F485486

General Info

Members Datasets Scaffolds Average Seq Length
911 405 841 230

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0056513|Ga0500568_0056513_370_1200
Length 276
Sequence MPARLDQQPVLDLCAGAGKPVHRKPTAKSRRVEAMSSTEALQLTRPDGSPLRVLVVDDEVNIAELIGMALRYEGWQVNTAHTGTSAVNAAKDVRPDAVVLDMMLPDIDGMEVLRRMRGTQPDVPVVFLTAKDAVEDRIAGLTAGGDDYVTKPFSLEELVARLRALMRRAGAQRVQSSSVLAVGDLELDEDSHEVSRGGEPIMLTATEFELLRFLMRNPRRVLSKAQILDRVWNYDFGGQANVVELYISYLRKKVDAGREPMIHTMRGAGYVLKPAG

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2516143018 Ensifer sp. BR816 Isolate Nodule
3 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
4 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
5 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
6 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
7 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
8 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
9 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
10 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
11 2643221557 Ensifer sp. Root558 Isolate Unclassified
12 2643221561 Nocardioides sp. Root151 Isolate Unclassified
13 2643221599 Rhizobium sp. Root708 Isolate Unclassified
14 2643221607 Rhizobium sp. Root73 Isolate Unclassified
15 2643221610 Ensifer sp. Root74 Isolate Unclassified
16 2643221615 Nocardioides sp. Root224 Isolate Unclassified
17 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
18 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
19 2643221668 Ensifer sp. Root423 Isolate Unclassified
20 2643221675 Ensifer sp. Root1298 Isolate Unclassified
21 2643221680 Ensifer sp. Root1312 Isolate Unclassified
22 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
23 2643221696 Nocardioides sp. Root140 Isolate Unclassified
24 2643221726 Ensifer sp. Root954 Isolate Unclassified
25 2643221731 Bacillus sp. Root147 Isolate Unclassified
26 2671180694 Paenibacillus sp. A3 Isolate Unclassified
27 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
28 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
29 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
30 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
31 2773857759 Microbacterium sp. 1294 Isolate Unclassified
32 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
33 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
34 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
35 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
36 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
37 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
38 2818991459 Paenibacillus sp. 597 Isolate Unclassified
39 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
40 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
41 2842882022 Bacillus sp. R-71893 Isolate Unclassified
42 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
43 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
44 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
45 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
46 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
47 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
48 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
49 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
50 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
51 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
52 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
53 2919720352 Priestia megaterium 4340 Isolate Unclassified
54 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
55 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
56 2929004312 Priestia megaterium 1104 Isolate Unclassified
57 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
58 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
59 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
60 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
61 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
62 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
63 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
64 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
65 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
66 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
67 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
68 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
69 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
70 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
71 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
74 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
81 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
91 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
92 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
93 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
94 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
95 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
96 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
97 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
98 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
99 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
100 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
101 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
102 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
103 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
104 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
105 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
106 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
107 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
108 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
109 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
110 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
111 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
112 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
115 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
136 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
137 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
138 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
142 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
173 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
188 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
242 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
243 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
244 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
245 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
246 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
252 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
277 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
278 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
279 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
302 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
306 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
332 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
333 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
352 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
353 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
358 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
361 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
369 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
370 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
386 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
387 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
388 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
389 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
390 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
394 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
395 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
396 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
399 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
400 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
401 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
402 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
403 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
404 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
405 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.66
Metatranscriptomes 0.66
Isolates 7.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.83
Nodule 1.21
Rhizoplane 11.42
Rhizosphere 65.42
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030464 3300001979 Bacteria 1754
2 JGI24735J21928_10039867 3300002067 Bacteria 1372
3 rootH2_10091126 3300003320 Bacteria 2105
4 rootL2_10113871 3300003322 Bacteria 4821
5 rootL2_10310571 3300003322 Bacteria 2291
6 rootH1_10302260 3300003323 Bacteria 1618
7 Ga0006562J51391_1000951 3300003578 Bacteria 9000
8 Ga0055532_1002555 3300003758 Bacteria 3669
9 Ga0055535_1001381 3300003761 Bacteria 12621
10 Ga0055526_1050140 3300003771 Bacteria 959
11 Ga0055524_1006468 3300003775 Bacteria 5078
12 Ga0055524_1026783 3300003775 Bacteria 1771
13 Ga0055528_1001799 3300003790 Bacteria 12294
14 Ga0055528_1002733 3300003790 Bacteria 9246
15 Ga0055528_1003910 3300003790 Bacteria 7317
16 Ga0055540_1007921 3300003792 Bacteria 3911
17 Ga0065165_1001643 3300005262 Bacteria 22733
18 Ga0070658_10072444 3300005327 Bacteria 2823
19 Ga0070683_100001398 3300005329 Bacteria 18519
20 Ga0070683_100177228 3300005329 Bacteria 2024
21 Ga0070670_100320646 3300005331 Bacteria 1358
22 Ga0068869_100389611 3300005334 Bacteria 1144
23 Ga0070682_100044716 3300005337 Bacteria 2742
24 Ga0070682_100053384 3300005337 Bacteria 2533
25 Ga0070682_100090767 3300005337 Bacteria 1998
26 Ga0070682_100150477 3300005337 Bacteria 1596
27 Ga0068868_100024281 3300005338 Bacteria 4598
28 Ga0068868_100135729 3300005338 Bacteria 2016
29 Ga0070660_100099906 3300005339 Bacteria 2298
30 Ga0070660_100166576 3300005339 Bacteria 1778
31 Ga0070660_100193937 3300005339 Bacteria 1646
32 Ga0070660_100354405 3300005339 Bacteria 1209
33 Ga0070689_100502596 3300005340 Bacteria 1039
34 Ga0070691_10057368 3300005341 Bacteria 1868
35 Ga0070668_100043923 3300005347 Bacteria 3427
36 Ga0070671_100021523 3300005355 Bacteria 5266
37 Ga0070671_100059731 3300005355 Bacteria 3173
38 Ga0070671_100238271 3300005355 Bacteria 1544
39 Ga0070674_100240561 3300005356 Bacteria 1417
40 Ga0070659_100021855 3300005366 Bacteria 4879
41 Ga0070659_100046567 3300005366 Bacteria 3400
42 Ga0070659_100205406 3300005366 Bacteria 1622
43 Ga0070667_100222972 3300005367 Bacteria 1679
44 Ga0070667_100548481 3300005367 Bacteria 1062
45 Ga0070709_10019568 3300005434 Bacteria 3916
46 Ga0070709_10061181 3300005434 Bacteria 2396
47 Ga0070709_10070867 3300005434 Bacteria 2248
48 Ga0070709_10476318 3300005434 Bacteria 944
49 Ga0070714_100008917 3300005435 Bacteria 7848
50 Ga0070714_100085997 3300005435 Bacteria 2747
51 Ga0070714_100123250 3300005435 Bacteria 2308
52 Ga0070713_100049430 3300005436 Bacteria 3469
53 Ga0070713_100247463 3300005436 Bacteria 1625
54 Ga0070710_10001036 3300005437 Bacteria 13206
55 Ga0070711_100057175 3300005439 Bacteria 2700
56 Ga0070711_100178845 3300005439 Bacteria 1623
57 Ga0070711_100210221 3300005439 Bacteria 1506
58 Ga0070711_100462342 3300005439 Bacteria 1040
59 Ga0070700_100433488 3300005441 Bacteria 996
60 Ga0070694_100046393 3300005444 Bacteria 2917
61 Ga0070663_100164502 3300005455 Bacteria 1710
62 Ga0070662_100109898 3300005457 Bacteria 2098
63 Ga0070662_100321813 3300005457 Unclassified 1261
64 Ga0070681_10051905 3300005458 Bacteria 4090
65 Ga0070681_10088284 3300005458 Bacteria 3052
66 Ga0070681_10717680 3300005458 Bacteria 916
67 Ga0070706_100523643 3300005467 Bacteria 1103
68 Ga0070707_100420649 3300005468 Bacteria 1297
69 Ga0070698_100013398 3300005471 Bacteria 8678
70 Ga0070679_100007581 3300005530 Bacteria 10152
71 Ga0070679_100081739 3300005530 Bacteria 3220
72 Ga0070679_100130043 3300005530 Bacteria 2499
73 Ga0070679_100177120 3300005530 Bacteria 2105
74 Ga0070684_100028739 3300005535 Bacteria 4704
75 Ga0070684_100062194 3300005535 Bacteria 3270
76 Ga0070684_100078482 3300005535 Bacteria 2917
77 Ga0070684_100501214 3300005535 Bacteria 1124
78 Ga0070695_100000424 3300005545 Bacteria 21845
79 Ga0070695_100834399 3300005545 Bacteria 741
80 Ga0070696_100036428 3300005546 Bacteria 3392
81 Ga0070696_100211116 3300005546 Bacteria 1453
82 Ga0070665_100000606 3300005548 Bacteria 49390
83 Ga0070665_100220582 3300005548 Bacteria 1897
84 Ga0070665_100341705 3300005548 Bacteria 1502
85 Ga0070665_100609893 3300005548 Bacteria 1104
86 Ga0068855_100163274 3300005563 Bacteria 2527
87 Ga0070664_100190809 3300005564 Bacteria 1826
88 Ga0068857_100050660 3300005577 Bacteria 3683
89 Ga0068857_100438709 3300005577 Bacteria 1220
90 Ga0068857_100972639 3300005577 Bacteria 816
91 Ga0068856_100049227 3300005614 Bacteria 4154
92 Ga0070702_100066152 3300005615 Bacteria 2119
93 Ga0070702_100183201 3300005615 Bacteria 1372
94 Ga0070702_100189326 3300005615 Bacteria 1353
95 Ga0068852_100146478 3300005616 Bacteria 2191
96 Ga0068852_100268834 3300005616 Bacteria 1640
97 Ga0068864_100197285 3300005618 Bacteria 1848
98 Ga0068866_10003247 3300005718 Bacteria 6696
99 Ga0068861_100012663 3300005719 Bacteria 5885
100 Ga0068861_100111931 3300005719 Bacteria 2188
101 Ga0068861_100329691 3300005719 Bacteria 1332
102 Ga0068863_100012869 3300005841 Bacteria 8069
103 Ga0068863_100101492 3300005841 Bacteria 2735
104 Ga0068860_100004939 3300005843 Bacteria 13590
105 Ga0068860_100114307 3300005843 Bacteria 2581
106 Ga0068860_100145433 3300005843 Bacteria 2281
107 Ga0068862_100731289 3300005844 Bacteria 961
108 Ga0081538_10022577 3300005981 Bacteria 4556
109 Ga0070717_10179566 3300006028 Bacteria 1844
110 Ga0070717_10186285 3300006028 Bacteria 1812
111 Ga0075365_10002498 3300006038 Bacteria 9051
112 Ga0075365_10002593 3300006038 Bacteria 8940
113 Ga0075365_10013292 3300006038 Bacteria 4915
114 Ga0075365_10025219 3300006038 Bacteria 3762
115 Ga0075365_10028760 3300006038 Bacteria 3546
116 Ga0075365_10039757 3300006038 Bacteria 3064
117 Ga0075365_10043437 3300006038 Bacteria 2942
118 Ga0075365_10049405 3300006038 Bacteria 2771
119 Ga0075365_10110747 3300006038 Bacteria 1886
120 Ga0075365_10120011 3300006038 Bacteria 1813
121 Ga0075365_10181532 3300006038 Bacteria 1471
122 Ga0075368_10000787 3300006042 Bacteria 9749
123 Ga0075368_10001808 3300006042 Bacteria 6875
124 Ga0075368_10184297 3300006042 Bacteria 880
125 Ga0075363_100001556 3300006048 Bacteria 8806
126 Ga0075363_100016538 3300006048 Bacteria 3644
127 Ga0075363_100031177 3300006048 Bacteria 2763
128 Ga0075363_100033187 3300006048 Bacteria 2686
129 Ga0075363_100046692 3300006048 Bacteria 2299
130 Ga0075363_100059210 3300006048 Bacteria 2059
131 Ga0075363_100217149 3300006048 Bacteria 1095
132 Ga0075364_10023355 3300006051 Bacteria 3915
133 Ga0075364_10029727 3300006051 Bacteria 3505
134 Ga0075364_10034908 3300006051 Bacteria 3248
135 Ga0075364_10051396 3300006051 Bacteria 2692
136 Ga0075364_10115458 3300006051 Bacteria 1794
137 Ga0075364_10203960 3300006051 Bacteria 1340
138 Ga0075364_10326450 3300006051 Bacteria 1045
139 Ga0070715_10018015 3300006163 Bacteria 2683
140 Ga0070715_10046904 3300006163 Bacteria 1839
141 Ga0070716_100016572 3300006173 Bacteria 3807
142 Ga0070716_100048576 3300006173 Bacteria 2399
143 Ga0070712_100041445 3300006175 Bacteria 3161
144 Ga0070712_100129626 3300006175 Bacteria 1910
145 Ga0070712_100129790 3300006175 Bacteria 1909
146 Ga0075367_10004044 3300006178 Bacteria 7093
147 Ga0075367_10018252 3300006178 Bacteria 3867
148 Ga0075367_10135628 3300006178 Bacteria 1522
149 Ga0075367_10163715 3300006178 Bacteria 1383
150 Ga0075369_10111481 3300006186 Bacteria 1233
151 Ga0097621_100192601 3300006237 Bacteria 1766
152 Ga0075370_10003503 3300006353 Bacteria 7480
153 Ga0075370_10005399 3300006353 Bacteria 6350
154 Ga0075370_10011633 3300006353 Bacteria 4628
155 Ga0075370_10012237 3300006353 Bacteria 4529
156 Ga0075370_10126608 3300006353 Unclassified 1489
157 Ga0075370_10152029 3300006353 Bacteria 1357
158 Ga0075428_100068912 3300006844 Bacteria 3869
159 Ga0075428_100082457 3300006844 Bacteria 3509
160 Ga0075428_100192794 3300006844 Bacteria 2204
161 Ga0075428_100257779 3300006844 Bacteria 1878
162 Ga0075431_100283624 3300006847 Bacteria 1677
163 Ga0075434_100000592 3300006871 Bacteria 28019
164 Ga0075429_100131704 3300006880 Bacteria 2188
165 Ga0075429_100179802 3300006880 Bacteria 1854
166 Ga0068865_100007888 3300006881 Bacteria 6569
167 Ga0075436_100005286 3300006914 Bacteria 8882
168 Ga0075435_100000398 3300007076 Bacteria 26576
169 Ga0105251_10005738 3300009011 Bacteria 8053
170 Ga0105251_10013084 3300009011 Bacteria 4658
171 Ga0105251_10023032 3300009011 Bacteria 3222
172 Ga0105244_10018182 3300009036 Bacteria 3951
173 Ga0105244_10221586 3300009036 Bacteria 887
174 Ga0105250_10009562 3300009092 Bacteria 4078
175 Ga0105250_10066317 3300009092 Unclassified 1455
176 Ga0105240_10033798 3300009093 Bacteria 6603
177 Ga0105240_10037358 3300009093 Bacteria 6242
178 Ga0105240_10317937 3300009093 Bacteria 1775
179 Ga0111539_10055190 3300009094 Bacteria 4723
180 Ga0105245_10013028 3300009098 Bacteria 7245
181 Ga0105245_10016541 3300009098 Bacteria 6436
182 Ga0105245_10051192 3300009098 Bacteria 3703
183 Ga0105245_10205224 3300009098 Bacteria 1894
184 Ga0105245_10270432 3300009098 Bacteria 1657
185 Ga0105247_10049742 3300009101 Bacteria 2578
186 Ga0114129_10525904 3300009147 Bacteria 1541
187 Ga0105243_10029624 3300009148 Bacteria 4210
188 Ga0105243_10045271 3300009148 Bacteria 3457
189 Ga0105243_10104527 3300009148 Bacteria 2357
190 Ga0105243_10130425 3300009148 Bacteria 2132
191 Ga0105243_10989414 3300009148 Bacteria 843
192 Ga0105241_10563474 3300009174 Bacteria 1024
193 Ga0105242_10081241 3300009176 Bacteria 2710
194 Ga0105242_10207134 3300009176 Bacteria 1745
195 Ga0105242_10432278 3300009176 Bacteria 1236
196 Ga0105237_10013297 3300009545 Bacteria 8633
197 Ga0105237_10084955 3300009545 Bacteria 3154
198 Ga0105237_10114878 3300009545 Bacteria 2685
199 Ga0105237_10225311 3300009545 Bacteria 1875
200 Ga0105238_10033763 3300009551 Bacteria 5206
201 Ga0105238_10523649 3300009551 Bacteria 1188
202 Ga0105249_10072069 3300009553 Bacteria 3193
203 Ga0105249_10118507 3300009553 Bacteria 2512
204 Ga0105249_10380398 3300009553 Bacteria 1437
205 Ga0123341_1078622 3300009765 Bacteria 1323
206 Ga0105239_10015690 3300010375 Bacteria 8384
207 Ga0105239_10083189 3300010375 Bacteria 3524
208 Ga0105239_10088214 3300010375 Bacteria 3420
209 Ga0105239_10116670 3300010375 Bacteria 2963
210 Ga0105239_10542585 3300010375 Bacteria 1324
211 Ga0105239_10586379 3300010375 Bacteria 1271
212 Ga0105239_11017153 3300010375 Bacteria 953
213 Ga0105239_11139124 3300010375 Bacteria 898
214 Ga0105246_10042792 3300011119 Bacteria 3068
215 Ga0105246_10048722 3300011119 Bacteria 2898
216 Ga0105246_10127366 3300011119 Bacteria 1896
217 Ga0157370_10177274 3300013104 Bacteria 1981
218 Ga0157370_10380170 3300013104 Bacteria 1301
219 Ga0157369_10105097 3300013105 Bacteria 3006
220 Ga0157369_10106512 3300013105 Bacteria 2983
221 Ga0157369_10445357 3300013105 Bacteria 1341
222 Ga0157369_10744742 3300013105 Bacteria 1008
223 Ga0157374_10122402 3300013296 Bacteria 2512
224 Ga0157374_10129426 3300013296 Bacteria 2442
225 Ga0157374_10177972 3300013296 Bacteria 2076
226 Ga0157374_10885746 3300013296 Bacteria 910
227 Ga0157378_10026724 3300013297 Bacteria 5088
228 Ga0157378_10242493 3300013297 Bacteria 1722
229 Ga0157378_10317988 3300013297 Bacteria 1511
230 Ga0163162_11033150 3300013306 Bacteria 930
231 Ga0157372_10003630 3300013307 Bacteria 16603
232 Ga0157372_10024536 3300013307 Bacteria 6553
233 Ga0157372_10037050 3300013307 Bacteria 5377
234 Ga0157372_10080102 3300013307 Bacteria 3694
235 Ga0157372_10118962 3300013307 Bacteria 3032
236 Ga0157372_10816815 3300013307 Bacteria 1083
237 Ga0157375_10032119 3300013308 Bacteria 4976
238 Ga0157375_10104454 3300013308 Bacteria 2922
239 Ga0163163_10054312 3300014325 Bacteria 3957
240 Ga0163163_10057376 3300014325 Bacteria 3850
241 Ga0163163_10057861 3300014325 Bacteria 3833
242 Ga0163163_10219473 3300014325 Bacteria 1950
243 Ga0163163_10329415 3300014325 Bacteria 1581
244 Ga0157380_10804425 3300014326 Bacteria 957
245 Ga0182008_10099700 3300014497 Bacteria 1435
246 Ga0182008_10115104 3300014497 Bacteria 1334
247 Ga0157377_10006626 3300014745 Bacteria 5535
248 Ga0157377_10028872 3300014745 Bacteria 2989
249 Ga0157379_10024932 3300014968 Bacteria 5308
250 Ga0157379_10131725 3300014968 Bacteria 2251
251 Ga0157379_10188016 3300014968 Bacteria 1866
252 Ga0157376_10004054 3300014969 Bacteria 10135
253 Ga0157376_10105516 3300014969 Bacteria 2471
254 Ga0183367_1010 3300015688 Bacteria 416164
255 Ga0183363_1146 3300015690 Bacteria 17733
256 Ga0163161_10333526 3300017792 Bacteria 1202
257 Ga0197907_10860015 3300020069 Bacteria 2946
258 Ga0206356_11782609 3300020070 Bacteria 2200
259 Ga0206354_11178818 3300020081 Bacteria 2039
260 Ga0206353_10100660 3300020082 Bacteria 6070
261 Ga0206353_10113132 3300020082 Bacteria 1958
262 Ga0209784_102716 3300025224 Bacteria 1691
263 Ga0209147_100640 3300025229 Bacteria 18610
264 Ga0209258_100713 3300025242 Bacteria 22248
265 Ga0209129_1000066 3300025258 Bacteria 226820
266 Ga0209129_1016456 3300025258 Unclassified 1484
267 Ga0209673_1000024 3300025273 Bacteria 409632
268 Ga0209673_1002852 3300025273 Bacteria 11064
269 Ga0209673_1008252 3300025273 Bacteria 4656
270 Ga0209673_1008507 3300025273 Bacteria 4559
271 Ga0209673_1011187 3300025273 Bacteria 3715
272 Ga0209130_1033406 3300025284 Bacteria 1042
273 Ga0209025_1000275 3300025294 Bacteria 119220
274 Ga0209025_1008812 3300025294 Bacteria 7172
275 Ga0209025_1018920 3300025294 Bacteria 3867
276 Ga0209025_1022379 3300025294 Bacteria 3355
277 Ga0209025_1027911 3300025294 Bacteria 2782
278 Ga0209025_1033755 3300025294 Bacteria 2356
279 Ga0209564_1003535 3300025295 Bacteria 10528
280 Ga0209564_1007247 3300025295 Bacteria 5766
281 Ga0209564_1012018 3300025295 Bacteria 3816
282 Ga0209758_1006866 3300025297 Bacteria 7954
283 Ga0209758_1036365 3300025297 Bacteria 1923
284 Ga0209256_1000027 3300025299 Bacteria 423283
285 Ga0209256_1001674 3300025299 Bacteria 21498
286 Ga0209256_1003288 3300025299 Bacteria 11528
287 Ga0209256_1018687 3300025299 Bacteria 2238
288 Ga0207426_1002707 3300025302 Bacteria 10794
289 Ga0209051_1006208 3300025303 Bacteria 6774
290 Ga0209051_1079549 3300025303 Bacteria 951
291 Ga0207696_1004609 3300025711 Bacteria 5903
292 Ga0207696_1016935 3300025711 Bacteria 2426
293 Ga0207655_1018102 3300025728 Bacteria 3758
294 Ga0207655_1018154 3300025728 Bacteria 3750
295 Ga0207655_1032487 3300025728 Bacteria 2384
296 Ga0207713_1000851 3300025735 Bacteria 28054
297 Ga0207713_1012854 3300025735 Bacteria 4446
298 Ga0207713_1022059 3300025735 Bacteria 3035
299 Ga0207692_10229892 3300025898 Bacteria 1103
300 Ga0207710_10023764 3300025900 Bacteria 2635
301 Ga0207688_10116111 3300025901 Bacteria 1558
302 Ga0207647_10024844 3300025904 Bacteria 3946
303 Ga0207647_10119706 3300025904 Bacteria 1553
304 Ga0207685_10056840 3300025905 Bacteria 1533
305 Ga0207685_10107858 3300025905 Bacteria 1202
306 Ga0207699_10095587 3300025906 Bacteria 1874
307 Ga0207699_10139336 3300025906 Bacteria 1593
308 Ga0207705_10237154 3300025909 Bacteria 1389
309 Ga0207705_10265401 3300025909 Bacteria 1312
310 Ga0207705_10470546 3300025909 Bacteria 975
311 Ga0207654_10024058 3300025911 Bacteria 3270
312 Ga0207707_10040469 3300025912 Bacteria 4070
313 Ga0207707_10099380 3300025912 Bacteria 2543
314 Ga0207707_10450124 3300025912 Bacteria 1102
315 Ga0207695_10011324 3300025913 Bacteria 10811
316 Ga0207695_10082209 3300025913 Bacteria 3258
317 Ga0207671_10110197 3300025914 Bacteria 2094
318 Ga0207671_10256806 3300025914 Bacteria 1375
319 Ga0207693_10031290 3300025915 Bacteria 4204
320 Ga0207693_10079013 3300025915 Bacteria 2575
321 Ga0207693_10121398 3300025915 Bacteria 2052
322 Ga0207663_10008339 3300025916 Bacteria 5412
323 Ga0207663_10032814 3300025916 Bacteria 3086
324 Ga0207660_10008889 3300025917 Bacteria 6494
325 Ga0207657_10014605 3300025919 Bacteria 7653
326 Ga0207657_10466087 3300025919 Bacteria 991
327 Ga0207649_10135236 3300025920 Bacteria 1680
328 Ga0207652_10018333 3300025921 Bacteria 5740
329 Ga0207652_10100213 3300025921 Bacteria 2557
330 Ga0207652_10452277 3300025921 Bacteria 1158
331 Ga0207681_10171079 3300025923 Bacteria 1647
332 Ga0207687_10006661 3300025927 Bacteria 7620
333 Ga0207687_10026416 3300025927 Bacteria 3888
334 Ga0207700_10000001 3300025928 Bacteria 1122509
335 Ga0207700_10203761 3300025928 Bacteria 1668
336 Ga0207700_10436363 3300025928 Bacteria 1152
337 Ga0207664_10039097 3300025929 Bacteria 3682
338 Ga0207664_10204092 3300025929 Bacteria 1707
339 Ga0207664_10213691 3300025929 Bacteria 1670
340 Ga0207644_10025762 3300025931 Bacteria 4046
341 Ga0207644_10119931 3300025931 Bacteria 2001
342 Ga0207644_10261525 3300025931 Bacteria 1384
343 Ga0207644_10389458 3300025931 Bacteria 1138
344 Ga0207690_10017620 3300025932 Bacteria 4366
345 Ga0207690_10158099 3300025932 Bacteria 1687
346 Ga0207686_10106637 3300025934 Bacteria 1881
347 Ga0207709_10003100 3300025935 Bacteria 10007
348 Ga0207709_10072287 3300025935 Bacteria 2193
349 Ga0207704_10397920 3300025938 Bacteria 1086
350 Ga0207665_10011508 3300025939 Bacteria 5811
351 Ga0207691_10583397 3300025940 Bacteria 947
352 Ga0207661_10010691 3300025944 Bacteria 6614
353 Ga0207661_10198017 3300025944 Bacteria 1765
354 Ga0207661_10241311 3300025944 Bacteria 1604
355 Ga0207679_10213334 3300025945 Bacteria 1620
356 Ga0207712_10199038 3300025961 Bacteria 1587
357 Ga0207712_10229157 3300025961 Bacteria 1490
358 Ga0207668_10011452 3300025972 Bacteria 5390
359 Ga0207640_10885556 3300025981 Bacteria 779
360 Ga0207658_10044226 3300025986 Bacteria 3242
361 Ga0207658_10433697 3300025986 Bacteria 1161
362 Ga0207677_10015540 3300026023 Bacteria 4481
363 Ga0207677_10084067 3300026023 Bacteria 2293
364 Ga0207703_10279525 3300026035 Bacteria 1515
365 Ga0207678_10140684 3300026067 Bacteria 2059
366 Ga0207678_10242930 3300026067 Bacteria 1542
367 Ga0207702_10004876 3300026078 Bacteria 11814
368 Ga0207702_10058818 3300026078 Bacteria 3272
369 Ga0207641_10083296 3300026088 Bacteria 2781
370 Ga0207641_10398101 3300026088 Bacteria 1322
371 Ga0207648_10619589 3300026089 Bacteria 998
372 Ga0207674_10064533 3300026116 Bacteria 3693
373 Ga0207674_10598818 3300026116 Bacteria 1065
374 Ga0207674_10860340 3300026116 Bacteria 874
375 Ga0209281_1000097 3300027111 Bacteria 227540
376 Ga0209281_1000844 3300027111 Bacteria 27278
377 Ga0209281_1002422 3300027111 Bacteria 7531
378 Ga0209813_10000655 3300027866 Bacteria 7933
379 Ga0209813_10018905 3300027866 Bacteria 1909
380 Ga0268266_10001445 3300028379 Bacteria 28270
381 Ga0268266_10176800 3300028379 Bacteria 1941
382 Ga0268266_10189044 3300028379 Bacteria 1879
383 Ga0268266_10199074 3300028379 Bacteria 1832
384 Ga0268264_10361836 3300028381 Bacteria 1384
385 Ga0307515_10200098 3300028794 Bacteria 1876
386 Ga0265325_10022060 3300031241 Bacteria 3490
387 Ga0265339_10100581 3300031249 Bacteria 1505
388 Ga0265313_10030991 3300031595 Bacteria 2746
389 Ga0307405_10020553 3300031731 Bacteria 3692
390 Ga0307405_10061467 3300031731 Bacteria 2375
391 Ga0316577_10170089 3300031733 Bacteria 1230
392 Ga0307410_10151679 3300031852 Bacteria 1726
393 Ga0307410_10275338 3300031852 Bacteria 1318
394 Ga0307410_10731037 3300031852 Bacteria 837
395 Ga0307407_10042566 3300031903 Bacteria 2547
396 Ga0307412_10103488 3300031911 Bacteria 2018
397 Ga0307409_100006011 3300031995 Bacteria 7076
398 Ga0307409_100142136 3300031995 Bacteria 2070
399 Ga0307409_100342641 3300031995 Bacteria 1407
400 Ga0307409_100868708 3300031995 Bacteria 914
401 Ga0307416_100000221 3300032002 Bacteria 30062
402 Ga0307416_100766571 3300032002 Bacteria 1058
403 Ga0307414_10025067 3300032004 Bacteria 3813
404 Ga0307415_100000455 3300032126 Bacteria 17595
405 Ga0307415_100077285 3300032126 Bacteria 2363
406 Ga0307415_100114766 3300032126 Bacteria 2006
407 Ga0307415_100600606 3300032126 Bacteria 979
408 Ga0316583_10006272 3300032133 Bacteria 4274
409 Ga0373926_0058903 3300035083 Bacteria 1397
410 Ga0373932_0096425 3300035112 Bacteria 956
411 Ga0373939_0089614 3300035114 Bacteria 1037
412 Ga0373941_0210546 3300035115 Bacteria 743
413 Ga0373942_0110937 3300035207 Bacteria 848
414 Ga0373935_0288305 3300035692 Unclassified 1157
415 Ga0373927_0000048 3300035695 Bacteria 86106
416 Ga0316582_0012397 3300036647 Bacteria 4756
417 Ga0316582_0273334 3300036647 Bacteria 1159
418 Ga0373925_0000668 3300037068 Bacteria 32227
419 Ga0395899_0049006 3300037312 Bacteria 3141
420 Ga0395900_0030791 3300037418 Bacteria 5510
421 Ga0395900_0122675 3300037418 Bacteria 2665
422 Ga0395900_0125710 3300037418 Bacteria 2630
423 Ga0395900_0225426 3300037418 Bacteria 1887
424 Ga0395898_0043916 3300037466 Bacteria 4403
425 Ga0395898_0110391 3300037466 Bacteria 2636
426 Ga0395898_0203763 3300037466 Bacteria 1888
427 Ga0395898_0233971 3300037466 Bacteria 1752
428 Ga0395898_0406943 3300037466 Bacteria 1297
429 Ga0395905_0000608 3300037471 Bacteria 47958
430 Ga0395905_0004534 3300037471 Bacteria 14385
431 Ga0395905_0025393 3300037471 Bacteria 5587
432 Ga0395905_0043829 3300037471 Bacteria 4197
433 Ga0395905_1016739 3300037471 Bacteria 732
434 Ga0395901_0128825 3300038443 Bacteria 2660
435 Ga0395901_0150818 3300038443 Bacteria 2443
436 Ga0395901_0301708 3300038443 Bacteria 1660
437 Ga0395901_0304985 3300038443 Bacteria 1650
438 Ga0439449_0019048 3300042007 Bacteria 2574
439 Ga0466969_0154633 3300044656 Bacteria 1056
440 Ga0466972_0015450 3300044658 Bacteria 3815
441 Ga0466972_0016907 3300044658 Bacteria 3649
442 Ga0466972_0213377 3300044658 Bacteria 903
443 Ga0466965_0001364 3300044683 Bacteria 9795
444 Ga0466965_0018571 3300044683 Bacteria 3335
445 Ga0466965_0024379 3300044683 Bacteria 2926
446 Ga0466965_0055705 3300044683 Bacteria 1968
447 Ga0466965_0124705 3300044683 Bacteria 1332
448 Ga0466965_0142777 3300044683 Bacteria 1248
449 Ga0466966_0014690 3300044684 Bacteria 5181
450 Ga0466966_0030866 3300044684 Bacteria 3476
451 Ga0466961_0000223 3300044693 Bacteria 38608
452 Ga0466961_0062701 3300044693 Bacteria 2362
453 Ga0466961_0306375 3300044693 Bacteria 970
454 Ga0466963_0001004 3300044694 Bacteria 14564
455 Ga0466963_0010684 3300044694 Bacteria 5569
456 Ga0466963_0013066 3300044694 Bacteria 5092
457 Ga0466963_0013564 3300044694 Bacteria 5004
458 Ga0466963_0016836 3300044694 Bacteria 4551
459 Ga0466963_0063820 3300044694 Bacteria 2466
460 Ga0466963_0150169 3300044694 Bacteria 1617
461 Ga0466963_0292434 3300044694 Bacteria 1145
462 Ga0466964_0049085 3300044706 Bacteria 1727
463 Ga0466964_0225495 3300044706 Bacteria 912
464 Ga0466971_0006327 3300044719 Bacteria 5138
465 Ga0466971_0022623 3300044719 Bacteria 2802
466 Ga0466971_0091970 3300044719 Bacteria 1390
467 Ga0466971_0162883 3300044719 Bacteria 1044
468 Ga0466971_0193155 3300044719 Bacteria 959
469 Ga0466968_0018631 3300044735 Bacteria 2787
470 Ga0466970_0009805 3300044765 Bacteria 4850
471 Ga0466970_0023123 3300044765 Bacteria 3245
472 Ga0466970_0034147 3300044765 Bacteria 2691
473 Ga0466970_0092599 3300044765 Bacteria 1641
474 Ga0466970_0244643 3300044765 Bacteria 1004
475 Ga0466957_0000283 3300044842 Bacteria 24756
476 Ga0466957_0026854 3300044842 Bacteria 3418
477 Ga0466957_0296013 3300044842 Bacteria 1086
478 Ga0466957_0418923 3300044842 Bacteria 918
479 Ga0466957_0801025 3300044842 Bacteria 669
480 Ga0466960_0015523 3300044901 Bacteria 3284
481 Ga0466960_0034517 3300044901 Bacteria 2358
482 Ga0466960_0062407 3300044901 Bacteria 1831
483 Ga0466960_0062821 3300044901 Bacteria 1826
484 Ga0466960_0074590 3300044901 Bacteria 1695
485 Ga0466960_0084883 3300044901 Bacteria 1603
486 Ga0466960_0314518 3300044901 Bacteria 885
487 Ga0466959_0039510 3300045049 Bacteria 3487
488 Ga0466959_0050275 3300045049 Unclassified 3061
489 Ga0466959_0064828 3300045049 Bacteria 2651
490 Ga0466959_0156111 3300045049 Bacteria 1606
491 Ga0466959_0183669 3300045049 Bacteria 1462
492 Ga0466959_0212991 3300045049 Bacteria 1342
493 Ga0466959_0352142 3300045049 Bacteria 1004
494 Ga0466959_0416024 3300045049 Bacteria 913
495 Ga0466958_0028047 3300045836 Bacteria 3335
496 Ga0466958_0029237 3300045836 Bacteria 3270
497 Ga0466958_0036234 3300045836 Bacteria 2952
498 Ga0466958_0069805 3300045836 Bacteria 2149
499 Ga0466967_0001608 3300045976 Bacteria 13322
500 Ga0466967_0002748 3300045976 Bacteria 11129
501 Ga0466967_0003756 3300045976 Bacteria 10014
502 Ga0466967_0010091 3300045976 Bacteria 7059
503 Ga0466967_0017214 3300045976 Bacteria 5731
504 Ga0466967_0027096 3300045976 Bacteria 4762
505 Ga0466967_0056887 3300045976 Bacteria 3450
506 Ga0466967_0125229 3300045976 Bacteria 2379
507 Ga0466967_0163423 3300045976 Bacteria 2091
508 Ga0466967_0191434 3300045976 Bacteria 1933
509 Ga0466967_0300066 3300045976 Bacteria 1545
510 Ga0495603_0113446 3300046455 Bacteria 1580
511 Ga0495638_0033750 3300046460 Bacteria 3271
512 Ga0495641_0054335 3300046461 Bacteria 1820
513 Ga0495641_0131012 3300046461 Bacteria 1119
514 Ga0495641_0137199 3300046461 Bacteria 1092
515 Ga0495641_0209925 3300046461 Bacteria 873
516 Ga0495653_0315502 3300046463 Bacteria 1015
517 Ga0495582_0033385 3300046473 Bacteria 2829
518 Ga0495585_0169031 3300046492 Bacteria 1130
519 Ga0495594_0061561 3300046499 Bacteria 2077
520 Ga0495607_0039385 3300046501 Bacteria 2823
521 Ga0495618_0214576 3300046514 Bacteria 1216
522 Ga0495630_0128973 3300046517 Bacteria 1920
523 Ga0495652_0381177 3300046529 Bacteria 1003
524 Ga0495587_0072618 3300046536 Bacteria 2000
525 Ga0495667_0096875 3300046559 Bacteria 1910
526 Ga0495667_0109447 3300046559 Bacteria 1785
527 Ga0495634_0461204 3300046642 Bacteria 748
528 Ga0495635_0157853 3300046663 Bacteria 1544
529 Ga0495635_0220097 3300046663 Bacteria 1284
530 Ga0495635_0482803 3300046663 Bacteria 817
531 Ga0495588_0079974 3300046674 Bacteria 1706
532 Ga0495657_0080879 3300046675 Bacteria 2102
533 Ga0495623_0240463 3300046679 Bacteria 1023
534 Ga0495649_0174188 3300046694 Bacteria 1125
535 Ga0495660_0093620 3300046810 Bacteria 1557
536 Ga0495604_0034954 3300047317 Bacteria 3971
537 Ga0495674_0036983 3300047319 Bacteria 4388
538 Ga0495672_0096930 3300047320 Bacteria 1607
539 Ga0495683_0064813 3300047323 Bacteria 1804
540 Ga0495675_0227666 3300047444 Bacteria 1126
541 Ga0495677_0088318 3300047445 Bacteria 1167
542 Ga0495684_0254644 3300047471 Bacteria 1276
543 Ga0496100_0009970 3300048903 Bacteria 5361
544 Ga0496100_0060664 3300048903 Bacteria 2489
545 Ga0496100_0153190 3300048903 Bacteria 1646
546 Ga0496100_0372494 3300048903 Bacteria 1083
547 Ga0496100_0569188 3300048903 Bacteria 878
548 Ga0496101_0003395 3300048904 Bacteria 9935
549 Ga0496101_0005998 3300048904 Bacteria 7792
550 Ga0496101_0053137 3300048904 Bacteria 2922
551 Ga0496101_0073020 3300048904 Bacteria 2519
552 Ga0496101_0449525 3300048904 Bacteria 1016
553 Ga0496102_0001253 3300048905 Bacteria 22878
554 Ga0496102_0016004 3300048905 Bacteria 6547
555 Ga0496102_0026325 3300048905 Bacteria 5186
556 Ga0496102_0077997 3300048905 Bacteria 3049
557 Ga0496102_0092320 3300048905 Bacteria 2803
558 Ga0496102_0102732 3300048905 Bacteria 2657
559 Ga0496102_0135297 3300048905 Bacteria 2309
560 Ga0496102_0162939 3300048905 Bacteria 2098
561 Ga0496102_0548759 3300048905 Bacteria 1078
562 Ga0496102_0671372 3300048905 Bacteria 959
563 Ga0496103_0002461 3300048906 Bacteria 11637
564 Ga0496103_0014248 3300048906 Bacteria 4721
565 Ga0496103_0016086 3300048906 Bacteria 4463
566 Ga0496103_0018836 3300048906 Bacteria 4144
567 Ga0496103_0027563 3300048906 Bacteria 3443
568 Ga0496103_0215215 3300048906 Bacteria 1235
569 Ga0496103_0221477 3300048906 Bacteria 1217
570 Ga0496103_0363717 3300048906 Bacteria 930
571 Ga0496104_0000546 3300048907 Bacteria 32183
572 Ga0496104_0025841 3300048907 Bacteria 5415
573 Ga0496104_0048838 3300048907 Bacteria 3990
574 Ga0496104_0051975 3300048907 Bacteria 3869
575 Ga0496104_0164726 3300048907 Bacteria 2126
576 Ga0496104_0189627 3300048907 Bacteria 1967
577 Ga0496104_0211661 3300048907 Bacteria 1850
578 Ga0496104_0235060 3300048907 Bacteria 1744
579 Ga0496104_0418304 3300048907 Bacteria 1252
580 Ga0496104_0681297 3300048907 Bacteria 936
581 Ga0496105_0001973 3300048908 Bacteria 14762
582 Ga0496105_0043182 3300048908 Bacteria 3717
583 Ga0496105_0059563 3300048908 Bacteria 3150
584 Ga0496105_0093282 3300048908 Bacteria 2486
585 Ga0496105_0255147 3300048908 Bacteria 1420
586 Ga0496105_0415361 3300048908 Bacteria 1066
587 Ga0496106_0005321 3300048909 Bacteria 9532
588 Ga0496106_0012196 3300048909 Bacteria 6342
589 Ga0496106_0014231 3300048909 Bacteria 5876
590 Ga0496106_0029362 3300048909 Bacteria 4097
591 Ga0496106_0034894 3300048909 Bacteria 3759
592 Ga0496106_0322211 3300048909 Bacteria 1240
593 Ga0496107_0001086 3300048910 Bacteria 16332
594 Ga0496107_0016640 3300048910 Bacteria 5167
595 Ga0496107_0196684 3300048910 Bacteria 1498
596 Ga0496108_0004135 3300048911 Bacteria 11665
597 Ga0496108_0014544 3300048911 Bacteria 6425
598 Ga0496108_0020230 3300048911 Bacteria 5469
599 Ga0496108_0038858 3300048911 Bacteria 3966
600 Ga0496108_0090774 3300048911 Bacteria 2597
601 Ga0496108_0155121 3300048911 Bacteria 1977
602 Ga0496108_0735993 3300048911 Bacteria 854
603 Ga0496109_0000938 3300048912 Bacteria 24150
604 Ga0496109_0029534 3300048912 Bacteria 4911
605 Ga0496109_0033180 3300048912 Bacteria 4643
606 Ga0496109_0070633 3300048912 Bacteria 3205
607 Ga0496109_0293617 3300048912 Bacteria 1532
608 Ga0496109_0365111 3300048912 Bacteria 1364
609 Ga0496109_0621770 3300048912 Bacteria 1016
610 Ga0496110_0031715 3300048913 Bacteria 4561
611 Ga0496110_0035553 3300048913 Bacteria 4322
612 Ga0496110_0068137 3300048913 Bacteria 3149
613 Ga0496110_0092490 3300048913 Bacteria 2706
614 Ga0496110_0397628 3300048913 Bacteria 1256
615 Ga0496110_0475743 3300048913 Bacteria 1138
616 Ga0496110_0540906 3300048913 Bacteria 1059
617 Ga0496110_0629315 3300048913 Bacteria 972
618 Ga0496111_0003428 3300048914 Bacteria 9806
619 Ga0496111_0006183 3300048914 Bacteria 7752
620 Ga0496111_0014466 3300048914 Bacteria 5391
621 Ga0496111_0040563 3300048914 Bacteria 3339
622 Ga0496112_0000907 3300048915 Bacteria 21371
623 Ga0496112_0003202 3300048915 Bacteria 13472
624 Ga0496112_0016652 3300048915 Bacteria 6892
625 Ga0496112_0018621 3300048915 Bacteria 6542
626 Ga0496112_0051244 3300048915 Bacteria 4048
627 Ga0496112_0095533 3300048915 Bacteria 2942
628 Ga0496112_0106534 3300048915 Bacteria 2773
629 Ga0496113_0000155 3300048916 Bacteria 30022
630 Ga0496113_0027299 3300048916 Bacteria 4092
631 Ga0496113_0161877 3300048916 Bacteria 1769
632 Ga0496113_0197557 3300048916 Bacteria 1598
633 Ga0496113_0324352 3300048916 Bacteria 1234
634 Ga0496114_0002377 3300048917 Bacteria 14310
635 Ga0496114_0031017 3300048917 Bacteria 4397
636 Ga0496114_0089913 3300048917 Bacteria 2606
637 Ga0496114_0526195 3300048917 Bacteria 1045
638 Ga0496114_0574761 3300048917 Bacteria 995
639 Ga0496115_0022593 3300048918 Bacteria 4876
640 Ga0496115_0096587 3300048918 Bacteria 2419
641 Ga0496115_0175492 3300048918 Bacteria 1772
642 Ga0496115_0236370 3300048918 Bacteria 1506
643 Ga0496115_0800883 3300048918 Bacteria 733
644 Ga0496116_0034283 3300048919 Bacteria 3584
645 Ga0496116_0111385 3300048919 Bacteria 1608
646 Ga0496117_0038338 3300048920 Bacteria 3556
647 Ga0496117_0188302 3300048920 Bacteria 1179
648 Ga0496119_0000055 3300048922 Bacteria 180121
649 Ga0496119_0006558 3300048922 Bacteria 10735
650 Ga0496120_0032458 3300048923 Bacteria 3148
651 Ga0496120_0033598 3300048923 Bacteria 3081
652 Ga0496120_0058898 3300048923 Bacteria 2155
653 Ga0496121_0065339 3300048924 Bacteria 2960
654 Ga0496121_0066205 3300048924 Bacteria 2935
655 Ga0496122_0038832 3300048925 Bacteria 3805
656 Ga0496122_0042752 3300048925 Bacteria 3560
657 Ga0496122_0143398 3300048925 Unclassified 1489
658 Ga0496123_0141033 3300048926 Unclassified 1317
659 Ga0496124_0005559 3300048927 Bacteria 14119
660 Ga0496124_0018229 3300048927 Bacteria 6581
661 Ga0496124_0083478 3300048927 Bacteria 2621
662 Ga0496124_0095692 3300048927 Bacteria 2413
663 Ga0496124_0168982 3300048927 Bacteria 1696
664 Ga0496124_0437447 3300048927 Bacteria 896
665 Ga0496125_0004429 3300048928 Bacteria 16207
666 Ga0496126_0022478 3300048929 Bacteria 6136
667 Ga0496126_0059163 3300048929 Bacteria 3451
668 Ga0496126_0095773 3300048929 Bacteria 2603
669 Ga0501031_0000752 3300049568 Bacteria 19504
670 Ga0501031_0011081 3300049568 Bacteria 5876
671 Ga0501032_0002341 3300049569 Bacteria 14858
672 Ga0501032_0017772 3300049569 Bacteria 4991
673 Ga0501032_0028361 3300049569 Bacteria 3847
674 Ga0501033_0001065 3300049570 Bacteria 25048
675 Ga0501033_0002108 3300049570 Bacteria 17222
676 Ga0501033_0104850 3300049570 Bacteria 2061
677 Ga0501033_0133672 3300049570 Bacteria 1795
678 Ga0501033_0188305 3300049570 Bacteria 1477
679 Ga0501034_0027325 3300049571 Bacteria 5804
680 Ga0501034_0029177 3300049571 Bacteria 5608
681 Ga0501034_0029851 3300049571 Bacteria 5541
682 Ga0501034_0185334 3300049571 Bacteria 2045
683 Ga0501036_0000867 3300049572 Bacteria 22512
684 Ga0501036_0002042 3300049572 Bacteria 15721
685 Ga0501036_0008657 3300049572 Bacteria 8348
686 Ga0501036_0022863 3300049572 Bacteria 5263
687 Ga0501036_0174250 3300049572 Bacteria 1812
688 Ga0501037_0008086 3300049573 Bacteria 7706
689 Ga0501037_0010476 3300049573 Bacteria 6809
690 Ga0501037_0018431 3300049573 Bacteria 5146
691 Ga0501037_0043979 3300049573 Bacteria 3281
692 Ga0501038_0000675 3300049574 Bacteria 30401
693 Ga0501038_0001411 3300049574 Bacteria 22000
694 Ga0501038_0005982 3300049574 Bacteria 11253
695 Ga0501038_0099140 3300049574 Bacteria 2429
696 Ga0501039_0001531 3300049575 Bacteria 17007
697 Ga0501039_0013991 3300049575 Bacteria 6139
698 Ga0501039_0015698 3300049575 Bacteria 5793
699 Ga0501039_0106664 3300049575 Bacteria 2188
700 Ga0501039_0188489 3300049575 Bacteria 1622
701 Ga0501040_0084886 3300049576 Bacteria 2197
702 Ga0501040_0192006 3300049576 Bacteria 1449
703 Ga0501040_0194023 3300049576 Bacteria 1442
704 Ga0501041_0040277 3300049577 Bacteria 2836
705 Ga0501042_0014307 3300049578 Bacteria 5415
706 Ga0501042_0114176 3300049578 Bacteria 1945
707 Ga0501042_0138665 3300049578 Bacteria 1753
708 Ga0501043_0002968 3300049579 Bacteria 14139
709 Ga0501043_0018008 3300049579 Bacteria 5540
710 Ga0501043_0023904 3300049579 Bacteria 4793
711 Ga0501043_0027990 3300049579 Bacteria 4423
712 Ga0501043_0408040 3300049579 Bacteria 1026
713 Ga0501046_0000841 3300049580 Bacteria 29918
714 Ga0501046_0007097 3300049580 Bacteria 9860
715 Ga0501046_0028827 3300049580 Bacteria 4517
716 Ga0501046_0109419 3300049580 Bacteria 2112
717 Ga0501047_0004414 3300049581 Bacteria 13248
718 Ga0501047_0026928 3300049581 Bacteria 5535
719 Ga0501047_0029239 3300049581 Bacteria 5314
720 Ga0501048_0001346 3300049582 Bacteria 18637
721 Ga0501048_0062411 3300049582 Bacteria 2637
722 Ga0501048_0102397 3300049582 Bacteria 2020
723 Ga0501067_0001915 3300049583 Bacteria 11443
724 Ga0501067_0004646 3300049583 Bacteria 7609
725 Ga0501067_0004983 3300049583 Bacteria 7379
726 Ga0501067_0035724 3300049583 Bacteria 2759
727 Ga0501067_0102813 3300049583 Bacteria 1587
728 Ga0501067_0146652 3300049583 Bacteria 1315
729 Ga0501068_0018161 3300049584 Bacteria 4072
730 Ga0501068_0198980 3300049584 Bacteria 1270
731 Ga0501069_0000486 3300049585 Bacteria 18160
732 Ga0501069_0001048 3300049585 Bacteria 13212
733 Ga0501069_0003084 3300049585 Bacteria 8533
734 Ga0501069_0055912 3300049585 Bacteria 2198
735 Ga0501070_0008158 3300049586 Bacteria 8858
736 Ga0501070_0019148 3300049586 Bacteria 5742
737 Ga0501070_0058761 3300049586 Bacteria 3187
738 Ga0501071_0063746 3300049587 Bacteria 2673
739 Ga0501071_0120107 3300049587 Bacteria 1948
740 Ga0501072_0037972 3300049588 Bacteria 3779
741 Ga0501072_0124490 3300049588 Bacteria 2054
742 Ga0501073_0029715 3300049589 Bacteria 3905
743 Ga0501073_0125320 3300049589 Bacteria 1780
744 Ga0501073_0226931 3300049589 Bacteria 1290
745 Ga0501073_0316134 3300049589 Bacteria 1077
746 Ga0501074_0000833 3300049590 Bacteria 19581
747 Ga0501074_0004359 3300049590 Bacteria 10104
748 Ga0501074_0014170 3300049590 Bacteria 5798
749 Ga0501074_0037812 3300049590 Bacteria 3498
750 Ga0501074_0051005 3300049590 Bacteria 2986
751 Ga0501076_0456106 3300049592 Bacteria 1052
752 Ga0501076_0792511 3300049592 Bacteria 782
753 Ga0501077_0024498 3300049593 Bacteria 3832
754 Ga0501077_0079251 3300049593 Bacteria 2081
755 Ga0501209_112440 3300049656 Bacteria 804
756 Ga0501079_0370950 3300049741 Bacteria 1122
757 Ga0501080_0005335 3300049742 Bacteria 11453
758 Ga0501080_0046143 3300049742 Bacteria 4058
759 Ga0501080_0380359 3300049742 Bacteria 1272
760 Ga0501080_0707807 3300049742 Bacteria 888
761 Ga0501083_0027945 3300049744 Bacteria 3889
762 Ga0501083_0034257 3300049744 Bacteria 3473
763 Ga0501083_0069875 3300049744 Bacteria 2336
764 Ga0501035_0002522 3300049822 Bacteria 17914
765 Ga0501035_0010212 3300049822 Bacteria 8714
766 Ga0501035_0044188 3300049822 Bacteria 4012
767 Ga0501035_0322122 3300049822 Bacteria 1298
768 Ga0501044_0024097 3300049823 Bacteria 6466
769 Ga0501044_0034809 3300049823 Bacteria 5279
770 Ga0501044_0043242 3300049823 Bacteria 4681
771 Ga0501044_0077818 3300049823 Bacteria 3362
772 Ga0501045_0106765 3300049824 Bacteria 2075
773 nmdc:mga03n38_1320_c1 3300050490 Bacteria 7014
774 nmdc:mga03n38_148739_c1 3300050490 Bacteria 1177
775 nmdc:mga03n38_216782_c1 3300050490 Bacteria 997
776 nmdc:mga03n38_281064_c1 3300050490 Bacteria 888
777 nmdc:mga00v17_113448_c1 3300050491 Bacteria 1721
778 nmdc:mga00v17_15144_c1 3300050491 Bacteria 4324
779 nmdc:mga00v17_17946_c2 3300050491 Bacteria 3272
780 nmdc:mga00v17_203894_c1 3300050491 Bacteria 1279
781 nmdc:mga00v17_281529_c1 3300050491 Bacteria 1079
782 nmdc:mga00v17_72469_c1 3300050491 Bacteria 2137
783 nmdc:mga0yw44_101340_c1 3300050492 Bacteria 1834
784 nmdc:mga0yw44_14440_c1 3300050492 Bacteria 4194
785 nmdc:mga0yw44_3123_c1 3300050492 Bacteria 7271
786 nmdc:mga0yw44_393927_c1 3300050492 Bacteria 936
787 nmdc:mga0yw44_406627_c1 3300050492 Bacteria 921
788 nmdc:mga0yw44_411809_c1 3300050492 Bacteria 915
789 nmdc:mga0yw44_46306_c1 3300050492 Bacteria 2611
790 nmdc:mga0yw44_53656_c1 3300050492 Bacteria 2448
791 nmdc:mga0yw44_746_c1 3300050492 Bacteria 12040
792 nmdc:mga0yw44_91179_c1 3300050492 Bacteria 1926
793 nmdc:mga0yw44_9146_c1 3300050492 Bacteria 4985
794 nmdc:mga06z11_152480_c1 3300050494 Bacteria 1315
795 nmdc:mga06z11_2345_c1 3300050494 Bacteria 7216
796 nmdc:mga06z11_366885_c1 3300050494 Bacteria 864
797 nmdc:mga04h51_15119_c1 3300050495 Bacteria 2219
798 nmdc:mga07m45_134999_c1 3300050496 Bacteria 1428
799 nmdc:mga07m45_13854_c1 3300050496 Bacteria 4285
800 nmdc:mga07m45_147052_c1 3300050496 Bacteria 1366
801 nmdc:mga07m45_4164_c1 3300050496 Bacteria 7064
802 nmdc:mga07m45_75985_c1 3300050496 Bacteria 1915
803 nmdc:mga05p37_125501_c1 3300050507 Bacteria 3152
804 nmdc:mga05p37_153476_c1 3300050507 Bacteria 2815
805 nmdc:mga05p37_613169_c1 3300050507 Bacteria 1226
806 nmdc:mga09592_9965_c1 3300050508 Bacteria 7730
807 nmdc:mga06r32_239510_c1 3300050510 Bacteria 1802
808 nmdc:mga08y16_488886_c1 3300050511 Bacteria 1252
809 nmdc:mga0n895_130027_c1 3300050512 Bacteria 2543
810 nmdc:mga08x19_7683_c1 3300050514 Bacteria 6402
811 nmdc:mga0a205_62866_c1 3300050515 Bacteria 3586
812 nmdc:mga0sz30_6878_c2 3300050516 Bacteria 3368
813 Ga0500635_0142687 3300053080 Bacteria 909
814 Ga0495595_0093442 3300053084 Bacteria 1445
815 Ga0495595_0101718 3300053084 Bacteria 1388
816 Ga0495595_0126560 3300053084 Bacteria 1247
817 Ga0495619_0135319 3300053085 Bacteria 1695
818 Ga0495619_0324102 3300053085 Bacteria 1066
819 Ga0500644_0000143 3300053088 Bacteria 44243
820 Ga0500644_0140846 3300053088 Bacteria 958
821 Ga0500556_0000502 3300053104 Bacteria 27054
822 Ga0500593_000518 3300053117 Bacteria 15122
823 Ga0500608_048138 3300053122 Bacteria 2048
824 Ga0500618_006516 3300053125 Bacteria 3417
825 Ga0500618_012194 3300053125 Bacteria 2256
826 Ga0500655_054436 3300053133 Bacteria 800
827 Ga0500559_0002295 3300053136 Bacteria 10052
828 Ga0500568_0056513 3300053139 Bacteria 1530
829 Ga0500573_0030579 3300053140 Bacteria 3106
830 Ga0500573_0038905 3300053140 Bacteria 2748
831 Ga0500603_135235 3300053150 Bacteria 756
832 Ga0500622_0001044 3300053156 Bacteria 23122
833 Ga0501084_0003690 3300054114 Bacteria 12430
834 Ga0501084_0042123 3300054114 Bacteria 3819
835 Ga0501084_0589844 3300054114 Bacteria 939
836 Ga0501082_0271445 3300060353 Bacteria 1476
837 Ga0466962_0000302 3300061719 Bacteria 21145
838 Ga0466962_0085480 3300061719 Bacteria 1510
839 Ga0466962_0152746 3300061719 Bacteria 1120
840 Ga0466962_0216167 3300061719 Bacteria 938
841 Ga0530510_0260945 3300061734 Bacteria 1292

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003761 Ga0055535_1001381 Ga0055535_10013815 195
2 3300044719 Ga0466971_0162883 Ga0466971_0162883_10_639 208
3 3300044842 Ga0466957_0801025 Ga0466957_0801025_18_644 208
4 3300045976 Ga0466967_0191434 Ga0466967_0191434_12_638 208
5 iso_pu_bacteria 2643221599 2644004481 209
6 3300005435 Ga0070714_100123250 Ga0070714_1001232502 210
7 iso_pu_bacteria 2524023129 2524187488 210
8 iso_pu_bacteria 2671180694 2673821067 210
9 iso_pu_bacteria 2744054657 2745166211 210
10 iso_pu_bacteria 2816332336 2817618104 210
11 iso_pu_bacteria 2818991459 2819674456 210
12 3300005339 Ga0070660_100166576 Ga0070660_1001665761 211
13 3300005341 Ga0070691_10057368 Ga0070691_100573682 211
14 3300005457 Ga0070662_100109898 Ga0070662_1001098982 211
15 3300005615 Ga0070702_100066152 Ga0070702_1000661522 211
16 3300005718 Ga0068866_10003247 Ga0068866_100032477 211
17 3300005719 Ga0068861_100111931 Ga0068861_1001119312 211
18 3300005981 Ga0081538_10022577 Ga0081538_100225775 211
19 3300006881 Ga0068865_100007888 Ga0068865_1000078882 211
20 3300009148 Ga0105243_10104527 Ga0105243_101045271 211
21 3300009551 Ga0105238_10523649 Ga0105238_105236491 211
22 3300009553 Ga0105249_10380398 Ga0105249_103803981 211
23 3300010375 Ga0105239_10116670 Ga0105239_101166702 211
24 3300013307 Ga0157372_10024536 Ga0157372_100245368 211
25 3300014326 Ga0157380_10804425 Ga0157380_108044251 211
26 3300014497 Ga0182008_10099700 Ga0182008_100997002 211
27 3300031731 Ga0307405_10061467 Ga0307405_100614672 211
28 3300047445 Ga0495677_0088318 Ga0495677_0088318_330_1067 211
29 3300025224 Ga0209784_102716 Ga0209784_1027162 212
30 3300025242 Ga0209258_100713 Ga0209258_10071310 212
31 3300025294 Ga0209025_1027911 Ga0209025_10279114 212
32 3300027111 Ga0209281_1000097 Ga0209281_1000097141 212
33 3300027111 Ga0209281_1002422 Ga0209281_10024222 212
34 3300048925 Ga0496122_0042752 Ga0496122_0042752_1568_2233 212
35 3300048925 Ga0496122_0143398 Ga0496122_0143398_157_822 212
36 3300005434 Ga0070709_10019568 Ga0070709_100195684 213
37 3300006028 Ga0070717_10186285 Ga0070717_101862852 213
38 3300025929 Ga0207664_10213691 Ga0207664_102136912 213
39 iso_pu_bacteria 2558860983 2561467930 213
40 3300005356 Ga0070674_100240561 Ga0070674_1002405612 214
41 iso_pu_bacteria 8005658619 8005661459 214
42 iso_pu_bacteria 8055431914 8055433756 214
43 3300005843 Ga0068860_100114307 Ga0068860_1001143072 215
44 3300006163 Ga0070715_10046904 Ga0070715_100469042 215
45 3300025905 Ga0207685_10107858 Ga0207685_101078582 215
46 3300025906 Ga0207699_10139336 Ga0207699_101393362 215
47 3300026035 Ga0207703_10279525 Ga0207703_102795252 215
48 3300027111 Ga0209281_1000844 Ga0209281_100084424 215
49 3300048911 Ga0496108_0735993 Ga0496108_0735993_21_668 215
50 3300048918 Ga0496115_0800883 Ga0496115_0800883_20_667 215
51 3300049570 Ga0501033_0188305 Ga0501033_0188305_199_846 215
52 3300049572 Ga0501036_0002042 Ga0501036_0002042_13827_14474 215
53 3300049573 Ga0501037_0043979 Ga0501037_0043979_2074_2721 215
54 3300049575 Ga0501039_0013991 Ga0501039_0013991_4921_5568 215
55 3300049579 Ga0501043_0023904 Ga0501043_0023904_3705_4352 215
56 3300049580 Ga0501046_0028827 Ga0501046_0028827_1112_1759 215
57 3300049582 Ga0501048_0102397 Ga0501048_0102397_480_1127 215
58 3300049583 Ga0501067_0001915 Ga0501067_0001915_10369_11016 215
59 3300049584 Ga0501068_0198980 Ga0501068_0198980_389_1036 215
60 3300049585 Ga0501069_0055912 Ga0501069_0055912_1224_1871 215
61 3300049587 Ga0501071_0120107 Ga0501071_0120107_919_1566 215
62 3300049589 Ga0501073_0029715 Ga0501073_0029715_544_1191 215
63 3300049590 Ga0501074_0051005 Ga0501074_0051005_225_872 215
64 3300049744 Ga0501083_0034257 Ga0501083_0034257_1884_2531 215
65 3300049822 Ga0501035_0044188 Ga0501035_0044188_2118_2765 215
66 3300049823 Ga0501044_0034809 Ga0501044_0034809_1225_1872 215
67 3300049824 Ga0501045_0106765 Ga0501045_0106765_600_1247 215
68 3300054114 Ga0501084_0042123 Ga0501084_0042123_3093_3740 215
69 iso_pu_bacteria 2510917028 2511185394 215
70 iso_pu_bacteria 2516143018 2516204785 215
71 iso_pu_bacteria 2534681796 2535514638 215
72 iso_pu_bacteria 2582581294 2585201212 215
73 iso_pu_bacteria 2600254933 2600373975 215
74 iso_pu_bacteria 2643221557 2643805835 215
75 iso_pu_bacteria 2643221607 2644048699 215
76 iso_pu_bacteria 2643221610 2644066011 215
77 iso_pu_bacteria 2643221636 2644201982 215
78 iso_pu_bacteria 2643221668 2644380315 215
79 iso_pu_bacteria 2643221675 2644417342 215
80 iso_pu_bacteria 2643221680 2644450738 215
81 iso_pu_bacteria 2643221686 2644481501 215
82 iso_pu_bacteria 2643221726 2644692837 215
83 iso_pu_bacteria 2643221731 2644718534 215
84 iso_pu_bacteria 2690316117 2692317704 215
85 iso_pu_bacteria 2751185821 2753459907 215
86 iso_pu_bacteria 2791355091 2792621015 215
87 iso_pu_bacteria 2791355092 2792625230 215
88 iso_pu_bacteria 2791355094 2792637658 215
89 iso_pu_bacteria 2818991461 2819686766 215
90 iso_pu_bacteria 2818991465 2819712129 215
91 iso_pu_bacteria 2842882022 2842887992 215
92 iso_pu_bacteria 2847417321 2847421317 215
93 iso_pu_bacteria 2848992105 2848996104 215
94 iso_pu_bacteria 2855872281 2855877812 215
95 iso_pu_bacteria 2904524088 2904530242 215
96 iso_pu_bacteria 2919143609 2919149516 215
97 iso_pu_bacteria 2919517244 2919523078 215
98 iso_pu_bacteria 2919720352 2919726235 215
99 iso_pu_bacteria 2920822456 2920822873 215
100 iso_pu_bacteria 2928093941 2928099745 215
101 iso_pu_bacteria 2929004312 2929010255 215
102 iso_pu_bacteria 2960319331 2960323196 215
103 iso_pu_bacteria 2960375949 2960379820 215
104 iso_pu_bacteria 643692032 643827807 215
105 iso_pu_bacteria 8005542996 8005543301 215
106 iso_pu_bacteria 8022893055 8022896416 215
107 iso_pu_bacteria 8022914991 8022918160 215
108 3300005339 Ga0070660_100354405 Ga0070660_1003544051 216
109 3300005355 Ga0070671_100238271 Ga0070671_1002382712 216
110 3300005434 Ga0070709_10061181 Ga0070709_100611811 216
111 3300005434 Ga0070709_10476318 Ga0070709_104763181 216
112 3300005435 Ga0070714_100085997 Ga0070714_1000859973 216
113 3300005436 Ga0070713_100049430 Ga0070713_1000494304 216
114 3300005436 Ga0070713_100247463 Ga0070713_1002474632 216
115 3300005437 Ga0070710_10001036 Ga0070710_1000103617 216
116 3300005439 Ga0070711_100057175 Ga0070711_1000571753 216
117 3300005439 Ga0070711_100210221 Ga0070711_1002102212 216
118 3300005439 Ga0070711_100462342 Ga0070711_1004623422 216
119 3300005458 Ga0070681_10717680 Ga0070681_107176801 216
120 3300005468 Ga0070707_100420649 Ga0070707_1004206492 216
121 3300005535 Ga0070684_100501214 Ga0070684_1005012142 216
122 3300005545 Ga0070695_100834399 Ga0070695_1008343991 216
123 3300005546 Ga0070696_100036428 Ga0070696_1000364283 216
124 3300006173 Ga0070716_100048576 Ga0070716_1000485762 216
125 3300009093 Ga0105240_10033798 Ga0105240_100337984 216
126 3300009093 Ga0105240_10317937 Ga0105240_103179372 216
127 3300009098 Ga0105245_10205224 Ga0105245_102052242 216
128 3300009176 Ga0105242_10432278 Ga0105242_104322782 216
129 3300009545 Ga0105237_10013297 Ga0105237_100132978 216
130 3300009545 Ga0105237_10225311 Ga0105237_102253113 216
131 3300011119 Ga0105246_10127366 Ga0105246_101273663 216
132 3300013105 Ga0157369_10744742 Ga0157369_107447421 216
133 3300013296 Ga0157374_10122402 Ga0157374_101224022 216
134 3300013297 Ga0157378_10317988 Ga0157378_103179882 216
135 3300014968 Ga0157379_10188016 Ga0157379_101880161 216
136 3300014969 Ga0157376_10105516 Ga0157376_101055162 216
137 3300025911 Ga0207654_10024058 Ga0207654_100240582 216
138 3300025928 Ga0207700_10203761 Ga0207700_102037611 216
139 3300026089 Ga0207648_10619589 Ga0207648_106195892 216
140 3300035114 Ga0373939_0089614 Ga0373939_0089614_83_733 216
141 3300035115 Ga0373941_0210546 Ga0373941_0210546_58_708 216
142 3300037466 Ga0395898_0406943 Ga0395898_0406943_533_1183 216
143 3300044901 Ga0466960_0084883 Ga0466960_0084883_862_1530 216
144 3300045976 Ga0466967_0027096 Ga0466967_0027096_3464_4132 216
145 3300046517 Ga0495630_0128973 Ga0495630_0128973_789_1439 216
146 3300046559 Ga0495667_0096875 Ga0495667_0096875_423_1073 216
147 3300046674 Ga0495588_0079974 Ga0495588_0079974_763_1413 216
148 3300046675 Ga0495657_0080879 Ga0495657_0080879_1129_1779 216
149 3300048903 Ga0496100_0060664 Ga0496100_0060664_1338_1988 216
150 3300048903 Ga0496100_0569188 Ga0496100_0569188_171_821 216
151 3300048904 Ga0496101_0073020 Ga0496101_0073020_1368_2018 216
152 3300048904 Ga0496101_0449525 Ga0496101_0449525_61_711 216
153 3300048905 Ga0496102_0026325 Ga0496102_0026325_3297_3947 216
154 3300048905 Ga0496102_0092320 Ga0496102_0092320_1760_2410 216
155 3300048906 Ga0496103_0018836 Ga0496103_0018836_2464_3114 216
156 3300048906 Ga0496103_0215215 Ga0496103_0215215_189_839 216
157 3300048906 Ga0496103_0363717 Ga0496103_0363717_191_841 216
158 3300048907 Ga0496104_0025841 Ga0496104_0025841_2216_2866 216
159 3300048907 Ga0496104_0211661 Ga0496104_0211661_444_1094 216
160 3300048907 Ga0496104_0235060 Ga0496104_0235060_442_1092 216
161 3300048908 Ga0496105_0043182 Ga0496105_0043182_1512_2162 216
162 3300048908 Ga0496105_0059563 Ga0496105_0059563_1719_2369 216
163 3300048908 Ga0496105_0093282 Ga0496105_0093282_1311_1961 216
164 3300048908 Ga0496105_0255147 Ga0496105_0255147_37_687 216
165 3300048909 Ga0496106_0322211 Ga0496106_0322211_505_1155 216
166 3300048911 Ga0496108_0020230 Ga0496108_0020230_4167_4817 216
167 3300048912 Ga0496109_0029534 Ga0496109_0029534_733_1383 216
168 3300048912 Ga0496109_0621770 Ga0496109_0621770_47_697 216
169 3300048913 Ga0496110_0092490 Ga0496110_0092490_1981_2631 216
170 3300048915 Ga0496112_0095533 Ga0496112_0095533_1184_1834 216
171 3300048916 Ga0496113_0027299 Ga0496113_0027299_1113_1763 216
172 3300048916 Ga0496113_0197557 Ga0496113_0197557_554_1204 216
173 3300048917 Ga0496114_0526195 Ga0496114_0526195_204_854 216
174 3300048918 Ga0496115_0096587 Ga0496115_0096587_1347_1997 216
175 3300048918 Ga0496115_0236370 Ga0496115_0236370_555_1205 216
176 3300053084 Ga0495595_0093442 Ga0495595_0093442_750_1400 216
177 3300053084 Ga0495595_0101718 Ga0495595_0101718_104_754 216
178 iso_pu_bacteria 2582581304 2585256345 216
179 iso_pu_bacteria 2881636855 2881637515 216
180 iso_pu_bacteria 3005452660 3005456427 216
181 3300032126 Ga0307415_100600606 Ga0307415_1006006062 217
182 3300044658 Ga0466972_0015450 Ga0466972_0015450_1087_1851 217
183 3300044683 Ga0466965_0001364 Ga0466965_0001364_6916_7680 217
184 3300044684 Ga0466966_0014690 Ga0466966_0014690_293_1057 217
185 3300044693 Ga0466961_0000223 Ga0466961_0000223_35970_36734 217
186 3300044694 Ga0466963_0013564 Ga0466963_0013564_3030_3794 217
187 3300044719 Ga0466971_0006327 Ga0466971_0006327_1744_2508 217
188 3300044765 Ga0466970_0009805 Ga0466970_0009805_2484_3248 217
189 3300044842 Ga0466957_0000283 Ga0466957_0000283_6648_7412 217
190 3300045049 Ga0466959_0064828 Ga0466959_0064828_116_880 217
191 3300045976 Ga0466967_0010091 Ga0466967_0010091_3794_4558 217
192 3300061719 Ga0466962_0000302 Ga0466962_0000302_1056_1820 217
193 3300032133 Ga0316583_10006272 Ga0316583_100062724 218
194 3300049568 Ga0501031_0011081 Ga0501031_0011081_213_938 218
195 3300049569 Ga0501032_0017772 Ga0501032_0017772_3794_4519 218
196 3300049570 Ga0501033_0002108 Ga0501033_0002108_9356_10081 218
197 3300049570 Ga0501033_0104850 Ga0501033_0104850_199_924 218
198 3300049571 Ga0501034_0185334 Ga0501034_0185334_630_1355 218
199 3300049572 Ga0501036_0008657 Ga0501036_0008657_48_773 218
200 3300049573 Ga0501037_0008086 Ga0501037_0008086_4539_5264 218
201 3300049574 Ga0501038_0005982 Ga0501038_0005982_8667_9392 218
202 3300049575 Ga0501039_0015698 Ga0501039_0015698_562_1287 218
203 3300049576 Ga0501040_0192006 Ga0501040_0192006_356_1081 218
204 3300049578 Ga0501042_0138665 Ga0501042_0138665_360_1085 218
205 3300049579 Ga0501043_0018008 Ga0501043_0018008_461_1186 218
206 3300049579 Ga0501043_0027990 Ga0501043_0027990_275_1000 218
207 3300049580 Ga0501046_0000841 Ga0501046_0000841_14652_15377 218
208 3300049580 Ga0501046_0109419 Ga0501046_0109419_1218_1943 218
209 3300049581 Ga0501047_0026928 Ga0501047_0026928_4171_4896 218
210 3300049582 Ga0501048_0062411 Ga0501048_0062411_1703_2428 218
211 3300049586 Ga0501070_0019148 Ga0501070_0019148_755_1480 218
212 3300049742 Ga0501080_0380359 Ga0501080_0380359_199_924 218
213 3300049822 Ga0501035_0322122 Ga0501035_0322122_170_895 218
214 3300049823 Ga0501044_0077818 Ga0501044_0077818_170_895 218
215 3300050508 nmdc:mga09592_9965_c1 nmdc:mga09592_9965_c1_4215_4895 218
216 3300003320 rootH2_10091126 rootH2_100911262 219
217 3300003322 rootL2_10113871 rootL2_101138714 219
218 3300003322 rootL2_10310571 rootL2_103105712 219
219 3300003323 rootH1_10302260 rootH1_103022602 219
220 3300003578 Ga0006562J51391_1000951 Ga0006562J51391_10009517 219
221 3300003758 Ga0055532_1002555 Ga0055532_10025553 219
222 3300003771 Ga0055526_1050140 Ga0055526_10501402 219
223 3300003775 Ga0055524_1006468 Ga0055524_10064684 219
224 3300003775 Ga0055524_1026783 Ga0055524_10267832 219
225 3300003790 Ga0055528_1001799 Ga0055528_100179911 219
226 3300003790 Ga0055528_1002733 Ga0055528_10027334 219
227 3300003790 Ga0055528_1003910 Ga0055528_10039107 219
228 3300003792 Ga0055540_1007921 Ga0055540_10079212 219
229 3300005262 Ga0065165_1001643 Ga0065165_10016435 219
230 3300005331 Ga0070670_100320646 Ga0070670_1003206461 219
231 3300005337 Ga0070682_100150477 Ga0070682_1001504772 219
232 3300005340 Ga0070689_100502596 Ga0070689_1005025962 219
233 3300005347 Ga0070668_100043923 Ga0070668_1000439232 219
234 3300005355 Ga0070671_100021523 Ga0070671_1000215233 219
235 3300005355 Ga0070671_100059731 Ga0070671_1000597312 219
236 3300005367 Ga0070667_100548481 Ga0070667_1005484812 219
237 3300005455 Ga0070663_100164502 Ga0070663_1001645022 219
238 3300005457 Ga0070662_100321813 Ga0070662_1003218131 219
239 3300006048 Ga0075363_100217149 Ga0075363_1002171492 219
240 3300006353 Ga0075370_10011633 Ga0075370_100116336 219
241 3300006353 Ga0075370_10126608 Ga0075370_101266082 219
242 3300006847 Ga0075431_100283624 Ga0075431_1002836242 219
243 3300009011 Ga0105251_10005738 Ga0105251_100057386 219
244 3300009011 Ga0105251_10013084 Ga0105251_100130845 219
245 3300009011 Ga0105251_10023032 Ga0105251_100230323 219
246 3300009036 Ga0105244_10018182 Ga0105244_100181822 219
247 3300009036 Ga0105244_10221586 Ga0105244_102215861 219
248 3300009092 Ga0105250_10009562 Ga0105250_100095623 219
249 3300009092 Ga0105250_10066317 Ga0105250_100663172 219
250 3300009098 Ga0105245_10270432 Ga0105245_102704322 219
251 3300009101 Ga0105247_10049742 Ga0105247_100497423 219
252 3300009148 Ga0105243_10029624 Ga0105243_100296243 219
253 3300009148 Ga0105243_10989414 Ga0105243_109894142 219
254 3300009176 Ga0105242_10081241 Ga0105242_100812412 219
255 3300009553 Ga0105249_10072069 Ga0105249_100720695 219
256 3300009765 Ga0123341_1078622 Ga0123341_10786222 219
257 3300010375 Ga0105239_10083189 Ga0105239_100831895 219
258 3300011119 Ga0105246_10048722 Ga0105246_100487222 219
259 3300013104 Ga0157370_10177274 Ga0157370_101772742 219
260 3300013104 Ga0157370_10380170 Ga0157370_103801702 219
261 3300013296 Ga0157374_10129426 Ga0157374_101294262 219
262 3300013296 Ga0157374_10885746 Ga0157374_108857461 219
263 3300013297 Ga0157378_10026724 Ga0157378_100267243 219
264 3300013307 Ga0157372_10816815 Ga0157372_108168151 219
265 3300014745 Ga0157377_10006626 Ga0157377_100066263 219
266 3300014969 Ga0157376_10004054 Ga0157376_100040548 219
267 3300015690 Ga0183363_1146 Ga0183363_11464 219
268 3300025229 Ga0209147_100640 Ga0209147_10064014 219
269 3300025258 Ga0209129_1000066 Ga0209129_100006699 219
270 3300025258 Ga0209129_1016456 Ga0209129_10164562 219
271 3300025273 Ga0209673_1000024 Ga0209673_1000024165 219
272 3300025273 Ga0209673_1002852 Ga0209673_100285211 219
273 3300025273 Ga0209673_1008252 Ga0209673_10082525 219
274 3300025273 Ga0209673_1008507 Ga0209673_10085072 219
275 3300025273 Ga0209673_1011187 Ga0209673_10111875 219
276 3300025284 Ga0209130_1033406 Ga0209130_10334062 219
277 3300025294 Ga0209025_1000275 Ga0209025_10002752 219
278 3300025294 Ga0209025_1008812 Ga0209025_100881210 219
279 3300025294 Ga0209025_1018920 Ga0209025_10189202 219
280 3300025294 Ga0209025_1022379 Ga0209025_10223792 219
281 3300025294 Ga0209025_1033755 Ga0209025_10337552 219
282 3300025295 Ga0209564_1003535 Ga0209564_10035359 219
283 3300025295 Ga0209564_1007247 Ga0209564_10072472 219
284 3300025295 Ga0209564_1012018 Ga0209564_10120184 219
285 3300025297 Ga0209758_1036365 Ga0209758_10363652 219
286 3300025299 Ga0209256_1000027 Ga0209256_100002710 219
287 3300025299 Ga0209256_1001674 Ga0209256_100167416 219
288 3300025299 Ga0209256_1003288 Ga0209256_100328813 219
289 3300025299 Ga0209256_1018687 Ga0209256_10186874 219
290 3300025302 Ga0207426_1002707 Ga0207426_10027079 219
291 3300025303 Ga0209051_1006208 Ga0209051_10062084 219
292 3300025303 Ga0209051_1079549 Ga0209051_10795492 219
293 3300025711 Ga0207696_1004609 Ga0207696_10046096 219
294 3300025711 Ga0207696_1016935 Ga0207696_10169352 219
295 3300025728 Ga0207655_1018102 Ga0207655_10181025 219
296 3300025728 Ga0207655_1018154 Ga0207655_10181544 219
297 3300025728 Ga0207655_1032487 Ga0207655_10324873 219
298 3300025735 Ga0207713_1000851 Ga0207713_100085126 219
299 3300025735 Ga0207713_1012854 Ga0207713_10128545 219
300 3300025735 Ga0207713_1022059 Ga0207713_10220592 219
301 3300025900 Ga0207710_10023764 Ga0207710_100237643 219
302 3300025923 Ga0207681_10171079 Ga0207681_101710792 219
303 3300025931 Ga0207644_10025762 Ga0207644_100257623 219
304 3300025931 Ga0207644_10119931 Ga0207644_101199312 219
305 3300025934 Ga0207686_10106637 Ga0207686_101066372 219
306 3300025935 Ga0207709_10003100 Ga0207709_100031002 219
307 3300025961 Ga0207712_10229157 Ga0207712_102291572 219
308 3300025972 Ga0207668_10011452 Ga0207668_100114525 219
309 3300025986 Ga0207658_10433697 Ga0207658_104336972 219
310 3300028794 Ga0307515_10200098 Ga0307515_102000982 219
311 3300031733 Ga0316577_10170089 Ga0316577_101700892 219
312 3300032004 Ga0307414_10025067 Ga0307414_100250671 219
313 3300035692 Ga0373935_0288305 Ga0373935_0288305_298_963 219
314 3300035695 Ga0373927_0000048 Ga0373927_0000048_69350_70015 219
315 3300036647 Ga0316582_0012397 Ga0316582_0012397_253_918 219
316 3300036647 Ga0316582_0273334 Ga0316582_0273334_392_1057 219
317 3300037068 Ga0373925_0000668 Ga0373925_0000668_31144_31809 219
318 3300037418 Ga0395900_0225426 Ga0395900_0225426_1048_1713 219
319 3300037471 Ga0395905_0000608 Ga0395905_0000608_15506_16171 219
320 3300037471 Ga0395905_0043829 Ga0395905_0043829_1354_2019 219
321 3300038443 Ga0395901_0150818 Ga0395901_0150818_225_890 219
322 3300042007 Ga0439449_0019048 Ga0439449_0019048_1656_2321 219
323 3300046455 Ga0495603_0113446 Ga0495603_0113446_521_1198 219
324 3300046460 Ga0495638_0033750 Ga0495638_0033750_1174_1839 219
325 3300046492 Ga0495585_0169031 Ga0495585_0169031_287_964 219
326 3300046501 Ga0495607_0039385 Ga0495607_0039385_1900_2565 219
327 3300046810 Ga0495660_0093620 Ga0495660_0093620_178_849 219
328 3300047323 Ga0495683_0064813 Ga0495683_0064813_301_978 219
329 3300048904 Ga0496101_0005998 Ga0496101_0005998_4744_5421 219
330 3300048905 Ga0496102_0001253 Ga0496102_0001253_8038_8715 219
331 3300048905 Ga0496102_0077997 Ga0496102_0077997_2252_2917 219
332 3300048906 Ga0496103_0002461 Ga0496103_0002461_7795_8472 219
333 3300048906 Ga0496103_0014248 Ga0496103_0014248_1795_2460 219
334 3300048907 Ga0496104_0000546 Ga0496104_0000546_25642_26319 219
335 3300048907 Ga0496104_0051975 Ga0496104_0051975_2441_3106 219
336 3300048908 Ga0496105_0001973 Ga0496105_0001973_1469_2146 219
337 3300048909 Ga0496106_0005321 Ga0496106_0005321_363_1040 219
338 3300048909 Ga0496106_0029362 Ga0496106_0029362_2337_3002 219
339 3300048910 Ga0496107_0001086 Ga0496107_0001086_1743_2420 219
340 3300048911 Ga0496108_0004135 Ga0496108_0004135_4872_5549 219
341 3300048911 Ga0496108_0155121 Ga0496108_0155121_1144_1809 219
342 3300048912 Ga0496109_0000938 Ga0496109_0000938_22886_23563 219
343 3300048912 Ga0496109_0070633 Ga0496109_0070633_1915_2580 219
344 3300048913 Ga0496110_0035553 Ga0496110_0035553_2493_3158 219
345 3300048913 Ga0496110_0068137 Ga0496110_0068137_1583_2260 219
346 3300048913 Ga0496110_0397628 Ga0496110_0397628_553_1218 219
347 3300048914 Ga0496111_0006183 Ga0496111_0006183_6445_7122 219
348 3300048914 Ga0496111_0040563 Ga0496111_0040563_1169_1834 219
349 3300048915 Ga0496112_0000907 Ga0496112_0000907_15907_16584 219
350 3300048916 Ga0496113_0000155 Ga0496113_0000155_28268_28945 219
351 3300048917 Ga0496114_0089913 Ga0496114_0089913_501_1166 219
352 3300048917 Ga0496114_0574761 Ga0496114_0574761_24_689 219
353 3300048919 Ga0496116_0034283 Ga0496116_0034283_1541_2206 219
354 3300048920 Ga0496117_0038338 Ga0496117_0038338_770_1447 219
355 3300048920 Ga0496117_0188302 Ga0496117_0188302_200_865 219
356 3300048922 Ga0496119_0006558 Ga0496119_0006558_7208_7885 219
357 3300048923 Ga0496120_0032458 Ga0496120_0032458_1302_1967 219
358 3300048923 Ga0496120_0058898 Ga0496120_0058898_111_788 219
359 3300048924 Ga0496121_0065339 Ga0496121_0065339_1271_1936 219
360 3300048924 Ga0496121_0066205 Ga0496121_0066205_585_1250 219
361 3300048925 Ga0496122_0038832 Ga0496122_0038832_2618_3295 219
362 3300048926 Ga0496123_0141033 Ga0496123_0141033_501_1166 219
363 3300048927 Ga0496124_0168982 Ga0496124_0168982_976_1641 219
364 3300048927 Ga0496124_0437447 Ga0496124_0437447_156_824 219
365 3300048928 Ga0496125_0004429 Ga0496125_0004429_8292_8969 219
366 3300048929 Ga0496126_0022478 Ga0496126_0022478_2647_3312 219
367 3300048929 Ga0496126_0059163 Ga0496126_0059163_1087_1752 219
368 3300048929 Ga0496126_0095773 Ga0496126_0095773_392_1069 219
369 3300050492 nmdc:mga0yw44_46306_c1 nmdc:mga0yw44_46306_c1_1646_2311 219
370 3300050516 nmdc:mga0sz30_6878_c2 nmdc:mga0sz30_6878_c2_1014_1679 219
371 3300053088 Ga0500644_0140846 Ga0500644_0140846_130_795 219
372 3300053122 Ga0500608_048138 Ga0500608_048138_1243_1908 219
373 3300053125 Ga0500618_006516 Ga0500618_006516_1225_1890 219
374 3300053125 Ga0500618_012194 Ga0500618_012194_641_1306 219
375 3300053136 Ga0500559_0002295 Ga0500559_0002295_415_1080 219
376 3300053156 Ga0500622_0001044 Ga0500622_0001044_15965_16630 219
377 3300005434 Ga0070709_10070867 Ga0070709_100708672 220
378 3300005467 Ga0070706_100523643 Ga0070706_1005236432 220
379 3300005471 Ga0070698_100013398 Ga0070698_1000133984 220
380 3300005546 Ga0070696_100211116 Ga0070696_1002111162 220
381 3300005844 Ga0068862_100731289 Ga0068862_1007312891 220
382 3300006880 Ga0075429_100179802 Ga0075429_1001798022 220
383 3300009147 Ga0114129_10525904 Ga0114129_105259042 220
384 3300009176 Ga0105242_10207134 Ga0105242_102071342 220
385 3300013297 Ga0157378_10242493 Ga0157378_102424931 220
386 3300014968 Ga0157379_10024932 Ga0157379_100249322 220
387 3300037471 Ga0395905_1016739 Ga0395905_1016739_25_702 220
388 3300048903 Ga0496100_0372494 Ga0496100_0372494_124_795 220
389 3300048905 Ga0496102_0102732 Ga0496102_0102732_342_1013 220
390 3300048909 Ga0496106_0014231 Ga0496106_0014231_4778_5449 220
391 3300048919 Ga0496116_0111385 Ga0496116_0111385_96_890 220
392 3300048927 Ga0496124_0005559 Ga0496124_0005559_5511_6215 220
393 3300048927 Ga0496124_0018229 Ga0496124_0018229_1088_1756 220
394 3300048927 Ga0496124_0095692 Ga0496124_0095692_1162_1830 220
395 3300049589 Ga0501073_0316134 Ga0501073_0316134_220_894 220
396 3300049590 Ga0501074_0037812 Ga0501074_0037812_508_1233 220
397 3300049593 Ga0501077_0024498 Ga0501077_0024498_634_1308 220
398 3300050507 nmdc:mga05p37_613169_c1 nmdc:mga05p37_613169_c1_182_886 220
399 3300050510 nmdc:mga06r32_239510_c1 nmdc:mga06r32_239510_c1_585_1289 220
400 3300005338 Ga0068868_100024281 Ga0068868_1000242814 221
401 3300005366 Ga0070659_100046567 Ga0070659_1000465672 221
402 3300005458 Ga0070681_10051905 Ga0070681_100519053 221
403 3300005530 Ga0070679_100081739 Ga0070679_1000817393 221
404 3300006051 Ga0075364_10326450 Ga0075364_103264501 221
405 3300006871 Ga0075434_100000592 Ga0075434_10000059223 221
406 3300006914 Ga0075436_100005286 Ga0075436_1000052868 221
407 3300007076 Ga0075435_100000398 Ga0075435_10000039824 221
408 3300025912 Ga0207707_10040469 Ga0207707_100404693 221
409 3300025913 Ga0207695_10011324 Ga0207695_100113245 221
410 3300025914 Ga0207671_10110197 Ga0207671_101101972 221
411 3300025917 Ga0207660_10008889 Ga0207660_100088895 221
412 3300025920 Ga0207649_10135236 Ga0207649_101352362 221
413 3300025921 Ga0207652_10100213 Ga0207652_101002133 221
414 3300025927 Ga0207687_10026416 Ga0207687_100264162 221
415 3300025931 Ga0207644_10389458 Ga0207644_103894582 221
416 3300026023 Ga0207677_10015540 Ga0207677_100155403 221
417 3300044683 Ga0466965_0124705 Ga0466965_0124705_528_1202 221
418 3300044694 Ga0466963_0010684 Ga0466963_0010684_1458_2132 221
419 3300044706 Ga0466964_0049085 Ga0466964_0049085_760_1434 221
420 3300044719 Ga0466971_0091970 Ga0466971_0091970_86_760 221
421 3300044842 Ga0466957_0296013 Ga0466957_0296013_396_1070 221
422 3300045836 Ga0466958_0036234 Ga0466958_0036234_2072_2746 221
423 3300045976 Ga0466967_0002748 Ga0466967_0002748_6933_7607 221
424 3300046463 Ga0495653_0315502 Ga0495653_0315502_314_988 221
425 3300046529 Ga0495652_0381177 Ga0495652_0381177_23_697 221
426 3300046536 Ga0495587_0072618 Ga0495587_0072618_1131_1805 221
427 3300046663 Ga0495635_0482803 Ga0495635_0482803_51_725 221
428 3300050491 nmdc:mga00v17_281529_c1 nmdc:mga00v17_281529_c1_158_832 221
429 3300050494 nmdc:mga06z11_366885_c1 nmdc:mga06z11_366885_c1_48_713 221
430 3300053084 Ga0495595_0126560 Ga0495595_0126560_246_920 221
431 3300053085 Ga0495619_0324102 Ga0495619_0324102_109_783 221
432 3300061719 Ga0466962_0152746 Ga0466962_0152746_368_1042 221
433 3300005441 Ga0070700_100433488 Ga0070700_1004334881 222
434 3300044683 Ga0466965_0055705 Ga0466965_0055705_1114_1782 222
435 3300044684 Ga0466966_0030866 Ga0466966_0030866_1765_2466 222
436 3300044693 Ga0466961_0062701 Ga0466961_0062701_1041_1742 222
437 3300044693 Ga0466961_0306375 Ga0466961_0306375_101_769 222
438 3300044719 Ga0466971_0022623 Ga0466971_0022623_1267_1968 222
439 3300045836 Ga0466958_0029237 Ga0466958_0029237_1302_2003 222
440 3300045836 Ga0466958_0069805 Ga0466958_0069805_596_1267 222
441 3300048913 Ga0496110_0629315 Ga0496110_0629315_228_914 222
442 3300061719 Ga0466962_0085480 Ga0466962_0085480_406_1107 222
443 3300005337 Ga0070682_100053384 Ga0070682_1000533843 223
444 3300005435 Ga0070714_100008917 Ga0070714_1000089176 223
445 3300005439 Ga0070711_100178845 Ga0070711_1001788452 223
446 3300005444 Ga0070694_100046393 Ga0070694_1000463933 223
447 3300005530 Ga0070679_100130043 Ga0070679_1001300433 223
448 3300005545 Ga0070695_100000424 Ga0070695_1000004244 223
449 3300005577 Ga0068857_100972639 Ga0068857_1009726391 223
450 3300006028 Ga0070717_10179566 Ga0070717_101795661 223
451 3300006163 Ga0070715_10018015 Ga0070715_100180152 223
452 3300006173 Ga0070716_100016572 Ga0070716_1000165722 223
453 3300006175 Ga0070712_100041445 Ga0070712_1000414453 223
454 3300006175 Ga0070712_100129626 Ga0070712_1001296263 223
455 3300006237 Ga0097621_100192601 Ga0097621_1001926013 223
456 3300013105 Ga0157369_10445357 Ga0157369_104453573 223
457 3300013307 Ga0157372_10080102 Ga0157372_100801024 223
458 3300025898 Ga0207692_10229892 Ga0207692_102298921 223
459 3300025905 Ga0207685_10056840 Ga0207685_100568403 223
460 3300025906 Ga0207699_10095587 Ga0207699_100955873 223
461 3300025913 Ga0207695_10082209 Ga0207695_100822094 223
462 3300025914 Ga0207671_10256806 Ga0207671_102568061 223
463 3300025915 Ga0207693_10031290 Ga0207693_100312902 223
464 3300025915 Ga0207693_10079013 Ga0207693_100790132 223
465 3300025916 Ga0207663_10008339 Ga0207663_100083395 223
466 3300025916 Ga0207663_10032814 Ga0207663_100328144 223
467 3300025928 Ga0207700_10000001 Ga0207700_10000001405 223
468 3300025928 Ga0207700_10436363 Ga0207700_104363632 223
469 3300025929 Ga0207664_10039097 Ga0207664_100390972 223
470 3300025931 Ga0207644_10261525 Ga0207644_102615253 223
471 3300025939 Ga0207665_10011508 Ga0207665_100115086 223
472 3300025944 Ga0207661_10241311 Ga0207661_102413112 223
473 3300026067 Ga0207678_10140684 Ga0207678_101406842 223
474 3300026078 Ga0207702_10004876 Ga0207702_100048765 223
475 3300026088 Ga0207641_10398101 Ga0207641_103981012 223
476 3300035083 Ga0373926_0058903 Ga0373926_0058903_20_781 223
477 3300045049 Ga0466959_0050275 Ga0466959_0050275_2368_3039 223
478 3300046514 Ga0495618_0214576 Ga0495618_0214576_403_1092 223
479 3300046559 Ga0495667_0109447 Ga0495667_0109447_788_1477 223
480 3300046642 Ga0495634_0461204 Ga0495634_0461204_51_722 223
481 3300046679 Ga0495623_0240463 Ga0495623_0240463_123_812 223
482 3300047317 Ga0495604_0034954 Ga0495604_0034954_697_1386 223
483 3300047319 Ga0495674_0036983 Ga0495674_0036983_2954_3643 223
484 3300047444 Ga0495675_0227666 Ga0495675_0227666_396_1085 223
485 3300047471 Ga0495684_0254644 Ga0495684_0254644_532_1203 223
486 3300048907 Ga0496104_0681297 Ga0496104_0681297_49_720 223
487 3300048908 Ga0496105_0415361 Ga0496105_0415361_205_876 223
488 3300048918 Ga0496115_0175492 Ga0496115_0175492_852_1523 223
489 3300006038 Ga0075365_10002593 Ga0075365_100025934 224
490 3300006844 Ga0075428_100082457 Ga0075428_1000824574 224
491 3300025912 Ga0207707_10450124 Ga0207707_104501241 224
492 3300045976 Ga0466967_0300066 Ga0466967_0300066_28_702 224
493 3300048907 Ga0496104_0189627 Ga0496104_0189627_738_1415 224
494 3300048915 Ga0496112_0016652 Ga0496112_0016652_1117_1794 224
495 3300048915 Ga0496112_0051244 Ga0496112_0051244_276_953 224
496 3300049569 Ga0501032_0028361 Ga0501032_0028361_2507_3250 224
497 3300049570 Ga0501033_0133672 Ga0501033_0133672_515_1258 224
498 3300049571 Ga0501034_0029177 Ga0501034_0029177_679_1422 224
499 3300049572 Ga0501036_0022863 Ga0501036_0022863_2820_3563 224
500 3300049573 Ga0501037_0018431 Ga0501037_0018431_4122_4865 224
501 3300049574 Ga0501038_0001411 Ga0501038_0001411_11587_12330 224
502 3300049575 Ga0501039_0188489 Ga0501039_0188489_660_1343 224
503 3300049576 Ga0501040_0194023 Ga0501040_0194023_76_759 224
504 3300049578 Ga0501042_0114176 Ga0501042_0114176_399_1082 224
505 3300049579 Ga0501043_0408040 Ga0501043_0408040_255_938 224
506 3300049581 Ga0501047_0004414 Ga0501047_0004414_11592_12335 224
507 3300049588 Ga0501072_0124490 Ga0501072_0124490_908_1591 224
508 3300049589 Ga0501073_0226931 Ga0501073_0226931_494_1237 224
509 3300049592 Ga0501076_0456106 Ga0501076_0456106_73_756 224
510 3300049822 Ga0501035_0010212 Ga0501035_0010212_1570_2313 224
511 3300049823 Ga0501044_0024097 Ga0501044_0024097_32_775 224
512 3300050492 nmdc:mga0yw44_746_c1 nmdc:mga0yw44_746_c1_7068_7751 224
513 iso_pu_bacteria 2576861424 2578337164 224
514 iso_pu_bacteria 2600255286 2601637815 224
515 iso_pu_bacteria 2971511577 2971511639 224
516 iso_pu_bacteria 2980176882 2980182051 224
517 3300025981 Ga0207640_10885556 Ga0207640_108855561 225
518 3300045049 Ga0466959_0416024 Ga0466959_0416024_92_790 225
519 3300045836 Ga0466958_0028047 Ga0466958_0028047_718_1416 225
520 3300047320 Ga0495672_0096930 Ga0495672_0096930_65_751 225
521 3300048913 Ga0496110_0540906 Ga0496110_0540906_326_1006 225
522 3300053080 Ga0500635_0142687 Ga0500635_0142687_39_725 225
523 3300053133 Ga0500655_054436 Ga0500655_054436_84_770 225
524 3300053150 Ga0500603_135235 Ga0500603_135235_19_705 225
525 3300048905 Ga0496102_0671372 Ga0496102_0671372_24_704 226
526 3300054114 Ga0501084_0589844 Ga0501084_0589844_55_753 226
527 3300006038 Ga0075365_10002498 Ga0075365_1000249811 227
528 3300006186 Ga0075369_10111481 Ga0075369_101114812 227
529 3300046461 Ga0495641_0131012 Ga0495641_0131012_405_1100 227
530 3300006175 Ga0070712_100129790 Ga0070712_1001297902 228
531 3300009093 Ga0105240_10037358 Ga0105240_100373585 228
532 3300009098 Ga0105245_10051192 Ga0105245_100511923 228
533 3300009545 Ga0105237_10084955 Ga0105237_100849552 228
534 3300009551 Ga0105238_10033763 Ga0105238_100337632 228
535 3300010375 Ga0105239_10542585 Ga0105239_105425851 228
536 3300010375 Ga0105239_11017153 Ga0105239_110171532 228
537 3300013105 Ga0157369_10106512 Ga0157369_101065123 228
538 3300013307 Ga0157372_10037050 Ga0157372_100370502 228
539 3300014745 Ga0157377_10028872 Ga0157377_100288722 228
540 3300025915 Ga0207693_10121398 Ga0207693_101213982 228
541 3300025929 Ga0207664_10204092 Ga0207664_102040922 228
542 3300044658 Ga0466972_0213377 Ga0466972_0213377_94_789 228
543 3300044694 Ga0466963_0001004 Ga0466963_0001004_11359_12054 228
544 3300044842 Ga0466957_0418923 Ga0466957_0418923_63_758 228
545 3300044901 Ga0466960_0074590 Ga0466960_0074590_285_980 228
546 3300045976 Ga0466967_0001608 Ga0466967_0001608_6546_7241 228
547 3300048903 Ga0496100_0009970 Ga0496100_0009970_2020_2715 228
548 3300048904 Ga0496101_0003395 Ga0496101_0003395_2349_3044 228
549 3300048907 Ga0496104_0048838 Ga0496104_0048838_569_1264 228
550 3300048909 Ga0496106_0012196 Ga0496106_0012196_5045_5740 228
551 3300048910 Ga0496107_0016640 Ga0496107_0016640_2491_3186 228
552 3300048911 Ga0496108_0014544 Ga0496108_0014544_4267_4962 228
553 3300048912 Ga0496109_0033180 Ga0496109_0033180_2100_2795 228
554 3300048914 Ga0496111_0014466 Ga0496111_0014466_3459_4154 228
555 3300048915 Ga0496112_0106534 Ga0496112_0106534_589_1284 228
556 3300048917 Ga0496114_0002377 Ga0496114_0002377_7316_8011 228
557 3300048918 Ga0496115_0022593 Ga0496115_0022593_1516_2211 228
558 3300048927 Ga0496124_0083478 Ga0496124_0083478_716_1420 228
559 3300049583 Ga0501067_0004983 Ga0501067_0004983_2987_3682 228
560 3300049585 Ga0501069_0003084 Ga0501069_0003084_111_806 228
561 3300050512 nmdc:mga0n895_130027_c1 nmdc:mga0n895_130027_c1_83_778 228
562 3300050514 nmdc:mga08x19_7683_c1 nmdc:mga08x19_7683_c1_415_1110 228
563 3300050515 nmdc:mga0a205_62866_c1 nmdc:mga0a205_62866_c1_2712_3407 228
564 3300037312 Ga0395899_0049006 Ga0395899_0049006_1105_1851 231
565 3300037418 Ga0395900_0030791 Ga0395900_0030791_2360_3106 231
566 3300037466 Ga0395898_0110391 Ga0395898_0110391_916_1662 231
567 3300037471 Ga0395905_0025393 Ga0395905_0025393_2207_2953 231
568 3300038443 Ga0395901_0301708 Ga0395901_0301708_895_1641 231
569 3300050507 nmdc:mga05p37_125501_c1 nmdc:mga05p37_125501_c1_2214_3008 231
570 iso_pu_bacteria 2643221561 2643827666 231
571 iso_pu_bacteria 2643221696 2644534918 231
572 3300005548 Ga0070665_100341705 Ga0070665_1003417052 232
573 3300005618 Ga0068864_100197285 Ga0068864_1001972853 232
574 3300005841 Ga0068863_100012869 Ga0068863_1000128694 232
575 3300014325 Ga0163163_10057861 Ga0163163_100578613 232
576 3300028379 Ga0268266_10176800 Ga0268266_101768003 232
577 3300046499 Ga0495594_0061561 Ga0495594_0061561_30_734 232
578 3300046694 Ga0495649_0174188 Ga0495649_0174188_14_724 232
579 iso_pu_bacteria 2643221615 2644091530 232
580 iso_pu_bacteria 2643221657 2644321333 232
581 3300005563 Ga0068855_100163274 Ga0068855_1001632742 234
582 3300010375 Ga0105239_10015690 Ga0105239_100156904 234
583 3300025909 Ga0207705_10237154 Ga0207705_102371542 234
584 3300038443 Ga0395901_0304985 Ga0395901_0304985_500_1219 234
585 3300044658 Ga0466972_0016907 Ga0466972_0016907_1496_2227 234
586 3300044683 Ga0466965_0142777 Ga0466965_0142777_14_718 234
587 3300044765 Ga0466970_0034147 Ga0466970_0034147_1135_1866 234
588 3300044901 Ga0466960_0015523 Ga0466960_0015523_1644_2360 234
589 3300045049 Ga0466959_0183669 Ga0466959_0183669_152_907 234
590 3300006038 Ga0075365_10039757 Ga0075365_100397574 235
591 3300006038 Ga0075365_10120011 Ga0075365_101200112 235
592 3300006048 Ga0075363_100033187 Ga0075363_1000331872 235
593 3300020069 Ga0197907_10860015 Ga0197907_108600151 235
594 3300020070 Ga0206356_11782609 Ga0206356_117826092 235
595 3300020081 Ga0206354_11178818 Ga0206354_111788182 235
596 3300020082 Ga0206353_10100660 Ga0206353_101006609 235
597 3300025944 Ga0207661_10198017 Ga0207661_101980172 235
598 3300037418 Ga0395900_0122675 Ga0395900_0122675_1713_2450 235
599 3300037466 Ga0395898_0203763 Ga0395898_0203763_1105_1851 235
600 3300037466 Ga0395898_0233971 Ga0395898_0233971_452_1189 235
601 3300037471 Ga0395905_0004534 Ga0395905_0004534_13619_14344 235
602 3300044656 Ga0466969_0154633 Ga0466969_0154633_13_750 235
603 3300044694 Ga0466963_0013066 Ga0466963_0013066_85_828 235
604 3300044694 Ga0466963_0063820 Ga0466963_0063820_1613_2356 235
605 3300044694 Ga0466963_0150169 Ga0466963_0150169_418_1164 235
606 3300044719 Ga0466971_0193155 Ga0466971_0193155_19_765 235
607 3300044735 Ga0466968_0018631 Ga0466968_0018631_1306_2052 235
608 3300044765 Ga0466970_0092599 Ga0466970_0092599_214_963 235
609 3300044765 Ga0466970_0244643 Ga0466970_0244643_217_939 235
610 3300044901 Ga0466960_0062821 Ga0466960_0062821_140_883 235
611 3300044901 Ga0466960_0314518 Ga0466960_0314518_110_865 235
612 3300045049 Ga0466959_0039510 Ga0466959_0039510_2028_2774 235
613 3300045049 Ga0466959_0156111 Ga0466959_0156111_312_1058 235
614 3300045049 Ga0466959_0212991 Ga0466959_0212991_551_1297 235
615 3300045049 Ga0466959_0352142 Ga0466959_0352142_34_756 235
616 3300045976 Ga0466967_0017214 Ga0466967_0017214_2399_3133 235
617 3300045976 Ga0466967_0163423 Ga0466967_0163423_687_1433 235
618 3300046461 Ga0495641_0054335 Ga0495641_0054335_673_1380 235
619 3300046473 Ga0495582_0033385 Ga0495582_0033385_1008_1715 235
620 3300048907 Ga0496104_0164726 Ga0496104_0164726_415_1137 235
621 3300049583 Ga0501067_0102813 Ga0501067_0102813_576_1298 235
622 3300049742 Ga0501080_0707807 Ga0501080_0707807_151_873 235
623 3300050492 nmdc:mga0yw44_411809_c1 nmdc:mga0yw44_411809_c1_20_754 235
624 3300061719 Ga0466962_0216167 Ga0466962_0216167_170_916 235
625 iso_pu_bacteria 2857481737 2857485408 235
626 3300001979 JGI24740J21852_10030464 JGI24740J21852_100304641 236
627 3300002067 JGI24735J21928_10039867 JGI24735J21928_100398672 236
628 3300005327 Ga0070658_10072444 Ga0070658_100724443 236
629 3300005329 Ga0070683_100001398 Ga0070683_1000013987 236
630 3300005329 Ga0070683_100177228 Ga0070683_1001772282 236
631 3300005334 Ga0068869_100389611 Ga0068869_1003896112 236
632 3300005337 Ga0070682_100044716 Ga0070682_1000447162 236
633 3300005337 Ga0070682_100090767 Ga0070682_1000907673 236
634 3300005338 Ga0068868_100135729 Ga0068868_1001357292 236
635 3300005339 Ga0070660_100099906 Ga0070660_1000999062 236
636 3300005339 Ga0070660_100193937 Ga0070660_1001939372 236
637 3300005366 Ga0070659_100021855 Ga0070659_1000218554 236
638 3300005366 Ga0070659_100205406 Ga0070659_1002054062 236
639 3300005367 Ga0070667_100222972 Ga0070667_1002229722 236
640 3300005458 Ga0070681_10088284 Ga0070681_100882842 236
641 3300005530 Ga0070679_100007581 Ga0070679_1000075818 236
642 3300005530 Ga0070679_100177120 Ga0070679_1001771203 236
643 3300005535 Ga0070684_100028739 Ga0070684_1000287393 236
644 3300005535 Ga0070684_100062194 Ga0070684_1000621942 236
645 3300005535 Ga0070684_100078482 Ga0070684_1000784822 236
646 3300005548 Ga0070665_100000606 Ga0070665_1000006065 236
647 3300005548 Ga0070665_100220582 Ga0070665_1002205823 236
648 3300005548 Ga0070665_100609893 Ga0070665_1006098932 236
649 3300005564 Ga0070664_100190809 Ga0070664_1001908092 236
650 3300005577 Ga0068857_100050660 Ga0068857_1000506603 236
651 3300005577 Ga0068857_100438709 Ga0068857_1004387092 236
652 3300005614 Ga0068856_100049227 Ga0068856_1000492272 236
653 3300005615 Ga0070702_100183201 Ga0070702_1001832012 236
654 3300005615 Ga0070702_100189326 Ga0070702_1001893261 236
655 3300005616 Ga0068852_100146478 Ga0068852_1001464782 236
656 3300005616 Ga0068852_100268834 Ga0068852_1002688342 236
657 3300005719 Ga0068861_100012663 Ga0068861_1000126632 236
658 3300005719 Ga0068861_100329691 Ga0068861_1003296912 236
659 3300005841 Ga0068863_100101492 Ga0068863_1001014922 236
660 3300005843 Ga0068860_100004939 Ga0068860_1000049399 236
661 3300005843 Ga0068860_100145433 Ga0068860_1001454332 236
662 3300006038 Ga0075365_10013292 Ga0075365_100132925 236
663 3300006038 Ga0075365_10025219 Ga0075365_100252192 236
664 3300006038 Ga0075365_10028760 Ga0075365_100287602 236
665 3300006038 Ga0075365_10043437 Ga0075365_100434373 236
666 3300006038 Ga0075365_10049405 Ga0075365_100494052 236
667 3300006038 Ga0075365_10110747 Ga0075365_101107472 236
668 3300006038 Ga0075365_10181532 Ga0075365_101815322 236
669 3300006042 Ga0075368_10000787 Ga0075368_100007873 236
670 3300006042 Ga0075368_10001808 Ga0075368_100018084 236
671 3300006042 Ga0075368_10184297 Ga0075368_101842971 236
672 3300006048 Ga0075363_100001556 Ga0075363_1000015566 236
673 3300006048 Ga0075363_100016538 Ga0075363_1000165382 236
674 3300006048 Ga0075363_100031177 Ga0075363_1000311772 236
675 3300006048 Ga0075363_100046692 Ga0075363_1000466922 236
676 3300006048 Ga0075363_100059210 Ga0075363_1000592102 236
677 3300006051 Ga0075364_10023355 Ga0075364_100233552 236
678 3300006051 Ga0075364_10029727 Ga0075364_100297271 236
679 3300006051 Ga0075364_10034908 Ga0075364_100349084 236
680 3300006051 Ga0075364_10051396 Ga0075364_100513962 236
681 3300006051 Ga0075364_10115458 Ga0075364_101154582 236
682 3300006051 Ga0075364_10203960 Ga0075364_102039602 236
683 3300006178 Ga0075367_10004044 Ga0075367_100040443 236
684 3300006178 Ga0075367_10018252 Ga0075367_100182524 236
685 3300006178 Ga0075367_10135628 Ga0075367_101356282 236
686 3300006178 Ga0075367_10163715 Ga0075367_101637152 236
687 3300006353 Ga0075370_10003503 Ga0075370_100035036 236
688 3300006353 Ga0075370_10005399 Ga0075370_100053992 236
689 3300006353 Ga0075370_10012237 Ga0075370_100122372 236
690 3300006353 Ga0075370_10152029 Ga0075370_101520292 236
691 3300006844 Ga0075428_100068912 Ga0075428_1000689123 236
692 3300006844 Ga0075428_100192794 Ga0075428_1001927942 236
693 3300006844 Ga0075428_100257779 Ga0075428_1002577792 236
694 3300006880 Ga0075429_100131704 Ga0075429_1001317042 236
695 3300009094 Ga0111539_10055190 Ga0111539_100551903 236
696 3300009098 Ga0105245_10013028 Ga0105245_100130286 236
697 3300009098 Ga0105245_10016541 Ga0105245_100165416 236
698 3300009148 Ga0105243_10045271 Ga0105243_100452716 236
699 3300009148 Ga0105243_10130425 Ga0105243_101304252 236
700 3300009174 Ga0105241_10563474 Ga0105241_105634741 236
701 3300009545 Ga0105237_10114878 Ga0105237_101148783 236
702 3300009553 Ga0105249_10118507 Ga0105249_101185072 236
703 3300010375 Ga0105239_10088214 Ga0105239_100882144 236
704 3300010375 Ga0105239_10586379 Ga0105239_105863792 236
705 3300010375 Ga0105239_11139124 Ga0105239_111391241 236
706 3300011119 Ga0105246_10042792 Ga0105246_100427923 236
707 3300013105 Ga0157369_10105097 Ga0157369_101050972 236
708 3300013296 Ga0157374_10177972 Ga0157374_101779722 236
709 3300013306 Ga0163162_11033150 Ga0163162_110331501 236
710 3300013307 Ga0157372_10003630 Ga0157372_100036308 236
711 3300013307 Ga0157372_10118962 Ga0157372_101189624 236
712 3300013308 Ga0157375_10032119 Ga0157375_100321192 236
713 3300013308 Ga0157375_10104454 Ga0157375_101044543 236
714 3300014325 Ga0163163_10054312 Ga0163163_100543122 236
715 3300014325 Ga0163163_10057376 Ga0163163_100573766 236
716 3300014325 Ga0163163_10219473 Ga0163163_102194732 236
717 3300014325 Ga0163163_10329415 Ga0163163_103294152 236
718 3300014497 Ga0182008_10115104 Ga0182008_101151041 236
719 3300014968 Ga0157379_10131725 Ga0157379_101317252 236
720 3300015688 Ga0183367_1010 Ga0183367_1010296 236
721 3300017792 Ga0163161_10333526 Ga0163161_103335262 236
722 3300020082 Ga0206353_10113132 Ga0206353_101131321 236
723 3300025297 Ga0209758_1006866 Ga0209758_10068664 236
724 3300025901 Ga0207688_10116111 Ga0207688_101161111 236
725 3300025904 Ga0207647_10024844 Ga0207647_100248441 236
726 3300025904 Ga0207647_10119706 Ga0207647_101197062 236
727 3300025909 Ga0207705_10265401 Ga0207705_102654012 236
728 3300025909 Ga0207705_10470546 Ga0207705_104705462 236
729 3300025912 Ga0207707_10099380 Ga0207707_100993802 236
730 3300025919 Ga0207657_10014605 Ga0207657_100146053 236
731 3300025919 Ga0207657_10466087 Ga0207657_104660872 236
732 3300025921 Ga0207652_10018333 Ga0207652_100183334 236
733 3300025921 Ga0207652_10452277 Ga0207652_104522772 236
734 3300025927 Ga0207687_10006661 Ga0207687_100066616 236
735 3300025932 Ga0207690_10017620 Ga0207690_100176203 236
736 3300025932 Ga0207690_10158099 Ga0207690_101580992 236
737 3300025935 Ga0207709_10072287 Ga0207709_100722873 236
738 3300025938 Ga0207704_10397920 Ga0207704_103979202 236
739 3300025940 Ga0207691_10583397 Ga0207691_105833971 236
740 3300025944 Ga0207661_10010691 Ga0207661_100106917 236
741 3300025945 Ga0207679_10213334 Ga0207679_102133342 236
742 3300025961 Ga0207712_10199038 Ga0207712_101990382 236
743 3300025986 Ga0207658_10044226 Ga0207658_100442263 236
744 3300026023 Ga0207677_10084067 Ga0207677_100840672 236
745 3300026067 Ga0207678_10242930 Ga0207678_102429303 236
746 3300026078 Ga0207702_10058818 Ga0207702_100588185 236
747 3300026088 Ga0207641_10083296 Ga0207641_100832962 236
748 3300026116 Ga0207674_10064533 Ga0207674_100645333 236
749 3300026116 Ga0207674_10598818 Ga0207674_105988182 236
750 3300026116 Ga0207674_10860340 Ga0207674_108603401 236
751 3300027866 Ga0209813_10000655 Ga0209813_100006556 236
752 3300027866 Ga0209813_10018905 Ga0209813_100189052 236
753 3300028379 Ga0268266_10001445 Ga0268266_1000144515 236
754 3300028379 Ga0268266_10189044 Ga0268266_101890442 236
755 3300028379 Ga0268266_10199074 Ga0268266_101990741 236
756 3300028381 Ga0268264_10361836 Ga0268264_103618361 236
757 3300031241 Ga0265325_10022060 Ga0265325_100220602 236
758 3300031249 Ga0265339_10100581 Ga0265339_101005812 236
759 3300031595 Ga0265313_10030991 Ga0265313_100309913 236
760 3300031731 Ga0307405_10020553 Ga0307405_100205532 236
761 3300031852 Ga0307410_10151679 Ga0307410_101516791 236
762 3300031852 Ga0307410_10275338 Ga0307410_102753382 236
763 3300031852 Ga0307410_10731037 Ga0307410_107310371 236
764 3300031903 Ga0307407_10042566 Ga0307407_100425662 236
765 3300031911 Ga0307412_10103488 Ga0307412_101034882 236
766 3300031995 Ga0307409_100006011 Ga0307409_1000060112 236
767 3300031995 Ga0307409_100142136 Ga0307409_1001421362 236
768 3300031995 Ga0307409_100342641 Ga0307409_1003426412 236
769 3300031995 Ga0307409_100868708 Ga0307409_1008687081 236
770 3300032002 Ga0307416_100000221 Ga0307416_10000022126 236
771 3300032002 Ga0307416_100766571 Ga0307416_1007665711 236
772 3300032126 Ga0307415_100000455 Ga0307415_1000004557 236
773 3300032126 Ga0307415_100077285 Ga0307415_1000772852 236
774 3300032126 Ga0307415_100114766 Ga0307415_1001147662 236
775 3300035112 Ga0373932_0096425 Ga0373932_0096425_90_821 236
776 3300035207 Ga0373942_0110937 Ga0373942_0110937_97_828 236
777 3300037418 Ga0395900_0125710 Ga0395900_0125710_915_1640 236
778 3300037466 Ga0395898_0043916 Ga0395898_0043916_3586_4341 236
779 3300038443 Ga0395901_0128825 Ga0395901_0128825_512_1252 236
780 3300044683 Ga0466965_0018571 Ga0466965_0018571_712_1440 236
781 3300044683 Ga0466965_0024379 Ga0466965_0024379_1653_2405 236
782 3300044694 Ga0466963_0016836 Ga0466963_0016836_2639_3349 236
783 3300044694 Ga0466963_0292434 Ga0466963_0292434_387_1097 236
784 3300044706 Ga0466964_0225495 Ga0466964_0225495_19_729 236
785 3300044765 Ga0466970_0023123 Ga0466970_0023123_1162_1914 236
786 3300044842 Ga0466957_0026854 Ga0466957_0026854_113_865 236
787 3300044901 Ga0466960_0034517 Ga0466960_0034517_1468_2199 236
788 3300044901 Ga0466960_0062407 Ga0466960_0062407_1048_1779 236
789 3300045976 Ga0466967_0003756 Ga0466967_0003756_6684_7424 236
790 3300045976 Ga0466967_0056887 Ga0466967_0056887_231_941 236
791 3300045976 Ga0466967_0125229 Ga0466967_0125229_580_1290 236
792 3300046461 Ga0495641_0137199 Ga0495641_0137199_266_982 236
793 3300046461 Ga0495641_0209925 Ga0495641_0209925_49_783 236
794 3300046663 Ga0495635_0157853 Ga0495635_0157853_388_1113 236
795 3300046663 Ga0495635_0220097 Ga0495635_0220097_416_1144 236
796 3300048903 Ga0496100_0153190 Ga0496100_0153190_515_1246 236
797 3300048904 Ga0496101_0053137 Ga0496101_0053137_2023_2754 236
798 3300048905 Ga0496102_0016004 Ga0496102_0016004_1613_2323 236
799 3300048905 Ga0496102_0135297 Ga0496102_0135297_1289_2065 236
800 3300048905 Ga0496102_0162939 Ga0496102_0162939_883_1593 236
801 3300048905 Ga0496102_0548759 Ga0496102_0548759_91_822 236
802 3300048906 Ga0496103_0016086 Ga0496103_0016086_2221_2952 236
803 3300048906 Ga0496103_0027563 Ga0496103_0027563_280_990 236
804 3300048906 Ga0496103_0221477 Ga0496103_0221477_132_908 236
805 3300048907 Ga0496104_0418304 Ga0496104_0418304_388_1119 236
806 3300048909 Ga0496106_0034894 Ga0496106_0034894_2789_3520 236
807 3300048910 Ga0496107_0196684 Ga0496107_0196684_520_1230 236
808 3300048911 Ga0496108_0038858 Ga0496108_0038858_3081_3812 236
809 3300048911 Ga0496108_0090774 Ga0496108_0090774_300_1010 236
810 3300048912 Ga0496109_0293617 Ga0496109_0293617_393_1124 236
811 3300048912 Ga0496109_0365111 Ga0496109_0365111_92_802 236
812 3300048913 Ga0496110_0031715 Ga0496110_0031715_816_1526 236
813 3300048913 Ga0496110_0475743 Ga0496110_0475743_249_974 236
814 3300048914 Ga0496111_0003428 Ga0496111_0003428_1921_2631 236
815 3300048915 Ga0496112_0003202 Ga0496112_0003202_5669_6415 236
816 3300048915 Ga0496112_0018621 Ga0496112_0018621_982_1728 236
817 3300048916 Ga0496113_0161877 Ga0496113_0161877_543_1289 236
818 3300048916 Ga0496113_0324352 Ga0496113_0324352_377_1108 236
819 3300048917 Ga0496114_0031017 Ga0496114_0031017_311_1036 236
820 3300048922 Ga0496119_0000055 Ga0496119_0000055_161738_162514 236
821 3300048923 Ga0496120_0033598 Ga0496120_0033598_1389_2165 236
822 3300049568 Ga0501031_0000752 Ga0501031_0000752_15367_16110 236
823 3300049569 Ga0501032_0002341 Ga0501032_0002341_9798_10541 236
824 3300049570 Ga0501033_0001065 Ga0501033_0001065_4422_5165 236
825 3300049571 Ga0501034_0027325 Ga0501034_0027325_2439_3182 236
826 3300049571 Ga0501034_0029851 Ga0501034_0029851_192_920 236
827 3300049572 Ga0501036_0000867 Ga0501036_0000867_6052_6795 236
828 3300049572 Ga0501036_0174250 Ga0501036_0174250_790_1518 236
829 3300049573 Ga0501037_0010476 Ga0501037_0010476_1593_2336 236
830 3300049574 Ga0501038_0000675 Ga0501038_0000675_18191_18934 236
831 3300049574 Ga0501038_0099140 Ga0501038_0099140_382_1092 236
832 3300049575 Ga0501039_0001531 Ga0501039_0001531_5874_6617 236
833 3300049575 Ga0501039_0106664 Ga0501039_0106664_471_1181 236
834 3300049576 Ga0501040_0084886 Ga0501040_0084886_1420_2163 236
835 3300049577 Ga0501041_0040277 Ga0501041_0040277_942_1652 236
836 3300049578 Ga0501042_0014307 Ga0501042_0014307_3181_3924 236
837 3300049579 Ga0501043_0002968 Ga0501043_0002968_11591_12334 236
838 3300049580 Ga0501046_0007097 Ga0501046_0007097_5902_6645 236
839 3300049581 Ga0501047_0029239 Ga0501047_0029239_2439_3182 236
840 3300049582 Ga0501048_0001346 Ga0501048_0001346_15495_16238 236
841 3300049583 Ga0501067_0004646 Ga0501067_0004646_1254_1997 236
842 3300049583 Ga0501067_0035724 Ga0501067_0035724_976_1686 236
843 3300049583 Ga0501067_0146652 Ga0501067_0146652_230_940 236
844 3300049584 Ga0501068_0018161 Ga0501068_0018161_140_877 236
845 3300049585 Ga0501069_0000486 Ga0501069_0000486_12360_13070 236
846 3300049585 Ga0501069_0001048 Ga0501069_0001048_10681_11424 236
847 3300049586 Ga0501070_0008158 Ga0501070_0008158_1806_2549 236
848 3300049586 Ga0501070_0058761 Ga0501070_0058761_2156_2866 236
849 3300049587 Ga0501071_0063746 Ga0501071_0063746_138_881 236
850 3300049588 Ga0501072_0037972 Ga0501072_0037972_1426_2136 236
851 3300049589 Ga0501073_0125320 Ga0501073_0125320_146_874 236
852 3300049590 Ga0501074_0000833 Ga0501074_0000833_3378_4121 236
853 3300049590 Ga0501074_0004359 Ga0501074_0004359_9254_9964 236
854 3300049590 Ga0501074_0014170 Ga0501074_0014170_3051_3761 236
855 3300049592 Ga0501076_0792511 Ga0501076_0792511_42_752 236
856 3300049593 Ga0501077_0079251 Ga0501077_0079251_660_1388 236
857 3300049656 Ga0501209_112440 Ga0501209_112440_52_783 236
858 3300049741 Ga0501079_0370950 Ga0501079_0370950_62_790 236
859 3300049742 Ga0501080_0005335 Ga0501080_0005335_5670_6413 236
860 3300049742 Ga0501080_0046143 Ga0501080_0046143_652_1362 236
861 3300049744 Ga0501083_0027945 Ga0501083_0027945_1933_2676 236
862 3300049744 Ga0501083_0069875 Ga0501083_0069875_1612_2322 236
863 3300049822 Ga0501035_0002522 Ga0501035_0002522_11468_12211 236
864 3300049823 Ga0501044_0043242 Ga0501044_0043242_2133_2876 236
865 3300050490 nmdc:mga03n38_1320_c1 nmdc:mga03n38_1320_c1_940_1668 236
866 3300050490 nmdc:mga03n38_148739_c1 nmdc:mga03n38_148739_c1_194_922 236
867 3300050490 nmdc:mga03n38_216782_c1 nmdc:mga03n38_216782_c1_156_896 236
868 3300050490 nmdc:mga03n38_281064_c1 nmdc:mga03n38_281064_c1_51_779 236
869 3300050491 nmdc:mga00v17_113448_c1 nmdc:mga00v17_113448_c1_415_1158 236
870 3300050491 nmdc:mga00v17_15144_c1 nmdc:mga00v17_15144_c1_1058_1783 236
871 3300050491 nmdc:mga00v17_17946_c2 nmdc:mga00v17_17946_c2_431_1159 236
872 3300050491 nmdc:mga00v17_203894_c1 nmdc:mga00v17_203894_c1_187_915 236
873 3300050491 nmdc:mga00v17_72469_c1 nmdc:mga00v17_72469_c1_716_1444 236
874 3300050492 nmdc:mga0yw44_101340_c1 nmdc:mga0yw44_101340_c1_1032_1742 236
875 3300050492 nmdc:mga0yw44_14440_c1 nmdc:mga0yw44_14440_c1_1592_2320 236
876 3300050492 nmdc:mga0yw44_3123_c1 nmdc:mga0yw44_3123_c1_233_943 236
877 3300050492 nmdc:mga0yw44_393927_c1 nmdc:mga0yw44_393927_c1_102_830 236
878 3300050492 nmdc:mga0yw44_406627_c1 nmdc:mga0yw44_406627_c1_100_825 236
879 3300050492 nmdc:mga0yw44_53656_c1 nmdc:mga0yw44_53656_c1_793_1518 236
880 3300050492 nmdc:mga0yw44_91179_c1 nmdc:mga0yw44_91179_c1_1137_1847 236
881 3300050492 nmdc:mga0yw44_9146_c1 nmdc:mga0yw44_9146_c1_1697_2410 236
882 3300050494 nmdc:mga06z11_152480_c1 nmdc:mga06z11_152480_c1_419_1147 236
883 3300050494 nmdc:mga06z11_2345_c1 nmdc:mga06z11_2345_c1_1151_1879 236
884 3300050495 nmdc:mga04h51_15119_c1 nmdc:mga04h51_15119_c1_1276_2001 236
885 3300050496 nmdc:mga07m45_134999_c1 nmdc:mga07m45_134999_c1_650_1378 236
886 3300050496 nmdc:mga07m45_13854_c1 nmdc:mga07m45_13854_c1_1595_2320 236
887 3300050496 nmdc:mga07m45_147052_c1 nmdc:mga07m45_147052_c1_548_1273 236
888 3300050496 nmdc:mga07m45_4164_c1 nmdc:mga07m45_4164_c1_6208_6936 236
889 3300050496 nmdc:mga07m45_75985_c1 nmdc:mga07m45_75985_c1_1029_1757 236
890 3300050507 nmdc:mga05p37_153476_c1 nmdc:mga05p37_153476_c1_702_1451 236
891 3300050511 nmdc:mga08y16_488886_c1 nmdc:mga08y16_488886_c1_410_1141 236
892 3300053085 Ga0495619_0135319 Ga0495619_0135319_763_1494 236
893 3300053088 Ga0500644_0000143 Ga0500644_0000143_26871_27596 236
894 3300053104 Ga0500556_0000502 Ga0500556_0000502_9169_9879 236
895 3300053117 Ga0500593_000518 Ga0500593_000518_14274_14984 236
896 3300053139 Ga0500568_0056513 Ga0500568_0056513_370_1200 236
897 3300053140 Ga0500573_0030579 Ga0500573_0030579_441_1169 236
898 3300053140 Ga0500573_0038905 Ga0500573_0038905_1899_2609 236
899 3300054114 Ga0501084_0003690 Ga0501084_0003690_5027_5770 236
900 3300060353 Ga0501082_0271445 Ga0501082_0271445_441_1184 236
901 3300061734 Ga0530510_0260945 Ga0530510_0260945_420_1130 236
902 iso_pu_bacteria 2728369276 2729904885 236
903 iso_pu_bacteria 2773857759 2774384022 236
904 iso_pu_bacteria 2784746768 2785367233 236
905 iso_pu_bacteria 2795385472 2795796036 236
906 iso_pu_bacteria 2852635781 2852637797 236
907 iso_pu_bacteria 2855386786 2855390519 236
908 iso_pu_bacteria 2912723979 2912726033 236
909 iso_pu_bacteria 2947224130 2947231744 236
910 iso_pu_bacteria 2977251589 2977254450 236
911 iso_pu_bacteria 3006393351 3006399471 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

53

163

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

198

272

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ftk-assembly2.cif.gz_H berylloflouride spo0f complex with spo0b 0.9757 11 125
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9726 11 127
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9688 12 128
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9687 12 128
2pmu-assembly1.cif.gz_C crystal structure of the dna-binding domain of phop 0.9676 138 233
ID Description Score Start End Superfamily
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9967 10 90 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9846 10 90 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9779 11 90 3.40.50.2300
af_L7N689_150_256_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9749 139 234 1.10.10.10
af_O07776_147_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9739 139 233 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y5WFG4-F1-model_v4 Response regulator transcription factor 0.977 3 130 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-G2FSB7-F1-model_v4 Stage 0 sporulation protein A homolog 0.9747 10 133 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A7G3D9R8-F1-model_v4 deleted 0.9743 2 130
AF-N0E2E3-F1-model_v4 Response regulatory domain-containing protein 0.9616 2 136 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2T3FE36-F1-model_v4 Stage 0 sporulation protein A homolog 0.9322 26 232 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
89.37 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map