F485489

General Info

Members Datasets Scaffolds Average Seq Length
911 778 285 460

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221609|2644061966
Length 460
Sequence DYDLFVIGGGSGGVRAGRVAASLGKRVAVAEEYRFGGTCVIRGCVPKKLFVYASQFHEHFEDAAGYGWQVGTPTFDWKALIAAKDKEIARLEGLYRRGLDTNGAEIIDSRAELVDAHTVRLVASGKTVTAERIVIATGGAPNPHAALPGHELCISSNEAFDLAKLPRSILIAGGGYIAVEFANIFHGLGVQVTLIYRGKEILSRFDHDMRQGLHKAMVDKGIRILLADVIENVAKVEGAGGGLIATTKNGETIAVDTVMLALGRDPNTRGLGLEAAGVAMDERGAIIVDPYSRTNVPSIWALGDVTNRVQLTPVAIHEAMCFIETEYRGKPTVPDHDLIATAVFSQPEIGTVGLSEEDAAQRYAEIEVYRAEFRPMKATLSGRAEKMIMKLVVDAASRKVLGAHILGHDAGEMVQLLGISLKAGVTKDDFDRTMAVHPTASEELVTMYQPSYRIKNGQRA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
11 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
12 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
16 2512875024 Mesorhizobium loti R88b Isolate Nodule
17 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
24 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
25 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
26 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
27 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
28 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
29 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
32 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
33 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
34 2534681786 Brucella suis 92/29 Isolate Unclassified
35 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
36 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
37 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
38 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
39 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
40 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
41 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
42 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
43 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
44 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
45 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
46 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
47 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
48 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
49 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
50 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
51 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
52 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
53 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
54 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
55 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
56 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
57 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
58 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
59 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
60 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
61 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
62 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
63 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
64 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
65 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
66 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
67 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
68 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
69 2643221557 Ensifer sp. Root558 Isolate Unclassified
70 2643221558 Rhizobium sp. Root149 Isolate Unclassified
71 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
72 2643221568 Rhizobium sp. Root564 Isolate Unclassified
73 2643221582 Rhizobium sp. Root651 Isolate Unclassified
74 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
75 2643221607 Rhizobium sp. Root73 Isolate Unclassified
76 2643221609 Acidovorax sp. Root217 Isolate Unclassified
77 2643221610 Ensifer sp. Root74 Isolate Unclassified
78 2643221611 Acidovorax sp. Root219 Isolate Unclassified
79 2643221618 Ensifer sp. Root231 Isolate Unclassified
80 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
81 2643221626 Ensifer sp. Root31 Isolate Unclassified
82 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
83 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
84 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
85 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
86 2643221655 Ensifer sp. Root1252 Isolate Unclassified
87 2643221659 Ensifer sp. Root127 Isolate Unclassified
88 2643221668 Ensifer sp. Root423 Isolate Unclassified
89 2643221675 Ensifer sp. Root1298 Isolate Unclassified
90 2643221680 Ensifer sp. Root1312 Isolate Unclassified
91 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
92 2643221688 Rhizobium sp. Root482 Isolate Unclassified
93 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
94 2643221693 Rhizobium sp. Root491 Isolate Unclassified
95 2643221698 Ensifer sp. Root142 Isolate Unclassified
96 2643221712 Ensifer sp. Root258 Isolate Unclassified
97 2643221718 Rhizobium sp. Root268 Isolate Unclassified
98 2643221719 Rhizobium sp. Root274 Isolate Unclassified
99 2643221723 Ensifer sp. Root278 Isolate Unclassified
100 2643221726 Ensifer sp. Root954 Isolate Unclassified
101 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
102 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
103 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
104 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
105 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
106 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
107 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
108 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
109 2738543012 Acidovorax sp. CF301 Isolate Unclassified
110 2738543024 Aminobacter sp. AP02 Isolate Unclassified
111 2751185800 Brucella pituitosa AA2 Isolate Unclassified
112 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
113 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
114 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
115 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
116 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
117 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
118 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
119 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
120 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
121 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
122 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
123 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
124 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
125 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
126 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
127 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
128 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
129 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
130 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
131 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
132 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
133 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
134 2802429633 Rhizobium anhuiense J3 Isolate Nodule
135 2802429634 Rhizobium anhuiense S10 Isolate Nodule
136 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
137 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
138 2802429637 Rhizobium anhuiense C15 Isolate Nodule
139 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
140 2816332133 Acidovorax radicis 2721A Isolate Unclassified
141 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
142 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
143 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
144 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
145 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
146 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
147 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
148 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
149 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
150 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
151 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
152 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
153 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
154 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
155 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
156 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
157 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
158 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
159 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
160 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
161 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
162 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
163 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
164 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
165 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
166 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
167 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
168 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
169 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
170 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
171 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
172 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
173 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
174 2844163670 Ensifer sp. 1H6 Isolate Unclassified
175 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
176 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
177 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
178 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
179 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
180 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
181 2854911287 Brucella lupini LUP21 Isolate Unclassified
182 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
183 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
184 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
185 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
186 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
187 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
188 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
189 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
190 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
191 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
192 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
193 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
194 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
195 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
196 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
197 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
198 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
199 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
200 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
201 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
202 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
203 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
204 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
205 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
206 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
207 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
208 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
209 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
210 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
211 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
212 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
213 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
214 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
215 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
216 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
217 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
218 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
219 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
220 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
221 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
222 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
223 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
224 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
225 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
226 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
227 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
228 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
229 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
230 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
231 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
232 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
233 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
234 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
235 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
236 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
237 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
238 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
239 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
240 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
241 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
242 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
243 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
244 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
245 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
246 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
247 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
248 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
249 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
250 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
251 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
252 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
253 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
254 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
255 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
256 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
257 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
258 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
259 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
260 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
261 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
262 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
263 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
264 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
265 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
266 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
267 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
268 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
269 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
270 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
271 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
272 2904456579 Variovorax sp. 2002 Isolate Unclassified
273 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
274 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
275 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
276 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
277 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
278 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
279 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
280 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
281 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
282 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
283 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
284 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
285 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
286 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
287 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
288 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
289 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
290 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
291 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
292 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
293 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
294 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
295 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
296 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
297 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
298 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
299 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
300 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
301 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
302 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
303 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
304 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
305 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
306 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
307 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
308 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
309 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
310 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
311 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
312 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
313 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
314 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
315 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
316 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
317 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
318 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
319 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
320 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
321 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
322 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
323 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
324 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
325 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
326 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
327 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
328 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
329 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
330 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
331 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
332 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
333 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
334 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
335 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
336 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
337 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
338 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
339 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
340 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
341 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
342 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
343 2929520902 Variovorax beijingensis 502 Isolate Unclassified
344 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
345 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
346 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
347 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
348 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
349 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
350 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
351 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
352 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
353 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
354 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
355 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
356 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
357 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
358 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
359 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
360 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
361 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
362 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
363 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
364 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
365 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
366 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
367 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
368 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
369 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
370 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
371 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
372 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
373 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
374 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
375 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
376 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
377 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
378 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
379 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
380 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
381 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
382 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
383 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
384 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
385 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
386 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
387 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
388 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
389 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
390 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
391 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
392 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
393 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
394 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
395 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
396 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
397 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
398 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
399 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
400 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
401 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
402 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
403 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
404 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
405 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
406 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
407 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
408 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
409 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
410 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
411 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
412 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
413 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
414 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
415 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
416 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
417 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
418 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
419 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
420 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
421 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
422 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
423 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
424 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
425 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
426 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
427 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
428 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
429 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
430 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
431 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
432 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
433 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
434 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
435 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
436 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
437 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
438 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
439 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
440 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
441 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
442 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
443 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
444 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
445 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
446 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
447 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
448 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
449 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
450 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
451 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
452 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
453 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
454 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
455 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
456 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
457 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
458 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
459 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
460 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
461 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
462 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
463 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
464 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
465 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
466 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
467 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
468 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
469 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
470 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
471 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
472 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
473 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
474 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
475 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
476 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
477 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
478 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
479 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
480 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
481 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
482 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
483 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
484 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
485 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
486 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
487 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
488 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
489 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
490 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
491 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
492 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
493 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
494 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
495 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
496 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
497 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
498 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
499 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
500 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
501 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
502 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
503 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
504 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
505 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
506 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
507 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
508 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
509 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
510 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
511 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
512 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
513 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
514 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
515 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
516 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
517 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
518 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
519 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
520 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
521 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
522 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
523 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
524 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
525 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
526 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
527 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
528 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
529 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
530 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
531 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
532 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
533 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
534 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
535 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
536 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
537 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
538 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
539 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
540 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
541 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
542 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
543 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
544 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
545 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
546 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
547 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
548 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
549 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
550 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
551 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
552 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
553 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
554 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
555 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
556 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
557 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
558 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
559 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
560 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
561 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
562 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
563 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
564 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
565 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
566 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
567 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
568 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
569 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
570 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
571 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
572 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
573 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
574 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
575 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
576 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
577 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
578 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
579 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
580 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
581 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
582 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
583 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
584 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
585 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
586 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
587 3004167301 Mesorhizobium loti 582 Isolate Unclassified
588 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
589 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
590 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
591 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
592 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
593 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
594 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
595 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
596 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
597 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
598 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
599 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
600 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
601 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
602 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
603 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
604 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
605 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
606 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
607 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
608 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
609 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
610 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
611 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
612 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
613 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
614 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
615 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
616 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
617 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
618 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
619 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
620 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
621 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
622 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
623 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
624 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
625 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
626 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
627 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
628 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
629 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
630 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
631 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
632 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
633 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
634 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
635 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
636 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
637 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
638 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
639 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
640 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
641 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
642 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
643 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
644 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
645 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
646 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
647 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
648 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
649 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
650 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
651 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
652 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
653 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
654 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
655 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
656 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
657 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
658 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
659 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
660 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
661 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
662 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
663 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
664 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
665 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
666 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
667 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
668 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
669 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
670 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
671 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
672 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
673 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
674 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
675 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
676 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
677 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
678 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
679 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
680 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
681 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
682 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
683 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
684 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
685 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
686 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
687 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
688 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
689 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
690 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
691 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
692 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
693 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
694 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
695 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
696 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
697 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
698 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
699 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
700 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
701 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
702 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
703 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
704 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
705 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
706 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
707 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
708 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
709 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
710 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
711 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
712 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
713 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
714 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
715 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
716 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
717 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
718 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
719 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
720 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
721 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
722 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
723 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
724 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
725 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
726 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
727 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
728 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
729 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
730 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
731 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
732 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
733 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
734 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
735 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
736 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
737 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
738 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
739 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
740 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
741 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
742 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
743 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
744 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
745 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
746 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
747 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
748 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
749 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
750 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
751 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
752 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
753 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
754 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
755 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
756 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
757 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
758 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
759 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
760 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
761 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
762 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
763 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
764 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
765 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
766 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
767 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
768 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
769 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
770 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
771 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
772 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
773 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
774 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
775 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
776 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
777 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
778 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 31.17
Metatranscriptomes 0.11
Isolates 68.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 9.66
Nodule 52.36
Rhizoplane 1.43
Rhizosphere 18.55
Stem 0
Stem Tuber 0
Unclassified 17.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10006473 3300001989 Bacteria 4419
2 JGI25157J39369_1000750 3300002741 Bacteria 17062
3 JGI25152J39213_1010229 3300002773 Bacteria 2164
4 JGI25151J46595_10000134 3300003187 Bacteria 98987
5 JGI25151J46595_10028641 3300003187 Bacteria 2216
6 JGI25165J46597_1000033 3300003214 Bacteria 293030
7 JGI25153J46596_10001403 3300003215 Bacteria 14441
8 JGI25153J46596_10011152 3300003215 Bacteria 3996
9 JGI25160J50197_1000011 3300003354 Bacteria 275577
10 JGI25160J50197_1000572 3300003354 Bacteria 20786
11 JGI25161J50226_1000232 3300003374 Bacteria 34042
12 JGI25161J50226_1001043 3300003374 Bacteria 9517
13 Ga0006562J51391_1008942 3300003578 Bacteria 4280
14 Ga0055542_1000654 3300003762 Bacteria 28482
15 Ga0055529_1002419 3300003763 Bacteria 3634
16 Ga0055526_1002003 3300003771 Bacteria 14035
17 Ga0055526_1003319 3300003771 Bacteria 10294
18 Ga0055524_1001915 3300003775 Bacteria 11254
19 Ga0055536_1002697 3300003781 Bacteria 9850
20 Ga0055528_1001460 3300003790 Bacteria 14399
21 Ga0055531_10000733 3300003794 Bacteria 27746
22 Ga0055531_10013794 3300003794 Bacteria 3698
23 Ga0058692_1001202 3300003856 Bacteria 9918
24 Ga0058692_1004873 3300003856 Bacteria 3902
25 Ga0055543_1000354 3300004625 Bacteria 31120
26 Ga0055543_1002191 3300004625 Bacteria 6697
27 Ga0065165_1000018 3300005262 Bacteria 275082
28 Ga0065165_1001860 3300005262 Bacteria 20499
29 Ga0065165_1009367 3300005262 Bacteria 4403
30 Ga0065704_10072842 3300005289 Bacteria 7936
31 Ga0070665_100060247 3300005548 Bacteria 3805
32 Ga0068856_100280332 3300005614 Bacteria 1683
33 Ga0081539_10001646 3300005985 Bacteria 36279
34 Ga0075365_10002027 3300006038 Bacteria 9621
35 Ga0075365_10047938 3300006038 Bacteria 2810
36 Ga0075365_10114197 3300006038 Bacteria 1858
37 Ga0075368_10013307 3300006042 Bacteria 3020
38 Ga0075363_100066825 3300006048 Bacteria 1947
39 Ga0075364_10003103 3300006051 Bacteria 9397
40 Ga0075362_10002505 3300006177 Bacteria 6180
41 Ga0075362_10028613 3300006177 Bacteria 2394
42 Ga0075367_10027101 3300006178 Bacteria 3256
43 Ga0075367_10058803 3300006178 Bacteria 2287
44 Ga0075367_10117277 3300006178 Bacteria 1638
45 Ga0075369_10012429 3300006186 Bacteria 3364
46 Ga0079104_1000022 3300006946 Bacteria 223522
47 Ga0079104_1004678 3300006946 Bacteria 5739
48 Ga0079104_1007604 3300006946 Bacteria 3895
49 Ga0099826_10000184 3300006948 Bacteria 26251
50 Ga0099826_10009956 3300006948 Bacteria 7107
51 Ga0105237_10180725 3300009545 Bacteria 2110
52 Ga0105238_10028151 3300009551 Bacteria 5725
53 Ga0123342_1000455 3300009766 Bacteria 64500
54 Ga0157371_10000015 3300013102 Bacteria 339838
55 Ga0157371_10004053 3300013102 Bacteria 12959
56 Ga0157370_10001244 3300013104 Bacteria 31808
57 Ga0157370_10001762 3300013104 Bacteria 26694
58 Ga0171463_1008 3300013249 Bacteria 299022
59 Ga0182008_10020318 3300014497 Bacteria 3421
60 Ga0182006_1006962 3300015261 Bacteria 5205
61 Ga0183363_1212 3300015690 Bacteria 11717
62 Ga0214544_1000691 3300021320 Bacteria 64943
63 Ga0214542_1000019 3300021321 Bacteria 199445
64 Ga0214542_1022261 3300021321 Bacteria 4105
65 Ga0214543_1000010 3300021327 Bacteria 364844
66 Ga0214543_1000011 3300021327 Bacteria 344093
67 Ga0228711_1000007 3300022739 Bacteria 202413
68 Ga0228710_1000007 3300022740 Bacteria 189104
69 Ga0209436_100281 3300025208 Bacteria 23411
70 Ga0207425_1004590 3300025245 Bacteria 4100
71 Ga0207425_1010512 3300025245 Bacteria 2250
72 Ga0209026_1000002 3300025250 Bacteria 1136158
73 Ga0209148_1000072 3300025254 Bacteria 325292
74 Ga0209759_1000146 3300025256 Bacteria 121497
75 Ga0209129_1000659 3300025258 Bacteria 23019
76 Ga0209233_1000027 3300025261 Bacteria 652089
77 Ga0209455_1000153 3300025272 Bacteria 124411
78 Ga0209673_1000552 3300025273 Bacteria 60264
79 Ga0209130_1000029 3300025284 Bacteria 323399
80 Ga0209676_1001236 3300025292 Bacteria 26898
81 Ga0209676_1001652 3300025292 Bacteria 19497
82 Ga0209025_1000094 3300025294 Bacteria 241080
83 Ga0209025_1000119 3300025294 Bacteria 210606
84 Ga0209025_1000166 3300025294 Bacteria 164692
85 Ga0209025_1000843 3300025294 Bacteria 48547
86 Ga0209025_1032078 3300025294 Bacteria 2466
87 Ga0209564_1000469 3300025295 Bacteria 67659
88 Ga0209564_1000501 3300025295 Bacteria 64474
89 Ga0209758_1000155 3300025297 Bacteria 160455
90 Ga0209758_1000218 3300025297 Bacteria 124300
91 Ga0209758_1047111 3300025297 Bacteria 1547
92 Ga0209050_1003018 3300025298 Bacteria 13041
93 Ga0209256_1000194 3300025299 Bacteria 116709
94 Ga0209256_1000946 3300025299 Bacteria 35213
95 Ga0209256_1001513 3300025299 Bacteria 23507
96 Ga0207426_1000039 3300025302 Bacteria 439937
97 Ga0207426_1000074 3300025302 Bacteria 323399
98 Ga0209051_1000998 3300025303 Bacteria 27177
99 Ga0209051_1002938 3300025303 Bacteria 11659
100 Ga0207647_10006306 3300025904 Bacteria 8636
101 Ga0207694_10033071 3300025924 Bacteria 3961
102 Ga0207640_10032392 3300025981 Bacteria 3240
103 Ga0207702_10139406 3300026078 Bacteria 2192
104 Ga0209281_1000036 3300027111 Bacteria 369415
105 Ga0209281_1000047 3300027111 Bacteria 326514
106 Ga0209281_1000128 3300027111 Bacteria 199265
107 Ga0209281_1000483 3300027111 Bacteria 55407
108 Ga0209371_1000021 3300027312 Bacteria 555864
109 Ga0209371_1001463 3300027312 Bacteria 15921
110 Ga0209282_1000034 3300027666 Bacteria 140100
111 Ga0209282_1003372 3300027666 Bacteria 9484
112 Ga0209282_1004065 3300027666 Bacteria 8797
113 Ga0268266_10021580 3300028379 Bacteria 5485
114 Ga0268266_10042265 3300028379 Bacteria 3893
115 Ga0307515_10000023 3300028794 Bacteria 400846
116 Ga0307515_10000945 3300028794 Bacteria 66458
117 Ga0307515_10009074 3300028794 Bacteria 19290
118 Ga0268256_1000020 3300030500 Bacteria 557873
119 Ga0268256_1005833 3300030500 Bacteria 4732
120 Ga0316181_1152995 3300030744 Bacteria 3207
121 Ga0307513_10002881 3300031456 Bacteria 23553
122 Ga0315914_1000010 3300031967 Bacteria 171642
123 Ga0307414_10143029 3300032004 Bacteria 1875
124 Ga0315913_1000005 3300033430 Bacteria 171651
125 Ga0315915_1000012 3300033464 Bacteria 199284
126 Ga0395899_0000073 3300037312 Bacteria 181387
127 Ga0395900_0000027 3300037418 Bacteria 285957
128 Ga0395900_0143628 3300037418 Bacteria 2442
129 Ga0395900_0240765 3300037418 Bacteria 1815
130 Ga0395898_0000043 3300037466 Bacteria 301783
131 Ga0395905_0000032 3300037471 Bacteria 285932
132 Ga0395905_0064647 3300037471 Bacteria 3424
133 Ga0395905_0125508 3300037471 Bacteria 2413
134 Ga0395905_0189378 3300037471 Bacteria 1930
135 Ga0395905_0268954 3300037471 Bacteria 1590
136 Ga0395901_0000056 3300038443 Bacteria 154356
137 Ga0395901_0105657 3300038443 Bacteria 2955
138 Ga0395901_0219947 3300038443 Bacteria 1985
139 Ga0439436_0013760 3300041404 Bacteria 2446
140 Ga0450920_004347 3300042122 Bacteria 2486
141 Ga0439434_0018339 3300042435 Bacteria 2095
142 Ga0450918_000667 3300042531 Bacteria 7314
143 Ga0466972_0023536 3300044658 Bacteria 3062
144 Ga0466965_0042987 3300044683 Bacteria 2230
145 Ga0466968_0018122 3300044735 Bacteria 2822
146 Ga0466968_0019776 3300044735 Bacteria 2714
147 Ga0466970_0006625 3300044765 Bacteria 5793
148 Ga0466960_0057972 3300044901 Bacteria 1890
149 Ga0495607_0000021 3300046501 Bacteria 164571
150 Ga0495633_0045000 3300046558 Bacteria 2091
151 Ga0495625_0043204 3300046660 Bacteria 3270
152 Ga0495588_0029082 3300046674 Bacteria 2770
153 Ga0495681_0007458 3300047470 Bacteria 6985
154 Ga0496111_0003923 3300048914 Bacteria 9324
155 Ga0496112_0018186 3300048915 Bacteria 6615
156 Ga0496115_0074577 3300048918 Bacteria 2755
157 Ga0496116_0000043 3300048919 Bacteria 328085
158 Ga0496117_0000002 3300048920 Bacteria 2483758
159 Ga0496118_0001571 3300048921 Bacteria 33887
160 Ga0496119_0015286 3300048922 Bacteria 5928
161 Ga0496120_0001517 3300048923 Bacteria 27372
162 Ga0496120_0002771 3300048923 Bacteria 17044
163 Ga0496120_0008186 3300048923 Bacteria 7661
164 Ga0496120_0014559 3300048923 Bacteria 5236
165 Ga0496121_0000001 3300048924 Bacteria 1830318
166 Ga0496121_0000959 3300048924 Bacteria 52098
167 Ga0496121_0071523 3300048924 Bacteria 2789
168 Ga0496122_0000001 3300048925 Bacteria 1827766
169 Ga0496122_0000025 3300048925 Bacteria 362915
170 Ga0496122_0005442 3300048925 Bacteria 15164
171 Ga0496122_0008197 3300048925 Bacteria 11352
172 Ga0496122_0047797 3300048925 Bacteria 3298
173 Ga0496122_0059066 3300048925 Bacteria 2833
174 Ga0496123_0000001 3300048926 Bacteria 1831497
175 Ga0496123_0000032 3300048926 Bacteria 285282
176 Ga0496123_0000552 3300048926 Bacteria 64124
177 Ga0496123_0024982 3300048926 Bacteria 4520
178 Ga0496124_0002011 3300048927 Bacteria 27685
179 Ga0496124_0024412 3300048927 Bacteria 5497
180 Ga0496124_0035414 3300048927 Bacteria 4368
181 Ga0496124_0036108 3300048927 Bacteria 4315
182 Ga0496125_0000001 3300048928 Bacteria 1766138
183 Ga0496125_0000394 3300048928 Bacteria 81230
184 Ga0496125_0049047 3300048928 Bacteria 3512
185 Ga0496125_0151403 3300048928 Bacteria 1592
186 Ga0496126_0001040 3300048929 Bacteria 46920
187 Ga0496126_0002456 3300048929 Bacteria 25007
188 Ga0501031_0000087 3300049568 Bacteria 49387
189 Ga0501031_0070635 3300049568 Bacteria 2274
190 Ga0501032_0000059 3300049569 Bacteria 96399
191 Ga0501032_0000111 3300049569 Bacteria 69802
192 Ga0501032_0008780 3300049569 Bacteria 7361
193 Ga0501032_0033625 3300049569 Bacteria 3512
194 Ga0501032_0073947 3300049569 Bacteria 2270
195 Ga0501033_0000048 3300049570 Bacteria 120958
196 Ga0501033_0000213 3300049570 Bacteria 55690
197 Ga0501033_0003451 3300049570 Bacteria 12993
198 Ga0501033_0003709 3300049570 Bacteria 12426
199 Ga0501033_0012509 3300049570 Bacteria 6476
200 Ga0501033_0013177 3300049570 Bacteria 6299
201 Ga0501034_0000452 3300049571 Bacteria 67967
202 Ga0501034_0000960 3300049571 Bacteria 41575
203 Ga0501034_0010338 3300049571 Bacteria 9726
204 Ga0501034_0034410 3300049571 Bacteria 5135
205 Ga0501034_0045555 3300049571 Bacteria 4432
206 Ga0501034_0072537 3300049571 Bacteria 3451
207 Ga0501034_0143246 3300049571 Bacteria 2369
208 Ga0501036_0000092 3300049572 Bacteria 56405
209 Ga0501036_0000093 3300049572 Bacteria 55690
210 Ga0501037_0000061 3300049573 Bacteria 98711
211 Ga0501037_0000131 3300049573 Bacteria 69802
212 Ga0501037_0001008 3300049573 Bacteria 20840
213 Ga0501038_0000109 3300049574 Bacteria 69802
214 Ga0501038_0000123 3300049574 Bacteria 65136
215 Ga0501038_0039203 3300049574 Bacteria 4145
216 Ga0501038_0120640 3300049574 Bacteria 2163
217 Ga0501039_0000108 3300049575 Bacteria 55675
218 Ga0501040_0003364 3300049576 Bacteria 10323
219 Ga0501043_0000063 3300049579 Bacteria 95102
220 Ga0501043_0000303 3300049579 Bacteria 44666
221 Ga0501043_0003292 3300049579 Bacteria 13310
222 Ga0501043_0033651 3300049579 Bacteria 4033
223 Ga0501043_0051239 3300049579 Bacteria 3243
224 Ga0501046_0101215 3300049580 Bacteria 2210
225 Ga0501047_0002263 3300049581 Bacteria 18414
226 Ga0501047_0006155 3300049581 Bacteria 11283
227 Ga0501047_0013540 3300049581 Bacteria 7735
228 Ga0501047_0014712 3300049581 Bacteria 7445
229 Ga0501047_0019990 3300049581 Bacteria 6429
230 Ga0501047_0065758 3300049581 Bacteria 3495
231 Ga0501048_0150604 3300049582 Bacteria 1645
232 Ga0501069_0000060 3300049585 Bacteria 62672
233 Ga0501069_0027706 3300049585 Bacteria 3106
234 Ga0501070_0002994 3300049586 Bacteria 14700
235 Ga0501070_0014307 3300049586 Bacteria 6677
236 Ga0501070_0018055 3300049586 Bacteria 5919
237 Ga0501070_0026613 3300049586 Bacteria 4853
238 Ga0501071_0003798 3300049587 Bacteria 9494
239 Ga0501071_0058670 3300049587 Bacteria 2783
240 Ga0501073_0010648 3300049589 Bacteria 6731
241 Ga0501074_0000070 3300049590 Bacteria 48920
242 Ga0501079_0196407 3300049741 Bacteria 1575
243 Ga0501080_0000761 3300049742 Bacteria 26140
244 Ga0501080_0026967 3300049742 Bacteria 5342
245 Ga0501083_0000098 3300049744 Bacteria 59246
246 Ga0501083_0025339 3300049744 Bacteria 4106
247 Ga0501280_004522 3300049776 Bacteria 2040
248 Ga0501035_0000055 3300049822 Bacteria 139471
249 Ga0501035_0000076 3300049822 Bacteria 121548
250 Ga0501035_0000219 3300049822 Bacteria 68343
251 Ga0501035_0001473 3300049822 Bacteria 24103
252 Ga0501035_0002916 3300049822 Bacteria 16465
253 Ga0501035_0005019 3300049822 Bacteria 12534
254 Ga0501035_0006674 3300049822 Bacteria 10786
255 Ga0501035_0035138 3300049822 Bacteria 4549
256 Ga0501035_0058637 3300049822 Bacteria 3430
257 Ga0501035_0159254 3300049822 Bacteria 1955
258 Ga0501044_0000075 3300049823 Bacteria 120819
259 Ga0501044_0000234 3300049823 Bacteria 69802
260 Ga0501044_0001711 3300049823 Bacteria 25728
261 Ga0501044_0004401 3300049823 Bacteria 15758
262 Ga0501044_0007161 3300049823 Bacteria 12270
263 nmdc:mga03683_2603_c1 3300050489 Bacteria 5634
264 nmdc:mga03n38_29434_c1 3300050490 Bacteria 2298
265 nmdc:mga00v17_667_c1 3300050491 Bacteria 18911
266 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
267 nmdc:mga0yw44_109121_c1 3300050492 Bacteria 1771
268 nmdc:mga0yw44_25580_c1 3300050492 Bacteria 3359
269 nmdc:mga0yw44_34054_c1 3300050492 Bacteria 2982
270 nmdc:mga0sz30_94_c1 3300050516 Bacteria 34557
271 Ga0500556_0011736 3300053104 Bacteria 2601
272 Ga0500618_000084 3300053125 Bacteria 76331
273 Ga0500618_000777 3300053125 Bacteria 17927
274 Ga0500559_0009220 3300053136 Bacteria 4282
275 Ga0500561_0000351 3300053137 Bacteria 7696
276 Ga0500568_0000144 3300053139 Bacteria 62519
277 Ga0500573_0000256 3300053140 Bacteria 22413
278 Ga0500616_0000551 3300053153 Bacteria 46529
279 Ga0500616_0042806 3300053153 Bacteria 2424
280 Ga0500616_0059768 3300053153 Bacteria 1978
281 Ga0500620_000380 3300053155 Bacteria 8222
282 Ga0500622_0000116 3300053156 Bacteria 82811
283 Ga0500634_0005798 3300053161 Bacteria 5911
284 Ga0500636_0000015 3300053177 Bacteria 123980
285 Ga0500611_004864 3300053727 Bacteria 1846

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2977971508 2977971962 420
2 iso_pu_bacteria 2871444079 2871451764 422
3 3300046660 Ga0495625_0043204 Ga0495625_0043204_1671_2957 428
4 iso_pu_bacteria 8004361976 8004368514 430
5 iso_pu_bacteria 2871481445 2871486532 431
6 3300049741 Ga0501079_0196407 Ga0501079_0196407_52_1353 432
7 3300049776 Ga0501280_004522 Ga0501280_004522_27_1337 436
8 iso_pu_bacteria 2938014810 2938020877 436
9 iso_pu_bacteria 2979793036 2979795121 439
10 3300038443 Ga0395901_0219947 Ga0395901_0219947_629_1951 440
11 iso_pu_bacteria 2876406927 2876408471 443
12 iso_pu_bacteria 2915993759 2915994868 446
13 iso_pu_bacteria 2921201388 2921205251 447
14 iso_pu_bacteria 2965110997 2965118930 450
15 iso_pu_bacteria 2889790730 2889791861 454
16 iso_pu_bacteria 2937036028 2937041860 454
17 iso_pu_bacteria 2889914905 2889918866 456
18 iso_pu_bacteria 2503198000 2503202525 458
19 iso_pu_bacteria 2508501122 2509107494 458
20 iso_pu_bacteria 2508501123 2509114320 458
21 iso_pu_bacteria 2508501127 2509140377 458
22 iso_pu_bacteria 2509276018 2509370372 458
23 iso_pu_bacteria 2509276019 2509375829 458
24 iso_pu_bacteria 2509276022 2509397044 458
25 iso_pu_bacteria 2510065057 2510303358 458
26 iso_pu_bacteria 2510065059 2510317343 458
27 iso_pu_bacteria 2510461069 2510842930 458
28 iso_pu_bacteria 2510917026 2511172850 458
29 iso_pu_bacteria 2511231027 2511389612 458
30 iso_pu_bacteria 2511231052 2511501825 458
31 iso_pu_bacteria 2512047086 2512533262 458
32 iso_pu_bacteria 2512875016 2512930696 458
33 iso_pu_bacteria 2512875024 2512958441 458
34 iso_pu_bacteria 2512875026 2512971242 458
35 iso_pu_bacteria 2513237086 2513584684 458
36 iso_pu_bacteria 2513237089 2513603952 458
37 iso_pu_bacteria 2513237090 2513613607 458
38 iso_pu_bacteria 2513237091 2513615394 458
39 iso_pu_bacteria 2513237140 2513881182 458
40 iso_pu_bacteria 2513237143 2513905677 458
41 iso_pu_bacteria 2513237156 2513984390 458
42 iso_pu_bacteria 2513237159 2513997164 458
43 iso_pu_bacteria 2513237160 2514006177 458
44 iso_pu_bacteria 2513237164 2514038408 458
45 iso_pu_bacteria 2513237305 2514416808 458
46 iso_pu_bacteria 2513237351 2514590129 458
47 iso_pu_bacteria 2515154107 2515608688 458
48 iso_pu_bacteria 2516653046 2516893120 458
49 iso_pu_bacteria 2517487022 2517569876 458
50 iso_pu_bacteria 2524023207 2524448909 458
51 iso_pu_bacteria 2534681786 2535484737 458
52 iso_pu_bacteria 2537561587 2537877601 458
53 iso_pu_bacteria 2551306084 2551677986 458
54 iso_pu_bacteria 2551306085 2551686741 458
55 iso_pu_bacteria 2551306086 2551690966 458
56 iso_pu_bacteria 2551306087 2551703004 458
57 iso_pu_bacteria 2551306089 2551713842 458
58 iso_pu_bacteria 2551306090 2551717843 458
59 iso_pu_bacteria 2551306090 2551719323 458
60 iso_pu_bacteria 2551306091 2551727843 458
61 iso_pu_bacteria 2551306092 2551732549 458
62 iso_pu_bacteria 2551306093 2551743905 458
63 iso_pu_bacteria 2554235003 2554247686 458
64 iso_pu_bacteria 2558860100 2558868100 458
65 iso_pu_bacteria 2558860242 2559294819 458
66 iso_pu_bacteria 2582581283 2585166038 458
67 iso_pu_bacteria 2582581306 2585268059 458
68 iso_pu_bacteria 2582581865 2585386838 458
69 iso_pu_bacteria 2582581866 2585396723 458
70 iso_pu_bacteria 2585427528 2585537574 458
71 iso_pu_bacteria 2585427593 2585835524 458
72 iso_pu_bacteria 2585427633 2585995750 458
73 iso_pu_bacteria 2585427634 2586000315 458
74 iso_pu_bacteria 2588253730 2588516359 458
75 iso_pu_bacteria 2597489875 2597813847 458
76 iso_pu_bacteria 2599185156 2599331497 458
77 iso_pu_bacteria 2599185210 2599604086 458
78 iso_pu_bacteria 2599185236 2599721099 458
79 iso_pu_bacteria 2599185301 2599939660 458
80 iso_pu_bacteria 2599185352 2600193181 458
81 iso_pu_bacteria 2600254933 2600374514 458
82 iso_pu_bacteria 2600255279 2601608124 458
83 iso_pu_bacteria 2600255308 2601744899 458
84 iso_pu_bacteria 2643221550 2643774263 458
85 iso_pu_bacteria 2643221551 2643775345 458
86 iso_pu_bacteria 2643221555 2643793791 458
87 iso_pu_bacteria 2643221557 2643803676 458
88 iso_pu_bacteria 2643221558 2643811711 458
89 iso_pu_bacteria 2643221564 2643837603 458
90 iso_pu_bacteria 2643221582 2643919307 458
91 iso_pu_bacteria 2643221595 2643986741 458
92 iso_pu_bacteria 2643221607 2644049130 458
93 iso_pu_bacteria 2643221609 2644061966 458
94 iso_pu_bacteria 2643221610 2644067645 458
95 iso_pu_bacteria 2643221611 2644071526 458
96 iso_pu_bacteria 2643221618 2644107796 458
97 iso_pu_bacteria 2643221623 2644132248 458
98 iso_pu_bacteria 2643221626 2644148531 458
99 iso_pu_bacteria 2643221627 2644155331 458
100 iso_pu_bacteria 2643221636 2644204526 458
101 iso_pu_bacteria 2643221637 2644210291 458
102 iso_pu_bacteria 2643221653 2644298527 458
103 iso_pu_bacteria 2643221655 2644309190 458
104 iso_pu_bacteria 2643221659 2644333017 458
105 iso_pu_bacteria 2643221668 2644375323 458
106 iso_pu_bacteria 2643221675 2644418699 458
107 iso_pu_bacteria 2643221680 2644452065 458
108 iso_pu_bacteria 2643221686 2644482164 458
109 iso_pu_bacteria 2643221688 2644491726 458
110 iso_pu_bacteria 2643221689 2644501809 458
111 iso_pu_bacteria 2643221693 2644522212 458
112 iso_pu_bacteria 2643221698 2644545811 458
113 iso_pu_bacteria 2643221712 2644615132 458
114 iso_pu_bacteria 2643221718 2644653843 458
115 iso_pu_bacteria 2643221719 2644656756 458
116 iso_pu_bacteria 2643221723 2644672557 458
117 iso_pu_bacteria 2643221726 2644690828 458
118 iso_pu_bacteria 2657244999 2657685422 458
119 iso_pu_bacteria 2687453392 2688599256 458
120 iso_pu_bacteria 2690316117 2692315923 458
121 iso_pu_bacteria 2693429783 2694632049 458
122 iso_pu_bacteria 2693429784 2694634544 458
123 iso_pu_bacteria 2721755686 2723576203 458
124 iso_pu_bacteria 2738541317 2738946246 458
125 iso_pu_bacteria 2738541333 2739036537 458
126 iso_pu_bacteria 2738543012 2739245039 458
127 iso_pu_bacteria 2738543024 2739308064 458
128 iso_pu_bacteria 2751185800 2753359303 458
129 iso_pu_bacteria 2751185821 2753458809 458
130 iso_pu_bacteria 2756170246 2756676907 458
131 iso_pu_bacteria 2757320392 2757569548 458
132 iso_pu_bacteria 2758568016 2758641608 458
133 iso_pu_bacteria 2765235802 2765464872 458
134 iso_pu_bacteria 2767802442 2770195202 458
135 iso_pu_bacteria 2775506902 2776270897 458
136 iso_pu_bacteria 2775506904 2776282787 458
137 iso_pu_bacteria 2775507049 2776913723 458
138 iso_pu_bacteria 2791355082 2792581881 458
139 iso_pu_bacteria 2791355091 2792620081 458
140 iso_pu_bacteria 2791355092 2792626500 458
141 iso_pu_bacteria 2791355094 2792639430 458
142 iso_pu_bacteria 2791355123 2792752857 458
143 iso_pu_bacteria 2791355253 2793279878 458
144 iso_pu_bacteria 2802428858 2802719150 458
145 iso_pu_bacteria 2802428859 2802727381 458
146 iso_pu_bacteria 2802428860 2802732163 458
147 iso_pu_bacteria 2802428861 2802739093 458
148 iso_pu_bacteria 2802428862 2802744993 458
149 iso_pu_bacteria 2802428863 2802752268 458
150 iso_pu_bacteria 2802429268 2804752280 458
151 iso_pu_bacteria 2802429633 2806046087 458
152 iso_pu_bacteria 2802429634 2806054466 458
153 iso_pu_bacteria 2802429635 2806060471 458
154 iso_pu_bacteria 2802429636 2806065071 458
155 iso_pu_bacteria 2802429637 2806072336 458
156 iso_pu_bacteria 2808606387 2808985410 458
157 iso_pu_bacteria 2816332133 2816474602 458
158 iso_pu_bacteria 2818991272 2819241607 458
159 iso_pu_bacteria 2818991439 2819559842 458
160 iso_pu_bacteria 2818991461 2819687317 458
161 iso_pu_bacteria 2821123053 2821127991 458
162 iso_pu_bacteria 2837651117 2837653578 458
163 iso_pu_bacteria 2837678835 2837683271 458
164 iso_pu_bacteria 2838074704 2838078925 458
165 iso_pu_bacteria 2838675328 2838676255 458
166 iso_pu_bacteria 2838714209 2838715138 458
167 iso_pu_bacteria 2838719591 2838721062 458
168 iso_pu_bacteria 2838724970 2838725896 458
169 iso_pu_bacteria 2838736955 2838738403 458
170 iso_pu_bacteria 2839993093 2839994795 458
171 iso_pu_bacteria 2840764183 2840767660 458
172 iso_pu_bacteria 2841734538 2841740255 458
173 iso_pu_bacteria 2841840854 2841841228 458
174 iso_pu_bacteria 2841846520 2841848021 458
175 iso_pu_bacteria 2841859092 2841859430 458
176 iso_pu_bacteria 2842124991 2842125949 458
177 iso_pu_bacteria 2842130223 2842131149 458
178 iso_pu_bacteria 2842140634 2842141006 458
179 iso_pu_bacteria 2842152218 2842153681 458
180 iso_pu_bacteria 2842170452 2842171381 458
181 iso_pu_bacteria 2842175837 2842177301 458
182 iso_pu_bacteria 2842187318 2842188246 458
183 iso_pu_bacteria 2842211629 2842212557 458
184 iso_pu_bacteria 2842224351 2842225824 458
185 iso_pu_bacteria 2842515876 2842516214 458
186 iso_pu_bacteria 2842521101 2842522594 458
187 iso_pu_bacteria 2842871566 2842871708 458
188 iso_pu_bacteria 2842922631 2842923894 458
189 iso_pu_bacteria 2844002411 2844006653 458
190 iso_pu_bacteria 2844009547 2844014432 458
191 iso_pu_bacteria 2844163670 2844167484 458
192 iso_pu_bacteria 2847417321 2847419012 458
193 iso_pu_bacteria 2847670302 2847670924 458
194 iso_pu_bacteria 2847686936 2847693108 458
195 iso_pu_bacteria 2848992105 2848994044 458
196 iso_pu_bacteria 2850079185 2850082058 458
197 iso_pu_bacteria 2854896431 2854899165 458
198 iso_pu_bacteria 2854911287 2854912027 458
199 iso_pu_bacteria 2854916844 2854918813 458
200 iso_pu_bacteria 2855825444 2855825921 458
201 iso_pu_bacteria 2855839649 2855841270 458
202 iso_pu_bacteria 2855872281 2855876687 458
203 iso_pu_bacteria 2856314179 2856316381 458
204 iso_pu_bacteria 2856320880 2856326116 458
205 iso_pu_bacteria 2856328259 2856329204 458
206 iso_pu_bacteria 2856334872 2856341883 458
207 iso_pu_bacteria 2856342000 2856346200 458
208 iso_pu_bacteria 2856349417 2856354642 458
209 iso_pu_bacteria 2856356410 2856357675 458
210 iso_pu_bacteria 2856364286 2856369024 458
211 iso_pu_bacteria 2857349434 2857355728 458
212 iso_pu_bacteria 2857531043 2857535034 458
213 iso_pu_bacteria 2857576091 2857576759 458
214 iso_pu_bacteria 2858800743 2858802249 458
215 iso_pu_bacteria 2869162929 2869165423 458
216 iso_pu_bacteria 2869234852 2869240438 458
217 iso_pu_bacteria 2869242130 2869245554 458
218 iso_pu_bacteria 2869249662 2869253688 458
219 iso_pu_bacteria 2869256925 2869262633 458
220 iso_pu_bacteria 2869264136 2869264532 458
221 iso_pu_bacteria 2869278585 2869278799 458
222 iso_pu_bacteria 2869285874 2869291542 458
223 iso_pu_bacteria 2871429161 2871433822 458
224 iso_pu_bacteria 2871451962 2871452191 458
225 iso_pu_bacteria 2871466892 2871467776 458
226 iso_pu_bacteria 2871474448 2871475597 458
227 iso_pu_bacteria 2871488783 2871495149 458
228 iso_pu_bacteria 2871495908 2871500588 458
229 iso_pu_bacteria 2874102143 2874106916 458
230 iso_pu_bacteria 2874109183 2874112334 458
231 iso_pu_bacteria 2874116593 2874121504 458
232 iso_pu_bacteria 2874123672 2874125829 458
233 iso_pu_bacteria 2874131515 2874136682 458
234 iso_pu_bacteria 2874139085 2874145383 458
235 iso_pu_bacteria 2874146452 2874153401 458
236 iso_pu_bacteria 2874155637 2874160665 458
237 iso_pu_bacteria 2874162495 2874165832 458
238 iso_pu_bacteria 2874168670 2874172692 458
239 iso_pu_bacteria 2876363079 2876367957 458
240 iso_pu_bacteria 2876392853 2876395132 458
241 iso_pu_bacteria 2876399893 2876403309 458
242 iso_pu_bacteria 2876413966 2876419691 458
243 iso_pu_bacteria 2876420981 2876424418 458
244 iso_pu_bacteria 2878035449 2878041705 458
245 iso_pu_bacteria 2878738818 2878743709 458
246 iso_pu_bacteria 2878745973 2878751434 458
247 iso_pu_bacteria 2878753008 2878758185 458
248 iso_pu_bacteria 2878760144 2878764677 458
249 iso_pu_bacteria 2878767105 2878771778 458
250 iso_pu_bacteria 2878774303 2878779973 458
251 iso_pu_bacteria 2878781027 2878782052 458
252 iso_pu_bacteria 2881147464 2881152686 458
253 iso_pu_bacteria 2881155292 2881156083 458
254 iso_pu_bacteria 2881161766 2881168499 458
255 iso_pu_bacteria 2881845957 2881851530 458
256 iso_pu_bacteria 2881853255 2881856385 458
257 iso_pu_bacteria 2881861095 2881865239 458
258 iso_pu_bacteria 2882632389 2882638534 458
259 iso_pu_bacteria 2882912400 2882915215 458
260 iso_pu_bacteria 2885305155 2885310477 458
261 iso_pu_bacteria 2885312484 2885317303 458
262 iso_pu_bacteria 2885318864 2885322326 458
263 iso_pu_bacteria 2885326080 2885330356 458
264 iso_pu_bacteria 2885334103 2885341063 458
265 iso_pu_bacteria 2885350715 2885356032 458
266 iso_pu_bacteria 2888337043 2888340483 458
267 iso_pu_bacteria 2888343758 2888347711 458
268 iso_pu_bacteria 2888350351 2888356763 458
269 iso_pu_bacteria 2889010040 2889011818 458
270 iso_pu_bacteria 2889016732 2889023254 458
271 iso_pu_bacteria 2891048133 2891051792 458
272 iso_pu_bacteria 2891373044 2891373089 458
273 iso_pu_bacteria 2894652903 2894656230 458
274 iso_pu_bacteria 2899792073 2899796227 458
275 iso_pu_bacteria 2899803654 2899807695 458
276 iso_pu_bacteria 2899845264 2899847416 458
277 iso_pu_bacteria 2903448605 2903449719 458
278 iso_pu_bacteria 2903492973 2903496083 458
279 iso_pu_bacteria 2903492973 2903505539 458
280 iso_pu_bacteria 2903521522 2903526953 458
281 iso_pu_bacteria 2903528002 2903533180 458
282 iso_pu_bacteria 2903540706 2903545401 458
283 iso_pu_bacteria 2904449895 2904455974 458
284 iso_pu_bacteria 2904456579 2904461364 458
285 iso_pu_bacteria 2904578770 2904580863 458
286 iso_pu_bacteria 2904659560 2904661763 458
287 iso_pu_bacteria 2906308376 2906313351 458
288 iso_pu_bacteria 2906321335 2906326062 458
289 iso_pu_bacteria 2906328253 2906328511 458
290 iso_pu_bacteria 2906354277 2906356648 458
291 iso_pu_bacteria 2906393657 2906399139 458
292 iso_pu_bacteria 2906401398 2906403362 458
293 iso_pu_bacteria 2906408224 2906414254 458
294 iso_pu_bacteria 2906414383 2906416518 458
295 iso_pu_bacteria 2913295892 2913300658 458
296 iso_pu_bacteria 2913308742 2913311167 458
297 iso_pu_bacteria 2915650412 2915653950 458
298 iso_pu_bacteria 2915980308 2915981635 458
299 iso_pu_bacteria 2915986958 2915990333 458
300 iso_pu_bacteria 2916000859 2916005316 458
301 iso_pu_bacteria 2916007675 2916014466 458
302 iso_pu_bacteria 2916014648 2916017376 458
303 iso_pu_bacteria 2916021584 2916024005 458
304 iso_pu_bacteria 2916028427 2916033234 458
305 iso_pu_bacteria 2916035215 2916036707 458
306 iso_pu_bacteria 2916041962 2916044275 458
307 iso_pu_bacteria 2916048683 2916052213 458
308 iso_pu_bacteria 2916055098 2916055531 458
309 iso_pu_bacteria 2916061851 2916065272 458
310 iso_pu_bacteria 2916076590 2916082011 458
311 iso_pu_bacteria 2919114240 2919115228 458
312 iso_pu_bacteria 2919119836 2919121422 458
313 iso_pu_bacteria 2919166419 2919167617 458
314 iso_pu_bacteria 2919171160 2919175246 458
315 iso_pu_bacteria 2920760137 2920766164 458
316 iso_pu_bacteria 2920822456 2920824630 458
317 iso_pu_bacteria 2921208531 2921212615 458
318 iso_pu_bacteria 2921237296 2921241836 458
319 iso_pu_bacteria 2921244191 2921246584 458
320 iso_pu_bacteria 2921250672 2921255162 458
321 iso_pu_bacteria 2921257292 2921259590 458
322 iso_pu_bacteria 2921263974 2921266980 458
323 iso_pu_bacteria 2921282425 2921284127 458
324 iso_pu_bacteria 2921289301 2921294151 458
325 iso_pu_bacteria 2922130491 2922134849 458
326 iso_pu_bacteria 2922158528 2922165133 458
327 iso_pu_bacteria 2922172374 2922172997 458
328 iso_pu_bacteria 2922185730 2922190741 458
329 iso_pu_bacteria 2924144063 2924145984 458
330 iso_pu_bacteria 2924150972 2924154558 458
331 iso_pu_bacteria 2924158325 2924163049 458
332 iso_pu_bacteria 2924165586 2924170321 458
333 iso_pu_bacteria 2924172951 2924176330 458
334 iso_pu_bacteria 2924179722 2924184384 458
335 iso_pu_bacteria 2924186466 2924189833 458
336 iso_pu_bacteria 2924193448 2924196531 458
337 iso_pu_bacteria 2924200457 2924205815 458
338 iso_pu_bacteria 2924207177 2924211234 458
339 iso_pu_bacteria 2924214083 2924216536 458
340 iso_pu_bacteria 2924221636 2924225014 458
341 iso_pu_bacteria 2924228884 2924231454 458
342 iso_pu_bacteria 2924726620 2924727866 458
343 iso_pu_bacteria 2924733363 2924739203 458
344 iso_pu_bacteria 2924741084 2924744883 458
345 iso_pu_bacteria 2924754689 2924758321 458
346 iso_pu_bacteria 2924762789 2924768804 458
347 iso_pu_bacteria 2924776078 2924781522 458
348 iso_pu_bacteria 2924784321 2924785925 458
349 iso_pu_bacteria 2926754445 2926756276 458
350 iso_pu_bacteria 2926760298 2926760501 458
351 iso_pu_bacteria 2928521798 2928523645 458
352 iso_pu_bacteria 2929138655 2929139830 458
353 iso_pu_bacteria 2929520902 2929523024 458
354 iso_pu_bacteria 2933006813 2933008328 458
355 iso_pu_bacteria 2933011516 2933013143 458
356 iso_pu_bacteria 2933594066 2933597835 458
357 iso_pu_bacteria 2936996657 2936999598 458
358 iso_pu_bacteria 2937002841 2937005998 458
359 iso_pu_bacteria 2937009748 2937013288 458
360 iso_pu_bacteria 2937016420 2937019327 458
361 iso_pu_bacteria 2937023124 2937028902 458
362 iso_pu_bacteria 2937029754 2937033638 458
363 iso_pu_bacteria 2937042894 2937047526 458
364 iso_pu_bacteria 2937049772 2937050707 458
365 iso_pu_bacteria 2937056579 2937063629 458
366 iso_pu_bacteria 2937063883 2937068079 458
367 iso_pu_bacteria 2937071275 2937071965 458
368 iso_pu_bacteria 2937078374 2937079304 458
369 iso_pu_bacteria 2937084907 2937085213 458
370 iso_pu_bacteria 2937091812 2937093761 458
371 iso_pu_bacteria 2937098957 2937106224 458
372 iso_pu_bacteria 2937106411 2937108016 458
373 iso_pu_bacteria 2937113482 2937115209 458
374 iso_pu_bacteria 2937119839 2937123364 458
375 iso_pu_bacteria 2937126314 2937129099 458
376 iso_pu_bacteria 2937813078 2937820499 458
377 iso_pu_bacteria 2937822353 2937827097 458
378 iso_pu_bacteria 2937836603 2937837621 458
379 iso_pu_bacteria 2937843397 2937847421 458
380 iso_pu_bacteria 2937848649 2937853756 458
381 iso_pu_bacteria 2937868953 2937875751 458
382 iso_pu_bacteria 2937877337 2937879160 458
383 iso_pu_bacteria 2937972304 2937975093 458
384 iso_pu_bacteria 2937980651 2937987555 458
385 iso_pu_bacteria 2937994558 2937999251 458
386 iso_pu_bacteria 2941499720 2941503640 458
387 iso_pu_bacteria 2954011201 2954015928 458
388 iso_pu_bacteria 2957375807 2957381489 458
389 iso_pu_bacteria 2957382221 2957387498 458
390 iso_pu_bacteria 2957388812 2957391781 458
391 iso_pu_bacteria 2957395598 2957397331 458
392 iso_pu_bacteria 2957402308 2957404870 458
393 iso_pu_bacteria 2957408893 2957410907 458
394 iso_pu_bacteria 2957415311 2957420129 458
395 iso_pu_bacteria 2957422303 2957425987 458
396 iso_pu_bacteria 2957430029 2957433939 458
397 iso_pu_bacteria 2957437181 2957441119 458
398 iso_pu_bacteria 2957443900 2957445692 458
399 iso_pu_bacteria 2957450854 2957454625 458
400 iso_pu_bacteria 2957457609 2957464019 458
401 iso_pu_bacteria 2957464669 2957467815 458
402 iso_pu_bacteria 2957471148 2957472460 458
403 iso_pu_bacteria 2957478035 2957480729 458
404 iso_pu_bacteria 2957484790 2957488526 458
405 iso_pu_bacteria 2957491536 2957494359 458
406 iso_pu_bacteria 2957498199 2957502672 458
407 iso_pu_bacteria 2957505466 2957506814 458
408 iso_pu_bacteria 2958034702 2958034915 458
409 iso_pu_bacteria 2958041894 2958042956 458
410 iso_pu_bacteria 2958064165 2958067146 458
411 iso_pu_bacteria 2958071322 2958074165 458
412 iso_pu_bacteria 2958084443 2958086334 458
413 iso_pu_bacteria 2958108152 2958110242 458
414 iso_pu_bacteria 2958115193 2958122616 458
415 iso_pu_bacteria 2958122699 2958129402 458
416 iso_pu_bacteria 2958130278 2958135942 458
417 iso_pu_bacteria 2958137437 2958139116 458
418 iso_pu_bacteria 2958158011 2958160113 458
419 iso_pu_bacteria 2958165035 2958169725 458
420 iso_pu_bacteria 2958172287 2958175143 458
421 iso_pu_bacteria 2958179912 2958185409 458
422 iso_pu_bacteria 2960584000 2960587021 458
423 iso_pu_bacteria 2960591022 2960597303 458
424 iso_pu_bacteria 2960597568 2960598250 458
425 iso_pu_bacteria 2960603979 2960609075 458
426 iso_pu_bacteria 2960610863 2960615187 458
427 iso_pu_bacteria 2960617483 2960620896 458
428 iso_pu_bacteria 2960624210 2960627600 458
429 iso_pu_bacteria 2960631154 2960635907 458
430 iso_pu_bacteria 2960637947 2960644695 458
431 iso_pu_bacteria 2960645483 2960649042 458
432 iso_pu_bacteria 2960652885 2960659254 458
433 iso_pu_bacteria 2960660292 2960662191 458
434 iso_pu_bacteria 2960667422 2960672730 458
435 iso_pu_bacteria 2960674078 2960677149 458
436 iso_pu_bacteria 2960680706 2960687255 458
437 iso_pu_bacteria 2960687367 2960689905 458
438 iso_pu_bacteria 2960693952 2960698420 458
439 iso_pu_bacteria 2961077736 2961083676 458
440 iso_pu_bacteria 2961114664 2961116916 458
441 iso_pu_bacteria 2961127735 2961135814 458
442 iso_pu_bacteria 2961163497 2961168185 458
443 iso_pu_bacteria 2961170736 2961174816 458
444 iso_pu_bacteria 2961183825 2961184461 458
445 iso_pu_bacteria 2963644680 2963648530 458
446 iso_pu_bacteria 2964607997 2964611725 458
447 iso_pu_bacteria 2964615318 2964616915 458
448 iso_pu_bacteria 2964621998 2964624629 458
449 iso_pu_bacteria 2964628898 2964631119 458
450 iso_pu_bacteria 2964636051 2964637543 458
451 iso_pu_bacteria 2964643177 2964646436 458
452 iso_pu_bacteria 2964649959 2964651657 458
453 iso_pu_bacteria 2964656573 2964661635 458
454 iso_pu_bacteria 2964663802 2964669878 458
455 iso_pu_bacteria 2964670856 2964675048 458
456 iso_pu_bacteria 2964678106 2964678489 458
457 iso_pu_bacteria 2964685014 2964686865 458
458 iso_pu_bacteria 2964691889 2964694409 458
459 iso_pu_bacteria 2964698721 2964701566 458
460 iso_pu_bacteria 2964705432 2964710723 458
461 iso_pu_bacteria 2964712639 2964715649 458
462 iso_pu_bacteria 2964719344 2964723467 458
463 iso_pu_bacteria 2965018300 2965023004 458
464 iso_pu_bacteria 2965025482 2965029357 458
465 iso_pu_bacteria 2965040258 2965047201 458
466 iso_pu_bacteria 2965047637 2965055080 458
467 iso_pu_bacteria 2965062239 2965066835 458
468 iso_pu_bacteria 2965089291 2965094510 458
469 iso_pu_bacteria 2965119406 2965126093 458
470 iso_pu_bacteria 2967664464 2967665141 458
471 iso_pu_bacteria 2967671571 2967675543 458
472 iso_pu_bacteria 2967678726 2967686154 458
473 iso_pu_bacteria 2967686174 2967690088 458
474 iso_pu_bacteria 2967693043 2967697477 458
475 iso_pu_bacteria 2967699805 2967702539 458
476 iso_pu_bacteria 2967706974 2967709038 458
477 iso_pu_bacteria 2967714385 2967716809 458
478 iso_pu_bacteria 2967721400 2967726358 458
479 iso_pu_bacteria 2967728569 2967732747 458
480 iso_pu_bacteria 2967735183 2967740070 458
481 iso_pu_bacteria 2967742019 2967744868 458
482 iso_pu_bacteria 2967748971 2967753760 458
483 iso_pu_bacteria 2967755722 2967758679 458
484 iso_pu_bacteria 2967762386 2967769289 458
485 iso_pu_bacteria 2967769361 2967770904 458
486 iso_pu_bacteria 2967775926 2967776903 458
487 iso_pu_bacteria 2967996073 2968000751 458
488 iso_pu_bacteria 2968003550 2968009877 458
489 iso_pu_bacteria 2968016561 2968017660 458
490 iso_pu_bacteria 2968083720 2968083759 458
491 iso_pu_bacteria 2968091066 2968091954 458
492 iso_pu_bacteria 2968097103 2968099354 458
493 iso_pu_bacteria 2968110612 2968112823 458
494 iso_pu_bacteria 2968117919 2968122945 458
495 iso_pu_bacteria 2968128360 2968128886 458
496 iso_pu_bacteria 2968171901 2968176585 458
497 iso_pu_bacteria 2970019648 2970024646 458
498 iso_pu_bacteria 2970026789 2970030855 458
499 iso_pu_bacteria 2970033650 2970036936 458
500 iso_pu_bacteria 2970040964 2970042091 458
501 iso_pu_bacteria 2970047711 2970048917 458
502 iso_pu_bacteria 2970054988 2970057111 458
503 iso_pu_bacteria 2970061556 2970066197 458
504 iso_pu_bacteria 2970068827 2970070872 458
505 iso_pu_bacteria 2970076120 2970079287 458
506 iso_pu_bacteria 2970082768 2970083675 458
507 iso_pu_bacteria 2970088815 2970090467 458
508 iso_pu_bacteria 2970095765 2970099177 458
509 iso_pu_bacteria 2970102677 2970107429 458
510 iso_pu_bacteria 2970109326 2970111629 458
511 iso_pu_bacteria 2970116247 2970121951 458
512 iso_pu_bacteria 2970122695 2970126706 458
513 iso_pu_bacteria 2970129317 2970133439 458
514 iso_pu_bacteria 2970136068 2970143248 458
515 iso_pu_bacteria 2970143518 2970148103 458
516 iso_pu_bacteria 2970149975 2970156392 458
517 iso_pu_bacteria 2970156795 2970157210 458
518 iso_pu_bacteria 2970164137 2970168189 458
519 iso_pu_bacteria 2970170962 2970174699 458
520 iso_pu_bacteria 2970177841 2970180525 458
521 iso_pu_bacteria 2970184632 2970189318 458
522 iso_pu_bacteria 2970191845 2970195793 458
523 iso_pu_bacteria 2970469710 2970472165 458
524 iso_pu_bacteria 2970489779 2970489895 458
525 iso_pu_bacteria 2970503327 2970507402 458
526 iso_pu_bacteria 2970510686 2970517833 458
527 iso_pu_bacteria 2970524798 2970530157 458
528 iso_pu_bacteria 2970532167 2970539457 458
529 iso_pu_bacteria 2970540015 2970546148 458
530 iso_pu_bacteria 2970547951 2970548157 458
531 iso_pu_bacteria 2970554993 2970559524 458
532 iso_pu_bacteria 2970593180 2970593395 458
533 iso_pu_bacteria 2970619444 2970623398 458
534 iso_pu_bacteria 2970627176 2970628400 458
535 iso_pu_bacteria 2977516862 2977521402 458
536 iso_pu_bacteria 2977523885 2977530270 458
537 iso_pu_bacteria 2977530762 2977534788 458
538 iso_pu_bacteria 2977537788 2977542585 458
539 iso_pu_bacteria 2977544691 2977547776 458
540 iso_pu_bacteria 2977551784 2977556368 458
541 iso_pu_bacteria 2977558990 2977560954 458
542 iso_pu_bacteria 2977565890 2977567897 458
543 iso_pu_bacteria 2977572785 2977575166 458
544 iso_pu_bacteria 2977579622 2977584259 458
545 iso_pu_bacteria 2977821940 2977828741 458
546 iso_pu_bacteria 2977828996 2977830423 458
547 iso_pu_bacteria 2977843712 2977848797 458
548 iso_pu_bacteria 2977851361 2977853573 458
549 iso_pu_bacteria 2977858184 2977864883 458
550 iso_pu_bacteria 2977864932 2977872096 458
551 iso_pu_bacteria 2977872689 2977873132 458
552 iso_pu_bacteria 2977907340 2977911130 458
553 iso_pu_bacteria 2977915119 2977919689 458
554 iso_pu_bacteria 2977922695 2977929086 458
555 iso_pu_bacteria 2977935797 2977939939 458
556 iso_pu_bacteria 2977942078 2977944385 458
557 iso_pu_bacteria 2977986579 2977989876 458
558 iso_pu_bacteria 2978969890 2978974067 458
559 iso_pu_bacteria 2979095461 2979098399 458
560 iso_pu_bacteria 2979100975 2979106225 458
561 iso_pu_bacteria 2979710463 2979713940 458
562 iso_pu_bacteria 2979772303 2979777610 458
563 iso_pu_bacteria 2979779861 2979784442 458
564 iso_pu_bacteria 2979808191 2979812598 458
565 iso_pu_bacteria 2984509177 2984511978 458
566 iso_pu_bacteria 2984518228 2984521661 458
567 iso_pu_bacteria 2984537506 2984540956 458
568 iso_pu_bacteria 2984587000 2984589395 458
569 iso_pu_bacteria 2984601300 2984603217 458
570 iso_pu_bacteria 2987636660 2987640862 458
571 iso_pu_bacteria 2987645492 2987647666 458
572 iso_pu_bacteria 2987652177 2987657104 458
573 iso_pu_bacteria 2987659509 2987664199 458
574 iso_pu_bacteria 2987666974 2987670482 458
575 iso_pu_bacteria 2987673487 2987676717 458
576 iso_pu_bacteria 2989349275 2989349357 458
577 iso_pu_bacteria 2989771324 2989775863 458
578 iso_pu_bacteria 2989776772 2989779057 458
579 iso_pu_bacteria 2996310559 2996310693 458
580 iso_pu_bacteria 2996336353 2996337935 458
581 iso_pu_bacteria 2996341866 2996344773 458
582 iso_pu_bacteria 2996348954 2996351081 458
583 iso_pu_bacteria 2996386984 2996388205 458
584 iso_pu_bacteria 3000135777 3000138314 458
585 iso_pu_bacteria 3002141150 3002144447 458
586 iso_pu_bacteria 3003930520 3003933697 458
587 iso_pu_bacteria 3004167301 3004170047 458
588 iso_pu_bacteria 3004188549 3004193254 458
589 iso_pu_bacteria 3004203850 3004209059 458
590 iso_pu_bacteria 3004211236 3004212623 458
591 iso_pu_bacteria 3004218560 3004221687 458
592 iso_pu_bacteria 3004232784 3004238162 458
593 iso_pu_bacteria 3004268573 3004273767 458
594 iso_pu_bacteria 3004275668 3004277779 458
595 iso_pu_bacteria 3004334049 3004340419 458
596 iso_pu_bacteria 637000159 637073741 458
597 iso_pu_bacteria 643692032 643825900 458
598 iso_pu_bacteria 648276728 648737489 458
599 iso_pu_bacteria 649633066 649873743 458
600 iso_pu_bacteria 650716007 650740077 458
601 iso_pu_bacteria 8002285264 8002286275 458
602 iso_pu_bacteria 8003570095 8003571074 458
603 iso_pu_bacteria 8003992118 8003993776 458
604 iso_pu_bacteria 8003999396 8004001242 458
605 iso_pu_bacteria 8004300914 8004304341 458
606 iso_pu_bacteria 8004312739 8004318654 458
607 iso_pu_bacteria 8004374579 8004379697 458
608 iso_pu_bacteria 8004387939 8004393902 458
609 iso_pu_bacteria 8004445564 8004446310 458
610 iso_pu_bacteria 8004633249 8004636237 458
611 iso_pu_bacteria 8004640170 8004643258 458
612 iso_pu_bacteria 8004703790 8004714576 458
613 iso_pu_bacteria 8004714634 8004719606 458
614 iso_pu_bacteria 8004727605 8004729137 458
615 iso_pu_bacteria 8005246636 8005248614 458
616 iso_pu_bacteria 8005570704 8005574269 458
617 iso_pu_bacteria 8005658619 8005659309 458
618 iso_pu_bacteria 8045864390 8045865052 458
619 iso_pu_bacteria 8049293176 8049294845 458
620 iso_pu_bacteria 8054460903 8054462611 458
621 iso_pu_bacteria 8054558443 8054558681 458
622 iso_pu_bacteria 8055617313 8055621789 458
623 iso_pu_bacteria 8056875544 8056877511 458
624 iso_pu_bacteria 2643221568 2643855619 459
625 iso_pu_bacteria 2894817345 2894820220 459
626 3300053727 Ga0500611_004864 Ga0500611_004864_203_1591 461
627 3300001989 JGI24739J22299_10006473 JGI24739J22299_100064732 462
628 3300002741 JGI25157J39369_1000750 JGI25157J39369_10007508 462
629 3300002773 JGI25152J39213_1010229 JGI25152J39213_10102292 462
630 3300003187 JGI25151J46595_10000134 JGI25151J46595_1000013478 462
631 3300003187 JGI25151J46595_10028641 JGI25151J46595_100286412 462
632 3300003214 JGI25165J46597_1000033 JGI25165J46597_1000033129 462
633 3300003215 JGI25153J46596_10001403 JGI25153J46596_100014036 462
634 3300003215 JGI25153J46596_10011152 JGI25153J46596_100111523 462
635 3300003354 JGI25160J50197_1000011 JGI25160J50197_100001158 462
636 3300003354 JGI25160J50197_1000572 JGI25160J50197_10005727 462
637 3300003374 JGI25161J50226_1000232 JGI25161J50226_100023219 462
638 3300003374 JGI25161J50226_1001043 JGI25161J50226_10010439 462
639 3300003578 Ga0006562J51391_1008942 Ga0006562J51391_10089423 462
640 3300003762 Ga0055542_1000654 Ga0055542_100065413 462
641 3300003763 Ga0055529_1002419 Ga0055529_10024192 462
642 3300003771 Ga0055526_1002003 Ga0055526_10020037 462
643 3300003771 Ga0055526_1003319 Ga0055526_10033193 462
644 3300003775 Ga0055524_1001915 Ga0055524_10019159 462
645 3300003781 Ga0055536_1002697 Ga0055536_10026975 462
646 3300003790 Ga0055528_1001460 Ga0055528_10014605 462
647 3300003794 Ga0055531_10000733 Ga0055531_1000073326 462
648 3300003794 Ga0055531_10013794 Ga0055531_100137943 462
649 3300003856 Ga0058692_1001202 Ga0058692_10012029 462
650 3300003856 Ga0058692_1004873 Ga0058692_10048733 462
651 3300004625 Ga0055543_1000354 Ga0055543_10003548 462
652 3300004625 Ga0055543_1002191 Ga0055543_10021912 462
653 3300005262 Ga0065165_1000018 Ga0065165_100001858 462
654 3300005262 Ga0065165_1001860 Ga0065165_100186015 462
655 3300005262 Ga0065165_1009367 Ga0065165_10093673 462
656 3300005289 Ga0065704_10072842 Ga0065704_100728423 462
657 3300005548 Ga0070665_100060247 Ga0070665_1000602472 462
658 3300005614 Ga0068856_100280332 Ga0068856_1002803322 462
659 3300005985 Ga0081539_10001646 Ga0081539_1000164626 462
660 3300006038 Ga0075365_10002027 Ga0075365_100020275 462
661 3300006038 Ga0075365_10047938 Ga0075365_100479381 462
662 3300006038 Ga0075365_10114197 Ga0075365_101141972 462
663 3300006042 Ga0075368_10013307 Ga0075368_100133073 462
664 3300006048 Ga0075363_100066825 Ga0075363_1000668251 462
665 3300006051 Ga0075364_10003103 Ga0075364_100031038 462
666 3300006177 Ga0075362_10002505 Ga0075362_100025052 462
667 3300006177 Ga0075362_10028613 Ga0075362_100286132 462
668 3300006178 Ga0075367_10027101 Ga0075367_100271011 462
669 3300006178 Ga0075367_10058803 Ga0075367_100588033 462
670 3300006178 Ga0075367_10117277 Ga0075367_101172771 462
671 3300006186 Ga0075369_10012429 Ga0075369_100124292 462
672 3300006946 Ga0079104_1000022 Ga0079104_100002268 462
673 3300006946 Ga0079104_1004678 Ga0079104_10046785 462
674 3300006946 Ga0079104_1007604 Ga0079104_10076043 462
675 3300006948 Ga0099826_10000184 Ga0099826_1000018423 462
676 3300006948 Ga0099826_10009956 Ga0099826_100099563 462
677 3300009545 Ga0105237_10180725 Ga0105237_101807252 462
678 3300009551 Ga0105238_10028151 Ga0105238_100281513 462
679 3300009766 Ga0123342_1000455 Ga0123342_10004554 462
680 3300013102 Ga0157371_10000015 Ga0157371_10000015128 462
681 3300013102 Ga0157371_10004053 Ga0157371_1000405310 462
682 3300013104 Ga0157370_10001244 Ga0157370_100012449 462
683 3300013104 Ga0157370_10001762 Ga0157370_1000176221 462
684 3300013249 Ga0171463_1008 Ga0171463_1008268 462
685 3300014497 Ga0182008_10020318 Ga0182008_100203182 462
686 3300015261 Ga0182006_1006962 Ga0182006_10069622 462
687 3300015690 Ga0183363_1212 Ga0183363_12125 462
688 3300021320 Ga0214544_1000691 Ga0214544_100069127 462
689 3300021321 Ga0214542_1000019 Ga0214542_100001979 462
690 3300021321 Ga0214542_1022261 Ga0214542_10222614 462
691 3300021327 Ga0214543_1000010 Ga0214543_1000010235 462
692 3300021327 Ga0214543_1000011 Ga0214543_100001168 462
693 3300022739 Ga0228711_1000007 Ga0228711_100000728 462
694 3300022740 Ga0228710_1000007 Ga0228710_100000715 462
695 3300025208 Ga0209436_100281 Ga0209436_1002815 462
696 3300025245 Ga0207425_1004590 Ga0207425_10045902 462
697 3300025245 Ga0207425_1010512 Ga0207425_10105122 462
698 3300025250 Ga0209026_1000002 Ga0209026_1000002656 462
699 3300025254 Ga0209148_1000072 Ga0209148_100007258 462
700 3300025256 Ga0209759_1000146 Ga0209759_100014694 462
701 3300025258 Ga0209129_1000659 Ga0209129_10006593 462
702 3300025261 Ga0209233_1000027 Ga0209233_1000027535 462
703 3300025272 Ga0209455_1000153 Ga0209455_100015371 462
704 3300025273 Ga0209673_1000552 Ga0209673_100055248 462
705 3300025284 Ga0209130_1000029 Ga0209130_1000029194 462
706 3300025292 Ga0209676_1001236 Ga0209676_10012366 462
707 3300025292 Ga0209676_1001652 Ga0209676_100165211 462
708 3300025294 Ga0209025_1000094 Ga0209025_1000094132 462
709 3300025294 Ga0209025_1000119 Ga0209025_1000119158 462
710 3300025294 Ga0209025_1000166 Ga0209025_100016646 462
711 3300025294 Ga0209025_1000843 Ga0209025_10008432 462
712 3300025294 Ga0209025_1032078 Ga0209025_10320783 462
713 3300025295 Ga0209564_1000469 Ga0209564_100046936 462
714 3300025295 Ga0209564_1000501 Ga0209564_10005018 462
715 3300025297 Ga0209758_1000155 Ga0209758_10001553 462
716 3300025297 Ga0209758_1000218 Ga0209758_100021839 462
717 3300025297 Ga0209758_1047111 Ga0209758_10471112 462
718 3300025298 Ga0209050_1003018 Ga0209050_10030183 462
719 3300025299 Ga0209256_1000194 Ga0209256_100019446 462
720 3300025299 Ga0209256_1000946 Ga0209256_100094627 462
721 3300025299 Ga0209256_1001513 Ga0209256_100151310 462
722 3300025302 Ga0207426_1000039 Ga0207426_1000039138 462
723 3300025302 Ga0207426_1000074 Ga0207426_1000074104 462
724 3300025303 Ga0209051_1000998 Ga0209051_10009986 462
725 3300025303 Ga0209051_1002938 Ga0209051_10029389 462
726 3300025904 Ga0207647_10006306 Ga0207647_100063067 462
727 3300025924 Ga0207694_10033071 Ga0207694_100330713 462
728 3300025981 Ga0207640_10032392 Ga0207640_100323922 462
729 3300026078 Ga0207702_10139406 Ga0207702_101394061 462
730 3300027111 Ga0209281_1000036 Ga0209281_1000036346 462
731 3300027111 Ga0209281_1000047 Ga0209281_1000047288 462
732 3300027111 Ga0209281_1000128 Ga0209281_1000128176 462
733 3300027111 Ga0209281_1000483 Ga0209281_100048352 462
734 3300027312 Ga0209371_1000021 Ga0209371_100002121 462
735 3300027312 Ga0209371_1001463 Ga0209371_100146314 462
736 3300027666 Ga0209282_1000034 Ga0209282_1000034110 462
737 3300027666 Ga0209282_1003372 Ga0209282_10033727 462
738 3300027666 Ga0209282_1004065 Ga0209282_10040653 462
739 3300028379 Ga0268266_10021580 Ga0268266_100215804 462
740 3300028379 Ga0268266_10042265 Ga0268266_100422654 462
741 3300028794 Ga0307515_10000023 Ga0307515_10000023374 462
742 3300028794 Ga0307515_10000945 Ga0307515_1000094561 462
743 3300028794 Ga0307515_10009074 Ga0307515_1000907413 462
744 3300030500 Ga0268256_1000020 Ga0268256_100002027 462
745 3300030500 Ga0268256_1005833 Ga0268256_10058333 462
746 3300030744 Ga0316181_1152995 Ga0316181_11529953 462
747 3300031456 Ga0307513_10002881 Ga0307513_1000288111 462
748 3300031967 Ga0315914_1000010 Ga0315914_1000010148 462
749 3300032004 Ga0307414_10143029 Ga0307414_101430292 462
750 3300033430 Ga0315913_1000005 Ga0315913_1000005148 462
751 3300033464 Ga0315915_1000012 Ga0315915_100001215 462
752 3300037312 Ga0395899_0000073 Ga0395899_0000073_13317_14708 462
753 3300037418 Ga0395900_0000027 Ga0395900_0000027_117887_119278 462
754 3300037418 Ga0395900_0143628 Ga0395900_0143628_842_2230 462
755 3300037418 Ga0395900_0240765 Ga0395900_0240765_265_1653 462
756 3300037466 Ga0395898_0000043 Ga0395898_0000043_265661_267052 462
757 3300037471 Ga0395905_0000032 Ga0395905_0000032_166655_168046 462
758 3300037471 Ga0395905_0064647 Ga0395905_0064647_1386_2774 462
759 3300037471 Ga0395905_0125508 Ga0395905_0125508_624_2012 462
760 3300037471 Ga0395905_0189378 Ga0395905_0189378_120_1508 462
761 3300037471 Ga0395905_0268954 Ga0395905_0268954_169_1557 462
762 3300038443 Ga0395901_0000056 Ga0395901_0000056_117887_119278 462
763 3300038443 Ga0395901_0105657 Ga0395901_0105657_885_2273 462
764 3300041404 Ga0439436_0013760 Ga0439436_0013760_274_1665 462
765 3300042122 Ga0450920_004347 Ga0450920_004347_92_1483 462
766 3300042435 Ga0439434_0018339 Ga0439434_0018339_40_1431 462
767 3300042531 Ga0450918_000667 Ga0450918_000667_5206_6597 462
768 3300044658 Ga0466972_0023536 Ga0466972_0023536_81_1469 462
769 3300044683 Ga0466965_0042987 Ga0466965_0042987_484_1872 462
770 3300044735 Ga0466968_0018122 Ga0466968_0018122_182_1570 462
771 3300044735 Ga0466968_0019776 Ga0466968_0019776_316_1704 462
772 3300044765 Ga0466970_0006625 Ga0466970_0006625_2380_3768 462
773 3300044901 Ga0466960_0057972 Ga0466960_0057972_217_1605 462
774 3300046501 Ga0495607_0000021 Ga0495607_0000021_151610_152998 462
775 3300046558 Ga0495633_0045000 Ga0495633_0045000_438_1829 462
776 3300046674 Ga0495588_0029082 Ga0495588_0029082_410_1798 462
777 3300047470 Ga0495681_0007458 Ga0495681_0007458_3964_5352 462
778 3300048914 Ga0496111_0003923 Ga0496111_0003923_5694_7100 462
779 3300048915 Ga0496112_0018186 Ga0496112_0018186_4422_5810 462
780 3300048918 Ga0496115_0074577 Ga0496115_0074577_404_1792 462
781 3300048919 Ga0496116_0000043 Ga0496116_0000043_146864_148255 462
782 3300048920 Ga0496117_0000002 Ga0496117_0000002_997161_998549 462
783 3300048921 Ga0496118_0001571 Ga0496118_0001571_26181_27569 462
784 3300048922 Ga0496119_0015286 Ga0496119_0015286_2173_3579 462
785 3300048923 Ga0496120_0001517 Ga0496120_0001517_12540_13928 462
786 3300048923 Ga0496120_0002771 Ga0496120_0002771_13477_14865 462
787 3300048923 Ga0496120_0008186 Ga0496120_0008186_942_2330 462
788 3300048923 Ga0496120_0014559 Ga0496120_0014559_3291_4679 462
789 3300048924 Ga0496121_0000001 Ga0496121_0000001_1211777_1213165 462
790 3300048924 Ga0496121_0000959 Ga0496121_0000959_43184_44590 462
791 3300048924 Ga0496121_0071523 Ga0496121_0071523_536_1924 462
792 3300048925 Ga0496122_0000001 Ga0496122_0000001_303615_305003 462
793 3300048925 Ga0496122_0000025 Ga0496122_0000025_226526_227914 462
794 3300048925 Ga0496122_0005442 Ga0496122_0005442_3937_5382 462
795 3300048925 Ga0496122_0008197 Ga0496122_0008197_6436_7872 462
796 3300048925 Ga0496122_0047797 Ga0496122_0047797_419_1825 462
797 3300048925 Ga0496122_0059066 Ga0496122_0059066_1345_2736 462
798 3300048926 Ga0496123_0000001 Ga0496123_0000001_307346_308734 462
799 3300048926 Ga0496123_0000032 Ga0496123_0000032_136299_137687 462
800 3300048926 Ga0496123_0000552 Ga0496123_0000552_53696_55141 462
801 3300048926 Ga0496123_0024982 Ga0496123_0024982_1582_2973 462
802 3300048927 Ga0496124_0002011 Ga0496124_0002011_147_1535 462
803 3300048927 Ga0496124_0024412 Ga0496124_0024412_2013_3401 462
804 3300048927 Ga0496124_0035414 Ga0496124_0035414_901_2289 462
805 3300048927 Ga0496124_0036108 Ga0496124_0036108_21_1427 462
806 3300048928 Ga0496125_0000001 Ga0496125_0000001_1370844_1372232 462
807 3300048928 Ga0496125_0000394 Ga0496125_0000394_25130_26593 462
808 3300048928 Ga0496125_0049047 Ga0496125_0049047_283_1671 462
809 3300048928 Ga0496125_0151403 Ga0496125_0151403_49_1437 462
810 3300048929 Ga0496126_0001040 Ga0496126_0001040_35911_37299 462
811 3300048929 Ga0496126_0002456 Ga0496126_0002456_18620_20011 462
812 3300049568 Ga0501031_0000087 Ga0501031_0000087_43299_44690 462
813 3300049568 Ga0501031_0070635 Ga0501031_0070635_503_1897 462
814 3300049569 Ga0501032_0000059 Ga0501032_0000059_75340_76734 462
815 3300049569 Ga0501032_0000111 Ga0501032_0000111_63714_65105 462
816 3300049569 Ga0501032_0008780 Ga0501032_0008780_1340_2731 462
817 3300049569 Ga0501032_0033625 Ga0501032_0033625_1316_2704 462
818 3300049569 Ga0501032_0073947 Ga0501032_0073947_322_1713 462
819 3300049570 Ga0501033_0000048 Ga0501033_0000048_26430_27824 462
820 3300049570 Ga0501033_0000213 Ga0501033_0000213_4698_6089 462
821 3300049570 Ga0501033_0003451 Ga0501033_0003451_6445_7836 462
822 3300049570 Ga0501033_0003709 Ga0501033_0003709_6191_7600 462
823 3300049570 Ga0501033_0012509 Ga0501033_0012509_4984_6375 462
824 3300049570 Ga0501033_0013177 Ga0501033_0013177_1468_2859 462
825 3300049571 Ga0501034_0000452 Ga0501034_0000452_26402_27796 462
826 3300049571 Ga0501034_0000960 Ga0501034_0000960_31429_32877 462
827 3300049571 Ga0501034_0010338 Ga0501034_0010338_6389_7780 462
828 3300049571 Ga0501034_0034410 Ga0501034_0034410_322_1713 462
829 3300049571 Ga0501034_0045555 Ga0501034_0045555_2363_3751 462
830 3300049571 Ga0501034_0072537 Ga0501034_0072537_1217_2611 462
831 3300049571 Ga0501034_0143246 Ga0501034_0143246_886_2277 462
832 3300049572 Ga0501036_0000092 Ga0501036_0000092_26402_27796 462
833 3300049572 Ga0501036_0000093 Ga0501036_0000093_4698_6089 462
834 3300049573 Ga0501037_0000061 Ga0501037_0000061_5158_6549 462
835 3300049573 Ga0501037_0000131 Ga0501037_0000131_4698_6089 462
836 3300049573 Ga0501037_0001008 Ga0501037_0001008_1573_2967 462
837 3300049574 Ga0501038_0000109 Ga0501038_0000109_4698_6089 462
838 3300049574 Ga0501038_0000123 Ga0501038_0000123_37340_38734 462
839 3300049574 Ga0501038_0039203 Ga0501038_0039203_2651_4042 462
840 3300049574 Ga0501038_0120640 Ga0501038_0120640_359_1747 462
841 3300049575 Ga0501039_0000108 Ga0501039_0000108_49587_50978 462
842 3300049576 Ga0501040_0003364 Ga0501040_0003364_4259_5650 462
843 3300049579 Ga0501043_0000063 Ga0501043_0000063_88554_89945 462
844 3300049579 Ga0501043_0000303 Ga0501043_0000303_9285_10679 462
845 3300049579 Ga0501043_0003292 Ga0501043_0003292_4670_6061 462
846 3300049579 Ga0501043_0033651 Ga0501043_0033651_23_1417 462
847 3300049579 Ga0501043_0051239 Ga0501043_0051239_1007_2395 462
848 3300049580 Ga0501046_0101215 Ga0501046_0101215_262_1653 462
849 3300049581 Ga0501047_0002263 Ga0501047_0002263_5256_6650 462
850 3300049581 Ga0501047_0006155 Ga0501047_0006155_5846_7240 462
851 3300049581 Ga0501047_0013540 Ga0501047_0013540_5735_7126 462
852 3300049581 Ga0501047_0014712 Ga0501047_0014712_4651_6042 462
853 3300049581 Ga0501047_0019990 Ga0501047_0019990_2744_4135 462
854 3300049581 Ga0501047_0065758 Ga0501047_0065758_970_2394 462
855 3300049582 Ga0501048_0150604 Ga0501048_0150604_237_1628 462
856 3300049585 Ga0501069_0000060 Ga0501069_0000060_5140_6531 462
857 3300049585 Ga0501069_0027706 Ga0501069_0027706_890_2281 462
858 3300049586 Ga0501070_0002994 Ga0501070_0002994_10749_12140 462
859 3300049586 Ga0501070_0014307 Ga0501070_0014307_1866_3257 462
860 3300049586 Ga0501070_0018055 Ga0501070_0018055_2213_3604 462
861 3300049586 Ga0501070_0026613 Ga0501070_0026613_2807_4198 462
862 3300049587 Ga0501071_0003798 Ga0501071_0003798_7105_8496 462
863 3300049587 Ga0501071_0058670 Ga0501071_0058670_869_2260 462
864 3300049589 Ga0501073_0010648 Ga0501073_0010648_2021_3412 462
865 3300049590 Ga0501074_0000070 Ga0501074_0000070_12538_13929 462
866 3300049742 Ga0501080_0000761 Ga0501080_0000761_2582_3973 462
867 3300049742 Ga0501080_0026967 Ga0501080_0026967_689_2080 462
868 3300049744 Ga0501083_0000098 Ga0501083_0000098_6451_7842 462
869 3300049744 Ga0501083_0025339 Ga0501083_0025339_1425_2816 462
870 3300049822 Ga0501035_0000055 Ga0501035_0000055_5158_6549 462
871 3300049822 Ga0501035_0000076 Ga0501035_0000076_26430_27824 462
872 3300049822 Ga0501035_0000219 Ga0501035_0000219_52234_53643 462
873 3300049822 Ga0501035_0001473 Ga0501035_0001473_12773_14164 462
874 3300049822 Ga0501035_0002916 Ga0501035_0002916_619_2010 462
875 3300049822 Ga0501035_0005019 Ga0501035_0005019_2704_4095 462
876 3300049822 Ga0501035_0006674 Ga0501035_0006674_4698_6089 462
877 3300049822 Ga0501035_0035138 Ga0501035_0035138_1672_3063 462
878 3300049822 Ga0501035_0058637 Ga0501035_0058637_1055_2479 462
879 3300049822 Ga0501035_0159254 Ga0501035_0159254_214_1605 462
880 3300049823 Ga0501044_0000075 Ga0501044_0000075_26403_27797 462
881 3300049823 Ga0501044_0000234 Ga0501044_0000234_4698_6089 462
882 3300049823 Ga0501044_0001711 Ga0501044_0001711_18310_19719 462
883 3300049823 Ga0501044_0004401 Ga0501044_0004401_5947_7338 462
884 3300049823 Ga0501044_0007161 Ga0501044_0007161_5722_7113 462
885 3300050489 nmdc:mga03683_2603_c1 nmdc:mga03683_2603_c1_867_2255 462
886 3300050490 nmdc:mga03n38_29434_c1 nmdc:mga03n38_29434_c1_74_1462 462
887 3300050491 nmdc:mga00v17_667_c1 nmdc:mga00v17_667_c1_17031_18437 462
888 3300050491 nmdc:mga00v17_6_c1 nmdc:mga00v17_6_c1_150961_152349 462
889 3300050492 nmdc:mga0yw44_109121_c1 nmdc:mga0yw44_109121_c1_126_1514 462
890 3300050492 nmdc:mga0yw44_25580_c1 nmdc:mga0yw44_25580_c1_1320_2708 462
891 3300050492 nmdc:mga0yw44_34054_c1 nmdc:mga0yw44_34054_c1_1170_2558 462
892 3300050516 nmdc:mga0sz30_94_c1 nmdc:mga0sz30_94_c1_18668_20056 462
893 3300053104 Ga0500556_0011736 Ga0500556_0011736_759_2147 462
894 3300053125 Ga0500618_000084 Ga0500618_000084_69194_70582 462
895 3300053125 Ga0500618_000777 Ga0500618_000777_6706_8094 462
896 3300053136 Ga0500559_0009220 Ga0500559_0009220_1721_3109 462
897 3300053137 Ga0500561_0000351 Ga0500561_0000351_5758_7146 462
898 3300053139 Ga0500568_0000144 Ga0500568_0000144_59066_60457 462
899 3300053140 Ga0500573_0000256 Ga0500573_0000256_12099_13493 462
900 3300053153 Ga0500616_0000551 Ga0500616_0000551_5577_7004 462
901 3300053153 Ga0500616_0042806 Ga0500616_0042806_929_2317 462
902 3300053153 Ga0500616_0059768 Ga0500616_0059768_127_1518 462
903 3300053155 Ga0500620_000380 Ga0500620_000380_1321_2712 462
904 3300053156 Ga0500622_0000116 Ga0500622_0000116_23271_24659 462
905 3300053161 Ga0500634_0005798 Ga0500634_0005798_732_2126 462
906 3300053177 Ga0500636_0000015 Ga0500636_0000015_51990_53429 462
907 iso_pu_bacteria 2937891427 2937893547 462
908 iso_pu_bacteria 2958100919 2958106368 462
909 iso_pu_bacteria 2977950692 2977950710 462
910 iso_pu_bacteria 2977957713 2977961395 462
911 iso_pu_bacteria 2979742915 2979743536 462

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02852

Pyr_redox_dim

Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

339

448

0.98

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

2

319

0.97

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

168

247

0.93

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

96

303

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kdg-assembly1.cif.gz_B crystal structure of the flavin domain of cellobiose dehydrogenase 0.9893 6 36
4dna-assembly1.cif.gz_B crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021 0.9782 4 462
3o0h-assembly1.cif.gz_A crystal structure of glutathione reductase from bartonella henselae 0.9755 4 462
3o0h-assembly1.cif.gz_B crystal structure of glutathione reductase from bartonella henselae 0.9731 4 462
4dna-assembly1.cif.gz_B crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021 0.9719 4 462
ID Description Score Start End Superfamily
af_A0A1D6HP35_184_301_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9805 156 271 3.50.50.60
af_P9WFZ3_1_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9798 172 202 3.40.50.720
4dnaB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9794 146 261 3.50.50.60
2hqmB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9783 146 264 3.50.50.60
6b4oA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9774 151 263 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A530GGC5-F1-model_v4 Glutathione-disulfide reductase 0.991 137 256 GO:0004362
GO:0005829
GO:0006749
GO:0034599
GO:0045454
GO:0050660
AF-A0A7S2ZAC2-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9839 2 283 GO:0004362
GO:0005739
GO:0005829
GO:0006749
GO:0034599
GO:0045454
GO:0050660
AF-A0A530GGC5-F1-model_v4 Glutathione-disulfide reductase 0.9829 137 256 GO:0004362
GO:0005829
GO:0006749
GO:0034599
GO:0045454
GO:0050660
AF-A0A135HUU0-F1-model_v4 Glutathione reductase (GRase) (EC 1.8.1.7) 0.9821 1 462 GO:0004362
GO:0005829
GO:0006749
GO:0034599
GO:0045454
GO:0050660
GO:0050661
AF-A0A7C7WI17-F1-model_v4 deleted 0.9816 1 252

Feature Viewer

pLDDT pTM Quality
93.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map