| 394 | Ga0207664_10027330 | 3300025929 | Bacteria | 4324 |
| 395 | Ga0207664_10040856 | 3300025929 | Bacteria | 3610 |
| 396 | Ga0207664_10052000 | 3300025929 | Bacteria | 3238 |
| 397 | Ga0207664_10080480 | 3300025929 | Bacteria | 2648 |
| 398 | Ga0207664_10171390 | 3300025929 | Bacteria | 1858 |
| 399 | Ga0207644_10008220 | 3300025931 | Bacteria | 6834 |
| 400 | Ga0207644_10016312 | 3300025931 | Bacteria | 4997 |
| 401 | Ga0207690_10002627 | 3300025932 | Bacteria | 10817 |
| 402 | Ga0207706_10000734 | 3300025933 | Bacteria | 34159 |
| 403 | Ga0207706_10013528 | 3300025933 | Bacteria | 7416 |
| 404 | Ga0207706_10519887 | 3300025933 | Bacteria | 1026 |
| 405 | Ga0207686_10003173 | 3300025934 | Bacteria | 8849 |
| 406 | Ga0207686_10054173 | 3300025934 | Bacteria | 2512 |
| 407 | Ga0207709_10003573 | 3300025935 | Bacteria | 9192 |
| 408 | Ga0207709_10051102 | 3300025935 | Bacteria | 2532 |
| 409 | Ga0207670_10002092 | 3300025936 | Bacteria | 10434 |
| 410 | Ga0207670_10006340 | 3300025936 | Bacteria | 6554 |
| 411 | Ga0207670_10028166 | 3300025936 | Bacteria | 3562 |
| 412 | Ga0207670_10052750 | 3300025936 | Bacteria | 2736 |
| 413 | Ga0207669_10000204 | 3300025937 | Bacteria | 27121 |
| 414 | Ga0207704_10000130 | 3300025938 | Bacteria | 41287 |
| 415 | Ga0207665_10000605 | 3300025939 | Bacteria | 24109 |
| 416 | Ga0207665_10062868 | 3300025939 | Bacteria | 2520 |
| 417 | Ga0207665_10101584 | 3300025939 | Bacteria | 2008 |
| 418 | Ga0207691_10000309 | 3300025940 | Bacteria | 48592 |
| 419 | Ga0207691_10040902 | 3300025940 | Bacteria | 4282 |
| 420 | Ga0207711_10003739 | 3300025941 | Bacteria | 13120 |
| 421 | Ga0207711_10012929 | 3300025941 | Bacteria | 6934 |
| 422 | Ga0207711_10056517 | 3300025941 | Bacteria | 3373 |
| 423 | Ga0207711_10342954 | 3300025941 | Bacteria | 1383 |
| 424 | Ga0207689_10000893 | 3300025942 | Bacteria | 28654 |
| 425 | Ga0207689_10012479 | 3300025942 | Bacteria | 7259 |
| 426 | Ga0207689_10519408 | 3300025942 | Bacteria | 999 |
| 427 | Ga0207661_10002361 | 3300025944 | Bacteria | 12991 |
| 428 | Ga0207661_10510291 | 3300025944 | Bacteria | 1099 |
| 429 | Ga0207679_10000128 | 3300025945 | Bacteria | 61823 |
| 430 | Ga0207679_10095705 | 3300025945 | Bacteria | 2309 |
| 431 | Ga0207667_10035043 | 3300025949 | Bacteria | 5386 |
| 432 | Ga0207667_10084560 | 3300025949 | Bacteria | 3285 |
| 433 | Ga0207651_10003176 | 3300025960 | Bacteria | 8017 |
| 434 | Ga0207651_10056641 | 3300025960 | Bacteria | 2699 |
| 435 | Ga0207712_10003532 | 3300025961 | Bacteria | 9858 |
| 436 | Ga0207668_10002246 | 3300025972 | Bacteria | 11262 |
| 437 | Ga0207640_10003873 | 3300025981 | Bacteria | 8078 |
| 438 | Ga0207640_10097227 | 3300025981 | Bacteria | 2055 |
| 439 | Ga0207640_10118214 | 3300025981 | Bacteria | 1893 |
| 440 | Ga0207658_10005965 | 3300025986 | Bacteria | 8324 |
| 441 | Ga0207658_10087707 | 3300025986 | Bacteria | 2403 |
| 442 | Ga0207677_10003185 | 3300026023 | Bacteria | 8663 |
| 443 | Ga0207677_10026509 | 3300026023 | Bacteria | 3637 |
| 444 | Ga0207703_10010286 | 3300026035 | Bacteria | 7327 |
| 445 | Ga0207703_10016763 | 3300026035 | Bacteria | 5716 |
| 446 | Ga0207703_10169031 | 3300026035 | Bacteria | 1922 |
| 447 | Ga0207678_10000759 | 3300026067 | Bacteria | 29491 |
| 448 | Ga0207708_10000391 | 3300026075 | Bacteria | 34446 |
| 449 | Ga0207708_10007940 | 3300026075 | Bacteria | 7865 |
| 450 | Ga0207702_10026447 | 3300026078 | Bacteria | 4817 |
| 451 | Ga0207702_10137279 | 3300026078 | Bacteria | 2208 |
| 452 | Ga0207702_10137575 | 3300026078 | Bacteria | 2206 |
| 453 | Ga0207702_10187011 | 3300026078 | Bacteria | 1911 |
| 454 | Ga0207641_10008773 | 3300026088 | Bacteria | 8349 |
| 455 | Ga0207641_10042207 | 3300026088 | Bacteria | 3825 |
| 456 | Ga0207641_10466935 | 3300026088 | Bacteria | 1222 |
| 457 | Ga0207648_10000862 | 3300026089 | Bacteria | 34173 |
| 458 | Ga0207648_10013532 | 3300026089 | Bacteria | 7585 |
| 459 | Ga0207676_10007810 | 3300026095 | Bacteria | 7610 |
| 460 | Ga0207676_10046219 | 3300026095 | Bacteria | 3367 |
| 461 | Ga0207676_10230196 | 3300026095 | Bacteria | 1656 |
| 462 | Ga0207674_10000806 | 3300026116 | Bacteria | 40763 |
| 463 | Ga0207674_10071472 | 3300026116 | Bacteria | 3486 |
| 464 | Ga0207675_100000637 | 3300026118 | Bacteria | 34408 |
| 465 | Ga0207675_100022012 | 3300026118 | Bacteria | 5934 |
| 466 | Ga0207675_100141843 | 3300026118 | Bacteria | 2283 |
| 467 | Ga0207683_10000330 | 3300026121 | Bacteria | 43106 |
| 468 | Ga0207683_10004948 | 3300026121 | Bacteria | 11462 |
| 469 | Ga0207683_10027674 | 3300026121 | Bacteria | 4898 |
| 470 | Ga0207698_10003712 | 3300026142 | Bacteria | 9233 |
| 471 | Ga0207698_10609436 | 3300026142 | Bacteria | 1077 |
| 472 | Ga0209982_1024857 | 3300027552 | Bacteria | 930 |
| 473 | Ga0210002_1004342 | 3300027617 | Bacteria | 2107 |
| 474 | Ga0209971_1010514 | 3300027682 | Bacteria | 2192 |
| 475 | Ga0209998_10001194 | 3300027717 | Bacteria | 6412 |
| 476 | Ga0209974_10002570 | 3300027876 | Bacteria | 6593 |
| 477 | Ga0207428_10000164 | 3300027907 | Bacteria | 91968 |
| 478 | Ga0207428_10000815 | 3300027907 | Bacteria | 35204 |
| 479 | Ga0207428_10028987 | 3300027907 | Bacteria | 4593 |
| 480 | Ga0268266_10003098 | 3300028379 | Bacteria | 16939 |
| 481 | Ga0268266_10325574 | 3300028379 | Bacteria | 1439 |
| 482 | Ga0268265_10029530 | 3300028380 | Bacteria | 3936 |
| 483 | Ga0268264_10005408 | 3300028381 | Bacteria | 10815 |
| 484 | Ga0268264_10011667 | 3300028381 | Bacteria | 7245 |
| 485 | Ga0268264_10060114 | 3300028381 | Bacteria | 3185 |
| 486 | Ga0268264_10066354 | 3300028381 | Bacteria | 3043 |
| 487 | Ga0265337_1003126 | 3300028556 | Bacteria | 7295 |
| 488 | Ga0265338_10004795 | 3300028800 | Bacteria | 18074 |
| 489 | Ga0265338_10008257 | 3300028800 | Bacteria | 12676 |
| 490 | Ga0265330_10035525 | 3300031235 | Bacteria | 2223 |
| 491 | Ga0265325_10000474 | 3300031241 | Bacteria | 29121 |
| 492 | Ga0265325_10001518 | 3300031241 | Bacteria | 16310 |
| 493 | Ga0265325_10003355 | 3300031241 | Bacteria | 10511 |
| 494 | Ga0265325_10005419 | 3300031241 | Bacteria | 7873 |
| 495 | Ga0265325_10062342 | 3300031241 | Bacteria | 1889 |
| 496 | Ga0265325_10066896 | 3300031241 | Bacteria | 1811 |
| 497 | Ga0265325_10156220 | 3300031241 | Bacteria | 1076 |
| 498 | Ga0265340_10045716 | 3300031247 | Bacteria | 2137 |
| 499 | Ga0265339_10020454 | 3300031249 | Bacteria | 3866 |
| 500 | Ga0265316_10229918 | 3300031344 | Bacteria | 1366 |
| 501 | Ga0265316_10350671 | 3300031344 | Bacteria | 1068 |
| 502 | Ga0265313_10000251 | 3300031595 | Bacteria | 58545 |
| 503 | Ga0265313_10015134 | 3300031595 | Bacteria | 4514 |
| 504 | Ga0265313_10038015 | 3300031595 | Bacteria | 2401 |
| 505 | Ga0265313_10067483 | 3300031595 | Bacteria | 1654 |
| 506 | Ga0265314_10007418 | 3300031711 | Bacteria | 9510 |
| 507 | Ga0265314_10016261 | 3300031711 | Bacteria | 5886 |
| 508 | Ga0265314_10071938 | 3300031711 | Bacteria | 2312 |
| 509 | Ga0265342_10000321 | 3300031712 | Bacteria | 54074 |
| 510 | Ga0265342_10014775 | 3300031712 | Bacteria | 5171 |
| 511 | Ga0373930_0022536 | 3300034816 | Bacteria | 1246 |
| 512 | Ga0373950_0000743 | 3300034818 | Bacteria | 4051 |
| 513 | Ga0373958_0000470 | 3300034819 | Bacteria | 4945 |
| 514 | Ga0373958_0018017 | 3300034819 | Bacteria | 1276 |
| 515 | Ga0373959_0031410 | 3300034820 | Bacteria | 1074 |
| 516 | Ga0373938_0001451 | 3300034957 | Bacteria | 3794 |
| 517 | Ga0373926_0026193 | 3300035083 | Bacteria | 2038 |
| 518 | Ga0373928_0001031 | 3300035084 | Bacteria | 5485 |
| 519 | Ga0373928_0008518 | 3300035084 | Bacteria | 1992 |
| 520 | Ga0373929_0000454 | 3300035085 | Bacteria | 7780 |
| 521 | Ga0373929_0001366 | 3300035085 | Bacteria | 4674 |
| 522 | Ga0373929_0004285 | 3300035085 | Bacteria | 2561 |
| 523 | Ga0373934_0040680 | 3300035086 | Bacteria | 1834 |
| 524 | Ga0373940_0070103 | 3300035088 | Bacteria | 1019 |
| 525 | Ga0373949_0004409 | 3300035090 | Bacteria | 3230 |
| 526 | Ga0373951_0007587 | 3300035091 | Bacteria | 2462 |
| 527 | Ga0373951_0011872 | 3300035091 | Bacteria | 1958 |
| 528 | Ga0373951_0089852 | 3300035091 | Unclassified | 805 |
| 529 | Ga0373932_0002234 | 3300035112 | Bacteria | 4970 |
| 530 | Ga0373932_0004396 | 3300035112 | Bacteria | 3336 |
| 531 | Ga0373936_0009043 | 3300035113 | Bacteria | 3759 |
| 532 | Ga0373936_0014538 | 3300035113 | Bacteria | 3012 |
| 533 | Ga0373939_0002253 | 3300035114 | Bacteria | 4565 |
| 534 | Ga0373939_0014179 | 3300035114 | Bacteria | 2063 |
| 535 | Ga0373939_0030504 | 3300035114 | Bacteria | 1551 |
| 536 | Ga0373941_0008307 | 3300035115 | Bacteria | 2573 |
| 537 | Ga0373941_0009490 | 3300035115 | Bacteria | 2453 |
| 538 | Ga0373941_0062304 | 3300035115 | Bacteria | 1217 |
| 539 | Ga0373945_0020760 | 3300035116 | Bacteria | 2252 |
| 540 | Ga0373953_0052171 | 3300035117 | Bacteria | 1655 |
| 541 | Ga0373954_0038269 | 3300035118 | Bacteria | 2231 |
| 542 | Ga0373954_0081094 | 3300035118 | Bacteria | 1550 |
| 543 | Ga0373956_0075834 | 3300035119 | Bacteria | 1538 |
| 544 | Ga0373960_0008151 | 3300035121 | Bacteria | 2505 |
| 545 | Ga0373960_0023248 | 3300035121 | Bacteria | 1667 |
| 546 | Ga0373960_0033869 | 3300035121 | Bacteria | 1442 |
| 547 | Ga0373943_0040024 | 3300035170 | Bacteria | 2261 |
| 548 | Ga0373946_0007213 | 3300035171 | Bacteria | 4057 |
| 549 | Ga0373946_0015949 | 3300035171 | Bacteria | 2857 |
| 550 | Ga0373955_0015722 | 3300035172 | Bacteria | 3712 |
| 551 | Ga0373942_0001422 | 3300035207 | Bacteria | 6170 |
| 552 | Ga0373942_0010380 | 3300035207 | Bacteria | 2191 |
| 553 | Ga0373961_0005463 | 3300035241 | Bacteria | 3053 |
| 554 | Ga0373961_0026055 | 3300035241 | Bacteria | 1595 |
| 555 | Ga0373961_0088786 | 3300035241 | Bacteria | 984 |
| 556 | Ga0373962_0000508 | 3300035242 | Bacteria | 8667 |
| 557 | Ga0373962_0001559 | 3300035242 | Bacteria | 5437 |
| 558 | Ga0373962_0001607 | 3300035242 | Bacteria | 5363 |
| 559 | Ga0373924_0068203 | 3300035410 | Bacteria | 1497 |
| 560 | Ga0373931_0002659 | 3300035691 | Bacteria | 7949 |
| 561 | Ga0373931_0010579 | 3300035691 | Bacteria | 4436 |
| 562 | Ga0373931_0038830 | 3300035691 | Bacteria | 2492 |
| 563 | Ga0373931_0256913 | 3300035691 | Bacteria | 1064 |
| 564 | Ga0373935_0026597 | 3300035692 | Bacteria | 3573 |
| 565 | Ga0373935_0129704 | 3300035692 | Bacteria | 1693 |
| 566 | Ga0373935_0207252 | 3300035692 | Bacteria | 1357 |
| 567 | Ga0373927_0000755 | 3300035695 | Bacteria | 24701 |
| 568 | Ga0373927_0008778 | 3300035695 | Bacteria | 6792 |
| 569 | Ga0373927_0028473 | 3300035695 | Bacteria | 3644 |
| 570 | Ga0373927_0232028 | 3300035695 | Bacteria | 1213 |
| 571 | Ga0373933_0013479 | 3300035724 | Bacteria | 4532 |
| 572 | Ga0373933_0015863 | 3300035724 | Bacteria | 4205 |
| 573 | Ga0373933_0019168 | 3300035724 | Bacteria | 3859 |
| 574 | Ga0373933_0091510 | 3300035724 | Bacteria | 1877 |
| 575 | Ga0373933_0175147 | 3300035724 | Bacteria | 1366 |
| 576 | Ga0373947_0000280 | 3300035725 | Bacteria | 28900 |
| 577 | Ga0373947_0001444 | 3300035725 | Bacteria | 14616 |
| 578 | Ga0373947_0004394 | 3300035725 | Bacteria | 8267 |
| 579 | Ga0373947_0182370 | 3300035725 | Bacteria | 1367 |
| 580 | Ga0373947_0362426 | 3300035725 | Bacteria | 974 |
| 581 | Ga0373937_0000638 | 3300036401 | Bacteria | 30717 |
| 582 | Ga0373937_0011341 | 3300036401 | Bacteria | 7819 |
| 583 | Ga0373937_0018638 | 3300036401 | Bacteria | 6201 |
| 584 | Ga0373937_0022165 | 3300036401 | Bacteria | 5707 |
| 585 | Ga0373937_0026630 | 3300036401 | Bacteria | 5224 |
| 586 | Ga0373937_0088424 | 3300036401 | Bacteria | 2868 |
| 587 | Ga0373937_0224537 | 3300036401 | Bacteria | 1768 |
| 588 | Ga0373925_0001680 | 3300037068 | Bacteria | 18618 |
| 589 | Ga0373925_0001685 | 3300037068 | Bacteria | 18592 |
| 590 | Ga0373925_0094854 | 3300037068 | Bacteria | 2285 |
| 591 | Ga0373925_0241991 | 3300037068 | Bacteria | 1445 |
| 592 | Ga0395899_0014949 | 3300037312 | Bacteria | 5920 |
| 593 | Ga0395899_0047001 | 3300037312 | Bacteria | 3214 |
| 594 | Ga0395900_0005653 | 3300037418 | Bacteria | 13077 |
| 595 | Ga0395900_0010121 | 3300037418 | Bacteria | 9645 |
| 596 | Ga0395900_0030631 | 3300037418 | Bacteria | 5525 |
| 597 | Ga0395900_0188644 | 3300037418 | Bacteria | 2092 |
| 598 | Ga0395898_0007938 | 3300037466 | Bacteria | 11260 |
| 599 | Ga0395898_0024721 | 3300037466 | Bacteria | 6056 |
| 600 | Ga0395898_0136209 | 3300037466 | Unclassified | 2351 |
| 601 | Ga0395905_0132996 | 3300037471 | Bacteria | 2340 |
| 602 | Ga0395905_0203644 | 3300037471 | Bacteria | 1855 |
| 603 | Ga0395901_0014282 | 3300038443 | Bacteria | 8084 |
| 604 | Ga0395901_0019396 | 3300038443 | Bacteria | 6953 |
| 605 | Ga0395901_0122316 | 3300038443 | Unclassified | 2735 |
| 606 | Ga0395901_0730518 | 3300038443 | Bacteria | 985 |
| 607 | Ga0436365_0583672 | 3300039437 | Bacteria | 1481 |
| 608 | Ga0439448_0119386 | 3300042005 | Bacteria | 904 |
| 609 | Ga0439444_0006674 | 3300042437 | Unclassified | 1751 |
| 610 | Ga0439464_0031250 | 3300042439 | Unclassified | 1494 |
| 611 | Ga0466966_0160390 | 3300044684 | Bacteria | 1369 |
| 612 | Ga0466961_0083853 | 3300044693 | Bacteria | 2016 |
| 613 | Ga0466963_0113375 | 3300044694 | Bacteria | 1862 |
| 614 | Ga0466971_0111305 | 3300044719 | Bacteria | 1264 |
| 615 | Ga0466957_0013670 | 3300044842 | Bacteria | 4713 |
| 616 | Ga0466957_0140114 | 3300044842 | Bacteria | 1557 |
| 617 | Ga0466959_0061748 | 3300045049 | Bacteria | 2725 |
| 618 | Ga0451576_0335539 | 3300045051 | Bacteria | 1582 |
| 619 | Ga0466958_0012989 | 3300045836 | Bacteria | 4731 |
| 620 | Ga0466958_0040988 | 3300045836 | Bacteria | 2784 |
| 621 | Ga0466967_0123342 | 3300045976 | Bacteria | 2397 |
| 622 | Ga0495592_0007395 | 3300046454 | Bacteria | 8220 |
| 623 | Ga0495592_0041123 | 3300046454 | Bacteria | 3465 |
| 624 | Ga0495592_0181371 | 3300046454 | Bacteria | 1434 |
| 625 | Ga0495603_0095348 | 3300046455 | Bacteria | 1738 |
| 626 | Ga0495629_0006959 | 3300046459 | Bacteria | 8343 |
| 627 | Ga0495629_0021267 | 3300046459 | Bacteria | 4629 |
| 628 | Ga0495629_0056626 | 3300046459 | Bacteria | 2741 |
| 629 | Ga0495629_0077627 | 3300046459 | Bacteria | 2318 |
| 630 | Ga0495641_0029079 | 3300046461 | Bacteria | 2666 |
| 631 | Ga0495641_0033581 | 3300046461 | Bacteria | 2434 |
| 632 | Ga0495651_0024292 | 3300046462 | Bacteria | 4717 |
| 633 | Ga0495651_0025083 | 3300046462 | Bacteria | 4639 |
| 634 | Ga0495651_0025567 | 3300046462 | Bacteria | 4597 |
| 635 | Ga0495651_0052129 | 3300046462 | Bacteria | 3152 |
| 636 | Ga0495653_0021634 | 3300046463 | Bacteria | 5209 |
| 637 | Ga0495653_0055985 | 3300046463 | Bacteria | 3008 |
| 638 | Ga0495580_0200889 | 3300046472 | Bacteria | 1373 |
| 639 | Ga0495582_0001012 | 3300046473 | Bacteria | 15762 |
| 640 | Ga0495639_0008822 | 3300046475 | Bacteria | 4325 |
| 641 | Ga0495639_0011150 | 3300046475 | Bacteria | 3871 |
| 642 | Ga0495639_0096103 | 3300046475 | Bacteria | 1395 |
| 643 | Ga0495662_0004427 | 3300046476 | Bacteria | 7051 |
| 644 | Ga0495662_0004939 | 3300046476 | Bacteria | 6673 |
| 645 | Ga0495664_0000142 | 3300046477 | Bacteria | 35911 |
| 646 | Ga0495664_0051587 | 3300046477 | Bacteria | 2442 |
| 647 | Ga0495664_0113787 | 3300046477 | Unclassified | 1634 |
| 648 | Ga0495594_0017400 | 3300046499 | Bacteria | 3798 |
| 649 | Ga0495594_0087375 | 3300046499 | Bacteria | 1745 |
| 650 | Ga0495608_0000890 | 3300046511 | Bacteria | 20925 |
| 651 | Ga0495608_0007116 | 3300046511 | Bacteria | 7914 |
| 652 | Ga0495608_0036752 | 3300046511 | Bacteria | 3296 |
| 653 | Ga0495608_0092521 | 3300046511 | Unclassified | 1954 |
| 654 | Ga0495608_0107436 | 3300046511 | Bacteria | 1796 |
| 655 | Ga0495618_0004574 | 3300046514 | Bacteria | 8487 |
| 656 | Ga0495618_0008801 | 3300046514 | Bacteria | 6095 |
| 657 | Ga0495618_0075296 | 3300046514 | Bacteria | 2150 |
| 658 | Ga0495628_0001326 | 3300046516 | Bacteria | 22701 |
| 659 | Ga0495628_0019247 | 3300046516 | Bacteria | 5646 |
| 660 | Ga0495630_0008519 | 3300046517 | Bacteria | 7361 |
| 661 | Ga0495652_0016089 | 3300046529 | Bacteria | 6691 |
| 662 | Ga0495652_0034110 | 3300046529 | Bacteria | 4437 |
| 663 | Ga0495652_0042653 | 3300046529 | Bacteria | 3911 |
| 664 | Ga0495652_0127068 | 3300046529 | Bacteria | 2024 |
| 665 | Ga0495652_0208525 | 3300046529 | Bacteria | 1477 |
| 666 | Ga0495665_0065393 | 3300046531 | Unclassified | 1919 |
| 667 | Ga0495640_0021107 | 3300046533 | Bacteria | 4786 |
| 668 | Ga0495640_0023436 | 3300046533 | Bacteria | 4496 |
| 669 | Ga0495640_0074445 | 3300046533 | Bacteria | 2271 |
| 670 | Ga0495640_0198046 | 3300046533 | Bacteria | 1274 |
| 671 | Ga0495587_0002800 | 3300046536 | Bacteria | 11657 |
| 672 | Ga0495587_0010617 | 3300046536 | Bacteria | 5851 |
| 673 | Ga0495645_0003190 | 3300046543 | Bacteria | 11112 |
| 674 | Ga0495645_0006461 | 3300046543 | Bacteria | 8134 |
| 675 | Ga0495645_0038315 | 3300046543 | Bacteria | 3496 |
| 676 | Ga0495667_0003101 | 3300046559 | Bacteria | 11146 |
| 677 | Ga0495667_0006161 | 3300046559 | Bacteria | 8123 |
| 678 | Ga0495634_0014591 | 3300046642 | Bacteria | 5660 |
| 679 | Ga0495634_0030445 | 3300046642 | Bacteria | 3727 |
| 680 | Ga0495634_0036439 | 3300046642 | Bacteria | 3365 |
| 681 | Ga0495634_0078321 | 3300046642 | Bacteria | 2165 |
| 682 | Ga0495635_0001521 | 3300046663 | Bacteria | 15539 |
| 683 | Ga0495635_0003053 | 3300046663 | Bacteria | 11507 |
| 684 | Ga0495635_0042556 | 3300046663 | Bacteria | 3136 |
| 685 | Ga0495635_0045531 | 3300046663 | Bacteria | 3028 |
| 686 | Ga0495635_0117622 | 3300046663 | Bacteria | 1814 |
| 687 | Ga0495588_0056472 | 3300046674 | Bacteria | 2027 |
| 688 | Ga0495657_0010806 | 3300046675 | Bacteria | 6856 |
| 689 | Ga0495657_0062234 | 3300046675 | Bacteria | 2466 |
| 690 | Ga0495657_0074092 | 3300046675 | Bacteria | 2216 |
| 691 | Ga0495657_0146741 | 3300046675 | Bacteria | 1467 |
| 692 | Ga0495599_0002450 | 3300046678 | Bacteria | 10814 |
| 693 | Ga0495599_0069359 | 3300046678 | Bacteria | 2200 |
| 694 | Ga0495623_0012154 | 3300046679 | Bacteria | 5578 |
| 695 | Ga0495646_0018416 | 3300046680 | Bacteria | 4423 |
| 696 | Ga0495646_0098846 | 3300046680 | Bacteria | 1675 |
| 697 | Ga0495646_0228983 | 3300046680 | Bacteria | 1002 |
| 698 | Ga0495647_0026191 | 3300046681 | Bacteria | 2134 |
| 699 | Ga0495647_0039863 | 3300046681 | Bacteria | 1782 |
| 700 | Ga0495658_0001393 | 3300046683 | Bacteria | 12686 |
| 701 | Ga0495658_0006997 | 3300046683 | Bacteria | 5565 |
| 702 | Ga0495658_0007101 | 3300046683 | Bacteria | 5532 |
| 703 | Ga0495658_0039547 | 3300046683 | Bacteria | 2617 |
| 704 | Ga0495613_0046256 | 3300046689 | Bacteria | 3218 |
| 705 | Ga0495613_0064268 | 3300046689 | Bacteria | 2684 |
| 706 | Ga0495613_0134523 | 3300046689 | Bacteria | 1769 |
| 707 | Ga0495624_0003675 | 3300046690 | Bacteria | 11335 |
| 708 | Ga0495600_0006458 | 3300046809 | Bacteria | 7140 |
| 709 | Ga0495600_0016856 | 3300046809 | Bacteria | 4644 |
| 710 | Ga0495600_0065329 | 3300046809 | Bacteria | 2379 |
| 711 | Ga0495600_0113886 | 3300046809 | Bacteria | 1761 |
| 712 | Ga0495581_0009511 | 3300047315 | Bacteria | 5625 |
| 713 | Ga0495581_0024911 | 3300047315 | Bacteria | 3466 |
| 714 | Ga0495581_0113186 | 3300047315 | Bacteria | 1578 |
| 715 | Ga0495604_0008196 | 3300047317 | Bacteria | 8267 |
| 716 | Ga0495604_0014298 | 3300047317 | Bacteria | 6328 |
| 717 | Ga0495604_0051376 | 3300047317 | Bacteria | 3196 |
| 718 | Ga0495674_0009624 | 3300047319 | Bacteria | 9181 |
| 719 | Ga0495674_0037656 | 3300047319 | Bacteria | 4346 |
| 720 | Ga0495674_0049606 | 3300047319 | Bacteria | 3708 |
| 721 | Ga0495674_0072205 | 3300047319 | Bacteria | 2977 |
| 722 | Ga0495674_0078136 | 3300047319 | Bacteria | 2844 |
| 723 | Ga0495674_0078820 | 3300047319 | Bacteria | 2830 |
| 724 | Ga0495674_0114264 | 3300047319 | Bacteria | 2286 |
| 725 | Ga0495676_0014561 | 3300047321 | Bacteria | 7037 |
| 726 | Ga0495676_0056886 | 3300047321 | Bacteria | 3090 |
| 727 | Ga0495676_0058280 | 3300047321 | Unclassified | 3039 |
| 728 | Ga0495676_0157485 | 3300047321 | Bacteria | 1610 |
| 729 | Ga0495680_0002550 | 3300047322 | Bacteria | 18591 |
| 730 | Ga0495680_0003862 | 3300047322 | Bacteria | 14507 |
| 731 | Ga0495680_0005190 | 3300047322 | Bacteria | 12288 |
| 732 | Ga0495680_0022019 | 3300047322 | Bacteria | 5323 |
| 733 | Ga0495680_0201533 | 3300047322 | Bacteria | 1427 |
| 734 | Ga0495675_0001936 | 3300047444 | Bacteria | 12346 |
| 735 | Ga0495675_0038166 | 3300047444 | Bacteria | 3059 |
| 736 | Ga0495684_0000825 | 3300047471 | Bacteria | 25064 |
| 737 | Ga0495593_0009164 | 3300047673 | Bacteria | 5738 |
| 738 | Ga0495602_0000557 | 3300048088 | Bacteria | 34744 |
| 739 | Ga0495602_0006781 | 3300048088 | Bacteria | 12021 |
| 740 | Ga0495602_0048936 | 3300048088 | Bacteria | 3792 |
| 741 | Ga0495602_0118618 | 3300048088 | Bacteria | 2134 |
| 742 | Ga0496100_0001536 | 3300048903 | Bacteria | 11327 |
| 743 | Ga0496100_0025862 | 3300048903 | Bacteria | 3592 |
| 744 | Ga0496100_0080887 | 3300048903 | Bacteria | 2193 |
| 745 | Ga0496101_0003663 | 3300048904 | Bacteria | 9587 |
| 746 | Ga0496101_0040181 | 3300048904 | Bacteria | 3331 |
| 747 | Ga0496101_0206108 | 3300048904 | Bacteria | 1522 |
| 748 | Ga0496102_0009528 | 3300048905 | Bacteria | 8349 |
| 749 | Ga0496102_0047873 | 3300048905 | Bacteria | 3887 |
| 750 | Ga0496102_0057142 | 3300048905 | Bacteria | 3561 |
| 751 | Ga0496102_0064445 | 3300048905 | Bacteria | 3356 |
| 752 | Ga0496102_0167467 | 3300048905 | Bacteria | 2068 |
| 753 | Ga0496103_0002198 | 3300048906 | Bacteria | 12364 |
| 754 | Ga0496103_0053084 | 3300048906 | Bacteria | 2512 |
| 755 | Ga0496104_0001510 | 3300048907 | Bacteria | 20080 |
| 756 | Ga0496104_0069971 | 3300048907 | Bacteria | 3336 |
| 757 | Ga0496104_0380997 | 3300048907 | Bacteria | 1323 |
| 758 | Ga0496104_0581024 | 3300048907 | Bacteria | 1031 |
| 759 | Ga0496105_0169121 | 3300048908 | Bacteria | 1792 |
| 760 | Ga0496105_0177188 | 3300048908 | Bacteria | 1746 |
| 761 | Ga0496105_0384982 | 3300048908 | Bacteria | 1115 |
| 762 | Ga0496105_0467075 | 3300048908 | Bacteria | 994 |
| 763 | Ga0496106_0003156 | 3300048909 | Bacteria | 12301 |
| 764 | Ga0496107_0013279 | 3300048910 | Bacteria | 5756 |
| 765 | Ga0496107_0015892 | 3300048910 | Bacteria | 5280 |
| 766 | Ga0496107_0076900 | 3300048910 | Bacteria | 2431 |
| 767 | Ga0496107_0113263 | 3300048910 | Bacteria | 1995 |
| 768 | Ga0496107_0336677 | 3300048910 | Bacteria | 1123 |
| 769 | Ga0496108_0010429 | 3300048911 | Bacteria | 7545 |
| 770 | Ga0496108_0022171 | 3300048911 | Bacteria | 5221 |
| 771 | Ga0496108_0718223 | 3300048911 | Bacteria | 866 |
| 772 | Ga0496109_0001830 | 3300048912 | Bacteria | 17639 |
| 773 | Ga0496109_0029186 | 3300048912 | Bacteria | 4939 |
| 774 | Ga0496109_0162424 | 3300048912 | Bacteria | 2093 |
| 775 | Ga0496109_0609158 | 3300048912 | Bacteria | 1028 |
| 776 | Ga0496110_0011657 | 3300048913 | Bacteria | 7207 |
| 777 | Ga0496110_0140912 | 3300048913 | Bacteria | 2180 |
| 778 | Ga0496110_0459960 | 3300048913 | Bacteria | 1159 |
| 779 | Ga0496111_0003917 | 3300048914 | Bacteria | 9330 |
| 780 | Ga0496111_0016641 | 3300048914 | Bacteria | 5070 |
| 781 | Ga0496112_0020297 | 3300048915 | Bacteria | 6294 |
| 782 | Ga0496113_0014156 | 3300048916 | Bacteria | 5432 |
| 783 | Ga0496113_0051395 | 3300048916 | Bacteria | 3076 |
| 784 | Ga0496113_0125007 | 3300048916 | Bacteria | 2013 |
| 785 | Ga0496113_0301715 | 3300048916 | Bacteria | 1282 |
| 786 | Ga0496113_0406480 | 3300048916 | Bacteria | 1093 |
| 787 | Ga0496114_0003256 | 3300048917 | Bacteria | 12462 |
| 788 | Ga0496114_0006422 | 3300048917 | Bacteria | 9258 |
| 789 | Ga0496114_0024627 | 3300048917 | Bacteria | 4913 |
| 790 | Ga0496114_0080685 | 3300048917 | Bacteria | 2747 |
| 791 | Ga0496115_0007434 | 3300048918 | Bacteria | 8061 |
| 792 | Ga0496115_0024141 | 3300048918 | Bacteria | 4724 |
| 793 | Ga0496115_0140356 | 3300048918 | Bacteria | 1993 |
| 794 | Ga0496115_0399410 | 3300048918 | Bacteria | 1115 |
| 795 | Ga0496126_0016363 | 3300048929 | Bacteria | 7420 |
| 796 | Ga0501031_0009007 | 3300049568 | Bacteria | 6495 |
| 797 | Ga0501032_0008203 | 3300049569 | Bacteria | 7612 |
| 798 | Ga0501032_0085558 | 3300049569 | Bacteria | 2096 |
| 799 | Ga0501033_0002756 | 3300049570 | Bacteria | 14722 |
| 800 | Ga0501034_0003212 | 3300049571 | Bacteria | 18732 |
| 801 | Ga0501034_0020441 | 3300049571 | Bacteria | 6760 |
| 802 | Ga0501034_0392728 | 3300049571 | Bacteria | 1311 |
| 803 | Ga0501034_0538010 | 3300049571 | Bacteria | 1078 |
| 804 | Ga0501036_0001549 | 3300049572 | Bacteria | 17772 |
| 805 | Ga0501037_0001941 | 3300049573 | Bacteria | 14964 |
| 806 | Ga0501037_0091349 | 3300049573 | Bacteria | 2202 |
| 807 | Ga0501038_0007422 | 3300049574 | Bacteria | 10116 |
| 808 | Ga0501038_0165033 | 3300049574 | Bacteria | 1797 |
| 809 | Ga0501038_0324056 | 3300049574 | Bacteria | 1205 |
| 810 | Ga0501039_0019836 | 3300049575 | Bacteria | 5153 |
| 811 | Ga0501039_0431439 | 3300049575 | Bacteria | 1035 |
| 812 | Ga0501043_0006170 | 3300049579 | Bacteria | 9626 |
| 813 | Ga0501046_0003854 | 3300049580 | Bacteria | 13721 |
| 814 | Ga0501047_0075851 | 3300049581 | Bacteria | 3235 |
| 815 | Ga0501047_0154330 | 3300049581 | Bacteria | 2170 |
| 816 | Ga0501048_0003364 | 3300049582 | Bacteria | 12161 |
| 817 | Ga0501048_0313013 | 3300049582 | Bacteria | 1118 |
| 818 | Ga0501067_0017214 | 3300049583 | Bacteria | 3995 |
| 819 | Ga0501068_0293072 | 3300049584 | Bacteria | 1041 |
| 820 | Ga0501069_0001642 | 3300049585 | Bacteria | 11103 |
| 821 | Ga0501069_0035480 | 3300049585 | Bacteria | 2748 |
| 822 | Ga0501069_0260584 | 3300049585 | Bacteria | 1012 |
| 823 | Ga0501070_0017501 | 3300049586 | Bacteria | 6016 |
| 824 | Ga0501070_0018859 | 3300049586 | Bacteria | 5787 |
| 825 | Ga0501070_0089422 | 3300049586 | Bacteria | 2548 |
| 826 | Ga0501070_0119679 | 3300049586 | Bacteria | 2176 |
| 827 | Ga0501070_0286600 | 3300049586 | Bacteria | 1343 |
| 828 | Ga0501070_0485513 | 3300049586 | Bacteria | 993 |
| 829 | Ga0501072_0018965 | 3300049588 | Bacteria | 5310 |
| 830 | Ga0501072_0091811 | 3300049588 | Bacteria | 2411 |
| 831 | Ga0501073_0011148 | 3300049589 | Bacteria | 6573 |
| 832 | Ga0501073_0182783 | 3300049589 | Bacteria | 1451 |
| 833 | Ga0501074_0005415 | 3300049590 | Bacteria | 9182 |
| 834 | Ga0501074_0118145 | 3300049590 | Bacteria | 1897 |
| 835 | Ga0501075_0092855 | 3300049591 | Bacteria | 2291 |
| 836 | Ga0501076_0247579 | 3300049592 | Bacteria | 1458 |
| 837 | Ga0501077_0125185 | 3300049593 | Bacteria | 1629 |
| 838 | Ga0501079_0476957 | 3300049741 | Bacteria | 980 |
| 839 | Ga0501080_0013428 | 3300049742 | Bacteria | 7535 |
| 840 | Ga0501080_0145493 | 3300049742 | Bacteria | 2191 |
| 841 | Ga0501080_0358848 | 3300049742 | Bacteria | 1315 |
| 842 | Ga0501083_0003165 | 3300049744 | Bacteria | 11456 |
| 843 | Ga0501083_0020293 | 3300049744 | Bacteria | 4624 |
| 844 | Ga0501083_0042163 | 3300049744 | Bacteria | 3095 |
| 845 | Ga0501083_0072513 | 3300049744 | Bacteria | 2289 |
| 846 | Ga0501035_0001156 | 3300049822 | Bacteria | 27546 |
| 847 | Ga0501035_0091047 | 3300049822 | Bacteria | 2684 |
| 848 | Ga0501044_0035396 | 3300049823 | Bacteria | 5228 |
| 849 | Ga0501044_0087078 | 3300049823 | Bacteria | 3155 |
| 850 | Ga0501044_0107087 | 3300049823 | Bacteria | 2807 |
| 851 | Ga0501044_0112450 | 3300049823 | Bacteria | 2730 |
| 852 | Ga0501045_0371417 | 3300049824 | Bacteria | 1064 |
| 853 | nmdc:mga00v17_21508_c1 | 3300050491 | Bacteria | 3709 |
| 854 | nmdc:mga0yw44_10119_c1 | 3300050492 | Bacteria | 4804 |
| 855 | nmdc:mga0yw44_19226_c1 | 3300050492 | Bacteria | 3761 |
| 856 | nmdc:mga06z11_59567_c1 | 3300050494 | Bacteria | 1985 |
| 857 | nmdc:mga04h51_12828_c1 | 3300050495 | Bacteria | 2361 |
| 858 | nmdc:mga05p37_151_c1 | 3300050507 | Bacteria | 65585 |
| 859 | nmdc:mga05p37_26718_c1 | 3300050507 | Bacteria | 7020 |
| 860 | nmdc:mga09592_2557_c1 | 3300050508 | Bacteria | 14723 |
| 861 | nmdc:mga0qj67_2949_c1 | 3300050509 | Bacteria | 12202 |
| 862 | nmdc:mga06r32_592_c1 | 3300050510 | Bacteria | 31540 |
| 863 | nmdc:mga08y16_108_c1 | 3300050511 | Bacteria | 69804 |
| 864 | nmdc:mga08y16_17668_c1 | 3300050511 | Bacteria | 7514 |
| 865 | nmdc:mga0n895_107446_c1 | 3300050512 | Bacteria | 2804 |
| 866 | nmdc:mga0n895_337_c1 | 3300050512 | Bacteria | 31380 |
| 867 | nmdc:mga0n895_37367_c1 | 3300050512 | Bacteria | 4697 |
| 868 | nmdc:mga0n895_406_c1 | 3300050512 | Bacteria | 28847 |
| 869 | nmdc:mga0rr50_110886_c1 | 3300050513 | Bacteria | 2171 |
| 870 | nmdc:mga0rr50_1965_c1 | 3300050513 | Bacteria | 11416 |
| 871 | nmdc:mga0rr50_43524_c1 | 3300050513 | Bacteria | 3287 |
| 872 | nmdc:mga08x19_222292_c1 | 3300050514 | Bacteria | 1298 |
| 873 | nmdc:mga0a205_197136_c1 | 3300050515 | Bacteria | 1904 |
| 874 | nmdc:mga0a205_2351_c1 | 3300050515 | Bacteria | 16691 |
| 875 | nmdc:mga0a205_277689_c1 | 3300050515 | Bacteria | 1551 |
| 876 | nmdc:mga0a205_3783_c1 | 3300050515 | Bacteria | 13548 |
| 877 | nmdc:mga0a205_65337_c2 | 3300050515 | Bacteria | 3082 |
| 878 | nmdc:mga0a205_89700_c2 | 3300050515 | Bacteria | 2141 |
| 879 | Ga0495601_0000620 | 3300053077 | Bacteria | 18909 |
| 880 | Ga0495601_0001180 | 3300053077 | Bacteria | 14281 |
| 881 | Ga0495601_0008334 | 3300053077 | Bacteria | 6120 |
| 882 | Ga0495601_0008578 | 3300053077 | Bacteria | 6038 |
| 883 | Ga0495601_0014203 | 3300053077 | Bacteria | 4799 |
| 884 | Ga0495601_0014668 | 3300053077 | Bacteria | 4725 |
| 885 | Ga0495601_0097942 | 3300053077 | Bacteria | 1892 |
| 886 | Ga0495601_0196715 | 3300053077 | Bacteria | 1318 |
| 887 | Ga0495612_0000683 | 3300053078 | Bacteria | 13678 |
| 888 | Ga0495612_0004892 | 3300053078 | Bacteria | 5542 |
| 889 | Ga0495612_0016524 | 3300053078 | Bacteria | 2956 |
| 890 | Ga0495595_0000357 | 3300053084 | Bacteria | 17350 |
| 891 | Ga0495595_0000749 | 3300053084 | Bacteria | 12324 |
| 892 | Ga0495595_0002379 | 3300053084 | Bacteria | 7334 |
| 893 | Ga0495595_0013757 | 3300053084 | Bacteria | 3423 |
| 894 | Ga0495595_0018125 | 3300053084 | Bacteria | 3039 |
| 895 | Ga0495595_0022224 | 3300053084 | Bacteria | 2782 |
| 896 | Ga0495619_0000048 | 3300053085 | Bacteria | 102117 |
| 897 | Ga0495619_0000256 | 3300053085 | Bacteria | 38697 |
| 898 | Ga0495619_0000663 | 3300053085 | Bacteria | 22537 |
| 899 | Ga0495619_0008411 | 3300053085 | Bacteria | 6527 |
| 900 | Ga0495619_0010178 | 3300053085 | Bacteria | 5924 |
| 901 | Ga0495619_0013279 | 3300053085 | Bacteria | 5190 |
| 902 | Ga0495619_0023342 | 3300053085 | Bacteria | 3965 |
| 903 | Ga0495619_0023705 | 3300053085 | Bacteria | 3934 |
| 904 | Ga0500643_001301 | 3300053087 | Bacteria | 14696 |
| 905 | Ga0500644_0005965 | 3300053088 | Bacteria | 3099 |
| 906 | Ga0500651_0077762 | 3300053093 | Bacteria | 2059 |
| 907 | Ga0500650_0013749 | 3300053098 | Bacteria | 3404 |
| 908 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 909 | Ga0500577_0123562 | 3300053142 | Bacteria | 1079 |
| 910 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 911 | Ga0500645_000217 | 3300053730 | Bacteria | 43911 |
| 912 | Ga0501082_0070012 | 3300060353 | Bacteria | 3021 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035091 | Ga0373951_0089852 | Ga0373951_0089852_46_789 | 237 |
| 2 | 3300048908 | Ga0496105_0384982 | Ga0496105_0384982_349_1092 | 237 |
| 3 | 3300048918 | Ga0496115_0140356 | Ga0496115_0140356_1227_1970 | 237 |
| 4 | 3300048929 | Ga0496126_0016363 | Ga0496126_0016363_2560_3423 | 237 |
| 5 | 3300049581 | Ga0501047_0154330 | Ga0501047_0154330_253_1107 | 238 |
| 6 | 3300048911 | Ga0496108_0022171 | Ga0496108_0022171_4420_5199 | 244 |
| 7 | 3300028800 | Ga0265338_10008257 | Ga0265338_100082573 | 246 |
| 8 | 3300031235 | Ga0265330_10035525 | Ga0265330_100355252 | 246 |
| 9 | 3300031241 | Ga0265325_10156220 | Ga0265325_101562202 | 246 |
| 10 | 3300031712 | Ga0265342_10014775 | Ga0265342_100147754 | 246 |
| 11 | 3300038443 | Ga0395901_0730518 | Ga0395901_0730518_106_969 | 246 |
| 12 | 3300005336 | Ga0070680_100233548 | Ga0070680_1002335481 | 247 |
| 13 | 3300005337 | Ga0070682_100178814 | Ga0070682_1001788141 | 247 |
| 14 | 3300042005 | Ga0439448_0119386 | Ga0439448_0119386_149_892 | 247 |
| 15 | 3300053077 | Ga0495601_0196715 | Ga0495601_0196715_10_777 | 247 |
| 16 | 3300035724 | Ga0373933_0013479 | Ga0373933_0013479_3131_3994 | 248 |
| 17 | 3300037312 | Ga0395899_0014949 | Ga0395899_0014949_482_1354 | 248 |
| 18 | 3300037312 | Ga0395899_0047001 | Ga0395899_0047001_806_1678 | 248 |
| 19 | 3300037418 | Ga0395900_0005653 | Ga0395900_0005653_9406_10278 | 248 |
| 20 | 3300037418 | Ga0395900_0010121 | Ga0395900_0010121_8260_9132 | 248 |
| 21 | 3300037418 | Ga0395900_0188644 | Ga0395900_0188644_444_1316 | 248 |
| 22 | 3300037466 | Ga0395898_0007938 | Ga0395898_0007938_4213_5085 | 248 |
| 23 | 3300037466 | Ga0395898_0136209 | Ga0395898_0136209_1003_1875 | 248 |
| 24 | 3300038443 | Ga0395901_0019396 | Ga0395901_0019396_1795_2667 | 248 |
| 25 | 3300038443 | Ga0395901_0122316 | Ga0395901_0122316_600_1472 | 248 |
| 26 | 3300035170 | Ga0373943_0040024 | Ga0373943_0040024_20_799 | 249 |
| 27 | 3300046531 | Ga0495665_0065393 | Ga0495665_0065393_23_802 | 249 |
| 28 | 3300048910 | Ga0496107_0113263 | Ga0496107_0113263_963_1826 | 249 |
| 29 | 3300048913 | Ga0496110_0459960 | Ga0496110_0459960_16_795 | 249 |
| 30 | 3300005530 | Ga0070679_100594616 | Ga0070679_1005946161 | 250 |
| 31 | 3300036401 | Ga0373937_0224537 | Ga0373937_0224537_529_1392 | 250 |
| 32 | 3300049584 | Ga0501068_0293072 | Ga0501068_0293072_250_1029 | 251 |
| 33 | 3300050492 | nmdc:mga0yw44_19226_c1 | nmdc:mga0yw44_19226_c1_1666_2544 | 252 |
| 34 | 3300053084 | Ga0495595_0018125 | Ga0495595_0018125_368_1231 | 255 |
| 35 | 3300053085 | Ga0495619_0010178 | Ga0495619_0010178_3239_4102 | 255 |
| 36 | 3300035113 | Ga0373936_0014538 | Ga0373936_0014538_635_1495 | 256 |
| 37 | 3300037471 | Ga0395905_0203644 | Ga0395905_0203644_948_1808 | 256 |
| 38 | 3300049571 | Ga0501034_0020441 | Ga0501034_0020441_2511_3383 | 257 |
| 39 | 3300049586 | Ga0501070_0286600 | Ga0501070_0286600_140_1012 | 257 |
| 40 | 3300037471 | Ga0395905_0132996 | Ga0395905_0132996_586_1446 | 259 |
| 41 | 3300048911 | Ga0496108_0718223 | Ga0496108_0718223_10_789 | 259 |
| 42 | 3300035242 | Ga0373962_0001607 | Ga0373962_0001607_1994_2854 | 261 |
| 43 | 3300035083 | Ga0373926_0026193 | Ga0373926_0026193_290_1162 | 262 |
| 44 | 3300035113 | Ga0373936_0009043 | Ga0373936_0009043_309_1181 | 262 |
| 45 | 3300035116 | Ga0373945_0020760 | Ga0373945_0020760_723_1595 | 262 |
| 46 | 3300035695 | Ga0373927_0000755 | Ga0373927_0000755_4803_5675 | 262 |
| 47 | 3300035725 | Ga0373947_0001444 | Ga0373947_0001444_4832_5704 | 262 |
| 48 | 3300037068 | Ga0373925_0001685 | Ga0373925_0001685_4967_5839 | 262 |
| 49 | 3300046459 | Ga0495629_0077627 | Ga0495629_0077627_869_1741 | 262 |
| 50 | 3300046463 | Ga0495653_0021634 | Ga0495653_0021634_2709_3581 | 262 |
| 51 | 3300046472 | Ga0495580_0200889 | Ga0495580_0200889_378_1250 | 262 |
| 52 | 3300046476 | Ga0495662_0004427 | Ga0495662_0004427_1279_2151 | 262 |
| 53 | 3300046477 | Ga0495664_0000142 | Ga0495664_0000142_30705_31577 | 262 |
| 54 | 3300046514 | Ga0495618_0008801 | Ga0495618_0008801_4475_5347 | 262 |
| 55 | 3300046529 | Ga0495652_0016089 | Ga0495652_0016089_82_954 | 262 |
| 56 | 3300046533 | Ga0495640_0021107 | Ga0495640_0021107_2863_3735 | 262 |
| 57 | 3300046543 | Ga0495645_0038315 | Ga0495645_0038315_2463_3335 | 262 |
| 58 | 3300046642 | Ga0495634_0014591 | Ga0495634_0014591_131_1003 | 262 |
| 59 | 3300046663 | Ga0495635_0001521 | Ga0495635_0001521_3888_4760 | 262 |
| 60 | 3300046680 | Ga0495646_0228983 | Ga0495646_0228983_115_987 | 262 |
| 61 | 3300046683 | Ga0495658_0039547 | Ga0495658_0039547_1303_2175 | 262 |
| 62 | 3300046689 | Ga0495613_0134523 | Ga0495613_0134523_558_1430 | 262 |
| 63 | 3300046690 | Ga0495624_0003675 | Ga0495624_0003675_5622_6494 | 262 |
| 64 | 3300047315 | Ga0495581_0009511 | Ga0495581_0009511_2745_3617 | 262 |
| 65 | 3300047319 | Ga0495674_0009624 | Ga0495674_0009624_487_1359 | 262 |
| 66 | 3300047321 | Ga0495676_0056886 | Ga0495676_0056886_1092_1964 | 262 |
| 67 | 3300047322 | Ga0495680_0201533 | Ga0495680_0201533_95_967 | 262 |
| 68 | 3300053077 | Ga0495601_0008334 | Ga0495601_0008334_487_1359 | 262 |
| 69 | 3300053078 | Ga0495612_0016524 | Ga0495612_0016524_2062_2934 | 262 |
| 70 | 3300053085 | Ga0495619_0000663 | Ga0495619_0000663_515_1387 | 262 |
| 71 | 3300006237 | Ga0097621_100170040 | Ga0097621_1001700402 | 263 |
| 72 | 3300026078 | Ga0207702_10187011 | Ga0207702_101870112 | 263 |
| 73 | 3300028800 | Ga0265338_10004795 | Ga0265338_1000479513 | 263 |
| 74 | 3300046475 | Ga0495639_0096103 | Ga0495639_0096103_23_886 | 263 |
| 75 | 3300046642 | Ga0495634_0036439 | Ga0495634_0036439_394_1266 | 263 |
| 76 | 3300037068 | Ga0373925_0094854 | Ga0373925_0094854_732_1595 | 265 |
| 77 | 3300047315 | Ga0495581_0113186 | Ga0495581_0113186_431_1294 | 265 |
| 78 | 3300047319 | Ga0495674_0078820 | Ga0495674_0078820_1558_2421 | 265 |
| 79 | 3300047321 | Ga0495676_0157485 | Ga0495676_0157485_58_921 | 265 |
| 80 | 3300053077 | Ga0495601_0097942 | Ga0495601_0097942_416_1279 | 265 |
| 81 | 3300006175 | Ga0070712_100360171 | Ga0070712_1003601712 | 267 |
| 82 | 3300006844 | Ga0075428_100201448 | Ga0075428_1002014482 | 267 |
| 83 | 3300006852 | Ga0075433_10010986 | Ga0075433_100109862 | 267 |
| 84 | 3300007076 | Ga0075435_100025200 | Ga0075435_1000252003 | 267 |
| 85 | 3300009147 | Ga0114129_10007064 | Ga0114129_1000706414 | 267 |
| 86 | 3300048905 | Ga0496102_0167467 | Ga0496102_0167467_26_850 | 267 |
| 87 | 3300048912 | Ga0496109_0609158 | Ga0496109_0609158_189_1013 | 267 |
| 88 | 3300050513 | nmdc:mga0rr50_43524_c1 | nmdc:mga0rr50_43524_c1_2146_3018 | 267 |
| 89 | 3300050515 | nmdc:mga0a205_65337_c2 | nmdc:mga0a205_65337_c2_1561_2433 | 267 |
| 90 | 3300005458 | Ga0070681_10005194 | Ga0070681_1000519411 | 268 |
| 91 | 3300009093 | Ga0105240_10208342 | Ga0105240_102083422 | 268 |
| 92 | 3300013104 | Ga0157370_10011104 | Ga0157370_100111044 | 268 |
| 93 | 3300025912 | Ga0207707_10006429 | Ga0207707_100064297 | 268 |
| 94 | 3300025917 | Ga0207660_10102635 | Ga0207660_101026352 | 268 |
| 95 | 3300025921 | Ga0207652_10010905 | Ga0207652_100109054 | 268 |
| 96 | 3300049588 | Ga0501072_0091811 | Ga0501072_0091811_17_838 | 268 |
| 97 | 3300005434 | Ga0070709_10254314 | Ga0070709_102543142 | 269 |
| 98 | 3300025917 | Ga0207660_10151366 | Ga0207660_101513662 | 269 |
| 99 | 3300031711 | Ga0265314_10007418 | Ga0265314_100074187 | 269 |
| 100 | 3300048908 | Ga0496105_0467075 | Ga0496105_0467075_12_866 | 269 |
| 101 | 3300005530 | Ga0070679_100154418 | Ga0070679_1001544182 | 270 |
| 102 | 3300050512 | nmdc:mga0n895_107446_c1 | nmdc:mga0n895_107446_c1_1138_2010 | 270 |
| 103 | 3300005434 | Ga0070709_10150204 | Ga0070709_101502041 | 271 |
| 104 | 3300005435 | Ga0070714_100211552 | Ga0070714_1002115522 | 271 |
| 105 | 3300005436 | Ga0070713_100002801 | Ga0070713_10000280111 | 271 |
| 106 | 3300005437 | Ga0070710_10052553 | Ga0070710_100525531 | 271 |
| 107 | 3300005439 | Ga0070711_100099733 | Ga0070711_1000997332 | 271 |
| 108 | 3300005439 | Ga0070711_100169732 | Ga0070711_1001697322 | 271 |
| 109 | 3300005614 | Ga0068856_100186030 | Ga0068856_1001860302 | 271 |
| 110 | 3300005614 | Ga0068856_100189691 | Ga0068856_1001896912 | 271 |
| 111 | 3300006175 | Ga0070712_100011749 | Ga0070712_1000117493 | 271 |
| 112 | 3300006175 | Ga0070712_100077390 | Ga0070712_1000773902 | 271 |
| 113 | 3300006852 | Ga0075433_10205078 | Ga0075433_102050782 | 271 |
| 114 | 3300006871 | Ga0075434_100051855 | Ga0075434_1000518555 | 271 |
| 115 | 3300006914 | Ga0075436_100026247 | Ga0075436_1000262472 | 271 |
| 116 | 3300014497 | Ga0182008_10089735 | Ga0182008_100897352 | 271 |
| 117 | 3300025898 | Ga0207692_10039844 | Ga0207692_100398442 | 271 |
| 118 | 3300025915 | Ga0207693_10021327 | Ga0207693_100213275 | 271 |
| 119 | 3300025915 | Ga0207693_10051174 | Ga0207693_100511744 | 271 |
| 120 | 3300025928 | Ga0207700_10258449 | Ga0207700_102584492 | 271 |
| 121 | 3300025929 | Ga0207664_10080480 | Ga0207664_100804802 | 271 |
| 122 | 3300025929 | Ga0207664_10171390 | Ga0207664_101713902 | 271 |
| 123 | 3300026078 | Ga0207702_10137279 | Ga0207702_101372792 | 271 |
| 124 | 3300035410 | Ga0373924_0068203 | Ga0373924_0068203_540_1400 | 271 |
| 125 | 3300035692 | Ga0373935_0129704 | Ga0373935_0129704_798_1658 | 271 |
| 126 | 3300035724 | Ga0373933_0019168 | Ga0373933_0019168_2007_2867 | 271 |
| 127 | 3300036401 | Ga0373937_0000638 | Ga0373937_0000638_9644_10504 | 271 |
| 128 | 3300036401 | Ga0373937_0011341 | Ga0373937_0011341_6787_7647 | 271 |
| 129 | 3300046454 | Ga0495592_0041123 | Ga0495592_0041123_2541_3401 | 271 |
| 130 | 3300046462 | Ga0495651_0024292 | Ga0495651_0024292_1360_2220 | 271 |
| 131 | 3300046477 | Ga0495664_0051587 | Ga0495664_0051587_479_1339 | 271 |
| 132 | 3300046511 | Ga0495608_0000890 | Ga0495608_0000890_4238_5098 | 271 |
| 133 | 3300046511 | Ga0495608_0007116 | Ga0495608_0007116_6654_7514 | 271 |
| 134 | 3300046533 | Ga0495640_0198046 | Ga0495640_0198046_65_925 | 271 |
| 135 | 3300046536 | Ga0495587_0002800 | Ga0495587_0002800_4407_5267 | 271 |
| 136 | 3300046543 | Ga0495645_0006461 | Ga0495645_0006461_6670_7530 | 271 |
| 137 | 3300046559 | Ga0495667_0003101 | Ga0495667_0003101_5029_5889 | 271 |
| 138 | 3300046663 | Ga0495635_0117622 | Ga0495635_0117622_246_1106 | 271 |
| 139 | 3300046675 | Ga0495657_0146741 | Ga0495657_0146741_356_1216 | 271 |
| 140 | 3300046680 | Ga0495646_0098846 | Ga0495646_0098846_755_1615 | 271 |
| 141 | 3300047317 | Ga0495604_0008196 | Ga0495604_0008196_2668_3528 | 271 |
| 142 | 3300047319 | Ga0495674_0049606 | Ga0495674_0049606_1215_2075 | 271 |
| 143 | 3300047444 | Ga0495675_0001936 | Ga0495675_0001936_6774_7634 | 271 |
| 144 | 3300048088 | Ga0495602_0000557 | Ga0495602_0000557_27038_27898 | 271 |
| 145 | 3300048907 | Ga0496104_0380997 | Ga0496104_0380997_264_1124 | 271 |
| 146 | 3300048913 | Ga0496110_0140912 | Ga0496110_0140912_1241_2101 | 271 |
| 147 | 3300050514 | nmdc:mga08x19_222292_c1 | nmdc:mga08x19_222292_c1_276_1136 | 271 |
| 148 | 3300050515 | nmdc:mga0a205_89700_c2 | nmdc:mga0a205_89700_c2_378_1238 | 271 |
| 149 | 3300053077 | Ga0495601_0001180 | Ga0495601_0001180_6667_7527 | 271 |
| 150 | 3300053078 | Ga0495612_0004892 | Ga0495612_0004892_2072_2932 | 271 |
| 151 | 3300053085 | Ga0495619_0008411 | Ga0495619_0008411_2674_3534 | 271 |
| 152 | 3300005439 | Ga0070711_100016320 | Ga0070711_1000163205 | 272 |
| 153 | 3300005458 | Ga0070681_10481520 | Ga0070681_104815202 | 272 |
| 154 | 3300025916 | Ga0207663_10007441 | Ga0207663_100074415 | 272 |
| 155 | 3300025933 | Ga0207706_10519887 | Ga0207706_105198871 | 272 |
| 156 | 3300031241 | Ga0265325_10005419 | Ga0265325_100054198 | 272 |
| 157 | 3300031249 | Ga0265339_10020454 | Ga0265339_100204542 | 272 |
| 158 | 3300031344 | Ga0265316_10229918 | Ga0265316_102299182 | 272 |
| 159 | 3300031595 | Ga0265313_10015134 | Ga0265313_100151344 | 272 |
| 160 | 3300050491 | nmdc:mga00v17_21508_c1 | nmdc:mga00v17_21508_c1_1495_2382 | 272 |
| 161 | 3300050492 | nmdc:mga0yw44_10119_c1 | nmdc:mga0yw44_10119_c1_2979_3866 | 272 |
| 162 | 3300050494 | nmdc:mga06z11_59567_c1 | nmdc:mga06z11_59567_c1_821_1708 | 272 |
| 163 | 3300050495 | nmdc:mga04h51_12828_c1 | nmdc:mga04h51_12828_c1_315_1202 | 272 |
| 164 | 3300005338 | Ga0068868_100016754 | Ga0068868_1000167544 | 273 |
| 165 | 3300005364 | Ga0070673_100053689 | Ga0070673_1000536894 | 273 |
| 166 | 3300005547 | Ga0070693_100063071 | Ga0070693_1000630711 | 273 |
| 167 | 3300005617 | Ga0068859_100479684 | Ga0068859_1004796842 | 273 |
| 168 | 3300005841 | Ga0068863_100259042 | Ga0068863_1002590422 | 273 |
| 169 | 3300005983 | Ga0081540_1001075 | Ga0081540_100107521 | 273 |
| 170 | 3300006237 | Ga0097621_100060177 | Ga0097621_1000601772 | 273 |
| 171 | 3300006931 | Ga0097620_100479745 | Ga0097620_1004797452 | 273 |
| 172 | 3300009098 | Ga0105245_10001271 | Ga0105245_100012712 | 273 |
| 173 | 3300009148 | Ga0105243_10126450 | Ga0105243_101264502 | 273 |
| 174 | 3300009177 | Ga0105248_10112739 | Ga0105248_101127391 | 273 |
| 175 | 3300009545 | Ga0105237_10201002 | Ga0105237_102010021 | 273 |
| 176 | 3300009551 | Ga0105238_10040585 | Ga0105238_100405853 | 273 |
| 177 | 3300025924 | Ga0207694_10019609 | Ga0207694_100196093 | 273 |
| 178 | 3300025927 | Ga0207687_10002275 | Ga0207687_1000227511 | 273 |
| 179 | 3300025941 | Ga0207711_10342954 | Ga0207711_103429542 | 273 |
| 180 | 3300025942 | Ga0207689_10519408 | Ga0207689_105194081 | 273 |
| 181 | 3300025960 | Ga0207651_10056641 | Ga0207651_100566412 | 273 |
| 182 | 3300026023 | Ga0207677_10026509 | Ga0207677_100265094 | 273 |
| 183 | 3300026118 | Ga0207675_100141843 | Ga0207675_1001418433 | 273 |
| 184 | 3300005468 | Ga0070707_100314025 | Ga0070707_1003140251 | 274 |
| 185 | 3300012483 | Ga0157337_1001599 | Ga0157337_10015991 | 274 |
| 186 | 3300044694 | Ga0466963_0113375 | Ga0466963_0113375_594_1499 | 274 |
| 187 | 3300044842 | Ga0466957_0140114 | Ga0466957_0140114_332_1237 | 274 |
| 188 | 3300001976 | JGI24752J21851_1000784 | JGI24752J21851_10007845 | 275 |
| 189 | 3300001978 | JGI24747J21853_1003687 | JGI24747J21853_10036872 | 275 |
| 190 | 3300001989 | JGI24739J22299_10003989 | JGI24739J22299_100039891 | 275 |
| 191 | 3300001990 | JGI24737J22298_10000343 | JGI24737J22298_100003436 | 275 |
| 192 | 3300001991 | JGI24743J22301_10021555 | JGI24743J22301_100215551 | 275 |
| 193 | 3300002070 | JGI24750J21931_1000168 | JGI24750J21931_10001687 | 275 |
| 194 | 3300002073 | JGI24745J21846_1000151 | JGI24745J21846_10001513 | 275 |
| 195 | 3300002126 | JGI24035J26624_1000065 | JGI24035J26624_10000655 | 275 |
| 196 | 3300002239 | JGI24034J26672_10001763 | JGI24034J26672_100017631 | 275 |
| 197 | 3300002244 | JGI24742J22300_10000257 | JGI24742J22300_100002577 | 275 |
| 198 | 3300005290 | Ga0065712_10082435 | Ga0065712_100824354 | 275 |
| 199 | 3300005293 | Ga0065715_10139107 | Ga0065715_101391072 | 275 |
| 200 | 3300005328 | Ga0070676_10002063 | Ga0070676_100020633 | 275 |
| 201 | 3300005329 | Ga0070683_100001967 | Ga0070683_1000019675 | 275 |
| 202 | 3300005330 | Ga0070690_100000854 | Ga0070690_10000085414 | 275 |
| 203 | 3300005331 | Ga0070670_100004470 | Ga0070670_1000044705 | 275 |
| 204 | 3300005333 | Ga0070677_10000911 | Ga0070677_100009115 | 275 |
| 205 | 3300005334 | Ga0068869_100002063 | Ga0068869_1000020635 | 275 |
| 206 | 3300005335 | Ga0070666_10017947 | Ga0070666_100179472 | 275 |
| 207 | 3300005336 | Ga0070680_100003747 | Ga0070680_1000037479 | 275 |
| 208 | 3300005337 | Ga0070682_100003321 | Ga0070682_1000033217 | 275 |
| 209 | 3300005338 | Ga0068868_100001518 | Ga0068868_1000015187 | 275 |
| 210 | 3300005339 | Ga0070660_100001923 | Ga0070660_10000192314 | 275 |
| 211 | 3300005340 | Ga0070689_100001902 | Ga0070689_10000190212 | 275 |
| 212 | 3300005341 | Ga0070691_10001508 | Ga0070691_100015087 | 275 |
| 213 | 3300005343 | Ga0070687_100000581 | Ga0070687_10000058110 | 275 |
| 214 | 3300005344 | Ga0070661_100002173 | Ga0070661_10000217310 | 275 |
| 215 | 3300005345 | Ga0070692_10000022 | Ga0070692_1000002224 | 275 |
| 216 | 3300005347 | Ga0070668_100007861 | Ga0070668_1000078616 | 275 |
| 217 | 3300005353 | Ga0070669_100005226 | Ga0070669_1000052267 | 275 |
| 218 | 3300005354 | Ga0070675_100001735 | Ga0070675_10000173514 | 275 |
| 219 | 3300005355 | Ga0070671_100001490 | Ga0070671_1000014905 | 275 |
| 220 | 3300005356 | Ga0070674_100010186 | Ga0070674_1000101863 | 275 |
| 221 | 3300005364 | Ga0070673_100002359 | Ga0070673_1000023599 | 275 |
| 222 | 3300005365 | Ga0070688_100000196 | Ga0070688_1000001968 | 275 |
| 223 | 3300005366 | Ga0070659_100001661 | Ga0070659_1000016614 | 275 |
| 224 | 3300005367 | Ga0070667_100001157 | Ga0070667_10000115723 | 275 |
| 225 | 3300005406 | Ga0070703_10003849 | Ga0070703_100038492 | 275 |
| 226 | 3300005438 | Ga0070701_10001517 | Ga0070701_100015175 | 275 |
| 227 | 3300005440 | Ga0070705_100003506 | Ga0070705_1000035063 | 275 |
| 228 | 3300005441 | Ga0070700_100001358 | Ga0070700_10000135811 | 275 |
| 229 | 3300005445 | Ga0070708_100052232 | Ga0070708_1000522321 | 275 |
| 230 | 3300005455 | Ga0070663_100015910 | Ga0070663_1000159102 | 275 |
| 231 | 3300005456 | Ga0070678_100028197 | Ga0070678_1000281974 | 275 |
| 232 | 3300005457 | Ga0070662_100002117 | Ga0070662_1000021174 | 275 |
| 233 | 3300005458 | Ga0070681_10000884 | Ga0070681_1000088413 | 275 |
| 234 | 3300005459 | Ga0068867_100000744 | Ga0068867_1000007449 | 275 |
| 235 | 3300005466 | Ga0070685_10010537 | Ga0070685_100105372 | 275 |
| 236 | 3300005467 | Ga0070706_100276197 | Ga0070706_1002761972 | 275 |
| 237 | 3300005530 | Ga0070679_100009711 | Ga0070679_1000097117 | 275 |
| 238 | 3300005535 | Ga0070684_100001760 | Ga0070684_1000017608 | 275 |
| 239 | 3300005536 | Ga0070697_100170653 | Ga0070697_1001706532 | 275 |
| 240 | 3300005539 | Ga0068853_100005867 | Ga0068853_1000058677 | 275 |
| 241 | 3300005543 | Ga0070672_100001256 | Ga0070672_10000125614 | 275 |
| 242 | 3300005544 | Ga0070686_100000931 | Ga0070686_10000093116 | 275 |
| 243 | 3300005544 | Ga0070686_100038445 | Ga0070686_1000384451 | 275 |
| 244 | 3300005545 | Ga0070695_100001091 | Ga0070695_1000010913 | 275 |
| 245 | 3300005546 | Ga0070696_100003841 | Ga0070696_1000038419 | 275 |
| 246 | 3300005547 | Ga0070693_100001091 | Ga0070693_10000109110 | 275 |
| 247 | 3300005548 | Ga0070665_100370643 | Ga0070665_1003706432 | 275 |
| 248 | 3300005549 | Ga0070704_100000586 | Ga0070704_1000005866 | 275 |
| 249 | 3300005564 | Ga0070664_100007278 | Ga0070664_1000072785 | 275 |
| 250 | 3300005564 | Ga0070664_100077740 | Ga0070664_1000777402 | 275 |
| 251 | 3300005578 | Ga0068854_100005058 | Ga0068854_1000050584 | 275 |
| 252 | 3300005614 | Ga0068856_100002589 | Ga0068856_1000025899 | 275 |
| 253 | 3300005615 | Ga0070702_100001481 | Ga0070702_10000148110 | 275 |
| 254 | 3300005616 | Ga0068852_100001321 | Ga0068852_1000013215 | 275 |
| 255 | 3300005617 | Ga0068859_100003378 | Ga0068859_1000033784 | 275 |
| 256 | 3300005618 | Ga0068864_100005368 | Ga0068864_1000053685 | 275 |
| 257 | 3300005718 | Ga0068866_10001827 | Ga0068866_100018278 | 275 |
| 258 | 3300005719 | Ga0068861_100004442 | Ga0068861_1000044427 | 275 |
| 259 | 3300005840 | Ga0068870_10001047 | Ga0068870_100010477 | 275 |
| 260 | 3300005841 | Ga0068863_100004482 | Ga0068863_10000448211 | 275 |
| 261 | 3300005842 | Ga0068858_100002675 | Ga0068858_10000267516 | 275 |
| 262 | 3300005843 | Ga0068860_100008474 | Ga0068860_10000847410 | 275 |
| 263 | 3300005844 | Ga0068862_100001659 | Ga0068862_1000016596 | 275 |
| 264 | 3300006237 | Ga0097621_100000432 | Ga0097621_10000043226 | 275 |
| 265 | 3300006358 | Ga0068871_100002403 | Ga0068871_10000240311 | 275 |
| 266 | 3300006852 | Ga0075433_10006826 | Ga0075433_100068262 | 275 |
| 267 | 3300006871 | Ga0075434_100000482 | Ga0075434_10000048225 | 275 |
| 268 | 3300006871 | Ga0075434_100288436 | Ga0075434_1002884362 | 275 |
| 269 | 3300006881 | Ga0068865_100000989 | Ga0068865_1000009895 | 275 |
| 270 | 3300006931 | Ga0097620_100003378 | Ga0097620_1000033784 | 275 |
| 271 | 3300007076 | Ga0075435_100048841 | Ga0075435_1000488414 | 275 |
| 272 | 3300009092 | Ga0105250_10052453 | Ga0105250_100524532 | 275 |
| 273 | 3300009093 | Ga0105240_10431148 | Ga0105240_104311482 | 275 |
| 274 | 3300009094 | Ga0111539_10001938 | Ga0111539_100019384 | 275 |
| 275 | 3300009098 | Ga0105245_10000534 | Ga0105245_1000053426 | 275 |
| 276 | 3300009101 | Ga0105247_10004338 | Ga0105247_100043385 | 275 |
| 277 | 3300009101 | Ga0105247_10048562 | Ga0105247_100485622 | 275 |
| 278 | 3300009148 | Ga0105243_10002870 | Ga0105243_100028702 | 275 |
| 279 | 3300009174 | Ga0105241_10002371 | Ga0105241_100023717 | 275 |
| 280 | 3300009176 | Ga0105242_10003152 | Ga0105242_1000315211 | 275 |
| 281 | 3300009177 | Ga0105248_10003614 | Ga0105248_1000361412 | 275 |
| 282 | 3300009177 | Ga0105248_10051773 | Ga0105248_100517733 | 275 |
| 283 | 3300009553 | Ga0105249_10001017 | Ga0105249_1000101711 | 275 |
| 284 | 3300010375 | Ga0105239_10017653 | Ga0105239_100176535 | 275 |
| 285 | 3300011119 | Ga0105246_10007846 | Ga0105246_100078464 | 275 |
| 286 | 3300013100 | Ga0157373_10089296 | Ga0157373_100892962 | 275 |
| 287 | 3300013296 | Ga0157374_10004819 | Ga0157374_100048197 | 275 |
| 288 | 3300013297 | Ga0157378_10042017 | Ga0157378_100420172 | 275 |
| 289 | 3300013306 | Ga0163162_10003671 | Ga0163162_100036715 | 275 |
| 290 | 3300013307 | Ga0157372_10045137 | Ga0157372_100451375 | 275 |
| 291 | 3300013308 | Ga0157375_10001417 | Ga0157375_1000141715 | 275 |
| 292 | 3300014325 | Ga0163163_10019563 | Ga0163163_100195635 | 275 |
| 293 | 3300014325 | Ga0163163_10039219 | Ga0163163_100392194 | 275 |
| 294 | 3300014326 | Ga0157380_10007707 | Ga0157380_100077075 | 275 |
| 295 | 3300014745 | Ga0157377_10000458 | Ga0157377_1000045810 | 275 |
| 296 | 3300014968 | Ga0157379_10003079 | Ga0157379_1000307911 | 275 |
| 297 | 3300014968 | Ga0157379_10062633 | Ga0157379_100626332 | 275 |
| 298 | 3300014969 | Ga0157376_10004629 | Ga0157376_100046293 | 275 |
| 299 | 3300017792 | Ga0163161_10002260 | Ga0163161_1000226011 | 275 |
| 300 | 3300025271 | Ga0207666_1000030 | Ga0207666_10000307 | 275 |
| 301 | 3300025290 | Ga0207673_1003710 | Ga0207673_10037102 | 275 |
| 302 | 3300025315 | Ga0207697_10000225 | Ga0207697_100002259 | 275 |
| 303 | 3300025885 | Ga0207653_10002351 | Ga0207653_100023516 | 275 |
| 304 | 3300025893 | Ga0207682_10000009 | Ga0207682_1000000940 | 275 |
| 305 | 3300025899 | Ga0207642_10001175 | Ga0207642_100011754 | 275 |
| 306 | 3300025900 | Ga0207710_10025504 | Ga0207710_100255042 | 275 |
| 307 | 3300025901 | Ga0207688_10000060 | Ga0207688_1000006025 | 275 |
| 308 | 3300025903 | Ga0207680_10009851 | Ga0207680_100098515 | 275 |
| 309 | 3300025904 | Ga0207647_10000172 | Ga0207647_100001727 | 275 |
| 310 | 3300025907 | Ga0207645_10001556 | Ga0207645_1000155611 | 275 |
| 311 | 3300025908 | Ga0207643_10000244 | Ga0207643_1000024425 | 275 |
| 312 | 3300025910 | Ga0207684_10122547 | Ga0207684_101225472 | 275 |
| 313 | 3300025913 | Ga0207695_10087008 | Ga0207695_100870082 | 275 |
| 314 | 3300025914 | Ga0207671_10113869 | Ga0207671_101138692 | 275 |
| 315 | 3300025917 | Ga0207660_10000179 | Ga0207660_1000017915 | 275 |
| 316 | 3300025918 | Ga0207662_10000025 | Ga0207662_1000002539 | 275 |
| 317 | 3300025919 | Ga0207657_10006380 | Ga0207657_1000638010 | 275 |
| 318 | 3300025920 | Ga0207649_10000693 | Ga0207649_1000069320 | 275 |
| 319 | 3300025921 | Ga0207652_10002825 | Ga0207652_1000282513 | 275 |
| 320 | 3300025923 | Ga0207681_10001707 | Ga0207681_100017076 | 275 |
| 321 | 3300025925 | Ga0207650_10042870 | Ga0207650_100428702 | 275 |
| 322 | 3300025926 | Ga0207659_10000283 | Ga0207659_1000028326 | 275 |
| 323 | 3300025927 | Ga0207687_10002373 | Ga0207687_1000237311 | 275 |
| 324 | 3300025931 | Ga0207644_10016312 | Ga0207644_100163126 | 275 |
| 325 | 3300025932 | Ga0207690_10002627 | Ga0207690_100026276 | 275 |
| 326 | 3300025933 | Ga0207706_10000734 | Ga0207706_1000073425 | 275 |
| 327 | 3300025934 | Ga0207686_10003173 | Ga0207686_100031736 | 275 |
| 328 | 3300025935 | Ga0207709_10003573 | Ga0207709_100035735 | 275 |
| 329 | 3300025936 | Ga0207670_10002092 | Ga0207670_100020927 | 275 |
| 330 | 3300025937 | Ga0207669_10000204 | Ga0207669_1000020426 | 275 |
| 331 | 3300025938 | Ga0207704_10000130 | Ga0207704_1000013022 | 275 |
| 332 | 3300025940 | Ga0207691_10000309 | Ga0207691_100003099 | 275 |
| 333 | 3300025941 | Ga0207711_10003739 | Ga0207711_100037395 | 275 |
| 334 | 3300025941 | Ga0207711_10056517 | Ga0207711_100565174 | 275 |
| 335 | 3300025942 | Ga0207689_10000893 | Ga0207689_1000089325 | 275 |
| 336 | 3300025944 | Ga0207661_10002361 | Ga0207661_100023616 | 275 |
| 337 | 3300025945 | Ga0207679_10000128 | Ga0207679_100001286 | 275 |
| 338 | 3300025945 | Ga0207679_10095705 | Ga0207679_100957053 | 275 |
| 339 | 3300025960 | Ga0207651_10003176 | Ga0207651_100031764 | 275 |
| 340 | 3300025961 | Ga0207712_10003532 | Ga0207712_100035322 | 275 |
| 341 | 3300025972 | Ga0207668_10002246 | Ga0207668_100022468 | 275 |
| 342 | 3300025981 | Ga0207640_10003873 | Ga0207640_100038737 | 275 |
| 343 | 3300025986 | Ga0207658_10005965 | Ga0207658_100059656 | 275 |
| 344 | 3300026023 | Ga0207677_10003185 | Ga0207677_100031855 | 275 |
| 345 | 3300026035 | Ga0207703_10010286 | Ga0207703_100102864 | 275 |
| 346 | 3300026035 | Ga0207703_10169031 | Ga0207703_101690312 | 275 |
| 347 | 3300026067 | Ga0207678_10000759 | Ga0207678_1000075925 | 275 |
| 348 | 3300026075 | Ga0207708_10000391 | Ga0207708_1000039125 | 275 |
| 349 | 3300026078 | Ga0207702_10026447 | Ga0207702_100264475 | 275 |
| 350 | 3300026088 | Ga0207641_10008773 | Ga0207641_100087735 | 275 |
| 351 | 3300026089 | Ga0207648_10000862 | Ga0207648_1000086225 | 275 |
| 352 | 3300026095 | Ga0207676_10046219 | Ga0207676_100462194 | 275 |
| 353 | 3300026116 | Ga0207674_10000806 | Ga0207674_1000080615 | 275 |
| 354 | 3300026118 | Ga0207675_100000637 | Ga0207675_1000006379 | 275 |
| 355 | 3300026121 | Ga0207683_10000330 | Ga0207683_100003305 | 275 |
| 356 | 3300026142 | Ga0207698_10003712 | Ga0207698_100037125 | 275 |
| 357 | 3300027552 | Ga0209982_1024857 | Ga0209982_10248571 | 275 |
| 358 | 3300027617 | Ga0210002_1004342 | Ga0210002_10043422 | 275 |
| 359 | 3300027876 | Ga0209974_10002570 | Ga0209974_100025706 | 275 |
| 360 | 3300027907 | Ga0207428_10000164 | Ga0207428_1000016471 | 275 |
| 361 | 3300028379 | Ga0268266_10325574 | Ga0268266_103255742 | 275 |
| 362 | 3300028380 | Ga0268265_10029530 | Ga0268265_100295303 | 275 |
| 363 | 3300028381 | Ga0268264_10005408 | Ga0268264_100054086 | 275 |
| 364 | 3300028381 | Ga0268264_10066354 | Ga0268264_100663542 | 275 |
| 365 | 3300034816 | Ga0373930_0022536 | Ga0373930_0022536_43_915 | 275 |
| 366 | 3300035085 | Ga0373929_0000454 | Ga0373929_0000454_3226_4098 | 275 |
| 367 | 3300035088 | Ga0373940_0070103 | Ga0373940_0070103_20_892 | 275 |
| 368 | 3300035090 | Ga0373949_0004409 | Ga0373949_0004409_310_1182 | 275 |
| 369 | 3300035091 | Ga0373951_0007587 | Ga0373951_0007587_1015_1887 | 275 |
| 370 | 3300035112 | Ga0373932_0002234 | Ga0373932_0002234_783_1655 | 275 |
| 371 | 3300035114 | Ga0373939_0014179 | Ga0373939_0014179_172_1044 | 275 |
| 372 | 3300035121 | Ga0373960_0008151 | Ga0373960_0008151_1332_2204 | 275 |
| 373 | 3300035207 | Ga0373942_0010380 | Ga0373942_0010380_217_1089 | 275 |
| 374 | 3300035241 | Ga0373961_0088786 | Ga0373961_0088786_58_930 | 275 |
| 375 | 3300035242 | Ga0373962_0001559 | Ga0373962_0001559_3266_4138 | 275 |
| 376 | 3300035691 | Ga0373931_0002659 | Ga0373931_0002659_4429_5301 | 275 |
| 377 | 3300039437 | Ga0436365_0583672 | Ga0436365_0583672_300_1163 | 275 |
| 378 | 3300046683 | Ga0495658_0007101 | Ga0495658_0007101_3466_4338 | 275 |
| 379 | 3300048903 | Ga0496100_0001536 | Ga0496100_0001536_1441_2313 | 275 |
| 380 | 3300048904 | Ga0496101_0003663 | Ga0496101_0003663_4549_5421 | 275 |
| 381 | 3300048905 | Ga0496102_0009528 | Ga0496102_0009528_3653_4525 | 275 |
| 382 | 3300048906 | Ga0496103_0002198 | Ga0496103_0002198_7177_8049 | 275 |
| 383 | 3300048909 | Ga0496106_0003156 | Ga0496106_0003156_257_1129 | 275 |
| 384 | 3300048910 | Ga0496107_0015892 | Ga0496107_0015892_438_1310 | 275 |
| 385 | 3300048911 | Ga0496108_0010429 | Ga0496108_0010429_5365_6237 | 275 |
| 386 | 3300048912 | Ga0496109_0001830 | Ga0496109_0001830_11079_11951 | 275 |
| 387 | 3300048913 | Ga0496110_0011657 | Ga0496110_0011657_2970_3842 | 275 |
| 388 | 3300048915 | Ga0496112_0020297 | Ga0496112_0020297_1228_2100 | 275 |
| 389 | 3300048916 | Ga0496113_0014156 | Ga0496113_0014156_4012_4884 | 275 |
| 390 | 3300048917 | Ga0496114_0006422 | Ga0496114_0006422_7773_8645 | 275 |
| 391 | 3300048918 | Ga0496115_0024141 | Ga0496115_0024141_3838_4710 | 275 |
| 392 | 3300050511 | nmdc:mga08y16_108_c1 | nmdc:mga08y16_108_c1_24270_25142 | 275 |
| 393 | 3300050512 | nmdc:mga0n895_406_c1 | nmdc:mga0n895_406_c1_12640_13512 | 275 |
| 394 | 3300050513 | nmdc:mga0rr50_110886_c1 | nmdc:mga0rr50_110886_c1_1159_2031 | 275 |
| 395 | 3300050515 | nmdc:mga0a205_3783_c1 | nmdc:mga0a205_3783_c1_5041_5913 | 275 |
| 396 | 3300013307 | Ga0157372_10078105 | Ga0157372_100781052 | 276 |
| 397 | 3300025949 | Ga0207667_10084560 | Ga0207667_100845602 | 276 |
| 398 | 3300044719 | Ga0466971_0111305 | Ga0466971_0111305_115_987 | 276 |
| 399 | 3300048907 | Ga0496104_0069971 | Ga0496104_0069971_1134_1994 | 276 |
| 400 | 3300048910 | Ga0496107_0336677 | Ga0496107_0336677_198_1058 | 276 |
| 401 | 3300005985 | Ga0081539_10010901 | Ga0081539_100109013 | 277 |
| 402 | 3300035084 | Ga0373928_0001031 | Ga0373928_0001031_4137_5009 | 277 |
| 403 | 3300048905 | Ga0496102_0064445 | Ga0496102_0064445_611_1483 | 277 |
| 404 | 3300049582 | Ga0501048_0313013 | Ga0501048_0313013_71_931 | 277 |
| 405 | 3300049591 | Ga0501075_0092855 | Ga0501075_0092855_1257_2117 | 277 |
| 406 | 3300049592 | Ga0501076_0247579 | Ga0501076_0247579_434_1294 | 277 |
| 407 | 3300049593 | Ga0501077_0125185 | Ga0501077_0125185_204_1064 | 277 |
| 408 | 3300049741 | Ga0501079_0476957 | Ga0501079_0476957_77_937 | 277 |
| 409 | 3300049742 | Ga0501080_0145493 | Ga0501080_0145493_42_902 | 277 |
| 410 | 3300005435 | Ga0070714_100512959 | Ga0070714_1005129592 | 278 |
| 411 | 3300005563 | Ga0068855_100012952 | Ga0068855_1000129524 | 278 |
| 412 | 3300025929 | Ga0207664_10027330 | Ga0207664_100273303 | 278 |
| 413 | 3300035725 | Ga0373947_0182370 | Ga0373947_0182370_342_1205 | 278 |
| 414 | 3300005437 | Ga0070710_10028417 | Ga0070710_100284172 | 279 |
| 415 | 3300009766 | Ga0123342_1000455 | Ga0123342_10004558 | 279 |
| 416 | 3300025898 | Ga0207692_10154140 | Ga0207692_101541402 | 279 |
| 417 | 3300005327 | Ga0070658_10334573 | Ga0070658_103345732 | 280 |
| 418 | 3300005328 | Ga0070676_10009281 | Ga0070676_100092814 | 280 |
| 419 | 3300005331 | Ga0070670_100138997 | Ga0070670_1001389972 | 280 |
| 420 | 3300005335 | Ga0070666_10029521 | Ga0070666_100295213 | 280 |
| 421 | 3300005337 | Ga0070682_100048658 | Ga0070682_1000486582 | 280 |
| 422 | 3300005338 | Ga0068868_100052438 | Ga0068868_1000524382 | 280 |
| 423 | 3300005339 | Ga0070660_100010402 | Ga0070660_1000104024 | 280 |
| 424 | 3300005343 | Ga0070687_100019986 | Ga0070687_1000199862 | 280 |
| 425 | 3300005356 | Ga0070674_100153912 | Ga0070674_1001539122 | 280 |
| 426 | 3300005364 | Ga0070673_100035233 | Ga0070673_1000352334 | 280 |
| 427 | 3300005365 | Ga0070688_100008636 | Ga0070688_1000086366 | 280 |
| 428 | 3300005367 | Ga0070667_100041199 | Ga0070667_1000411993 | 280 |
| 429 | 3300005434 | Ga0070709_10012677 | Ga0070709_100126772 | 280 |
| 430 | 3300005434 | Ga0070709_10098427 | Ga0070709_100984271 | 280 |
| 431 | 3300005435 | Ga0070714_100010967 | Ga0070714_1000109674 | 280 |
| 432 | 3300005436 | Ga0070713_100015520 | Ga0070713_1000155202 | 280 |
| 433 | 3300005436 | Ga0070713_100024112 | Ga0070713_1000241123 | 280 |
| 434 | 3300005437 | Ga0070710_10004196 | Ga0070710_100041967 | 280 |
| 435 | 3300005439 | Ga0070711_100366611 | Ga0070711_1003666112 | 280 |
| 436 | 3300005466 | Ga0070685_10007166 | Ga0070685_100071662 | 280 |
| 437 | 3300005535 | Ga0070684_100397342 | Ga0070684_1003973421 | 280 |
| 438 | 3300005544 | Ga0070686_100064466 | Ga0070686_1000644662 | 280 |
| 439 | 3300005577 | Ga0068857_100168071 | Ga0068857_1001680712 | 280 |
| 440 | 3300005614 | Ga0068856_100186780 | Ga0068856_1001867802 | 280 |
| 441 | 3300005617 | Ga0068859_100125502 | Ga0068859_1001255022 | 280 |
| 442 | 3300005618 | Ga0068864_100033385 | Ga0068864_1000333852 | 280 |
| 443 | 3300005718 | Ga0068866_10003791 | Ga0068866_100037914 | 280 |
| 444 | 3300005841 | Ga0068863_100046817 | Ga0068863_1000468173 | 280 |
| 445 | 3300005842 | Ga0068858_100025282 | Ga0068858_1000252825 | 280 |
| 446 | 3300005843 | Ga0068860_100015436 | Ga0068860_1000154367 | 280 |
| 447 | 3300005983 | Ga0081540_1028851 | Ga0081540_10288512 | 280 |
| 448 | 3300006028 | Ga0070717_10020314 | Ga0070717_100203142 | 280 |
| 449 | 3300006058 | Ga0075432_10032913 | Ga0075432_100329131 | 280 |
| 450 | 3300006173 | Ga0070716_100002129 | Ga0070716_1000021294 | 280 |
| 451 | 3300006173 | Ga0070716_100076563 | Ga0070716_1000765632 | 280 |
| 452 | 3300006237 | Ga0097621_100003548 | Ga0097621_1000035487 | 280 |
| 453 | 3300006358 | Ga0068871_100012965 | Ga0068871_1000129656 | 280 |
| 454 | 3300006844 | Ga0075428_100006289 | Ga0075428_1000062896 | 280 |
| 455 | 3300006846 | Ga0075430_100000312 | Ga0075430_10000031228 | 280 |
| 456 | 3300006847 | Ga0075431_100007548 | Ga0075431_1000075486 | 280 |
| 457 | 3300006852 | Ga0075433_10000328 | Ga0075433_1000032827 | 280 |
| 458 | 3300006871 | Ga0075434_100002518 | Ga0075434_1000025183 | 280 |
| 459 | 3300006880 | Ga0075429_100001514 | Ga0075429_1000015146 | 280 |
| 460 | 3300006931 | Ga0097620_100125498 | Ga0097620_1001254982 | 280 |
| 461 | 3300007076 | Ga0075435_100007820 | Ga0075435_1000078203 | 280 |
| 462 | 3300009011 | Ga0105251_10012487 | Ga0105251_100124875 | 280 |
| 463 | 3300009094 | Ga0111539_10006634 | Ga0111539_100066343 | 280 |
| 464 | 3300009147 | Ga0114129_10013293 | Ga0114129_100132933 | 280 |
| 465 | 3300009148 | Ga0105243_10011971 | Ga0105243_100119713 | 280 |
| 466 | 3300009174 | Ga0105241_10027062 | Ga0105241_100270624 | 280 |
| 467 | 3300009176 | Ga0105242_10028950 | Ga0105242_100289503 | 280 |
| 468 | 3300009551 | Ga0105238_10053026 | Ga0105238_100530262 | 280 |
| 469 | 3300011119 | Ga0105246_10190093 | Ga0105246_101900932 | 280 |
| 470 | 3300013307 | Ga0157372_10137183 | Ga0157372_101371832 | 280 |
| 471 | 3300025898 | Ga0207692_10002474 | Ga0207692_100024746 | 280 |
| 472 | 3300025898 | Ga0207692_10016538 | Ga0207692_100165383 | 280 |
| 473 | 3300025900 | Ga0207710_10017761 | Ga0207710_100177613 | 280 |
| 474 | 3300025901 | Ga0207688_10027494 | Ga0207688_100274943 | 280 |
| 475 | 3300025903 | Ga0207680_10036845 | Ga0207680_100368452 | 280 |
| 476 | 3300025906 | Ga0207699_10004490 | Ga0207699_100044903 | 280 |
| 477 | 3300025906 | Ga0207699_10013160 | Ga0207699_100131602 | 280 |
| 478 | 3300025915 | Ga0207693_10005817 | Ga0207693_100058175 | 280 |
| 479 | 3300025916 | Ga0207663_10031199 | Ga0207663_100311992 | 280 |
| 480 | 3300025916 | Ga0207663_10402436 | Ga0207663_104024361 | 280 |
| 481 | 3300025918 | Ga0207662_10040739 | Ga0207662_100407392 | 280 |
| 482 | 3300025919 | Ga0207657_10038325 | Ga0207657_100383252 | 280 |
| 483 | 3300025920 | Ga0207649_10079162 | Ga0207649_100791622 | 280 |
| 484 | 3300025924 | Ga0207694_10237291 | Ga0207694_102372912 | 280 |
| 485 | 3300025925 | Ga0207650_10035875 | Ga0207650_100358752 | 280 |
| 486 | 3300025927 | Ga0207687_10003040 | Ga0207687_100030406 | 280 |
| 487 | 3300025928 | Ga0207700_10005221 | Ga0207700_100052215 | 280 |
| 488 | 3300025929 | Ga0207664_10040856 | Ga0207664_100408562 | 280 |
| 489 | 3300025929 | Ga0207664_10052000 | Ga0207664_100520003 | 280 |
| 490 | 3300025931 | Ga0207644_10008220 | Ga0207644_100082206 | 280 |
| 491 | 3300025935 | Ga0207709_10051102 | Ga0207709_100511022 | 280 |
| 492 | 3300025936 | Ga0207670_10028166 | Ga0207670_100281662 | 280 |
| 493 | 3300025939 | Ga0207665_10000605 | Ga0207665_1000060519 | 280 |
| 494 | 3300025939 | Ga0207665_10101584 | Ga0207665_101015842 | 280 |
| 495 | 3300025941 | Ga0207711_10012929 | Ga0207711_100129293 | 280 |
| 496 | 3300025942 | Ga0207689_10012479 | Ga0207689_100124794 | 280 |
| 497 | 3300025986 | Ga0207658_10087707 | Ga0207658_100877072 | 280 |
| 498 | 3300026035 | Ga0207703_10016763 | Ga0207703_100167635 | 280 |
| 499 | 3300026078 | Ga0207702_10137575 | Ga0207702_101375752 | 280 |
| 500 | 3300026088 | Ga0207641_10042207 | Ga0207641_100422073 | 280 |
| 501 | 3300026095 | Ga0207676_10007810 | Ga0207676_100078106 | 280 |
| 502 | 3300026116 | Ga0207674_10071472 | Ga0207674_100714724 | 280 |
| 503 | 3300026121 | Ga0207683_10004948 | Ga0207683_100049482 | 280 |
| 504 | 3300026142 | Ga0207698_10609436 | Ga0207698_106094361 | 280 |
| 505 | 3300027907 | Ga0207428_10000815 | Ga0207428_1000081540 | 280 |
| 506 | 3300028379 | Ga0268266_10003098 | Ga0268266_100030983 | 280 |
| 507 | 3300028381 | Ga0268264_10011667 | Ga0268264_100116674 | 280 |
| 508 | 3300031241 | Ga0265325_10000474 | Ga0265325_1000047411 | 280 |
| 509 | 3300031241 | Ga0265325_10062342 | Ga0265325_100623422 | 280 |
| 510 | 3300031711 | Ga0265314_10071938 | Ga0265314_100719382 | 280 |
| 511 | 3300031712 | Ga0265342_10000321 | Ga0265342_100003213 | 280 |
| 512 | 3300035084 | Ga0373928_0008518 | Ga0373928_0008518_909_1781 | 280 |
| 513 | 3300035114 | Ga0373939_0002253 | Ga0373939_0002253_2186_3058 | 280 |
| 514 | 3300035115 | Ga0373941_0008307 | Ga0373941_0008307_789_1661 | 280 |
| 515 | 3300035171 | Ga0373946_0007213 | Ga0373946_0007213_2234_3106 | 280 |
| 516 | 3300035241 | Ga0373961_0026055 | Ga0373961_0026055_673_1545 | 280 |
| 517 | 3300035691 | Ga0373931_0256913 | Ga0373931_0256913_132_1004 | 280 |
| 518 | 3300035692 | Ga0373935_0026597 | Ga0373935_0026597_1643_2515 | 280 |
| 519 | 3300035695 | Ga0373927_0008778 | Ga0373927_0008778_2909_3781 | 280 |
| 520 | 3300035695 | Ga0373927_0028473 | Ga0373927_0028473_1647_2519 | 280 |
| 521 | 3300035725 | Ga0373947_0000280 | Ga0373947_0000280_24080_24952 | 280 |
| 522 | 3300035725 | Ga0373947_0004394 | Ga0373947_0004394_1772_2644 | 280 |
| 523 | 3300036401 | Ga0373937_0018638 | Ga0373937_0018638_3257_4129 | 280 |
| 524 | 3300036401 | Ga0373937_0088424 | Ga0373937_0088424_1662_2534 | 280 |
| 525 | 3300037068 | Ga0373925_0001680 | Ga0373925_0001680_12773_13645 | 280 |
| 526 | 3300037418 | Ga0395900_0030631 | Ga0395900_0030631_3344_4201 | 280 |
| 527 | 3300037466 | Ga0395898_0024721 | Ga0395898_0024721_3344_4201 | 280 |
| 528 | 3300038443 | Ga0395901_0014282 | Ga0395901_0014282_6764_7621 | 280 |
| 529 | 3300046455 | Ga0495603_0095348 | Ga0495603_0095348_478_1350 | 280 |
| 530 | 3300046459 | Ga0495629_0006959 | Ga0495629_0006959_1805_2677 | 280 |
| 531 | 3300046459 | Ga0495629_0021267 | Ga0495629_0021267_199_1071 | 280 |
| 532 | 3300046461 | Ga0495641_0029079 | Ga0495641_0029079_1209_2081 | 280 |
| 533 | 3300046461 | Ga0495641_0033581 | Ga0495641_0033581_915_1787 | 280 |
| 534 | 3300046462 | Ga0495651_0025083 | Ga0495651_0025083_2379_3251 | 280 |
| 535 | 3300046463 | Ga0495653_0055985 | Ga0495653_0055985_25_897 | 280 |
| 536 | 3300046473 | Ga0495582_0001012 | Ga0495582_0001012_1242_2114 | 280 |
| 537 | 3300046475 | Ga0495639_0008822 | Ga0495639_0008822_518_1390 | 280 |
| 538 | 3300046475 | Ga0495639_0011150 | Ga0495639_0011150_1787_2659 | 280 |
| 539 | 3300046476 | Ga0495662_0004939 | Ga0495662_0004939_1187_2059 | 280 |
| 540 | 3300046499 | Ga0495594_0017400 | Ga0495594_0017400_1801_2673 | 280 |
| 541 | 3300046499 | Ga0495594_0087375 | Ga0495594_0087375_43_915 | 280 |
| 542 | 3300046511 | Ga0495608_0092521 | Ga0495608_0092521_88_960 | 280 |
| 543 | 3300046514 | Ga0495618_0004574 | Ga0495618_0004574_5676_6548 | 280 |
| 544 | 3300046514 | Ga0495618_0075296 | Ga0495618_0075296_857_1729 | 280 |
| 545 | 3300046517 | Ga0495630_0008519 | Ga0495630_0008519_4701_5573 | 280 |
| 546 | 3300046529 | Ga0495652_0042653 | Ga0495652_0042653_1237_2109 | 280 |
| 547 | 3300046529 | Ga0495652_0127068 | Ga0495652_0127068_342_1214 | 280 |
| 548 | 3300046533 | Ga0495640_0023436 | Ga0495640_0023436_2367_3239 | 280 |
| 549 | 3300046533 | Ga0495640_0074445 | Ga0495640_0074445_850_1722 | 280 |
| 550 | 3300046642 | Ga0495634_0030445 | Ga0495634_0030445_467_1339 | 280 |
| 551 | 3300046642 | Ga0495634_0078321 | Ga0495634_0078321_57_929 | 280 |
| 552 | 3300046663 | Ga0495635_0042556 | Ga0495635_0042556_1680_2552 | 280 |
| 553 | 3300046663 | Ga0495635_0045531 | Ga0495635_0045531_1804_2676 | 280 |
| 554 | 3300046674 | Ga0495588_0056472 | Ga0495588_0056472_927_1799 | 280 |
| 555 | 3300046675 | Ga0495657_0062234 | Ga0495657_0062234_465_1337 | 280 |
| 556 | 3300046681 | Ga0495647_0026191 | Ga0495647_0026191_26_898 | 280 |
| 557 | 3300046681 | Ga0495647_0039863 | Ga0495647_0039863_670_1542 | 280 |
| 558 | 3300046683 | Ga0495658_0001393 | Ga0495658_0001393_5448_6320 | 280 |
| 559 | 3300046683 | Ga0495658_0006997 | Ga0495658_0006997_3513_4385 | 280 |
| 560 | 3300046689 | Ga0495613_0046256 | Ga0495613_0046256_1043_1915 | 280 |
| 561 | 3300046689 | Ga0495613_0064268 | Ga0495613_0064268_362_1234 | 280 |
| 562 | 3300046809 | Ga0495600_0016856 | Ga0495600_0016856_1768_2640 | 280 |
| 563 | 3300046809 | Ga0495600_0113886 | Ga0495600_0113886_151_1023 | 280 |
| 564 | 3300047315 | Ga0495581_0024911 | Ga0495581_0024911_2557_3429 | 280 |
| 565 | 3300047317 | Ga0495604_0051376 | Ga0495604_0051376_51_923 | 280 |
| 566 | 3300047319 | Ga0495674_0037656 | Ga0495674_0037656_2243_3115 | 280 |
| 567 | 3300047319 | Ga0495674_0078136 | Ga0495674_0078136_155_1027 | 280 |
| 568 | 3300047321 | Ga0495676_0014561 | Ga0495676_0014561_2090_2962 | 280 |
| 569 | 3300047321 | Ga0495676_0058280 | Ga0495676_0058280_942_1814 | 280 |
| 570 | 3300047322 | Ga0495680_0002550 | Ga0495680_0002550_9130_10002 | 280 |
| 571 | 3300047322 | Ga0495680_0005190 | Ga0495680_0005190_6339_7211 | 280 |
| 572 | 3300047322 | Ga0495680_0022019 | Ga0495680_0022019_1069_1941 | 280 |
| 573 | 3300047471 | Ga0495684_0000825 | Ga0495684_0000825_10993_11865 | 280 |
| 574 | 3300047673 | Ga0495593_0009164 | Ga0495593_0009164_4632_5504 | 280 |
| 575 | 3300048088 | Ga0495602_0118618 | Ga0495602_0118618_581_1453 | 280 |
| 576 | 3300048903 | Ga0496100_0080887 | Ga0496100_0080887_957_1829 | 280 |
| 577 | 3300048905 | Ga0496102_0057142 | Ga0496102_0057142_2581_3453 | 280 |
| 578 | 3300048914 | Ga0496111_0016641 | Ga0496111_0016641_1839_2711 | 280 |
| 579 | 3300048916 | Ga0496113_0125007 | Ga0496113_0125007_313_1185 | 280 |
| 580 | 3300048916 | Ga0496113_0301715 | Ga0496113_0301715_376_1248 | 280 |
| 581 | 3300048917 | Ga0496114_0080685 | Ga0496114_0080685_1846_2718 | 280 |
| 582 | 3300049590 | Ga0501074_0118145 | Ga0501074_0118145_742_1614 | 280 |
| 583 | 3300049823 | Ga0501044_0107087 | Ga0501044_0107087_1816_2688 | 280 |
| 584 | 3300050507 | nmdc:mga05p37_151_c1 | nmdc:mga05p37_151_c1_1617_2489 | 280 |
| 585 | 3300050507 | nmdc:mga05p37_26718_c1 | nmdc:mga05p37_26718_c1_5024_5896 | 280 |
| 586 | 3300050508 | nmdc:mga09592_2557_c1 | nmdc:mga09592_2557_c1_4431_5303 | 280 |
| 587 | 3300050509 | nmdc:mga0qj67_2949_c1 | nmdc:mga0qj67_2949_c1_1946_2818 | 280 |
| 588 | 3300050510 | nmdc:mga06r32_592_c1 | nmdc:mga06r32_592_c1_2315_3187 | 280 |
| 589 | 3300050511 | nmdc:mga08y16_17668_c1 | nmdc:mga08y16_17668_c1_1977_2849 | 280 |
| 590 | 3300050512 | nmdc:mga0n895_337_c1 | nmdc:mga0n895_337_c1_21936_22808 | 280 |
| 591 | 3300050512 | nmdc:mga0n895_37367_c1 | nmdc:mga0n895_37367_c1_2212_3084 | 280 |
| 592 | 3300050513 | nmdc:mga0rr50_1965_c1 | nmdc:mga0rr50_1965_c1_5379_6251 | 280 |
| 593 | 3300050515 | nmdc:mga0a205_197136_c1 | nmdc:mga0a205_197136_c1_862_1734 | 280 |
| 594 | 3300050515 | nmdc:mga0a205_2351_c1 | nmdc:mga0a205_2351_c1_4666_5538 | 280 |
| 595 | 3300053077 | Ga0495601_0014668 | Ga0495601_0014668_1258_2130 | 280 |
| 596 | 3300053084 | Ga0495595_0000357 | Ga0495595_0000357_4890_5762 | 280 |
| 597 | 3300053084 | Ga0495595_0013757 | Ga0495595_0013757_2065_2937 | 280 |
| 598 | 3300053085 | Ga0495619_0000048 | Ga0495619_0000048_26480_27352 | 280 |
| 599 | 3300053085 | Ga0495619_0000256 | Ga0495619_0000256_3757_4629 | 280 |
| 600 | 3300053085 | Ga0495619_0023705 | Ga0495619_0023705_1258_2130 | 280 |
| 601 | 3300005329 | Ga0070683_100042152 | Ga0070683_1000421522 | 281 |
| 602 | 3300005434 | Ga0070709_10026420 | Ga0070709_100264201 | 281 |
| 603 | 3300005437 | Ga0070710_10007560 | Ga0070710_100075603 | 281 |
| 604 | 3300005439 | Ga0070711_100150321 | Ga0070711_1001503211 | 281 |
| 605 | 3300005535 | Ga0070684_100015270 | Ga0070684_1000152704 | 281 |
| 606 | 3300005539 | Ga0068853_100081713 | Ga0068853_1000817131 | 281 |
| 607 | 3300005563 | Ga0068855_100029487 | Ga0068855_1000294872 | 281 |
| 608 | 3300009093 | Ga0105240_10077191 | Ga0105240_100771912 | 281 |
| 609 | 3300009174 | Ga0105241_10023086 | Ga0105241_100230862 | 281 |
| 610 | 3300009551 | Ga0105238_10073363 | Ga0105238_100733632 | 281 |
| 611 | 3300010375 | Ga0105239_10668525 | Ga0105239_106685252 | 281 |
| 612 | 3300013102 | Ga0157371_10061309 | Ga0157371_100613092 | 281 |
| 613 | 3300013105 | Ga0157369_10047309 | Ga0157369_100473094 | 281 |
| 614 | 3300025915 | Ga0207693_10004633 | Ga0207693_100046337 | 281 |
| 615 | 3300025924 | Ga0207694_10440235 | Ga0207694_104402352 | 281 |
| 616 | 3300031241 | Ga0265325_10001518 | Ga0265325_1000151817 | 281 |
| 617 | 3300031241 | Ga0265325_10003355 | Ga0265325_100033555 | 281 |
| 618 | 3300031595 | Ga0265313_10038015 | Ga0265313_100380152 | 281 |
| 619 | 3300031595 | Ga0265313_10067483 | Ga0265313_100674832 | 281 |
| 620 | 3300046678 | Ga0495599_0002450 | Ga0495599_0002450_246_1115 | 281 |
| 621 | 3300053098 | Ga0500650_0013749 | Ga0500650_0013749_803_1675 | 281 |
| 622 | 3300005334 | Ga0068869_100468608 | Ga0068869_1004686081 | 282 |
| 623 | 3300026088 | Ga0207641_10466935 | Ga0207641_104669352 | 282 |
| 624 | 3300031241 | Ga0265325_10066896 | Ga0265325_100668962 | 282 |
| 625 | 3300031711 | Ga0265314_10016261 | Ga0265314_100162614 | 282 |
| 626 | 3300035117 | Ga0373953_0052171 | Ga0373953_0052171_423_1295 | 282 |
| 627 | 3300035118 | Ga0373954_0038269 | Ga0373954_0038269_1140_2012 | 282 |
| 628 | 3300035695 | Ga0373927_0232028 | Ga0373927_0232028_201_1073 | 282 |
| 629 | 3300035724 | Ga0373933_0091510 | Ga0373933_0091510_463_1335 | 282 |
| 630 | 3300035724 | Ga0373933_0175147 | Ga0373933_0175147_21_893 | 282 |
| 631 | 3300036401 | Ga0373937_0022165 | Ga0373937_0022165_1764_2636 | 282 |
| 632 | 3300046454 | Ga0495592_0007395 | Ga0495592_0007395_7177_8049 | 282 |
| 633 | 3300046462 | Ga0495651_0025567 | Ga0495651_0025567_308_1180 | 282 |
| 634 | 3300046477 | Ga0495664_0113787 | Ga0495664_0113787_411_1283 | 282 |
| 635 | 3300046511 | Ga0495608_0036752 | Ga0495608_0036752_2367_3239 | 282 |
| 636 | 3300046516 | Ga0495628_0001326 | Ga0495628_0001326_11938_12810 | 282 |
| 637 | 3300046529 | Ga0495652_0034110 | Ga0495652_0034110_201_1073 | 282 |
| 638 | 3300046543 | Ga0495645_0003190 | Ga0495645_0003190_325_1197 | 282 |
| 639 | 3300046559 | Ga0495667_0006161 | Ga0495667_0006161_4723_5595 | 282 |
| 640 | 3300046663 | Ga0495635_0003053 | Ga0495635_0003053_6504_7376 | 282 |
| 641 | 3300046675 | Ga0495657_0010806 | Ga0495657_0010806_5580_6452 | 282 |
| 642 | 3300046675 | Ga0495657_0074092 | Ga0495657_0074092_852_1724 | 282 |
| 643 | 3300046679 | Ga0495623_0012154 | Ga0495623_0012154_1935_2807 | 282 |
| 644 | 3300046680 | Ga0495646_0018416 | Ga0495646_0018416_1033_1905 | 282 |
| 645 | 3300046809 | Ga0495600_0006458 | Ga0495600_0006458_2760_3632 | 282 |
| 646 | 3300047317 | Ga0495604_0014298 | Ga0495604_0014298_2481_3353 | 282 |
| 647 | 3300047319 | Ga0495674_0114264 | Ga0495674_0114264_1240_2112 | 282 |
| 648 | 3300047322 | Ga0495680_0003862 | Ga0495680_0003862_3947_4819 | 282 |
| 649 | 3300047444 | Ga0495675_0038166 | Ga0495675_0038166_1899_2771 | 282 |
| 650 | 3300048088 | Ga0495602_0006781 | Ga0495602_0006781_5879_6751 | 282 |
| 651 | 3300053077 | Ga0495601_0000620 | Ga0495601_0000620_8132_9004 | 282 |
| 652 | 3300053078 | Ga0495612_0000683 | Ga0495612_0000683_7316_8188 | 282 |
| 653 | 3300053084 | Ga0495595_0000749 | Ga0495595_0000749_8983_9855 | 282 |
| 654 | 3300053087 | Ga0500643_001301 | Ga0500643_001301_4436_5308 | 282 |
| 655 | 3300053088 | Ga0500644_0005965 | Ga0500644_0005965_218_1090 | 282 |
| 656 | 3300053093 | Ga0500651_0077762 | Ga0500651_0077762_926_1798 | 282 |
| 657 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_163882_164754 | 282 |
| 658 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1350591_1351463 | 282 |
| 659 | 3300053730 | Ga0500645_000217 | Ga0500645_000217_3995_4867 | 282 |
| 660 | 3300003215 | JGI25153J46596_10001449 | JGI25153J46596_100014496 | 283 |
| 661 | 3300005328 | Ga0070676_10171792 | Ga0070676_101717922 | 283 |
| 662 | 3300005330 | Ga0070690_100013139 | Ga0070690_1000131393 | 283 |
| 663 | 3300005336 | Ga0070680_100221375 | Ga0070680_1002213752 | 283 |
| 664 | 3300005340 | Ga0070689_100003987 | Ga0070689_1000039877 | 283 |
| 665 | 3300005347 | Ga0070668_100233335 | Ga0070668_1002333352 | 283 |
| 666 | 3300005355 | Ga0070671_100516024 | Ga0070671_1005160241 | 283 |
| 667 | 3300005365 | Ga0070688_100008930 | Ga0070688_1000089302 | 283 |
| 668 | 3300005456 | Ga0070678_100019756 | Ga0070678_1000197564 | 283 |
| 669 | 3300005617 | Ga0068859_100226901 | Ga0068859_1002269012 | 283 |
| 670 | 3300006931 | Ga0097620_100226901 | Ga0097620_1002269012 | 283 |
| 671 | 3300009094 | Ga0111539_10084249 | Ga0111539_100842492 | 283 |
| 672 | 3300009101 | Ga0105247_10055194 | Ga0105247_100551942 | 283 |
| 673 | 3300010159 | Ga0099796_10061734 | Ga0099796_100617342 | 283 |
| 674 | 3300013308 | Ga0157375_10201737 | Ga0157375_102017372 | 283 |
| 675 | 3300025297 | Ga0209758_1001765 | Ga0209758_100176524 | 283 |
| 676 | 3300025906 | Ga0207699_10041381 | Ga0207699_100413812 | 283 |
| 677 | 3300025907 | Ga0207645_10167069 | Ga0207645_101670692 | 283 |
| 678 | 3300025926 | Ga0207659_10186717 | Ga0207659_101867172 | 283 |
| 679 | 3300025927 | Ga0207687_10234463 | Ga0207687_102344632 | 283 |
| 680 | 3300025934 | Ga0207686_10054173 | Ga0207686_100541732 | 283 |
| 681 | 3300025936 | Ga0207670_10006340 | Ga0207670_100063402 | 283 |
| 682 | 3300025939 | Ga0207665_10062868 | Ga0207665_100628682 | 283 |
| 683 | 3300026095 | Ga0207676_10230196 | Ga0207676_102301962 | 283 |
| 684 | 3300026121 | Ga0207683_10027674 | Ga0207683_100276745 | 283 |
| 685 | 3300034819 | Ga0373958_0018017 | Ga0373958_0018017_67_939 | 283 |
| 686 | 3300035085 | Ga0373929_0004285 | Ga0373929_0004285_1523_2395 | 283 |
| 687 | 3300035114 | Ga0373939_0030504 | Ga0373939_0030504_36_908 | 283 |
| 688 | 3300035115 | Ga0373941_0062304 | Ga0373941_0062304_272_1144 | 283 |
| 689 | 3300035121 | Ga0373960_0033869 | Ga0373960_0033869_373_1245 | 283 |
| 690 | 3300035171 | Ga0373946_0015949 | Ga0373946_0015949_1694_2566 | 283 |
| 691 | 3300035691 | Ga0373931_0010579 | Ga0373931_0010579_1652_2524 | 283 |
| 692 | 3300035692 | Ga0373935_0207252 | Ga0373935_0207252_463_1335 | 283 |
| 693 | 3300037068 | Ga0373925_0241991 | Ga0373925_0241991_510_1382 | 283 |
| 694 | 3300045976 | Ga0466967_0123342 | Ga0466967_0123342_390_1262 | 283 |
| 695 | 3300046454 | Ga0495592_0181371 | Ga0495592_0181371_511_1383 | 283 |
| 696 | 3300046459 | Ga0495629_0056626 | Ga0495629_0056626_1742_2614 | 283 |
| 697 | 3300046516 | Ga0495628_0019247 | Ga0495628_0019247_2406_3278 | 283 |
| 698 | 3300046678 | Ga0495599_0069359 | Ga0495599_0069359_210_1082 | 283 |
| 699 | 3300046809 | Ga0495600_0065329 | Ga0495600_0065329_531_1403 | 283 |
| 700 | 3300047319 | Ga0495674_0072205 | Ga0495674_0072205_1788_2660 | 283 |
| 701 | 3300048903 | Ga0496100_0025862 | Ga0496100_0025862_33_905 | 283 |
| 702 | 3300048904 | Ga0496101_0040181 | Ga0496101_0040181_1873_2745 | 283 |
| 703 | 3300048906 | Ga0496103_0053084 | Ga0496103_0053084_1300_2172 | 283 |
| 704 | 3300048907 | Ga0496104_0001510 | Ga0496104_0001510_3139_4011 | 283 |
| 705 | 3300048908 | Ga0496105_0169121 | Ga0496105_0169121_21_893 | 283 |
| 706 | 3300048908 | Ga0496105_0177188 | Ga0496105_0177188_686_1558 | 283 |
| 707 | 3300048910 | Ga0496107_0076900 | Ga0496107_0076900_1517_2389 | 283 |
| 708 | 3300048912 | Ga0496109_0029186 | Ga0496109_0029186_1179_2051 | 283 |
| 709 | 3300048914 | Ga0496111_0003917 | Ga0496111_0003917_7013_7885 | 283 |
| 710 | 3300048916 | Ga0496113_0406480 | Ga0496113_0406480_200_1072 | 283 |
| 711 | 3300048917 | Ga0496114_0003256 | Ga0496114_0003256_1873_2745 | 283 |
| 712 | 3300048917 | Ga0496114_0024627 | Ga0496114_0024627_1044_1916 | 283 |
| 713 | 3300048918 | Ga0496115_0007434 | Ga0496115_0007434_6643_7515 | 283 |
| 714 | 3300048918 | Ga0496115_0399410 | Ga0496115_0399410_221_1093 | 283 |
| 715 | 3300049585 | Ga0501069_0260584 | Ga0501069_0260584_118_990 | 283 |
| 716 | 3300049742 | Ga0501080_0358848 | Ga0501080_0358848_200_1072 | 283 |
| 717 | 3300049744 | Ga0501083_0072513 | Ga0501083_0072513_532_1404 | 283 |
| 718 | 3300053077 | Ga0495601_0008578 | Ga0495601_0008578_3394_4266 | 283 |
| 719 | 3300053084 | Ga0495595_0022224 | Ga0495595_0022224_739_1611 | 283 |
| 720 | 3300053085 | Ga0495619_0023342 | Ga0495619_0023342_1292_2164 | 283 |
| 721 | 3300053142 | Ga0500577_0123562 | Ga0500577_0123562_113_985 | 283 |
| 722 | 3300005327 | Ga0070658_10145431 | Ga0070658_101454312 | 284 |
| 723 | 3300005336 | Ga0070680_100005559 | Ga0070680_1000055597 | 284 |
| 724 | 3300005458 | Ga0070681_10010872 | Ga0070681_100108724 | 284 |
| 725 | 3300005458 | Ga0070681_10361388 | Ga0070681_103613882 | 284 |
| 726 | 3300025917 | Ga0207660_10006590 | Ga0207660_100065906 | 284 |
| 727 | 3300025921 | Ga0207652_10037589 | Ga0207652_100375892 | 284 |
| 728 | 3300031344 | Ga0265316_10350671 | Ga0265316_103506711 | 284 |
| 729 | 3300035086 | Ga0373934_0040680 | Ga0373934_0040680_875_1747 | 284 |
| 730 | 3300035118 | Ga0373954_0081094 | Ga0373954_0081094_561_1433 | 284 |
| 731 | 3300035119 | Ga0373956_0075834 | Ga0373956_0075834_42_914 | 284 |
| 732 | 3300035172 | Ga0373955_0015722 | Ga0373955_0015722_711_1583 | 284 |
| 733 | 3300035724 | Ga0373933_0015863 | Ga0373933_0015863_778_1650 | 284 |
| 734 | 3300035725 | Ga0373947_0362426 | Ga0373947_0362426_74_946 | 284 |
| 735 | 3300036401 | Ga0373937_0026630 | Ga0373937_0026630_1391_2263 | 284 |
| 736 | 3300046462 | Ga0495651_0052129 | Ga0495651_0052129_1364_2236 | 284 |
| 737 | 3300046511 | Ga0495608_0107436 | Ga0495608_0107436_602_1474 | 284 |
| 738 | 3300046529 | Ga0495652_0208525 | Ga0495652_0208525_452_1324 | 284 |
| 739 | 3300046536 | Ga0495587_0010617 | Ga0495587_0010617_4536_5408 | 284 |
| 740 | 3300048088 | Ga0495602_0048936 | Ga0495602_0048936_971_1843 | 284 |
| 741 | 3300053077 | Ga0495601_0014203 | Ga0495601_0014203_1250_2122 | 284 |
| 742 | 3300053084 | Ga0495595_0002379 | Ga0495595_0002379_1733_2605 | 284 |
| 743 | 3300053085 | Ga0495619_0013279 | Ga0495619_0013279_2785_3657 | 284 |
| 744 | 3300005456 | Ga0070678_100079831 | Ga0070678_1000798312 | 285 |
| 745 | 3300044684 | Ga0466966_0160390 | Ga0466966_0160390_139_1011 | 285 |
| 746 | 3300044693 | Ga0466961_0083853 | Ga0466961_0083853_1112_1984 | 285 |
| 747 | 3300045049 | Ga0466959_0061748 | Ga0466959_0061748_89_961 | 285 |
| 748 | 3300045836 | Ga0466958_0012989 | Ga0466958_0012989_3520_4392 | 285 |
| 749 | 3300049568 | Ga0501031_0009007 | Ga0501031_0009007_2457_3329 | 285 |
| 750 | 3300049569 | Ga0501032_0008203 | Ga0501032_0008203_2773_3645 | 285 |
| 751 | 3300049570 | Ga0501033_0002756 | Ga0501033_0002756_1435_2307 | 285 |
| 752 | 3300049571 | Ga0501034_0003212 | Ga0501034_0003212_11475_12347 | 285 |
| 753 | 3300049572 | Ga0501036_0001549 | Ga0501036_0001549_13539_14411 | 285 |
| 754 | 3300049573 | Ga0501037_0001941 | Ga0501037_0001941_2619_3491 | 285 |
| 755 | 3300049574 | Ga0501038_0007422 | Ga0501038_0007422_3795_4667 | 285 |
| 756 | 3300049575 | Ga0501039_0019836 | Ga0501039_0019836_3538_4410 | 285 |
| 757 | 3300049579 | Ga0501043_0006170 | Ga0501043_0006170_6571_7443 | 285 |
| 758 | 3300049580 | Ga0501046_0003854 | Ga0501046_0003854_10801_11673 | 285 |
| 759 | 3300049581 | Ga0501047_0075851 | Ga0501047_0075851_2184_3056 | 285 |
| 760 | 3300049582 | Ga0501048_0003364 | Ga0501048_0003364_479_1351 | 285 |
| 761 | 3300049583 | Ga0501067_0017214 | Ga0501067_0017214_1578_2450 | 285 |
| 762 | 3300049585 | Ga0501069_0001642 | Ga0501069_0001642_9299_10171 | 285 |
| 763 | 3300049586 | Ga0501070_0017501 | Ga0501070_0017501_2184_3056 | 285 |
| 764 | 3300049586 | Ga0501070_0485513 | Ga0501070_0485513_44_916 | 285 |
| 765 | 3300049589 | Ga0501073_0011148 | Ga0501073_0011148_3563_4435 | 285 |
| 766 | 3300049590 | Ga0501074_0005415 | Ga0501074_0005415_5578_6450 | 285 |
| 767 | 3300049742 | Ga0501080_0013428 | Ga0501080_0013428_3268_4140 | 285 |
| 768 | 3300049744 | Ga0501083_0003165 | Ga0501083_0003165_2368_3240 | 285 |
| 769 | 3300049822 | Ga0501035_0091047 | Ga0501035_0091047_378_1250 | 285 |
| 770 | 3300049823 | Ga0501044_0035396 | Ga0501044_0035396_1452_2324 | 285 |
| 771 | 3300049823 | Ga0501044_0112450 | Ga0501044_0112450_193_1065 | 285 |
| 772 | 3300049824 | Ga0501045_0371417 | Ga0501045_0371417_162_1034 | 285 |
| 773 | 3300060353 | Ga0501082_0070012 | Ga0501082_0070012_10_882 | 285 |
| 774 | 3300025929 | Ga0207664_10018705 | Ga0207664_100187052 | 286 |
| 775 | 3300028381 | Ga0268264_10060114 | Ga0268264_100601142 | 286 |
| 776 | 2209111006 | 2214800757 | 2213830073 | 290 |
| 777 | 3300000041 | ARcpr5oldR_c000270 | ARcpr5oldR_0002705 | 290 |
| 778 | 3300000043 | ARcpr5yngRDRAFT_c000228 | ARcpr5yngRDRAFT_0002285 | 290 |
| 779 | 3300000044 | ARSoilOldRDRAFT_c000005 | ARSoilOldRDRAFT_00000533 | 290 |
| 780 | 3300000652 | ARCol0yngRDRAFT_1000214 | ARCol0yngRDRAFT_10002147 | 290 |
| 781 | 3300005277 | Ga0065716_1002539 | Ga0065716_10025392 | 290 |
| 782 | 3300005290 | Ga0065712_10071205 | Ga0065712_100712054 | 290 |
| 783 | 3300005293 | Ga0065715_10003092 | Ga0065715_100030924 | 290 |
| 784 | 3300005327 | Ga0070658_10010555 | Ga0070658_100105553 | 290 |
| 785 | 3300005328 | Ga0070676_10038494 | Ga0070676_100384942 | 290 |
| 786 | 3300005330 | Ga0070690_100026597 | Ga0070690_1000265972 | 290 |
| 787 | 3300005336 | Ga0070680_100018993 | Ga0070680_1000189936 | 290 |
| 788 | 3300005336 | Ga0070680_100033893 | Ga0070680_1000338934 | 290 |
| 789 | 3300005339 | Ga0070660_100022813 | Ga0070660_1000228134 | 290 |
| 790 | 3300005339 | Ga0070660_100115004 | Ga0070660_1001150042 | 290 |
| 791 | 3300005340 | Ga0070689_100027712 | Ga0070689_1000277124 | 290 |
| 792 | 3300005341 | Ga0070691_10019887 | Ga0070691_100198872 | 290 |
| 793 | 3300005343 | Ga0070687_100002166 | Ga0070687_1000021668 | 290 |
| 794 | 3300005353 | Ga0070669_100019391 | Ga0070669_1000193915 | 290 |
| 795 | 3300005355 | Ga0070671_100148084 | Ga0070671_1001480842 | 290 |
| 796 | 3300005364 | Ga0070673_100301922 | Ga0070673_1003019221 | 290 |
| 797 | 3300005366 | Ga0070659_100013492 | Ga0070659_1000134924 | 290 |
| 798 | 3300005406 | Ga0070703_10052760 | Ga0070703_100527602 | 290 |
| 799 | 3300005438 | Ga0070701_10116682 | Ga0070701_101166822 | 290 |
| 800 | 3300005440 | Ga0070705_100029174 | Ga0070705_1000291742 | 290 |
| 801 | 3300005445 | Ga0070708_100327919 | Ga0070708_1003279192 | 290 |
| 802 | 3300005457 | Ga0070662_100073764 | Ga0070662_1000737642 | 290 |
| 803 | 3300005458 | Ga0070681_10031579 | Ga0070681_100315795 | 290 |
| 804 | 3300005458 | Ga0070681_10071764 | Ga0070681_100717644 | 290 |
| 805 | 3300005459 | Ga0068867_100008460 | Ga0068867_1000084605 | 290 |
| 806 | 3300005530 | Ga0070679_100079455 | Ga0070679_1000794553 | 290 |
| 807 | 3300005530 | Ga0070679_100109883 | Ga0070679_1001098833 | 290 |
| 808 | 3300005530 | Ga0070679_100378451 | Ga0070679_1003784512 | 290 |
| 809 | 3300005535 | Ga0070684_100018534 | Ga0070684_1000185343 | 290 |
| 810 | 3300005539 | Ga0068853_100009738 | Ga0068853_1000097385 | 290 |
| 811 | 3300005545 | Ga0070695_100006266 | Ga0070695_1000062665 | 290 |
| 812 | 3300005546 | Ga0070696_100011088 | Ga0070696_1000110884 | 290 |
| 813 | 3300005547 | Ga0070693_100038707 | Ga0070693_1000387072 | 290 |
| 814 | 3300005563 | Ga0068855_100042633 | Ga0068855_1000426334 | 290 |
| 815 | 3300005563 | Ga0068855_100082057 | Ga0068855_1000820572 | 290 |
| 816 | 3300005577 | Ga0068857_100037356 | Ga0068857_1000373562 | 290 |
| 817 | 3300005578 | Ga0068854_100065614 | Ga0068854_1000656144 | 290 |
| 818 | 3300005616 | Ga0068852_100188954 | Ga0068852_1001889542 | 290 |
| 819 | 3300005617 | Ga0068859_100006249 | Ga0068859_1000062496 | 290 |
| 820 | 3300005719 | Ga0068861_100051085 | Ga0068861_1000510852 | 290 |
| 821 | 3300005843 | Ga0068860_100036815 | Ga0068860_1000368152 | 290 |
| 822 | 3300006881 | Ga0068865_100017724 | Ga0068865_1000177242 | 290 |
| 823 | 3300006931 | Ga0097620_100006249 | Ga0097620_1000062498 | 290 |
| 824 | 3300009093 | Ga0105240_10110217 | Ga0105240_101102173 | 290 |
| 825 | 3300009093 | Ga0105240_10545184 | Ga0105240_105451842 | 290 |
| 826 | 3300009094 | Ga0111539_10024894 | Ga0111539_100248943 | 290 |
| 827 | 3300009098 | Ga0105245_10351569 | Ga0105245_103515692 | 290 |
| 828 | 3300009148 | Ga0105243_10216616 | Ga0105243_102166162 | 290 |
| 829 | 3300009174 | Ga0105241_10268296 | Ga0105241_102682962 | 290 |
| 830 | 3300009545 | Ga0105237_10044779 | Ga0105237_100447794 | 290 |
| 831 | 3300009553 | Ga0105249_10029951 | Ga0105249_100299513 | 290 |
| 832 | 3300010375 | Ga0105239_10069833 | Ga0105239_100698334 | 290 |
| 833 | 3300011119 | Ga0105246_10070968 | Ga0105246_100709682 | 290 |
| 834 | 3300012494 | Ga0157341_1000733 | Ga0157341_10007332 | 290 |
| 835 | 3300013102 | Ga0157371_10034311 | Ga0157371_100343112 | 290 |
| 836 | 3300013105 | Ga0157369_10049987 | Ga0157369_100499872 | 290 |
| 837 | 3300013306 | Ga0163162_10028781 | Ga0163162_100287815 | 290 |
| 838 | 3300013308 | Ga0157375_10025426 | Ga0157375_100254264 | 290 |
| 839 | 3300025271 | Ga0207666_1000322 | Ga0207666_10003224 | 290 |
| 840 | 3300025315 | Ga0207697_10003133 | Ga0207697_100031335 | 290 |
| 841 | 3300025885 | Ga0207653_10022395 | Ga0207653_100223952 | 290 |
| 842 | 3300025904 | Ga0207647_10007789 | Ga0207647_100077895 | 290 |
| 843 | 3300025909 | Ga0207705_10034529 | Ga0207705_100345294 | 290 |
| 844 | 3300025912 | Ga0207707_10025856 | Ga0207707_100258564 | 290 |
| 845 | 3300025913 | Ga0207695_10061716 | Ga0207695_100617163 | 290 |
| 846 | 3300025914 | Ga0207671_10124502 | Ga0207671_101245022 | 290 |
| 847 | 3300025917 | Ga0207660_10024675 | Ga0207660_100246752 | 290 |
| 848 | 3300025917 | Ga0207660_10125248 | Ga0207660_101252482 | 290 |
| 849 | 3300025918 | Ga0207662_10003619 | Ga0207662_100036199 | 290 |
| 850 | 3300025919 | Ga0207657_10018063 | Ga0207657_100180636 | 290 |
| 851 | 3300025919 | Ga0207657_10040159 | Ga0207657_100401592 | 290 |
| 852 | 3300025921 | Ga0207652_10007586 | Ga0207652_100075866 | 290 |
| 853 | 3300025921 | Ga0207652_10057175 | Ga0207652_100571753 | 290 |
| 854 | 3300025923 | Ga0207681_10075201 | Ga0207681_100752012 | 290 |
| 855 | 3300025933 | Ga0207706_10013528 | Ga0207706_100135285 | 290 |
| 856 | 3300025936 | Ga0207670_10052750 | Ga0207670_100527501 | 290 |
| 857 | 3300025940 | Ga0207691_10040902 | Ga0207691_100409023 | 290 |
| 858 | 3300025944 | Ga0207661_10510291 | Ga0207661_105102912 | 290 |
| 859 | 3300025949 | Ga0207667_10035043 | Ga0207667_100350433 | 290 |
| 860 | 3300025981 | Ga0207640_10097227 | Ga0207640_100972272 | 290 |
| 861 | 3300025981 | Ga0207640_10118214 | Ga0207640_101182142 | 290 |
| 862 | 3300026075 | Ga0207708_10007940 | Ga0207708_100079405 | 290 |
| 863 | 3300026089 | Ga0207648_10013532 | Ga0207648_100135325 | 290 |
| 864 | 3300026118 | Ga0207675_100022012 | Ga0207675_1000220123 | 290 |
| 865 | 3300027682 | Ga0209971_1010514 | Ga0209971_10105142 | 290 |
| 866 | 3300027717 | Ga0209998_10001194 | Ga0209998_100011945 | 290 |
| 867 | 3300027907 | Ga0207428_10028987 | Ga0207428_100289873 | 290 |
| 868 | 3300028556 | Ga0265337_1003126 | Ga0265337_10031265 | 290 |
| 869 | 3300031247 | Ga0265340_10045716 | Ga0265340_100457163 | 290 |
| 870 | 3300031595 | Ga0265313_10000251 | Ga0265313_100002515 | 290 |
| 871 | 3300034818 | Ga0373950_0000743 | Ga0373950_0000743_2829_3701 | 290 |
| 872 | 3300034819 | Ga0373958_0000470 | Ga0373958_0000470_3267_4139 | 290 |
| 873 | 3300034820 | Ga0373959_0031410 | Ga0373959_0031410_129_1001 | 290 |
| 874 | 3300034957 | Ga0373938_0001451 | Ga0373938_0001451_313_1185 | 290 |
| 875 | 3300035085 | Ga0373929_0001366 | Ga0373929_0001366_3261_4133 | 290 |
| 876 | 3300035091 | Ga0373951_0011872 | Ga0373951_0011872_412_1284 | 290 |
| 877 | 3300035112 | Ga0373932_0004396 | Ga0373932_0004396_282_1154 | 290 |
| 878 | 3300035115 | Ga0373941_0009490 | Ga0373941_0009490_550_1422 | 290 |
| 879 | 3300035121 | Ga0373960_0023248 | Ga0373960_0023248_666_1538 | 290 |
| 880 | 3300035207 | Ga0373942_0001422 | Ga0373942_0001422_2527_3399 | 290 |
| 881 | 3300035241 | Ga0373961_0005463 | Ga0373961_0005463_1408_2280 | 290 |
| 882 | 3300035242 | Ga0373962_0000508 | Ga0373962_0000508_4610_5482 | 290 |
| 883 | 3300035691 | Ga0373931_0038830 | Ga0373931_0038830_1409_2281 | 290 |
| 884 | 3300042437 | Ga0439444_0006674 | Ga0439444_0006674_357_1229 | 290 |
| 885 | 3300042439 | Ga0439464_0031250 | Ga0439464_0031250_549_1421 | 290 |
| 886 | 3300044842 | Ga0466957_0013670 | Ga0466957_0013670_3231_4103 | 290 |
| 887 | 3300045051 | Ga0451576_0335539 | Ga0451576_0335539_360_1232 | 290 |
| 888 | 3300045836 | Ga0466958_0040988 | Ga0466958_0040988_1843_2715 | 290 |
| 889 | 3300048904 | Ga0496101_0206108 | Ga0496101_0206108_413_1285 | 290 |
| 890 | 3300048905 | Ga0496102_0047873 | Ga0496102_0047873_50_922 | 290 |
| 891 | 3300048907 | Ga0496104_0581024 | Ga0496104_0581024_23_895 | 290 |
| 892 | 3300048910 | Ga0496107_0013279 | Ga0496107_0013279_1129_2001 | 290 |
| 893 | 3300048912 | Ga0496109_0162424 | Ga0496109_0162424_285_1157 | 290 |
| 894 | 3300048916 | Ga0496113_0051395 | Ga0496113_0051395_1279_2151 | 290 |
| 895 | 3300049569 | Ga0501032_0085558 | Ga0501032_0085558_297_1169 | 290 |
| 896 | 3300049571 | Ga0501034_0392728 | Ga0501034_0392728_15_887 | 290 |
| 897 | 3300049571 | Ga0501034_0538010 | Ga0501034_0538010_192_1064 | 290 |
| 898 | 3300049573 | Ga0501037_0091349 | Ga0501037_0091349_581_1453 | 290 |
| 899 | 3300049574 | Ga0501038_0165033 | Ga0501038_0165033_93_965 | 290 |
| 900 | 3300049574 | Ga0501038_0324056 | Ga0501038_0324056_136_1008 | 290 |
| 901 | 3300049575 | Ga0501039_0431439 | Ga0501039_0431439_38_910 | 290 |
| 902 | 3300049585 | Ga0501069_0035480 | Ga0501069_0035480_1337_2209 | 290 |
| 903 | 3300049586 | Ga0501070_0018859 | Ga0501070_0018859_3265_4137 | 290 |
| 904 | 3300049586 | Ga0501070_0089422 | Ga0501070_0089422_1033_1905 | 290 |
| 905 | 3300049586 | Ga0501070_0119679 | Ga0501070_0119679_269_1141 | 290 |
| 906 | 3300049588 | Ga0501072_0018965 | Ga0501072_0018965_3844_4716 | 290 |
| 907 | 3300049589 | Ga0501073_0182783 | Ga0501073_0182783_515_1387 | 290 |
| 908 | 3300049744 | Ga0501083_0020293 | Ga0501083_0020293_3207_4079 | 290 |
| 909 | 3300049744 | Ga0501083_0042163 | Ga0501083_0042163_1022_1894 | 290 |
| 910 | 3300049822 | Ga0501035_0001156 | Ga0501035_0001156_18631_19503 | 290 |
| 911 | 3300049823 | Ga0501044_0087078 | Ga0501044_0087078_659_1531 | 290 |
| 912 | 3300050515 | nmdc:mga0a205_277689_c1 | nmdc:mga0a205_277689_c1_560_1432 | 290 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5539 | 7 | 273 |
| 4dbl-assembly2.cif.gz_F | crystal structure of e159q mutant of btucdf | 0.5457 | 7 | 279 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5418 | 7 | 279 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5405 | 7 | 279 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.532 | 7 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8566 | 8 | 277 | 1.10.3470.10 |
| af_P0AGI4_56_383_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8208 | 8 | 277 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8195 | 8 | 277 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8186 | 9 | 277 | 1.10.3470.10 |
| af_P37772_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8147 | 9 | 277 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9K6A8-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9507 | 1 | 244 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A537JDJ2-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9496 | 9 | 211 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A535E139-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9474 | 9 | 230 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A1F7P391-F1-model_v4 | ABC transporter permease | 0.943 | 1 | 276 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A7Z9K6A8-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.943 | 1 | 244 |
GO:0005886
GO:0006865 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar