F485489
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 911 | 778 | 285 | 460 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221609|2644061966 |
| Length | 460 |
| Sequence | DYDLFVIGGGSGGVRAGRVAASLGKRVAVAEEYRFGGTCVIRGCVPKKLFVYASQFHEHFEDAAGYGWQVGTPTFDWKALIAAKDKEIARLEGLYRRGLDTNGAEIIDSRAELVDAHTVRLVASGKTVTAERIVIATGGAPNPHAALPGHELCISSNEAFDLAKLPRSILIAGGGYIAVEFANIFHGLGVQVTLIYRGKEILSRFDHDMRQGLHKAMVDKGIRILLADVIENVAKVEGAGGGLIATTKNGETIAVDTVMLALGRDPNTRGLGLEAAGVAMDERGAIIVDPYSRTNVPSIWALGDVTNRVQLTPVAIHEAMCFIETEYRGKPTVPDHDLIATAVFSQPEIGTVGLSEEDAAQRYAEIEVYRAEFRPMKATLSGRAEKMIMKLVVDAASRKVLGAHILGHDAGEMVQLLGISLKAGVTKDDFDRTMAVHPTASEELVTMYQPSYRIKNGQRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 10 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 11 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 12 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 16 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 17 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 20 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 21 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 22 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 23 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 24 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 25 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 26 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 27 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 28 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 29 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 30 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 31 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 32 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 33 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 34 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 35 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 36 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 37 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 38 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 39 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 40 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 41 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 42 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 43 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 44 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 45 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 46 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 47 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 48 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 49 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 50 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 51 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 52 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 53 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 54 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 55 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 56 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 57 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 58 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 59 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 60 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 61 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 62 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 63 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 64 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 65 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 66 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 67 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 68 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 69 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 70 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 71 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 72 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 73 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 74 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 75 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 76 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 77 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 78 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 79 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 80 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 81 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 82 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 83 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 84 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 85 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 86 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 87 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 88 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 89 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 90 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 91 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 92 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 93 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 94 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 95 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 96 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 97 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 98 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 99 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 100 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 101 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 102 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 103 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 104 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 105 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 106 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 107 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 108 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 109 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 110 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 111 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 112 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 113 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 114 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 115 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 116 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 117 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 118 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 119 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 120 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 121 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 122 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 123 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 124 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 125 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 126 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 127 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 128 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 129 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 130 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 131 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 132 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 133 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 134 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 135 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 136 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 137 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 138 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 139 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 140 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 141 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 142 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 143 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 144 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 145 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 146 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 147 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 148 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 149 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 150 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 151 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 152 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 153 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 154 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 155 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 156 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 157 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 158 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 159 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 160 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 161 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 162 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 163 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 164 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 165 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 166 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 167 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 168 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 169 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 170 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 171 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 172 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 173 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 174 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 175 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 176 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 177 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 178 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 179 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 180 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 181 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 182 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 183 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 184 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 185 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 186 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 187 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 188 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 189 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 190 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 191 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 192 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 193 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 194 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 195 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 196 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 197 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 198 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 199 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 200 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 201 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 202 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 203 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 204 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 205 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 206 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 207 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 208 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 209 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 210 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 211 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 212 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 213 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 214 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 215 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 216 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 217 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 218 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 219 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 220 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 221 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 222 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 223 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 224 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 225 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 226 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 227 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 228 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 229 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 230 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 231 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 232 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 233 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 234 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 235 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 236 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 237 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 238 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 239 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 240 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 241 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 242 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 243 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 244 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 245 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 246 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 247 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 248 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 249 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 250 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 251 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 252 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 253 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 254 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 255 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 256 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 257 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 258 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 259 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 260 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 261 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 262 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 263 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 264 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 265 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 266 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 267 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 268 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 269 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 270 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 271 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 272 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 273 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 274 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 275 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 276 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 277 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 278 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 279 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 280 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 281 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 282 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 283 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 284 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 285 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 286 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 287 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 288 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 289 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 290 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 291 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 292 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 293 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 294 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 295 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 296 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 297 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 298 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 299 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 300 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 301 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 302 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 303 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 304 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 305 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 306 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 307 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 308 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 309 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 310 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 311 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 312 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 313 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 314 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 315 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 316 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 317 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 318 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 319 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 320 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 321 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 322 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 323 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 324 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 325 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 326 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 327 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 328 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 329 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 330 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 331 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 332 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 333 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 334 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 335 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 336 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 337 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 338 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 339 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 340 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 341 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 342 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 343 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 344 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 345 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 346 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 347 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 348 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 349 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 350 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 351 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 352 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 353 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 354 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 355 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 356 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 357 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 358 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 359 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 360 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 361 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 362 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 363 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 364 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 365 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 366 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 367 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 368 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 369 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 370 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 371 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 372 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 373 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 374 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 375 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 376 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 377 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 378 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 379 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 380 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 381 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 382 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 383 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 384 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 385 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 386 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 387 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 388 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 389 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 390 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 391 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 392 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 393 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 394 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 395 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 396 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 397 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 398 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 399 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 400 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 401 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 402 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 403 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 404 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 405 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 406 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 407 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 408 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 409 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 410 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 411 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 412 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 413 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 414 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 415 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 416 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 417 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 418 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 419 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 420 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 421 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 422 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 423 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 424 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 425 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 426 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 427 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 428 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 429 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 430 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 431 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 432 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 433 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 434 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 435 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 436 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 437 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 438 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 439 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 440 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 441 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 442 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 443 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 444 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 445 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 446 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 447 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 448 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 449 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 450 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 451 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 452 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 453 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 454 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 455 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 456 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 457 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 458 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 459 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 460 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 461 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 462 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 463 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 464 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 465 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 466 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 467 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 468 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 469 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 470 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 471 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 472 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 473 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 474 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 475 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 476 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 477 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 478 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 479 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 480 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 481 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 482 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 483 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 484 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 485 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 486 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 487 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 488 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 489 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 490 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 491 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 492 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 493 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 494 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 495 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 496 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 497 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 498 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 499 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 500 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 501 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 502 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 503 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 504 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 505 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 506 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 507 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 508 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 509 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 510 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 511 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 512 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 513 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 514 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 515 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 516 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 517 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 518 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 519 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 520 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 521 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 522 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 523 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 524 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 525 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 526 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 527 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 528 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 529 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 530 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 531 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 532 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 533 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 534 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 535 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 536 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 537 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 538 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 539 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 540 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 541 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 542 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 543 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 544 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 545 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 546 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 547 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 548 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 549 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 550 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 551 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 552 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 553 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 554 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 555 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 556 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 557 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 558 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 559 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 560 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 561 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 562 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 563 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 564 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 565 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 566 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 567 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 568 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 569 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 570 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 571 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 572 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 573 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 574 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 575 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 576 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 577 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 578 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 579 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 580 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 581 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 582 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 583 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 584 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 585 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 586 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 587 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 588 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 589 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 590 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 591 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 592 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 593 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 594 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 595 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 596 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 597 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 598 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 599 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 600 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 601 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 602 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 603 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 604 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 605 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 606 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 607 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 608 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 609 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 610 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 611 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 612 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 613 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 614 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 615 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 616 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 617 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 618 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 619 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 620 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 621 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 622 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 623 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 624 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 625 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 626 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 627 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 628 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 629 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 630 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 631 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 632 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 633 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 634 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 635 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 636 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 637 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 638 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 639 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 640 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 641 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 642 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 643 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 644 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 645 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 646 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 647 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 648 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 649 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 650 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 651 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 652 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 653 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 654 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 655 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 656 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 657 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 658 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 659 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 660 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 661 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 662 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 663 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 664 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 665 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 666 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 667 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 668 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 669 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 670 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 671 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 672 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 673 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 674 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 675 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 676 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 677 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 678 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 679 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 680 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 681 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 682 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 683 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 684 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 685 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 686 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 687 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 688 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 689 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 690 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 696 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 697 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 698 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 699 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 700 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 701 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 702 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 703 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 704 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 705 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 706 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 707 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 708 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 709 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 710 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 711 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 712 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 713 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 714 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 715 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 716 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 717 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 718 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 719 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 720 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 721 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 722 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 723 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 724 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 725 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 726 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 727 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 728 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 729 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 730 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 731 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 732 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 733 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 734 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 735 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 736 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 737 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 738 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 739 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 740 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 741 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 742 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 743 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 744 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 745 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 746 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 747 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 748 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 749 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 750 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 751 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 752 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 753 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 754 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 755 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 756 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 757 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 758 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 759 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 760 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 761 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 762 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 763 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 764 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 765 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 766 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 767 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 768 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 769 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 770 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 771 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 772 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 773 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 774 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 775 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 776 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 777 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 778 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 31.17 |
| Metatranscriptomes | 0.11 |
| Isolates | 68.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.55 |
| Bulb | 0 |
| Endosphere | 9.66 |
| Nodule | 52.36 |
| Rhizoplane | 1.43 |
| Rhizosphere | 18.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10006473 | 3300001989 | Bacteria | 4419 |
| 2 | JGI25157J39369_1000750 | 3300002741 | Bacteria | 17062 |
| 3 | JGI25152J39213_1010229 | 3300002773 | Bacteria | 2164 |
| 4 | JGI25151J46595_10000134 | 3300003187 | Bacteria | 98987 |
| 5 | JGI25151J46595_10028641 | 3300003187 | Bacteria | 2216 |
| 6 | JGI25165J46597_1000033 | 3300003214 | Bacteria | 293030 |
| 7 | JGI25153J46596_10001403 | 3300003215 | Bacteria | 14441 |
| 8 | JGI25153J46596_10011152 | 3300003215 | Bacteria | 3996 |
| 9 | JGI25160J50197_1000011 | 3300003354 | Bacteria | 275577 |
| 10 | JGI25160J50197_1000572 | 3300003354 | Bacteria | 20786 |
| 11 | JGI25161J50226_1000232 | 3300003374 | Bacteria | 34042 |
| 12 | JGI25161J50226_1001043 | 3300003374 | Bacteria | 9517 |
| 13 | Ga0006562J51391_1008942 | 3300003578 | Bacteria | 4280 |
| 14 | Ga0055542_1000654 | 3300003762 | Bacteria | 28482 |
| 15 | Ga0055529_1002419 | 3300003763 | Bacteria | 3634 |
| 16 | Ga0055526_1002003 | 3300003771 | Bacteria | 14035 |
| 17 | Ga0055526_1003319 | 3300003771 | Bacteria | 10294 |
| 18 | Ga0055524_1001915 | 3300003775 | Bacteria | 11254 |
| 19 | Ga0055536_1002697 | 3300003781 | Bacteria | 9850 |
| 20 | Ga0055528_1001460 | 3300003790 | Bacteria | 14399 |
| 21 | Ga0055531_10000733 | 3300003794 | Bacteria | 27746 |
| 22 | Ga0055531_10013794 | 3300003794 | Bacteria | 3698 |
| 23 | Ga0058692_1001202 | 3300003856 | Bacteria | 9918 |
| 24 | Ga0058692_1004873 | 3300003856 | Bacteria | 3902 |
| 25 | Ga0055543_1000354 | 3300004625 | Bacteria | 31120 |
| 26 | Ga0055543_1002191 | 3300004625 | Bacteria | 6697 |
| 27 | Ga0065165_1000018 | 3300005262 | Bacteria | 275082 |
| 28 | Ga0065165_1001860 | 3300005262 | Bacteria | 20499 |
| 29 | Ga0065165_1009367 | 3300005262 | Bacteria | 4403 |
| 30 | Ga0065704_10072842 | 3300005289 | Bacteria | 7936 |
| 31 | Ga0070665_100060247 | 3300005548 | Bacteria | 3805 |
| 32 | Ga0068856_100280332 | 3300005614 | Bacteria | 1683 |
| 33 | Ga0081539_10001646 | 3300005985 | Bacteria | 36279 |
| 34 | Ga0075365_10002027 | 3300006038 | Bacteria | 9621 |
| 35 | Ga0075365_10047938 | 3300006038 | Bacteria | 2810 |
| 36 | Ga0075365_10114197 | 3300006038 | Bacteria | 1858 |
| 37 | Ga0075368_10013307 | 3300006042 | Bacteria | 3020 |
| 38 | Ga0075363_100066825 | 3300006048 | Bacteria | 1947 |
| 39 | Ga0075364_10003103 | 3300006051 | Bacteria | 9397 |
| 40 | Ga0075362_10002505 | 3300006177 | Bacteria | 6180 |
| 41 | Ga0075362_10028613 | 3300006177 | Bacteria | 2394 |
| 42 | Ga0075367_10027101 | 3300006178 | Bacteria | 3256 |
| 43 | Ga0075367_10058803 | 3300006178 | Bacteria | 2287 |
| 44 | Ga0075367_10117277 | 3300006178 | Bacteria | 1638 |
| 45 | Ga0075369_10012429 | 3300006186 | Bacteria | 3364 |
| 46 | Ga0079104_1000022 | 3300006946 | Bacteria | 223522 |
| 47 | Ga0079104_1004678 | 3300006946 | Bacteria | 5739 |
| 48 | Ga0079104_1007604 | 3300006946 | Bacteria | 3895 |
| 49 | Ga0099826_10000184 | 3300006948 | Bacteria | 26251 |
| 50 | Ga0099826_10009956 | 3300006948 | Bacteria | 7107 |
| 51 | Ga0105237_10180725 | 3300009545 | Bacteria | 2110 |
| 52 | Ga0105238_10028151 | 3300009551 | Bacteria | 5725 |
| 53 | Ga0123342_1000455 | 3300009766 | Bacteria | 64500 |
| 54 | Ga0157371_10000015 | 3300013102 | Bacteria | 339838 |
| 55 | Ga0157371_10004053 | 3300013102 | Bacteria | 12959 |
| 56 | Ga0157370_10001244 | 3300013104 | Bacteria | 31808 |
| 57 | Ga0157370_10001762 | 3300013104 | Bacteria | 26694 |
| 58 | Ga0171463_1008 | 3300013249 | Bacteria | 299022 |
| 59 | Ga0182008_10020318 | 3300014497 | Bacteria | 3421 |
| 60 | Ga0182006_1006962 | 3300015261 | Bacteria | 5205 |
| 61 | Ga0183363_1212 | 3300015690 | Bacteria | 11717 |
| 62 | Ga0214544_1000691 | 3300021320 | Bacteria | 64943 |
| 63 | Ga0214542_1000019 | 3300021321 | Bacteria | 199445 |
| 64 | Ga0214542_1022261 | 3300021321 | Bacteria | 4105 |
| 65 | Ga0214543_1000010 | 3300021327 | Bacteria | 364844 |
| 66 | Ga0214543_1000011 | 3300021327 | Bacteria | 344093 |
| 67 | Ga0228711_1000007 | 3300022739 | Bacteria | 202413 |
| 68 | Ga0228710_1000007 | 3300022740 | Bacteria | 189104 |
| 69 | Ga0209436_100281 | 3300025208 | Bacteria | 23411 |
| 70 | Ga0207425_1004590 | 3300025245 | Bacteria | 4100 |
| 71 | Ga0207425_1010512 | 3300025245 | Bacteria | 2250 |
| 72 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 73 | Ga0209148_1000072 | 3300025254 | Bacteria | 325292 |
| 74 | Ga0209759_1000146 | 3300025256 | Bacteria | 121497 |
| 75 | Ga0209129_1000659 | 3300025258 | Bacteria | 23019 |
| 76 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 77 | Ga0209455_1000153 | 3300025272 | Bacteria | 124411 |
| 78 | Ga0209673_1000552 | 3300025273 | Bacteria | 60264 |
| 79 | Ga0209130_1000029 | 3300025284 | Bacteria | 323399 |
| 80 | Ga0209676_1001236 | 3300025292 | Bacteria | 26898 |
| 81 | Ga0209676_1001652 | 3300025292 | Bacteria | 19497 |
| 82 | Ga0209025_1000094 | 3300025294 | Bacteria | 241080 |
| 83 | Ga0209025_1000119 | 3300025294 | Bacteria | 210606 |
| 84 | Ga0209025_1000166 | 3300025294 | Bacteria | 164692 |
| 85 | Ga0209025_1000843 | 3300025294 | Bacteria | 48547 |
| 86 | Ga0209025_1032078 | 3300025294 | Bacteria | 2466 |
| 87 | Ga0209564_1000469 | 3300025295 | Bacteria | 67659 |
| 88 | Ga0209564_1000501 | 3300025295 | Bacteria | 64474 |
| 89 | Ga0209758_1000155 | 3300025297 | Bacteria | 160455 |
| 90 | Ga0209758_1000218 | 3300025297 | Bacteria | 124300 |
| 91 | Ga0209758_1047111 | 3300025297 | Bacteria | 1547 |
| 92 | Ga0209050_1003018 | 3300025298 | Bacteria | 13041 |
| 93 | Ga0209256_1000194 | 3300025299 | Bacteria | 116709 |
| 94 | Ga0209256_1000946 | 3300025299 | Bacteria | 35213 |
| 95 | Ga0209256_1001513 | 3300025299 | Bacteria | 23507 |
| 96 | Ga0207426_1000039 | 3300025302 | Bacteria | 439937 |
| 97 | Ga0207426_1000074 | 3300025302 | Bacteria | 323399 |
| 98 | Ga0209051_1000998 | 3300025303 | Bacteria | 27177 |
| 99 | Ga0209051_1002938 | 3300025303 | Bacteria | 11659 |
| 100 | Ga0207647_10006306 | 3300025904 | Bacteria | 8636 |
| 101 | Ga0207694_10033071 | 3300025924 | Bacteria | 3961 |
| 102 | Ga0207640_10032392 | 3300025981 | Bacteria | 3240 |
| 103 | Ga0207702_10139406 | 3300026078 | Bacteria | 2192 |
| 104 | Ga0209281_1000036 | 3300027111 | Bacteria | 369415 |
| 105 | Ga0209281_1000047 | 3300027111 | Bacteria | 326514 |
| 106 | Ga0209281_1000128 | 3300027111 | Bacteria | 199265 |
| 107 | Ga0209281_1000483 | 3300027111 | Bacteria | 55407 |
| 108 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 109 | Ga0209371_1001463 | 3300027312 | Bacteria | 15921 |
| 110 | Ga0209282_1000034 | 3300027666 | Bacteria | 140100 |
| 111 | Ga0209282_1003372 | 3300027666 | Bacteria | 9484 |
| 112 | Ga0209282_1004065 | 3300027666 | Bacteria | 8797 |
| 113 | Ga0268266_10021580 | 3300028379 | Bacteria | 5485 |
| 114 | Ga0268266_10042265 | 3300028379 | Bacteria | 3893 |
| 115 | Ga0307515_10000023 | 3300028794 | Bacteria | 400846 |
| 116 | Ga0307515_10000945 | 3300028794 | Bacteria | 66458 |
| 117 | Ga0307515_10009074 | 3300028794 | Bacteria | 19290 |
| 118 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 119 | Ga0268256_1005833 | 3300030500 | Bacteria | 4732 |
| 120 | Ga0316181_1152995 | 3300030744 | Bacteria | 3207 |
| 121 | Ga0307513_10002881 | 3300031456 | Bacteria | 23553 |
| 122 | Ga0315914_1000010 | 3300031967 | Bacteria | 171642 |
| 123 | Ga0307414_10143029 | 3300032004 | Bacteria | 1875 |
| 124 | Ga0315913_1000005 | 3300033430 | Bacteria | 171651 |
| 125 | Ga0315915_1000012 | 3300033464 | Bacteria | 199284 |
| 126 | Ga0395899_0000073 | 3300037312 | Bacteria | 181387 |
| 127 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 128 | Ga0395900_0143628 | 3300037418 | Bacteria | 2442 |
| 129 | Ga0395900_0240765 | 3300037418 | Bacteria | 1815 |
| 130 | Ga0395898_0000043 | 3300037466 | Bacteria | 301783 |
| 131 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 132 | Ga0395905_0064647 | 3300037471 | Bacteria | 3424 |
| 133 | Ga0395905_0125508 | 3300037471 | Bacteria | 2413 |
| 134 | Ga0395905_0189378 | 3300037471 | Bacteria | 1930 |
| 135 | Ga0395905_0268954 | 3300037471 | Bacteria | 1590 |
| 136 | Ga0395901_0000056 | 3300038443 | Bacteria | 154356 |
| 137 | Ga0395901_0105657 | 3300038443 | Bacteria | 2955 |
| 138 | Ga0395901_0219947 | 3300038443 | Bacteria | 1985 |
| 139 | Ga0439436_0013760 | 3300041404 | Bacteria | 2446 |
| 140 | Ga0450920_004347 | 3300042122 | Bacteria | 2486 |
| 141 | Ga0439434_0018339 | 3300042435 | Bacteria | 2095 |
| 142 | Ga0450918_000667 | 3300042531 | Bacteria | 7314 |
| 143 | Ga0466972_0023536 | 3300044658 | Bacteria | 3062 |
| 144 | Ga0466965_0042987 | 3300044683 | Bacteria | 2230 |
| 145 | Ga0466968_0018122 | 3300044735 | Bacteria | 2822 |
| 146 | Ga0466968_0019776 | 3300044735 | Bacteria | 2714 |
| 147 | Ga0466970_0006625 | 3300044765 | Bacteria | 5793 |
| 148 | Ga0466960_0057972 | 3300044901 | Bacteria | 1890 |
| 149 | Ga0495607_0000021 | 3300046501 | Bacteria | 164571 |
| 150 | Ga0495633_0045000 | 3300046558 | Bacteria | 2091 |
| 151 | Ga0495625_0043204 | 3300046660 | Bacteria | 3270 |
| 152 | Ga0495588_0029082 | 3300046674 | Bacteria | 2770 |
| 153 | Ga0495681_0007458 | 3300047470 | Bacteria | 6985 |
| 154 | Ga0496111_0003923 | 3300048914 | Bacteria | 9324 |
| 155 | Ga0496112_0018186 | 3300048915 | Bacteria | 6615 |
| 156 | Ga0496115_0074577 | 3300048918 | Bacteria | 2755 |
| 157 | Ga0496116_0000043 | 3300048919 | Bacteria | 328085 |
| 158 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 159 | Ga0496118_0001571 | 3300048921 | Bacteria | 33887 |
| 160 | Ga0496119_0015286 | 3300048922 | Bacteria | 5928 |
| 161 | Ga0496120_0001517 | 3300048923 | Bacteria | 27372 |
| 162 | Ga0496120_0002771 | 3300048923 | Bacteria | 17044 |
| 163 | Ga0496120_0008186 | 3300048923 | Bacteria | 7661 |
| 164 | Ga0496120_0014559 | 3300048923 | Bacteria | 5236 |
| 165 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 166 | Ga0496121_0000959 | 3300048924 | Bacteria | 52098 |
| 167 | Ga0496121_0071523 | 3300048924 | Bacteria | 2789 |
| 168 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 169 | Ga0496122_0000025 | 3300048925 | Bacteria | 362915 |
| 170 | Ga0496122_0005442 | 3300048925 | Bacteria | 15164 |
| 171 | Ga0496122_0008197 | 3300048925 | Bacteria | 11352 |
| 172 | Ga0496122_0047797 | 3300048925 | Bacteria | 3298 |
| 173 | Ga0496122_0059066 | 3300048925 | Bacteria | 2833 |
| 174 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 175 | Ga0496123_0000032 | 3300048926 | Bacteria | 285282 |
| 176 | Ga0496123_0000552 | 3300048926 | Bacteria | 64124 |
| 177 | Ga0496123_0024982 | 3300048926 | Bacteria | 4520 |
| 178 | Ga0496124_0002011 | 3300048927 | Bacteria | 27685 |
| 179 | Ga0496124_0024412 | 3300048927 | Bacteria | 5497 |
| 180 | Ga0496124_0035414 | 3300048927 | Bacteria | 4368 |
| 181 | Ga0496124_0036108 | 3300048927 | Bacteria | 4315 |
| 182 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 183 | Ga0496125_0000394 | 3300048928 | Bacteria | 81230 |
| 184 | Ga0496125_0049047 | 3300048928 | Bacteria | 3512 |
| 185 | Ga0496125_0151403 | 3300048928 | Bacteria | 1592 |
| 186 | Ga0496126_0001040 | 3300048929 | Bacteria | 46920 |
| 187 | Ga0496126_0002456 | 3300048929 | Bacteria | 25007 |
| 188 | Ga0501031_0000087 | 3300049568 | Bacteria | 49387 |
| 189 | Ga0501031_0070635 | 3300049568 | Bacteria | 2274 |
| 190 | Ga0501032_0000059 | 3300049569 | Bacteria | 96399 |
| 191 | Ga0501032_0000111 | 3300049569 | Bacteria | 69802 |
| 192 | Ga0501032_0008780 | 3300049569 | Bacteria | 7361 |
| 193 | Ga0501032_0033625 | 3300049569 | Bacteria | 3512 |
| 194 | Ga0501032_0073947 | 3300049569 | Bacteria | 2270 |
| 195 | Ga0501033_0000048 | 3300049570 | Bacteria | 120958 |
| 196 | Ga0501033_0000213 | 3300049570 | Bacteria | 55690 |
| 197 | Ga0501033_0003451 | 3300049570 | Bacteria | 12993 |
| 198 | Ga0501033_0003709 | 3300049570 | Bacteria | 12426 |
| 199 | Ga0501033_0012509 | 3300049570 | Bacteria | 6476 |
| 200 | Ga0501033_0013177 | 3300049570 | Bacteria | 6299 |
| 201 | Ga0501034_0000452 | 3300049571 | Bacteria | 67967 |
| 202 | Ga0501034_0000960 | 3300049571 | Bacteria | 41575 |
| 203 | Ga0501034_0010338 | 3300049571 | Bacteria | 9726 |
| 204 | Ga0501034_0034410 | 3300049571 | Bacteria | 5135 |
| 205 | Ga0501034_0045555 | 3300049571 | Bacteria | 4432 |
| 206 | Ga0501034_0072537 | 3300049571 | Bacteria | 3451 |
| 207 | Ga0501034_0143246 | 3300049571 | Bacteria | 2369 |
| 208 | Ga0501036_0000092 | 3300049572 | Bacteria | 56405 |
| 209 | Ga0501036_0000093 | 3300049572 | Bacteria | 55690 |
| 210 | Ga0501037_0000061 | 3300049573 | Bacteria | 98711 |
| 211 | Ga0501037_0000131 | 3300049573 | Bacteria | 69802 |
| 212 | Ga0501037_0001008 | 3300049573 | Bacteria | 20840 |
| 213 | Ga0501038_0000109 | 3300049574 | Bacteria | 69802 |
| 214 | Ga0501038_0000123 | 3300049574 | Bacteria | 65136 |
| 215 | Ga0501038_0039203 | 3300049574 | Bacteria | 4145 |
| 216 | Ga0501038_0120640 | 3300049574 | Bacteria | 2163 |
| 217 | Ga0501039_0000108 | 3300049575 | Bacteria | 55675 |
| 218 | Ga0501040_0003364 | 3300049576 | Bacteria | 10323 |
| 219 | Ga0501043_0000063 | 3300049579 | Bacteria | 95102 |
| 220 | Ga0501043_0000303 | 3300049579 | Bacteria | 44666 |
| 221 | Ga0501043_0003292 | 3300049579 | Bacteria | 13310 |
| 222 | Ga0501043_0033651 | 3300049579 | Bacteria | 4033 |
| 223 | Ga0501043_0051239 | 3300049579 | Bacteria | 3243 |
| 224 | Ga0501046_0101215 | 3300049580 | Bacteria | 2210 |
| 225 | Ga0501047_0002263 | 3300049581 | Bacteria | 18414 |
| 226 | Ga0501047_0006155 | 3300049581 | Bacteria | 11283 |
| 227 | Ga0501047_0013540 | 3300049581 | Bacteria | 7735 |
| 228 | Ga0501047_0014712 | 3300049581 | Bacteria | 7445 |
| 229 | Ga0501047_0019990 | 3300049581 | Bacteria | 6429 |
| 230 | Ga0501047_0065758 | 3300049581 | Bacteria | 3495 |
| 231 | Ga0501048_0150604 | 3300049582 | Bacteria | 1645 |
| 232 | Ga0501069_0000060 | 3300049585 | Bacteria | 62672 |
| 233 | Ga0501069_0027706 | 3300049585 | Bacteria | 3106 |
| 234 | Ga0501070_0002994 | 3300049586 | Bacteria | 14700 |
| 235 | Ga0501070_0014307 | 3300049586 | Bacteria | 6677 |
| 236 | Ga0501070_0018055 | 3300049586 | Bacteria | 5919 |
| 237 | Ga0501070_0026613 | 3300049586 | Bacteria | 4853 |
| 238 | Ga0501071_0003798 | 3300049587 | Bacteria | 9494 |
| 239 | Ga0501071_0058670 | 3300049587 | Bacteria | 2783 |
| 240 | Ga0501073_0010648 | 3300049589 | Bacteria | 6731 |
| 241 | Ga0501074_0000070 | 3300049590 | Bacteria | 48920 |
| 242 | Ga0501079_0196407 | 3300049741 | Bacteria | 1575 |
| 243 | Ga0501080_0000761 | 3300049742 | Bacteria | 26140 |
| 244 | Ga0501080_0026967 | 3300049742 | Bacteria | 5342 |
| 245 | Ga0501083_0000098 | 3300049744 | Bacteria | 59246 |
| 246 | Ga0501083_0025339 | 3300049744 | Bacteria | 4106 |
| 247 | Ga0501280_004522 | 3300049776 | Bacteria | 2040 |
| 248 | Ga0501035_0000055 | 3300049822 | Bacteria | 139471 |
| 249 | Ga0501035_0000076 | 3300049822 | Bacteria | 121548 |
| 250 | Ga0501035_0000219 | 3300049822 | Bacteria | 68343 |
| 251 | Ga0501035_0001473 | 3300049822 | Bacteria | 24103 |
| 252 | Ga0501035_0002916 | 3300049822 | Bacteria | 16465 |
| 253 | Ga0501035_0005019 | 3300049822 | Bacteria | 12534 |
| 254 | Ga0501035_0006674 | 3300049822 | Bacteria | 10786 |
| 255 | Ga0501035_0035138 | 3300049822 | Bacteria | 4549 |
| 256 | Ga0501035_0058637 | 3300049822 | Bacteria | 3430 |
| 257 | Ga0501035_0159254 | 3300049822 | Bacteria | 1955 |
| 258 | Ga0501044_0000075 | 3300049823 | Bacteria | 120819 |
| 259 | Ga0501044_0000234 | 3300049823 | Bacteria | 69802 |
| 260 | Ga0501044_0001711 | 3300049823 | Bacteria | 25728 |
| 261 | Ga0501044_0004401 | 3300049823 | Bacteria | 15758 |
| 262 | Ga0501044_0007161 | 3300049823 | Bacteria | 12270 |
| 263 | nmdc:mga03683_2603_c1 | 3300050489 | Bacteria | 5634 |
| 264 | nmdc:mga03n38_29434_c1 | 3300050490 | Bacteria | 2298 |
| 265 | nmdc:mga00v17_667_c1 | 3300050491 | Bacteria | 18911 |
| 266 | nmdc:mga00v17_6_c1 | 3300050491 | Bacteria | 179509 |
| 267 | nmdc:mga0yw44_109121_c1 | 3300050492 | Bacteria | 1771 |
| 268 | nmdc:mga0yw44_25580_c1 | 3300050492 | Bacteria | 3359 |
| 269 | nmdc:mga0yw44_34054_c1 | 3300050492 | Bacteria | 2982 |
| 270 | nmdc:mga0sz30_94_c1 | 3300050516 | Bacteria | 34557 |
| 271 | Ga0500556_0011736 | 3300053104 | Bacteria | 2601 |
| 272 | Ga0500618_000084 | 3300053125 | Bacteria | 76331 |
| 273 | Ga0500618_000777 | 3300053125 | Bacteria | 17927 |
| 274 | Ga0500559_0009220 | 3300053136 | Bacteria | 4282 |
| 275 | Ga0500561_0000351 | 3300053137 | Bacteria | 7696 |
| 276 | Ga0500568_0000144 | 3300053139 | Bacteria | 62519 |
| 277 | Ga0500573_0000256 | 3300053140 | Bacteria | 22413 |
| 278 | Ga0500616_0000551 | 3300053153 | Bacteria | 46529 |
| 279 | Ga0500616_0042806 | 3300053153 | Bacteria | 2424 |
| 280 | Ga0500616_0059768 | 3300053153 | Bacteria | 1978 |
| 281 | Ga0500620_000380 | 3300053155 | Bacteria | 8222 |
| 282 | Ga0500622_0000116 | 3300053156 | Bacteria | 82811 |
| 283 | Ga0500634_0005798 | 3300053161 | Bacteria | 5911 |
| 284 | Ga0500636_0000015 | 3300053177 | Bacteria | 123980 |
| 285 | Ga0500611_004864 | 3300053727 | Bacteria | 1846 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF02852
Pyr_redox_dim
Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
339
448
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kdg-assembly1.cif.gz_B | crystal structure of the flavin domain of cellobiose dehydrogenase | 0.9893 | 6 | 36 |
| 4dna-assembly1.cif.gz_B | crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021 | 0.9782 | 4 | 462 |
| 3o0h-assembly1.cif.gz_A | crystal structure of glutathione reductase from bartonella henselae | 0.9755 | 4 | 462 |
| 3o0h-assembly1.cif.gz_B | crystal structure of glutathione reductase from bartonella henselae | 0.9731 | 4 | 462 |
| 4dna-assembly1.cif.gz_B | crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021 | 0.9719 | 4 | 462 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6HP35_184_301_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9805 | 156 | 271 | 3.50.50.60 |
| af_P9WFZ3_1_135_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9798 | 172 | 202 | 3.40.50.720 |
| 4dnaB02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9794 | 146 | 261 | 3.50.50.60 |
| 2hqmB02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9783 | 146 | 264 | 3.50.50.60 |
| 6b4oA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9774 | 151 | 263 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530GGC5-F1-model_v4 | Glutathione-disulfide reductase | 0.991 | 137 | 256 |
GO:0004362
GO:0005829 GO:0006749 GO:0034599 GO:0045454 GO:0050660 |
| AF-A0A7S2ZAC2-F1-model_v4 | FAD/NAD(P)-binding domain-containing protein | 0.9839 | 2 | 283 |
GO:0004362
GO:0005739 GO:0005829 GO:0006749 GO:0034599 GO:0045454 GO:0050660 |
| AF-A0A530GGC5-F1-model_v4 | Glutathione-disulfide reductase | 0.9829 | 137 | 256 |
GO:0004362
GO:0005829 GO:0006749 GO:0034599 GO:0045454 GO:0050660 |
| AF-A0A135HUU0-F1-model_v4 | Glutathione reductase (GRase) (EC 1.8.1.7) | 0.9821 | 1 | 462 |
GO:0004362
GO:0005829 GO:0006749 GO:0034599 GO:0045454 GO:0050660 GO:0050661 |
| AF-A0A7C7WI17-F1-model_v4 | deleted | 0.9816 | 1 | 252 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar