F485486
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 911 | 405 | 841 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0056513|Ga0500568_0056513_370_1200 |
| Length | 276 |
| Sequence | MPARLDQQPVLDLCAGAGKPVHRKPTAKSRRVEAMSSTEALQLTRPDGSPLRVLVVDDEVNIAELIGMALRYEGWQVNTAHTGTSAVNAAKDVRPDAVVLDMMLPDIDGMEVLRRMRGTQPDVPVVFLTAKDAVEDRIAGLTAGGDDYVTKPFSLEELVARLRALMRRAGAQRVQSSSVLAVGDLELDEDSHEVSRGGEPIMLTATEFELLRFLMRNPRRVLSKAQILDRVWNYDFGGQANVVELYISYLRKKVDAGREPMIHTMRGAGYVLKPAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 2 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 3 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 4 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 5 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 6 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 7 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 8 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 9 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 10 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 11 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 12 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 13 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 14 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 15 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 16 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 17 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 18 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 19 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 20 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 21 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 22 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 23 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 24 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 25 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 26 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 27 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 28 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 29 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 30 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 31 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 32 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 33 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 34 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 35 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 36 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 37 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 38 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 39 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 40 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 41 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 42 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 43 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 44 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 45 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 46 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 47 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 48 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 49 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 50 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 51 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 52 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 53 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 54 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 55 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 56 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 57 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 58 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 59 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 60 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 61 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 62 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 63 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 64 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 65 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 66 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 67 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 68 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 69 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 70 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 71 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 72 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 76 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 78 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 82 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 84 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 106 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 111 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 123 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 125 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 126 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 136 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 137 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 138 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 139 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 140 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 141 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 142 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 173 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 174 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 246 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 247 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 249 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 250 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 251 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 252 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 278 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 279 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 280 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 327 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 332 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 333 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 334 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 369 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 391 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 394 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 396 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 399 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 400 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 401 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 402 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 403 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 404 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 405 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.66 |
| Metatranscriptomes | 0.66 |
| Isolates | 7.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.83 |
| Nodule | 1.21 |
| Rhizoplane | 11.42 |
| Rhizosphere | 65.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10030464 | 3300001979 | Bacteria | 1754 |
| 2 | JGI24735J21928_10039867 | 3300002067 | Bacteria | 1372 |
| 3 | rootH2_10091126 | 3300003320 | Bacteria | 2105 |
| 4 | rootL2_10113871 | 3300003322 | Bacteria | 4821 |
| 5 | rootL2_10310571 | 3300003322 | Bacteria | 2291 |
| 6 | rootH1_10302260 | 3300003323 | Bacteria | 1618 |
| 7 | Ga0006562J51391_1000951 | 3300003578 | Bacteria | 9000 |
| 8 | Ga0055532_1002555 | 3300003758 | Bacteria | 3669 |
| 9 | Ga0055535_1001381 | 3300003761 | Bacteria | 12621 |
| 10 | Ga0055526_1050140 | 3300003771 | Bacteria | 959 |
| 11 | Ga0055524_1006468 | 3300003775 | Bacteria | 5078 |
| 12 | Ga0055524_1026783 | 3300003775 | Bacteria | 1771 |
| 13 | Ga0055528_1001799 | 3300003790 | Bacteria | 12294 |
| 14 | Ga0055528_1002733 | 3300003790 | Bacteria | 9246 |
| 15 | Ga0055528_1003910 | 3300003790 | Bacteria | 7317 |
| 16 | Ga0055540_1007921 | 3300003792 | Bacteria | 3911 |
| 17 | Ga0065165_1001643 | 3300005262 | Bacteria | 22733 |
| 18 | Ga0070658_10072444 | 3300005327 | Bacteria | 2823 |
| 19 | Ga0070683_100001398 | 3300005329 | Bacteria | 18519 |
| 20 | Ga0070683_100177228 | 3300005329 | Bacteria | 2024 |
| 21 | Ga0070670_100320646 | 3300005331 | Bacteria | 1358 |
| 22 | Ga0068869_100389611 | 3300005334 | Bacteria | 1144 |
| 23 | Ga0070682_100044716 | 3300005337 | Bacteria | 2742 |
| 24 | Ga0070682_100053384 | 3300005337 | Bacteria | 2533 |
| 25 | Ga0070682_100090767 | 3300005337 | Bacteria | 1998 |
| 26 | Ga0070682_100150477 | 3300005337 | Bacteria | 1596 |
| 27 | Ga0068868_100024281 | 3300005338 | Bacteria | 4598 |
| 28 | Ga0068868_100135729 | 3300005338 | Bacteria | 2016 |
| 29 | Ga0070660_100099906 | 3300005339 | Bacteria | 2298 |
| 30 | Ga0070660_100166576 | 3300005339 | Bacteria | 1778 |
| 31 | Ga0070660_100193937 | 3300005339 | Bacteria | 1646 |
| 32 | Ga0070660_100354405 | 3300005339 | Bacteria | 1209 |
| 33 | Ga0070689_100502596 | 3300005340 | Bacteria | 1039 |
| 34 | Ga0070691_10057368 | 3300005341 | Bacteria | 1868 |
| 35 | Ga0070668_100043923 | 3300005347 | Bacteria | 3427 |
| 36 | Ga0070671_100021523 | 3300005355 | Bacteria | 5266 |
| 37 | Ga0070671_100059731 | 3300005355 | Bacteria | 3173 |
| 38 | Ga0070671_100238271 | 3300005355 | Bacteria | 1544 |
| 39 | Ga0070674_100240561 | 3300005356 | Bacteria | 1417 |
| 40 | Ga0070659_100021855 | 3300005366 | Bacteria | 4879 |
| 41 | Ga0070659_100046567 | 3300005366 | Bacteria | 3400 |
| 42 | Ga0070659_100205406 | 3300005366 | Bacteria | 1622 |
| 43 | Ga0070667_100222972 | 3300005367 | Bacteria | 1679 |
| 44 | Ga0070667_100548481 | 3300005367 | Bacteria | 1062 |
| 45 | Ga0070709_10019568 | 3300005434 | Bacteria | 3916 |
| 46 | Ga0070709_10061181 | 3300005434 | Bacteria | 2396 |
| 47 | Ga0070709_10070867 | 3300005434 | Bacteria | 2248 |
| 48 | Ga0070709_10476318 | 3300005434 | Bacteria | 944 |
| 49 | Ga0070714_100008917 | 3300005435 | Bacteria | 7848 |
| 50 | Ga0070714_100085997 | 3300005435 | Bacteria | 2747 |
| 51 | Ga0070714_100123250 | 3300005435 | Bacteria | 2308 |
| 52 | Ga0070713_100049430 | 3300005436 | Bacteria | 3469 |
| 53 | Ga0070713_100247463 | 3300005436 | Bacteria | 1625 |
| 54 | Ga0070710_10001036 | 3300005437 | Bacteria | 13206 |
| 55 | Ga0070711_100057175 | 3300005439 | Bacteria | 2700 |
| 56 | Ga0070711_100178845 | 3300005439 | Bacteria | 1623 |
| 57 | Ga0070711_100210221 | 3300005439 | Bacteria | 1506 |
| 58 | Ga0070711_100462342 | 3300005439 | Bacteria | 1040 |
| 59 | Ga0070700_100433488 | 3300005441 | Bacteria | 996 |
| 60 | Ga0070694_100046393 | 3300005444 | Bacteria | 2917 |
| 61 | Ga0070663_100164502 | 3300005455 | Bacteria | 1710 |
| 62 | Ga0070662_100109898 | 3300005457 | Bacteria | 2098 |
| 63 | Ga0070662_100321813 | 3300005457 | Unclassified | 1261 |
| 64 | Ga0070681_10051905 | 3300005458 | Bacteria | 4090 |
| 65 | Ga0070681_10088284 | 3300005458 | Bacteria | 3052 |
| 66 | Ga0070681_10717680 | 3300005458 | Bacteria | 916 |
| 67 | Ga0070706_100523643 | 3300005467 | Bacteria | 1103 |
| 68 | Ga0070707_100420649 | 3300005468 | Bacteria | 1297 |
| 69 | Ga0070698_100013398 | 3300005471 | Bacteria | 8678 |
| 70 | Ga0070679_100007581 | 3300005530 | Bacteria | 10152 |
| 71 | Ga0070679_100081739 | 3300005530 | Bacteria | 3220 |
| 72 | Ga0070679_100130043 | 3300005530 | Bacteria | 2499 |
| 73 | Ga0070679_100177120 | 3300005530 | Bacteria | 2105 |
| 74 | Ga0070684_100028739 | 3300005535 | Bacteria | 4704 |
| 75 | Ga0070684_100062194 | 3300005535 | Bacteria | 3270 |
| 76 | Ga0070684_100078482 | 3300005535 | Bacteria | 2917 |
| 77 | Ga0070684_100501214 | 3300005535 | Bacteria | 1124 |
| 78 | Ga0070695_100000424 | 3300005545 | Bacteria | 21845 |
| 79 | Ga0070695_100834399 | 3300005545 | Bacteria | 741 |
| 80 | Ga0070696_100036428 | 3300005546 | Bacteria | 3392 |
| 81 | Ga0070696_100211116 | 3300005546 | Bacteria | 1453 |
| 82 | Ga0070665_100000606 | 3300005548 | Bacteria | 49390 |
| 83 | Ga0070665_100220582 | 3300005548 | Bacteria | 1897 |
| 84 | Ga0070665_100341705 | 3300005548 | Bacteria | 1502 |
| 85 | Ga0070665_100609893 | 3300005548 | Bacteria | 1104 |
| 86 | Ga0068855_100163274 | 3300005563 | Bacteria | 2527 |
| 87 | Ga0070664_100190809 | 3300005564 | Bacteria | 1826 |
| 88 | Ga0068857_100050660 | 3300005577 | Bacteria | 3683 |
| 89 | Ga0068857_100438709 | 3300005577 | Bacteria | 1220 |
| 90 | Ga0068857_100972639 | 3300005577 | Bacteria | 816 |
| 91 | Ga0068856_100049227 | 3300005614 | Bacteria | 4154 |
| 92 | Ga0070702_100066152 | 3300005615 | Bacteria | 2119 |
| 93 | Ga0070702_100183201 | 3300005615 | Bacteria | 1372 |
| 94 | Ga0070702_100189326 | 3300005615 | Bacteria | 1353 |
| 95 | Ga0068852_100146478 | 3300005616 | Bacteria | 2191 |
| 96 | Ga0068852_100268834 | 3300005616 | Bacteria | 1640 |
| 97 | Ga0068864_100197285 | 3300005618 | Bacteria | 1848 |
| 98 | Ga0068866_10003247 | 3300005718 | Bacteria | 6696 |
| 99 | Ga0068861_100012663 | 3300005719 | Bacteria | 5885 |
| 100 | Ga0068861_100111931 | 3300005719 | Bacteria | 2188 |
| 101 | Ga0068861_100329691 | 3300005719 | Bacteria | 1332 |
| 102 | Ga0068863_100012869 | 3300005841 | Bacteria | 8069 |
| 103 | Ga0068863_100101492 | 3300005841 | Bacteria | 2735 |
| 104 | Ga0068860_100004939 | 3300005843 | Bacteria | 13590 |
| 105 | Ga0068860_100114307 | 3300005843 | Bacteria | 2581 |
| 106 | Ga0068860_100145433 | 3300005843 | Bacteria | 2281 |
| 107 | Ga0068862_100731289 | 3300005844 | Bacteria | 961 |
| 108 | Ga0081538_10022577 | 3300005981 | Bacteria | 4556 |
| 109 | Ga0070717_10179566 | 3300006028 | Bacteria | 1844 |
| 110 | Ga0070717_10186285 | 3300006028 | Bacteria | 1812 |
| 111 | Ga0075365_10002498 | 3300006038 | Bacteria | 9051 |
| 112 | Ga0075365_10002593 | 3300006038 | Bacteria | 8940 |
| 113 | Ga0075365_10013292 | 3300006038 | Bacteria | 4915 |
| 114 | Ga0075365_10025219 | 3300006038 | Bacteria | 3762 |
| 115 | Ga0075365_10028760 | 3300006038 | Bacteria | 3546 |
| 116 | Ga0075365_10039757 | 3300006038 | Bacteria | 3064 |
| 117 | Ga0075365_10043437 | 3300006038 | Bacteria | 2942 |
| 118 | Ga0075365_10049405 | 3300006038 | Bacteria | 2771 |
| 119 | Ga0075365_10110747 | 3300006038 | Bacteria | 1886 |
| 120 | Ga0075365_10120011 | 3300006038 | Bacteria | 1813 |
| 121 | Ga0075365_10181532 | 3300006038 | Bacteria | 1471 |
| 122 | Ga0075368_10000787 | 3300006042 | Bacteria | 9749 |
| 123 | Ga0075368_10001808 | 3300006042 | Bacteria | 6875 |
| 124 | Ga0075368_10184297 | 3300006042 | Bacteria | 880 |
| 125 | Ga0075363_100001556 | 3300006048 | Bacteria | 8806 |
| 126 | Ga0075363_100016538 | 3300006048 | Bacteria | 3644 |
| 127 | Ga0075363_100031177 | 3300006048 | Bacteria | 2763 |
| 128 | Ga0075363_100033187 | 3300006048 | Bacteria | 2686 |
| 129 | Ga0075363_100046692 | 3300006048 | Bacteria | 2299 |
| 130 | Ga0075363_100059210 | 3300006048 | Bacteria | 2059 |
| 131 | Ga0075363_100217149 | 3300006048 | Bacteria | 1095 |
| 132 | Ga0075364_10023355 | 3300006051 | Bacteria | 3915 |
| 133 | Ga0075364_10029727 | 3300006051 | Bacteria | 3505 |
| 134 | Ga0075364_10034908 | 3300006051 | Bacteria | 3248 |
| 135 | Ga0075364_10051396 | 3300006051 | Bacteria | 2692 |
| 136 | Ga0075364_10115458 | 3300006051 | Bacteria | 1794 |
| 137 | Ga0075364_10203960 | 3300006051 | Bacteria | 1340 |
| 138 | Ga0075364_10326450 | 3300006051 | Bacteria | 1045 |
| 139 | Ga0070715_10018015 | 3300006163 | Bacteria | 2683 |
| 140 | Ga0070715_10046904 | 3300006163 | Bacteria | 1839 |
| 141 | Ga0070716_100016572 | 3300006173 | Bacteria | 3807 |
| 142 | Ga0070716_100048576 | 3300006173 | Bacteria | 2399 |
| 143 | Ga0070712_100041445 | 3300006175 | Bacteria | 3161 |
| 144 | Ga0070712_100129626 | 3300006175 | Bacteria | 1910 |
| 145 | Ga0070712_100129790 | 3300006175 | Bacteria | 1909 |
| 146 | Ga0075367_10004044 | 3300006178 | Bacteria | 7093 |
| 147 | Ga0075367_10018252 | 3300006178 | Bacteria | 3867 |
| 148 | Ga0075367_10135628 | 3300006178 | Bacteria | 1522 |
| 149 | Ga0075367_10163715 | 3300006178 | Bacteria | 1383 |
| 150 | Ga0075369_10111481 | 3300006186 | Bacteria | 1233 |
| 151 | Ga0097621_100192601 | 3300006237 | Bacteria | 1766 |
| 152 | Ga0075370_10003503 | 3300006353 | Bacteria | 7480 |
| 153 | Ga0075370_10005399 | 3300006353 | Bacteria | 6350 |
| 154 | Ga0075370_10011633 | 3300006353 | Bacteria | 4628 |
| 155 | Ga0075370_10012237 | 3300006353 | Bacteria | 4529 |
| 156 | Ga0075370_10126608 | 3300006353 | Unclassified | 1489 |
| 157 | Ga0075370_10152029 | 3300006353 | Bacteria | 1357 |
| 158 | Ga0075428_100068912 | 3300006844 | Bacteria | 3869 |
| 159 | Ga0075428_100082457 | 3300006844 | Bacteria | 3509 |
| 160 | Ga0075428_100192794 | 3300006844 | Bacteria | 2204 |
| 161 | Ga0075428_100257779 | 3300006844 | Bacteria | 1878 |
| 162 | Ga0075431_100283624 | 3300006847 | Bacteria | 1677 |
| 163 | Ga0075434_100000592 | 3300006871 | Bacteria | 28019 |
| 164 | Ga0075429_100131704 | 3300006880 | Bacteria | 2188 |
| 165 | Ga0075429_100179802 | 3300006880 | Bacteria | 1854 |
| 166 | Ga0068865_100007888 | 3300006881 | Bacteria | 6569 |
| 167 | Ga0075436_100005286 | 3300006914 | Bacteria | 8882 |
| 168 | Ga0075435_100000398 | 3300007076 | Bacteria | 26576 |
| 169 | Ga0105251_10005738 | 3300009011 | Bacteria | 8053 |
| 170 | Ga0105251_10013084 | 3300009011 | Bacteria | 4658 |
| 171 | Ga0105251_10023032 | 3300009011 | Bacteria | 3222 |
| 172 | Ga0105244_10018182 | 3300009036 | Bacteria | 3951 |
| 173 | Ga0105244_10221586 | 3300009036 | Bacteria | 887 |
| 174 | Ga0105250_10009562 | 3300009092 | Bacteria | 4078 |
| 175 | Ga0105250_10066317 | 3300009092 | Unclassified | 1455 |
| 176 | Ga0105240_10033798 | 3300009093 | Bacteria | 6603 |
| 177 | Ga0105240_10037358 | 3300009093 | Bacteria | 6242 |
| 178 | Ga0105240_10317937 | 3300009093 | Bacteria | 1775 |
| 179 | Ga0111539_10055190 | 3300009094 | Bacteria | 4723 |
| 180 | Ga0105245_10013028 | 3300009098 | Bacteria | 7245 |
| 181 | Ga0105245_10016541 | 3300009098 | Bacteria | 6436 |
| 182 | Ga0105245_10051192 | 3300009098 | Bacteria | 3703 |
| 183 | Ga0105245_10205224 | 3300009098 | Bacteria | 1894 |
| 184 | Ga0105245_10270432 | 3300009098 | Bacteria | 1657 |
| 185 | Ga0105247_10049742 | 3300009101 | Bacteria | 2578 |
| 186 | Ga0114129_10525904 | 3300009147 | Bacteria | 1541 |
| 187 | Ga0105243_10029624 | 3300009148 | Bacteria | 4210 |
| 188 | Ga0105243_10045271 | 3300009148 | Bacteria | 3457 |
| 189 | Ga0105243_10104527 | 3300009148 | Bacteria | 2357 |
| 190 | Ga0105243_10130425 | 3300009148 | Bacteria | 2132 |
| 191 | Ga0105243_10989414 | 3300009148 | Bacteria | 843 |
| 192 | Ga0105241_10563474 | 3300009174 | Bacteria | 1024 |
| 193 | Ga0105242_10081241 | 3300009176 | Bacteria | 2710 |
| 194 | Ga0105242_10207134 | 3300009176 | Bacteria | 1745 |
| 195 | Ga0105242_10432278 | 3300009176 | Bacteria | 1236 |
| 196 | Ga0105237_10013297 | 3300009545 | Bacteria | 8633 |
| 197 | Ga0105237_10084955 | 3300009545 | Bacteria | 3154 |
| 198 | Ga0105237_10114878 | 3300009545 | Bacteria | 2685 |
| 199 | Ga0105237_10225311 | 3300009545 | Bacteria | 1875 |
| 200 | Ga0105238_10033763 | 3300009551 | Bacteria | 5206 |
| 201 | Ga0105238_10523649 | 3300009551 | Bacteria | 1188 |
| 202 | Ga0105249_10072069 | 3300009553 | Bacteria | 3193 |
| 203 | Ga0105249_10118507 | 3300009553 | Bacteria | 2512 |
| 204 | Ga0105249_10380398 | 3300009553 | Bacteria | 1437 |
| 205 | Ga0123341_1078622 | 3300009765 | Bacteria | 1323 |
| 206 | Ga0105239_10015690 | 3300010375 | Bacteria | 8384 |
| 207 | Ga0105239_10083189 | 3300010375 | Bacteria | 3524 |
| 208 | Ga0105239_10088214 | 3300010375 | Bacteria | 3420 |
| 209 | Ga0105239_10116670 | 3300010375 | Bacteria | 2963 |
| 210 | Ga0105239_10542585 | 3300010375 | Bacteria | 1324 |
| 211 | Ga0105239_10586379 | 3300010375 | Bacteria | 1271 |
| 212 | Ga0105239_11017153 | 3300010375 | Bacteria | 953 |
| 213 | Ga0105239_11139124 | 3300010375 | Bacteria | 898 |
| 214 | Ga0105246_10042792 | 3300011119 | Bacteria | 3068 |
| 215 | Ga0105246_10048722 | 3300011119 | Bacteria | 2898 |
| 216 | Ga0105246_10127366 | 3300011119 | Bacteria | 1896 |
| 217 | Ga0157370_10177274 | 3300013104 | Bacteria | 1981 |
| 218 | Ga0157370_10380170 | 3300013104 | Bacteria | 1301 |
| 219 | Ga0157369_10105097 | 3300013105 | Bacteria | 3006 |
| 220 | Ga0157369_10106512 | 3300013105 | Bacteria | 2983 |
| 221 | Ga0157369_10445357 | 3300013105 | Bacteria | 1341 |
| 222 | Ga0157369_10744742 | 3300013105 | Bacteria | 1008 |
| 223 | Ga0157374_10122402 | 3300013296 | Bacteria | 2512 |
| 224 | Ga0157374_10129426 | 3300013296 | Bacteria | 2442 |
| 225 | Ga0157374_10177972 | 3300013296 | Bacteria | 2076 |
| 226 | Ga0157374_10885746 | 3300013296 | Bacteria | 910 |
| 227 | Ga0157378_10026724 | 3300013297 | Bacteria | 5088 |
| 228 | Ga0157378_10242493 | 3300013297 | Bacteria | 1722 |
| 229 | Ga0157378_10317988 | 3300013297 | Bacteria | 1511 |
| 230 | Ga0163162_11033150 | 3300013306 | Bacteria | 930 |
| 231 | Ga0157372_10003630 | 3300013307 | Bacteria | 16603 |
| 232 | Ga0157372_10024536 | 3300013307 | Bacteria | 6553 |
| 233 | Ga0157372_10037050 | 3300013307 | Bacteria | 5377 |
| 234 | Ga0157372_10080102 | 3300013307 | Bacteria | 3694 |
| 235 | Ga0157372_10118962 | 3300013307 | Bacteria | 3032 |
| 236 | Ga0157372_10816815 | 3300013307 | Bacteria | 1083 |
| 237 | Ga0157375_10032119 | 3300013308 | Bacteria | 4976 |
| 238 | Ga0157375_10104454 | 3300013308 | Bacteria | 2922 |
| 239 | Ga0163163_10054312 | 3300014325 | Bacteria | 3957 |
| 240 | Ga0163163_10057376 | 3300014325 | Bacteria | 3850 |
| 241 | Ga0163163_10057861 | 3300014325 | Bacteria | 3833 |
| 242 | Ga0163163_10219473 | 3300014325 | Bacteria | 1950 |
| 243 | Ga0163163_10329415 | 3300014325 | Bacteria | 1581 |
| 244 | Ga0157380_10804425 | 3300014326 | Bacteria | 957 |
| 245 | Ga0182008_10099700 | 3300014497 | Bacteria | 1435 |
| 246 | Ga0182008_10115104 | 3300014497 | Bacteria | 1334 |
| 247 | Ga0157377_10006626 | 3300014745 | Bacteria | 5535 |
| 248 | Ga0157377_10028872 | 3300014745 | Bacteria | 2989 |
| 249 | Ga0157379_10024932 | 3300014968 | Bacteria | 5308 |
| 250 | Ga0157379_10131725 | 3300014968 | Bacteria | 2251 |
| 251 | Ga0157379_10188016 | 3300014968 | Bacteria | 1866 |
| 252 | Ga0157376_10004054 | 3300014969 | Bacteria | 10135 |
| 253 | Ga0157376_10105516 | 3300014969 | Bacteria | 2471 |
| 254 | Ga0183367_1010 | 3300015688 | Bacteria | 416164 |
| 255 | Ga0183363_1146 | 3300015690 | Bacteria | 17733 |
| 256 | Ga0163161_10333526 | 3300017792 | Bacteria | 1202 |
| 257 | Ga0197907_10860015 | 3300020069 | Bacteria | 2946 |
| 258 | Ga0206356_11782609 | 3300020070 | Bacteria | 2200 |
| 259 | Ga0206354_11178818 | 3300020081 | Bacteria | 2039 |
| 260 | Ga0206353_10100660 | 3300020082 | Bacteria | 6070 |
| 261 | Ga0206353_10113132 | 3300020082 | Bacteria | 1958 |
| 262 | Ga0209784_102716 | 3300025224 | Bacteria | 1691 |
| 263 | Ga0209147_100640 | 3300025229 | Bacteria | 18610 |
| 264 | Ga0209258_100713 | 3300025242 | Bacteria | 22248 |
| 265 | Ga0209129_1000066 | 3300025258 | Bacteria | 226820 |
| 266 | Ga0209129_1016456 | 3300025258 | Unclassified | 1484 |
| 267 | Ga0209673_1000024 | 3300025273 | Bacteria | 409632 |
| 268 | Ga0209673_1002852 | 3300025273 | Bacteria | 11064 |
| 269 | Ga0209673_1008252 | 3300025273 | Bacteria | 4656 |
| 270 | Ga0209673_1008507 | 3300025273 | Bacteria | 4559 |
| 271 | Ga0209673_1011187 | 3300025273 | Bacteria | 3715 |
| 272 | Ga0209130_1033406 | 3300025284 | Bacteria | 1042 |
| 273 | Ga0209025_1000275 | 3300025294 | Bacteria | 119220 |
| 274 | Ga0209025_1008812 | 3300025294 | Bacteria | 7172 |
| 275 | Ga0209025_1018920 | 3300025294 | Bacteria | 3867 |
| 276 | Ga0209025_1022379 | 3300025294 | Bacteria | 3355 |
| 277 | Ga0209025_1027911 | 3300025294 | Bacteria | 2782 |
| 278 | Ga0209025_1033755 | 3300025294 | Bacteria | 2356 |
| 279 | Ga0209564_1003535 | 3300025295 | Bacteria | 10528 |
| 280 | Ga0209564_1007247 | 3300025295 | Bacteria | 5766 |
| 281 | Ga0209564_1012018 | 3300025295 | Bacteria | 3816 |
| 282 | Ga0209758_1006866 | 3300025297 | Bacteria | 7954 |
| 283 | Ga0209758_1036365 | 3300025297 | Bacteria | 1923 |
| 284 | Ga0209256_1000027 | 3300025299 | Bacteria | 423283 |
| 285 | Ga0209256_1001674 | 3300025299 | Bacteria | 21498 |
| 286 | Ga0209256_1003288 | 3300025299 | Bacteria | 11528 |
| 287 | Ga0209256_1018687 | 3300025299 | Bacteria | 2238 |
| 288 | Ga0207426_1002707 | 3300025302 | Bacteria | 10794 |
| 289 | Ga0209051_1006208 | 3300025303 | Bacteria | 6774 |
| 290 | Ga0209051_1079549 | 3300025303 | Bacteria | 951 |
| 291 | Ga0207696_1004609 | 3300025711 | Bacteria | 5903 |
| 292 | Ga0207696_1016935 | 3300025711 | Bacteria | 2426 |
| 293 | Ga0207655_1018102 | 3300025728 | Bacteria | 3758 |
| 294 | Ga0207655_1018154 | 3300025728 | Bacteria | 3750 |
| 295 | Ga0207655_1032487 | 3300025728 | Bacteria | 2384 |
| 296 | Ga0207713_1000851 | 3300025735 | Bacteria | 28054 |
| 297 | Ga0207713_1012854 | 3300025735 | Bacteria | 4446 |
| 298 | Ga0207713_1022059 | 3300025735 | Bacteria | 3035 |
| 299 | Ga0207692_10229892 | 3300025898 | Bacteria | 1103 |
| 300 | Ga0207710_10023764 | 3300025900 | Bacteria | 2635 |
| 301 | Ga0207688_10116111 | 3300025901 | Bacteria | 1558 |
| 302 | Ga0207647_10024844 | 3300025904 | Bacteria | 3946 |
| 303 | Ga0207647_10119706 | 3300025904 | Bacteria | 1553 |
| 304 | Ga0207685_10056840 | 3300025905 | Bacteria | 1533 |
| 305 | Ga0207685_10107858 | 3300025905 | Bacteria | 1202 |
| 306 | Ga0207699_10095587 | 3300025906 | Bacteria | 1874 |
| 307 | Ga0207699_10139336 | 3300025906 | Bacteria | 1593 |
| 308 | Ga0207705_10237154 | 3300025909 | Bacteria | 1389 |
| 309 | Ga0207705_10265401 | 3300025909 | Bacteria | 1312 |
| 310 | Ga0207705_10470546 | 3300025909 | Bacteria | 975 |
| 311 | Ga0207654_10024058 | 3300025911 | Bacteria | 3270 |
| 312 | Ga0207707_10040469 | 3300025912 | Bacteria | 4070 |
| 313 | Ga0207707_10099380 | 3300025912 | Bacteria | 2543 |
| 314 | Ga0207707_10450124 | 3300025912 | Bacteria | 1102 |
| 315 | Ga0207695_10011324 | 3300025913 | Bacteria | 10811 |
| 316 | Ga0207695_10082209 | 3300025913 | Bacteria | 3258 |
| 317 | Ga0207671_10110197 | 3300025914 | Bacteria | 2094 |
| 318 | Ga0207671_10256806 | 3300025914 | Bacteria | 1375 |
| 319 | Ga0207693_10031290 | 3300025915 | Bacteria | 4204 |
| 320 | Ga0207693_10079013 | 3300025915 | Bacteria | 2575 |
| 321 | Ga0207693_10121398 | 3300025915 | Bacteria | 2052 |
| 322 | Ga0207663_10008339 | 3300025916 | Bacteria | 5412 |
| 323 | Ga0207663_10032814 | 3300025916 | Bacteria | 3086 |
| 324 | Ga0207660_10008889 | 3300025917 | Bacteria | 6494 |
| 325 | Ga0207657_10014605 | 3300025919 | Bacteria | 7653 |
| 326 | Ga0207657_10466087 | 3300025919 | Bacteria | 991 |
| 327 | Ga0207649_10135236 | 3300025920 | Bacteria | 1680 |
| 328 | Ga0207652_10018333 | 3300025921 | Bacteria | 5740 |
| 329 | Ga0207652_10100213 | 3300025921 | Bacteria | 2557 |
| 330 | Ga0207652_10452277 | 3300025921 | Bacteria | 1158 |
| 331 | Ga0207681_10171079 | 3300025923 | Bacteria | 1647 |
| 332 | Ga0207687_10006661 | 3300025927 | Bacteria | 7620 |
| 333 | Ga0207687_10026416 | 3300025927 | Bacteria | 3888 |
| 334 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 335 | Ga0207700_10203761 | 3300025928 | Bacteria | 1668 |
| 336 | Ga0207700_10436363 | 3300025928 | Bacteria | 1152 |
| 337 | Ga0207664_10039097 | 3300025929 | Bacteria | 3682 |
| 338 | Ga0207664_10204092 | 3300025929 | Bacteria | 1707 |
| 339 | Ga0207664_10213691 | 3300025929 | Bacteria | 1670 |
| 340 | Ga0207644_10025762 | 3300025931 | Bacteria | 4046 |
| 341 | Ga0207644_10119931 | 3300025931 | Bacteria | 2001 |
| 342 | Ga0207644_10261525 | 3300025931 | Bacteria | 1384 |
| 343 | Ga0207644_10389458 | 3300025931 | Bacteria | 1138 |
| 344 | Ga0207690_10017620 | 3300025932 | Bacteria | 4366 |
| 345 | Ga0207690_10158099 | 3300025932 | Bacteria | 1687 |
| 346 | Ga0207686_10106637 | 3300025934 | Bacteria | 1881 |
| 347 | Ga0207709_10003100 | 3300025935 | Bacteria | 10007 |
| 348 | Ga0207709_10072287 | 3300025935 | Bacteria | 2193 |
| 349 | Ga0207704_10397920 | 3300025938 | Bacteria | 1086 |
| 350 | Ga0207665_10011508 | 3300025939 | Bacteria | 5811 |
| 351 | Ga0207691_10583397 | 3300025940 | Bacteria | 947 |
| 352 | Ga0207661_10010691 | 3300025944 | Bacteria | 6614 |
| 353 | Ga0207661_10198017 | 3300025944 | Bacteria | 1765 |
| 354 | Ga0207661_10241311 | 3300025944 | Bacteria | 1604 |
| 355 | Ga0207679_10213334 | 3300025945 | Bacteria | 1620 |
| 356 | Ga0207712_10199038 | 3300025961 | Bacteria | 1587 |
| 357 | Ga0207712_10229157 | 3300025961 | Bacteria | 1490 |
| 358 | Ga0207668_10011452 | 3300025972 | Bacteria | 5390 |
| 359 | Ga0207640_10885556 | 3300025981 | Bacteria | 779 |
| 360 | Ga0207658_10044226 | 3300025986 | Bacteria | 3242 |
| 361 | Ga0207658_10433697 | 3300025986 | Bacteria | 1161 |
| 362 | Ga0207677_10015540 | 3300026023 | Bacteria | 4481 |
| 363 | Ga0207677_10084067 | 3300026023 | Bacteria | 2293 |
| 364 | Ga0207703_10279525 | 3300026035 | Bacteria | 1515 |
| 365 | Ga0207678_10140684 | 3300026067 | Bacteria | 2059 |
| 366 | Ga0207678_10242930 | 3300026067 | Bacteria | 1542 |
| 367 | Ga0207702_10004876 | 3300026078 | Bacteria | 11814 |
| 368 | Ga0207702_10058818 | 3300026078 | Bacteria | 3272 |
| 369 | Ga0207641_10083296 | 3300026088 | Bacteria | 2781 |
| 370 | Ga0207641_10398101 | 3300026088 | Bacteria | 1322 |
| 371 | Ga0207648_10619589 | 3300026089 | Bacteria | 998 |
| 372 | Ga0207674_10064533 | 3300026116 | Bacteria | 3693 |
| 373 | Ga0207674_10598818 | 3300026116 | Bacteria | 1065 |
| 374 | Ga0207674_10860340 | 3300026116 | Bacteria | 874 |
| 375 | Ga0209281_1000097 | 3300027111 | Bacteria | 227540 |
| 376 | Ga0209281_1000844 | 3300027111 | Bacteria | 27278 |
| 377 | Ga0209281_1002422 | 3300027111 | Bacteria | 7531 |
| 378 | Ga0209813_10000655 | 3300027866 | Bacteria | 7933 |
| 379 | Ga0209813_10018905 | 3300027866 | Bacteria | 1909 |
| 380 | Ga0268266_10001445 | 3300028379 | Bacteria | 28270 |
| 381 | Ga0268266_10176800 | 3300028379 | Bacteria | 1941 |
| 382 | Ga0268266_10189044 | 3300028379 | Bacteria | 1879 |
| 383 | Ga0268266_10199074 | 3300028379 | Bacteria | 1832 |
| 384 | Ga0268264_10361836 | 3300028381 | Bacteria | 1384 |
| 385 | Ga0307515_10200098 | 3300028794 | Bacteria | 1876 |
| 386 | Ga0265325_10022060 | 3300031241 | Bacteria | 3490 |
| 387 | Ga0265339_10100581 | 3300031249 | Bacteria | 1505 |
| 388 | Ga0265313_10030991 | 3300031595 | Bacteria | 2746 |
| 389 | Ga0307405_10020553 | 3300031731 | Bacteria | 3692 |
| 390 | Ga0307405_10061467 | 3300031731 | Bacteria | 2375 |
| 391 | Ga0316577_10170089 | 3300031733 | Bacteria | 1230 |
| 392 | Ga0307410_10151679 | 3300031852 | Bacteria | 1726 |
| 393 | Ga0307410_10275338 | 3300031852 | Bacteria | 1318 |
| 394 | Ga0307410_10731037 | 3300031852 | Bacteria | 837 |
| 395 | Ga0307407_10042566 | 3300031903 | Bacteria | 2547 |
| 396 | Ga0307412_10103488 | 3300031911 | Bacteria | 2018 |
| 397 | Ga0307409_100006011 | 3300031995 | Bacteria | 7076 |
| 398 | Ga0307409_100142136 | 3300031995 | Bacteria | 2070 |
| 399 | Ga0307409_100342641 | 3300031995 | Bacteria | 1407 |
| 400 | Ga0307409_100868708 | 3300031995 | Bacteria | 914 |
| 401 | Ga0307416_100000221 | 3300032002 | Bacteria | 30062 |
| 402 | Ga0307416_100766571 | 3300032002 | Bacteria | 1058 |
| 403 | Ga0307414_10025067 | 3300032004 | Bacteria | 3813 |
| 404 | Ga0307415_100000455 | 3300032126 | Bacteria | 17595 |
| 405 | Ga0307415_100077285 | 3300032126 | Bacteria | 2363 |
| 406 | Ga0307415_100114766 | 3300032126 | Bacteria | 2006 |
| 407 | Ga0307415_100600606 | 3300032126 | Bacteria | 979 |
| 408 | Ga0316583_10006272 | 3300032133 | Bacteria | 4274 |
| 409 | Ga0373926_0058903 | 3300035083 | Bacteria | 1397 |
| 410 | Ga0373932_0096425 | 3300035112 | Bacteria | 956 |
| 411 | Ga0373939_0089614 | 3300035114 | Bacteria | 1037 |
| 412 | Ga0373941_0210546 | 3300035115 | Bacteria | 743 |
| 413 | Ga0373942_0110937 | 3300035207 | Bacteria | 848 |
| 414 | Ga0373935_0288305 | 3300035692 | Unclassified | 1157 |
| 415 | Ga0373927_0000048 | 3300035695 | Bacteria | 86106 |
| 416 | Ga0316582_0012397 | 3300036647 | Bacteria | 4756 |
| 417 | Ga0316582_0273334 | 3300036647 | Bacteria | 1159 |
| 418 | Ga0373925_0000668 | 3300037068 | Bacteria | 32227 |
| 419 | Ga0395899_0049006 | 3300037312 | Bacteria | 3141 |
| 420 | Ga0395900_0030791 | 3300037418 | Bacteria | 5510 |
| 421 | Ga0395900_0122675 | 3300037418 | Bacteria | 2665 |
| 422 | Ga0395900_0125710 | 3300037418 | Bacteria | 2630 |
| 423 | Ga0395900_0225426 | 3300037418 | Bacteria | 1887 |
| 424 | Ga0395898_0043916 | 3300037466 | Bacteria | 4403 |
| 425 | Ga0395898_0110391 | 3300037466 | Bacteria | 2636 |
| 426 | Ga0395898_0203763 | 3300037466 | Bacteria | 1888 |
| 427 | Ga0395898_0233971 | 3300037466 | Bacteria | 1752 |
| 428 | Ga0395898_0406943 | 3300037466 | Bacteria | 1297 |
| 429 | Ga0395905_0000608 | 3300037471 | Bacteria | 47958 |
| 430 | Ga0395905_0004534 | 3300037471 | Bacteria | 14385 |
| 431 | Ga0395905_0025393 | 3300037471 | Bacteria | 5587 |
| 432 | Ga0395905_0043829 | 3300037471 | Bacteria | 4197 |
| 433 | Ga0395905_1016739 | 3300037471 | Bacteria | 732 |
| 434 | Ga0395901_0128825 | 3300038443 | Bacteria | 2660 |
| 435 | Ga0395901_0150818 | 3300038443 | Bacteria | 2443 |
| 436 | Ga0395901_0301708 | 3300038443 | Bacteria | 1660 |
| 437 | Ga0395901_0304985 | 3300038443 | Bacteria | 1650 |
| 438 | Ga0439449_0019048 | 3300042007 | Bacteria | 2574 |
| 439 | Ga0466969_0154633 | 3300044656 | Bacteria | 1056 |
| 440 | Ga0466972_0015450 | 3300044658 | Bacteria | 3815 |
| 441 | Ga0466972_0016907 | 3300044658 | Bacteria | 3649 |
| 442 | Ga0466972_0213377 | 3300044658 | Bacteria | 903 |
| 443 | Ga0466965_0001364 | 3300044683 | Bacteria | 9795 |
| 444 | Ga0466965_0018571 | 3300044683 | Bacteria | 3335 |
| 445 | Ga0466965_0024379 | 3300044683 | Bacteria | 2926 |
| 446 | Ga0466965_0055705 | 3300044683 | Bacteria | 1968 |
| 447 | Ga0466965_0124705 | 3300044683 | Bacteria | 1332 |
| 448 | Ga0466965_0142777 | 3300044683 | Bacteria | 1248 |
| 449 | Ga0466966_0014690 | 3300044684 | Bacteria | 5181 |
| 450 | Ga0466966_0030866 | 3300044684 | Bacteria | 3476 |
| 451 | Ga0466961_0000223 | 3300044693 | Bacteria | 38608 |
| 452 | Ga0466961_0062701 | 3300044693 | Bacteria | 2362 |
| 453 | Ga0466961_0306375 | 3300044693 | Bacteria | 970 |
| 454 | Ga0466963_0001004 | 3300044694 | Bacteria | 14564 |
| 455 | Ga0466963_0010684 | 3300044694 | Bacteria | 5569 |
| 456 | Ga0466963_0013066 | 3300044694 | Bacteria | 5092 |
| 457 | Ga0466963_0013564 | 3300044694 | Bacteria | 5004 |
| 458 | Ga0466963_0016836 | 3300044694 | Bacteria | 4551 |
| 459 | Ga0466963_0063820 | 3300044694 | Bacteria | 2466 |
| 460 | Ga0466963_0150169 | 3300044694 | Bacteria | 1617 |
| 461 | Ga0466963_0292434 | 3300044694 | Bacteria | 1145 |
| 462 | Ga0466964_0049085 | 3300044706 | Bacteria | 1727 |
| 463 | Ga0466964_0225495 | 3300044706 | Bacteria | 912 |
| 464 | Ga0466971_0006327 | 3300044719 | Bacteria | 5138 |
| 465 | Ga0466971_0022623 | 3300044719 | Bacteria | 2802 |
| 466 | Ga0466971_0091970 | 3300044719 | Bacteria | 1390 |
| 467 | Ga0466971_0162883 | 3300044719 | Bacteria | 1044 |
| 468 | Ga0466971_0193155 | 3300044719 | Bacteria | 959 |
| 469 | Ga0466968_0018631 | 3300044735 | Bacteria | 2787 |
| 470 | Ga0466970_0009805 | 3300044765 | Bacteria | 4850 |
| 471 | Ga0466970_0023123 | 3300044765 | Bacteria | 3245 |
| 472 | Ga0466970_0034147 | 3300044765 | Bacteria | 2691 |
| 473 | Ga0466970_0092599 | 3300044765 | Bacteria | 1641 |
| 474 | Ga0466970_0244643 | 3300044765 | Bacteria | 1004 |
| 475 | Ga0466957_0000283 | 3300044842 | Bacteria | 24756 |
| 476 | Ga0466957_0026854 | 3300044842 | Bacteria | 3418 |
| 477 | Ga0466957_0296013 | 3300044842 | Bacteria | 1086 |
| 478 | Ga0466957_0418923 | 3300044842 | Bacteria | 918 |
| 479 | Ga0466957_0801025 | 3300044842 | Bacteria | 669 |
| 480 | Ga0466960_0015523 | 3300044901 | Bacteria | 3284 |
| 481 | Ga0466960_0034517 | 3300044901 | Bacteria | 2358 |
| 482 | Ga0466960_0062407 | 3300044901 | Bacteria | 1831 |
| 483 | Ga0466960_0062821 | 3300044901 | Bacteria | 1826 |
| 484 | Ga0466960_0074590 | 3300044901 | Bacteria | 1695 |
| 485 | Ga0466960_0084883 | 3300044901 | Bacteria | 1603 |
| 486 | Ga0466960_0314518 | 3300044901 | Bacteria | 885 |
| 487 | Ga0466959_0039510 | 3300045049 | Bacteria | 3487 |
| 488 | Ga0466959_0050275 | 3300045049 | Unclassified | 3061 |
| 489 | Ga0466959_0064828 | 3300045049 | Bacteria | 2651 |
| 490 | Ga0466959_0156111 | 3300045049 | Bacteria | 1606 |
| 491 | Ga0466959_0183669 | 3300045049 | Bacteria | 1462 |
| 492 | Ga0466959_0212991 | 3300045049 | Bacteria | 1342 |
| 493 | Ga0466959_0352142 | 3300045049 | Bacteria | 1004 |
| 494 | Ga0466959_0416024 | 3300045049 | Bacteria | 913 |
| 495 | Ga0466958_0028047 | 3300045836 | Bacteria | 3335 |
| 496 | Ga0466958_0029237 | 3300045836 | Bacteria | 3270 |
| 497 | Ga0466958_0036234 | 3300045836 | Bacteria | 2952 |
| 498 | Ga0466958_0069805 | 3300045836 | Bacteria | 2149 |
| 499 | Ga0466967_0001608 | 3300045976 | Bacteria | 13322 |
| 500 | Ga0466967_0002748 | 3300045976 | Bacteria | 11129 |
| 501 | Ga0466967_0003756 | 3300045976 | Bacteria | 10014 |
| 502 | Ga0466967_0010091 | 3300045976 | Bacteria | 7059 |
| 503 | Ga0466967_0017214 | 3300045976 | Bacteria | 5731 |
| 504 | Ga0466967_0027096 | 3300045976 | Bacteria | 4762 |
| 505 | Ga0466967_0056887 | 3300045976 | Bacteria | 3450 |
| 506 | Ga0466967_0125229 | 3300045976 | Bacteria | 2379 |
| 507 | Ga0466967_0163423 | 3300045976 | Bacteria | 2091 |
| 508 | Ga0466967_0191434 | 3300045976 | Bacteria | 1933 |
| 509 | Ga0466967_0300066 | 3300045976 | Bacteria | 1545 |
| 510 | Ga0495603_0113446 | 3300046455 | Bacteria | 1580 |
| 511 | Ga0495638_0033750 | 3300046460 | Bacteria | 3271 |
| 512 | Ga0495641_0054335 | 3300046461 | Bacteria | 1820 |
| 513 | Ga0495641_0131012 | 3300046461 | Bacteria | 1119 |
| 514 | Ga0495641_0137199 | 3300046461 | Bacteria | 1092 |
| 515 | Ga0495641_0209925 | 3300046461 | Bacteria | 873 |
| 516 | Ga0495653_0315502 | 3300046463 | Bacteria | 1015 |
| 517 | Ga0495582_0033385 | 3300046473 | Bacteria | 2829 |
| 518 | Ga0495585_0169031 | 3300046492 | Bacteria | 1130 |
| 519 | Ga0495594_0061561 | 3300046499 | Bacteria | 2077 |
| 520 | Ga0495607_0039385 | 3300046501 | Bacteria | 2823 |
| 521 | Ga0495618_0214576 | 3300046514 | Bacteria | 1216 |
| 522 | Ga0495630_0128973 | 3300046517 | Bacteria | 1920 |
| 523 | Ga0495652_0381177 | 3300046529 | Bacteria | 1003 |
| 524 | Ga0495587_0072618 | 3300046536 | Bacteria | 2000 |
| 525 | Ga0495667_0096875 | 3300046559 | Bacteria | 1910 |
| 526 | Ga0495667_0109447 | 3300046559 | Bacteria | 1785 |
| 527 | Ga0495634_0461204 | 3300046642 | Bacteria | 748 |
| 528 | Ga0495635_0157853 | 3300046663 | Bacteria | 1544 |
| 529 | Ga0495635_0220097 | 3300046663 | Bacteria | 1284 |
| 530 | Ga0495635_0482803 | 3300046663 | Bacteria | 817 |
| 531 | Ga0495588_0079974 | 3300046674 | Bacteria | 1706 |
| 532 | Ga0495657_0080879 | 3300046675 | Bacteria | 2102 |
| 533 | Ga0495623_0240463 | 3300046679 | Bacteria | 1023 |
| 534 | Ga0495649_0174188 | 3300046694 | Bacteria | 1125 |
| 535 | Ga0495660_0093620 | 3300046810 | Bacteria | 1557 |
| 536 | Ga0495604_0034954 | 3300047317 | Bacteria | 3971 |
| 537 | Ga0495674_0036983 | 3300047319 | Bacteria | 4388 |
| 538 | Ga0495672_0096930 | 3300047320 | Bacteria | 1607 |
| 539 | Ga0495683_0064813 | 3300047323 | Bacteria | 1804 |
| 540 | Ga0495675_0227666 | 3300047444 | Bacteria | 1126 |
| 541 | Ga0495677_0088318 | 3300047445 | Bacteria | 1167 |
| 542 | Ga0495684_0254644 | 3300047471 | Bacteria | 1276 |
| 543 | Ga0496100_0009970 | 3300048903 | Bacteria | 5361 |
| 544 | Ga0496100_0060664 | 3300048903 | Bacteria | 2489 |
| 545 | Ga0496100_0153190 | 3300048903 | Bacteria | 1646 |
| 546 | Ga0496100_0372494 | 3300048903 | Bacteria | 1083 |
| 547 | Ga0496100_0569188 | 3300048903 | Bacteria | 878 |
| 548 | Ga0496101_0003395 | 3300048904 | Bacteria | 9935 |
| 549 | Ga0496101_0005998 | 3300048904 | Bacteria | 7792 |
| 550 | Ga0496101_0053137 | 3300048904 | Bacteria | 2922 |
| 551 | Ga0496101_0073020 | 3300048904 | Bacteria | 2519 |
| 552 | Ga0496101_0449525 | 3300048904 | Bacteria | 1016 |
| 553 | Ga0496102_0001253 | 3300048905 | Bacteria | 22878 |
| 554 | Ga0496102_0016004 | 3300048905 | Bacteria | 6547 |
| 555 | Ga0496102_0026325 | 3300048905 | Bacteria | 5186 |
| 556 | Ga0496102_0077997 | 3300048905 | Bacteria | 3049 |
| 557 | Ga0496102_0092320 | 3300048905 | Bacteria | 2803 |
| 558 | Ga0496102_0102732 | 3300048905 | Bacteria | 2657 |
| 559 | Ga0496102_0135297 | 3300048905 | Bacteria | 2309 |
| 560 | Ga0496102_0162939 | 3300048905 | Bacteria | 2098 |
| 561 | Ga0496102_0548759 | 3300048905 | Bacteria | 1078 |
| 562 | Ga0496102_0671372 | 3300048905 | Bacteria | 959 |
| 563 | Ga0496103_0002461 | 3300048906 | Bacteria | 11637 |
| 564 | Ga0496103_0014248 | 3300048906 | Bacteria | 4721 |
| 565 | Ga0496103_0016086 | 3300048906 | Bacteria | 4463 |
| 566 | Ga0496103_0018836 | 3300048906 | Bacteria | 4144 |
| 567 | Ga0496103_0027563 | 3300048906 | Bacteria | 3443 |
| 568 | Ga0496103_0215215 | 3300048906 | Bacteria | 1235 |
| 569 | Ga0496103_0221477 | 3300048906 | Bacteria | 1217 |
| 570 | Ga0496103_0363717 | 3300048906 | Bacteria | 930 |
| 571 | Ga0496104_0000546 | 3300048907 | Bacteria | 32183 |
| 572 | Ga0496104_0025841 | 3300048907 | Bacteria | 5415 |
| 573 | Ga0496104_0048838 | 3300048907 | Bacteria | 3990 |
| 574 | Ga0496104_0051975 | 3300048907 | Bacteria | 3869 |
| 575 | Ga0496104_0164726 | 3300048907 | Bacteria | 2126 |
| 576 | Ga0496104_0189627 | 3300048907 | Bacteria | 1967 |
| 577 | Ga0496104_0211661 | 3300048907 | Bacteria | 1850 |
| 578 | Ga0496104_0235060 | 3300048907 | Bacteria | 1744 |
| 579 | Ga0496104_0418304 | 3300048907 | Bacteria | 1252 |
| 580 | Ga0496104_0681297 | 3300048907 | Bacteria | 936 |
| 581 | Ga0496105_0001973 | 3300048908 | Bacteria | 14762 |
| 582 | Ga0496105_0043182 | 3300048908 | Bacteria | 3717 |
| 583 | Ga0496105_0059563 | 3300048908 | Bacteria | 3150 |
| 584 | Ga0496105_0093282 | 3300048908 | Bacteria | 2486 |
| 585 | Ga0496105_0255147 | 3300048908 | Bacteria | 1420 |
| 586 | Ga0496105_0415361 | 3300048908 | Bacteria | 1066 |
| 587 | Ga0496106_0005321 | 3300048909 | Bacteria | 9532 |
| 588 | Ga0496106_0012196 | 3300048909 | Bacteria | 6342 |
| 589 | Ga0496106_0014231 | 3300048909 | Bacteria | 5876 |
| 590 | Ga0496106_0029362 | 3300048909 | Bacteria | 4097 |
| 591 | Ga0496106_0034894 | 3300048909 | Bacteria | 3759 |
| 592 | Ga0496106_0322211 | 3300048909 | Bacteria | 1240 |
| 593 | Ga0496107_0001086 | 3300048910 | Bacteria | 16332 |
| 594 | Ga0496107_0016640 | 3300048910 | Bacteria | 5167 |
| 595 | Ga0496107_0196684 | 3300048910 | Bacteria | 1498 |
| 596 | Ga0496108_0004135 | 3300048911 | Bacteria | 11665 |
| 597 | Ga0496108_0014544 | 3300048911 | Bacteria | 6425 |
| 598 | Ga0496108_0020230 | 3300048911 | Bacteria | 5469 |
| 599 | Ga0496108_0038858 | 3300048911 | Bacteria | 3966 |
| 600 | Ga0496108_0090774 | 3300048911 | Bacteria | 2597 |
| 601 | Ga0496108_0155121 | 3300048911 | Bacteria | 1977 |
| 602 | Ga0496108_0735993 | 3300048911 | Bacteria | 854 |
| 603 | Ga0496109_0000938 | 3300048912 | Bacteria | 24150 |
| 604 | Ga0496109_0029534 | 3300048912 | Bacteria | 4911 |
| 605 | Ga0496109_0033180 | 3300048912 | Bacteria | 4643 |
| 606 | Ga0496109_0070633 | 3300048912 | Bacteria | 3205 |
| 607 | Ga0496109_0293617 | 3300048912 | Bacteria | 1532 |
| 608 | Ga0496109_0365111 | 3300048912 | Bacteria | 1364 |
| 609 | Ga0496109_0621770 | 3300048912 | Bacteria | 1016 |
| 610 | Ga0496110_0031715 | 3300048913 | Bacteria | 4561 |
| 611 | Ga0496110_0035553 | 3300048913 | Bacteria | 4322 |
| 612 | Ga0496110_0068137 | 3300048913 | Bacteria | 3149 |
| 613 | Ga0496110_0092490 | 3300048913 | Bacteria | 2706 |
| 614 | Ga0496110_0397628 | 3300048913 | Bacteria | 1256 |
| 615 | Ga0496110_0475743 | 3300048913 | Bacteria | 1138 |
| 616 | Ga0496110_0540906 | 3300048913 | Bacteria | 1059 |
| 617 | Ga0496110_0629315 | 3300048913 | Bacteria | 972 |
| 618 | Ga0496111_0003428 | 3300048914 | Bacteria | 9806 |
| 619 | Ga0496111_0006183 | 3300048914 | Bacteria | 7752 |
| 620 | Ga0496111_0014466 | 3300048914 | Bacteria | 5391 |
| 621 | Ga0496111_0040563 | 3300048914 | Bacteria | 3339 |
| 622 | Ga0496112_0000907 | 3300048915 | Bacteria | 21371 |
| 623 | Ga0496112_0003202 | 3300048915 | Bacteria | 13472 |
| 624 | Ga0496112_0016652 | 3300048915 | Bacteria | 6892 |
| 625 | Ga0496112_0018621 | 3300048915 | Bacteria | 6542 |
| 626 | Ga0496112_0051244 | 3300048915 | Bacteria | 4048 |
| 627 | Ga0496112_0095533 | 3300048915 | Bacteria | 2942 |
| 628 | Ga0496112_0106534 | 3300048915 | Bacteria | 2773 |
| 629 | Ga0496113_0000155 | 3300048916 | Bacteria | 30022 |
| 630 | Ga0496113_0027299 | 3300048916 | Bacteria | 4092 |
| 631 | Ga0496113_0161877 | 3300048916 | Bacteria | 1769 |
| 632 | Ga0496113_0197557 | 3300048916 | Bacteria | 1598 |
| 633 | Ga0496113_0324352 | 3300048916 | Bacteria | 1234 |
| 634 | Ga0496114_0002377 | 3300048917 | Bacteria | 14310 |
| 635 | Ga0496114_0031017 | 3300048917 | Bacteria | 4397 |
| 636 | Ga0496114_0089913 | 3300048917 | Bacteria | 2606 |
| 637 | Ga0496114_0526195 | 3300048917 | Bacteria | 1045 |
| 638 | Ga0496114_0574761 | 3300048917 | Bacteria | 995 |
| 639 | Ga0496115_0022593 | 3300048918 | Bacteria | 4876 |
| 640 | Ga0496115_0096587 | 3300048918 | Bacteria | 2419 |
| 641 | Ga0496115_0175492 | 3300048918 | Bacteria | 1772 |
| 642 | Ga0496115_0236370 | 3300048918 | Bacteria | 1506 |
| 643 | Ga0496115_0800883 | 3300048918 | Bacteria | 733 |
| 644 | Ga0496116_0034283 | 3300048919 | Bacteria | 3584 |
| 645 | Ga0496116_0111385 | 3300048919 | Bacteria | 1608 |
| 646 | Ga0496117_0038338 | 3300048920 | Bacteria | 3556 |
| 647 | Ga0496117_0188302 | 3300048920 | Bacteria | 1179 |
| 648 | Ga0496119_0000055 | 3300048922 | Bacteria | 180121 |
| 649 | Ga0496119_0006558 | 3300048922 | Bacteria | 10735 |
| 650 | Ga0496120_0032458 | 3300048923 | Bacteria | 3148 |
| 651 | Ga0496120_0033598 | 3300048923 | Bacteria | 3081 |
| 652 | Ga0496120_0058898 | 3300048923 | Bacteria | 2155 |
| 653 | Ga0496121_0065339 | 3300048924 | Bacteria | 2960 |
| 654 | Ga0496121_0066205 | 3300048924 | Bacteria | 2935 |
| 655 | Ga0496122_0038832 | 3300048925 | Bacteria | 3805 |
| 656 | Ga0496122_0042752 | 3300048925 | Bacteria | 3560 |
| 657 | Ga0496122_0143398 | 3300048925 | Unclassified | 1489 |
| 658 | Ga0496123_0141033 | 3300048926 | Unclassified | 1317 |
| 659 | Ga0496124_0005559 | 3300048927 | Bacteria | 14119 |
| 660 | Ga0496124_0018229 | 3300048927 | Bacteria | 6581 |
| 661 | Ga0496124_0083478 | 3300048927 | Bacteria | 2621 |
| 662 | Ga0496124_0095692 | 3300048927 | Bacteria | 2413 |
| 663 | Ga0496124_0168982 | 3300048927 | Bacteria | 1696 |
| 664 | Ga0496124_0437447 | 3300048927 | Bacteria | 896 |
| 665 | Ga0496125_0004429 | 3300048928 | Bacteria | 16207 |
| 666 | Ga0496126_0022478 | 3300048929 | Bacteria | 6136 |
| 667 | Ga0496126_0059163 | 3300048929 | Bacteria | 3451 |
| 668 | Ga0496126_0095773 | 3300048929 | Bacteria | 2603 |
| 669 | Ga0501031_0000752 | 3300049568 | Bacteria | 19504 |
| 670 | Ga0501031_0011081 | 3300049568 | Bacteria | 5876 |
| 671 | Ga0501032_0002341 | 3300049569 | Bacteria | 14858 |
| 672 | Ga0501032_0017772 | 3300049569 | Bacteria | 4991 |
| 673 | Ga0501032_0028361 | 3300049569 | Bacteria | 3847 |
| 674 | Ga0501033_0001065 | 3300049570 | Bacteria | 25048 |
| 675 | Ga0501033_0002108 | 3300049570 | Bacteria | 17222 |
| 676 | Ga0501033_0104850 | 3300049570 | Bacteria | 2061 |
| 677 | Ga0501033_0133672 | 3300049570 | Bacteria | 1795 |
| 678 | Ga0501033_0188305 | 3300049570 | Bacteria | 1477 |
| 679 | Ga0501034_0027325 | 3300049571 | Bacteria | 5804 |
| 680 | Ga0501034_0029177 | 3300049571 | Bacteria | 5608 |
| 681 | Ga0501034_0029851 | 3300049571 | Bacteria | 5541 |
| 682 | Ga0501034_0185334 | 3300049571 | Bacteria | 2045 |
| 683 | Ga0501036_0000867 | 3300049572 | Bacteria | 22512 |
| 684 | Ga0501036_0002042 | 3300049572 | Bacteria | 15721 |
| 685 | Ga0501036_0008657 | 3300049572 | Bacteria | 8348 |
| 686 | Ga0501036_0022863 | 3300049572 | Bacteria | 5263 |
| 687 | Ga0501036_0174250 | 3300049572 | Bacteria | 1812 |
| 688 | Ga0501037_0008086 | 3300049573 | Bacteria | 7706 |
| 689 | Ga0501037_0010476 | 3300049573 | Bacteria | 6809 |
| 690 | Ga0501037_0018431 | 3300049573 | Bacteria | 5146 |
| 691 | Ga0501037_0043979 | 3300049573 | Bacteria | 3281 |
| 692 | Ga0501038_0000675 | 3300049574 | Bacteria | 30401 |
| 693 | Ga0501038_0001411 | 3300049574 | Bacteria | 22000 |
| 694 | Ga0501038_0005982 | 3300049574 | Bacteria | 11253 |
| 695 | Ga0501038_0099140 | 3300049574 | Bacteria | 2429 |
| 696 | Ga0501039_0001531 | 3300049575 | Bacteria | 17007 |
| 697 | Ga0501039_0013991 | 3300049575 | Bacteria | 6139 |
| 698 | Ga0501039_0015698 | 3300049575 | Bacteria | 5793 |
| 699 | Ga0501039_0106664 | 3300049575 | Bacteria | 2188 |
| 700 | Ga0501039_0188489 | 3300049575 | Bacteria | 1622 |
| 701 | Ga0501040_0084886 | 3300049576 | Bacteria | 2197 |
| 702 | Ga0501040_0192006 | 3300049576 | Bacteria | 1449 |
| 703 | Ga0501040_0194023 | 3300049576 | Bacteria | 1442 |
| 704 | Ga0501041_0040277 | 3300049577 | Bacteria | 2836 |
| 705 | Ga0501042_0014307 | 3300049578 | Bacteria | 5415 |
| 706 | Ga0501042_0114176 | 3300049578 | Bacteria | 1945 |
| 707 | Ga0501042_0138665 | 3300049578 | Bacteria | 1753 |
| 708 | Ga0501043_0002968 | 3300049579 | Bacteria | 14139 |
| 709 | Ga0501043_0018008 | 3300049579 | Bacteria | 5540 |
| 710 | Ga0501043_0023904 | 3300049579 | Bacteria | 4793 |
| 711 | Ga0501043_0027990 | 3300049579 | Bacteria | 4423 |
| 712 | Ga0501043_0408040 | 3300049579 | Bacteria | 1026 |
| 713 | Ga0501046_0000841 | 3300049580 | Bacteria | 29918 |
| 714 | Ga0501046_0007097 | 3300049580 | Bacteria | 9860 |
| 715 | Ga0501046_0028827 | 3300049580 | Bacteria | 4517 |
| 716 | Ga0501046_0109419 | 3300049580 | Bacteria | 2112 |
| 717 | Ga0501047_0004414 | 3300049581 | Bacteria | 13248 |
| 718 | Ga0501047_0026928 | 3300049581 | Bacteria | 5535 |
| 719 | Ga0501047_0029239 | 3300049581 | Bacteria | 5314 |
| 720 | Ga0501048_0001346 | 3300049582 | Bacteria | 18637 |
| 721 | Ga0501048_0062411 | 3300049582 | Bacteria | 2637 |
| 722 | Ga0501048_0102397 | 3300049582 | Bacteria | 2020 |
| 723 | Ga0501067_0001915 | 3300049583 | Bacteria | 11443 |
| 724 | Ga0501067_0004646 | 3300049583 | Bacteria | 7609 |
| 725 | Ga0501067_0004983 | 3300049583 | Bacteria | 7379 |
| 726 | Ga0501067_0035724 | 3300049583 | Bacteria | 2759 |
| 727 | Ga0501067_0102813 | 3300049583 | Bacteria | 1587 |
| 728 | Ga0501067_0146652 | 3300049583 | Bacteria | 1315 |
| 729 | Ga0501068_0018161 | 3300049584 | Bacteria | 4072 |
| 730 | Ga0501068_0198980 | 3300049584 | Bacteria | 1270 |
| 731 | Ga0501069_0000486 | 3300049585 | Bacteria | 18160 |
| 732 | Ga0501069_0001048 | 3300049585 | Bacteria | 13212 |
| 733 | Ga0501069_0003084 | 3300049585 | Bacteria | 8533 |
| 734 | Ga0501069_0055912 | 3300049585 | Bacteria | 2198 |
| 735 | Ga0501070_0008158 | 3300049586 | Bacteria | 8858 |
| 736 | Ga0501070_0019148 | 3300049586 | Bacteria | 5742 |
| 737 | Ga0501070_0058761 | 3300049586 | Bacteria | 3187 |
| 738 | Ga0501071_0063746 | 3300049587 | Bacteria | 2673 |
| 739 | Ga0501071_0120107 | 3300049587 | Bacteria | 1948 |
| 740 | Ga0501072_0037972 | 3300049588 | Bacteria | 3779 |
| 741 | Ga0501072_0124490 | 3300049588 | Bacteria | 2054 |
| 742 | Ga0501073_0029715 | 3300049589 | Bacteria | 3905 |
| 743 | Ga0501073_0125320 | 3300049589 | Bacteria | 1780 |
| 744 | Ga0501073_0226931 | 3300049589 | Bacteria | 1290 |
| 745 | Ga0501073_0316134 | 3300049589 | Bacteria | 1077 |
| 746 | Ga0501074_0000833 | 3300049590 | Bacteria | 19581 |
| 747 | Ga0501074_0004359 | 3300049590 | Bacteria | 10104 |
| 748 | Ga0501074_0014170 | 3300049590 | Bacteria | 5798 |
| 749 | Ga0501074_0037812 | 3300049590 | Bacteria | 3498 |
| 750 | Ga0501074_0051005 | 3300049590 | Bacteria | 2986 |
| 751 | Ga0501076_0456106 | 3300049592 | Bacteria | 1052 |
| 752 | Ga0501076_0792511 | 3300049592 | Bacteria | 782 |
| 753 | Ga0501077_0024498 | 3300049593 | Bacteria | 3832 |
| 754 | Ga0501077_0079251 | 3300049593 | Bacteria | 2081 |
| 755 | Ga0501209_112440 | 3300049656 | Bacteria | 804 |
| 756 | Ga0501079_0370950 | 3300049741 | Bacteria | 1122 |
| 757 | Ga0501080_0005335 | 3300049742 | Bacteria | 11453 |
| 758 | Ga0501080_0046143 | 3300049742 | Bacteria | 4058 |
| 759 | Ga0501080_0380359 | 3300049742 | Bacteria | 1272 |
| 760 | Ga0501080_0707807 | 3300049742 | Bacteria | 888 |
| 761 | Ga0501083_0027945 | 3300049744 | Bacteria | 3889 |
| 762 | Ga0501083_0034257 | 3300049744 | Bacteria | 3473 |
| 763 | Ga0501083_0069875 | 3300049744 | Bacteria | 2336 |
| 764 | Ga0501035_0002522 | 3300049822 | Bacteria | 17914 |
| 765 | Ga0501035_0010212 | 3300049822 | Bacteria | 8714 |
| 766 | Ga0501035_0044188 | 3300049822 | Bacteria | 4012 |
| 767 | Ga0501035_0322122 | 3300049822 | Bacteria | 1298 |
| 768 | Ga0501044_0024097 | 3300049823 | Bacteria | 6466 |
| 769 | Ga0501044_0034809 | 3300049823 | Bacteria | 5279 |
| 770 | Ga0501044_0043242 | 3300049823 | Bacteria | 4681 |
| 771 | Ga0501044_0077818 | 3300049823 | Bacteria | 3362 |
| 772 | Ga0501045_0106765 | 3300049824 | Bacteria | 2075 |
| 773 | nmdc:mga03n38_1320_c1 | 3300050490 | Bacteria | 7014 |
| 774 | nmdc:mga03n38_148739_c1 | 3300050490 | Bacteria | 1177 |
| 775 | nmdc:mga03n38_216782_c1 | 3300050490 | Bacteria | 997 |
| 776 | nmdc:mga03n38_281064_c1 | 3300050490 | Bacteria | 888 |
| 777 | nmdc:mga00v17_113448_c1 | 3300050491 | Bacteria | 1721 |
| 778 | nmdc:mga00v17_15144_c1 | 3300050491 | Bacteria | 4324 |
| 779 | nmdc:mga00v17_17946_c2 | 3300050491 | Bacteria | 3272 |
| 780 | nmdc:mga00v17_203894_c1 | 3300050491 | Bacteria | 1279 |
| 781 | nmdc:mga00v17_281529_c1 | 3300050491 | Bacteria | 1079 |
| 782 | nmdc:mga00v17_72469_c1 | 3300050491 | Bacteria | 2137 |
| 783 | nmdc:mga0yw44_101340_c1 | 3300050492 | Bacteria | 1834 |
| 784 | nmdc:mga0yw44_14440_c1 | 3300050492 | Bacteria | 4194 |
| 785 | nmdc:mga0yw44_3123_c1 | 3300050492 | Bacteria | 7271 |
| 786 | nmdc:mga0yw44_393927_c1 | 3300050492 | Bacteria | 936 |
| 787 | nmdc:mga0yw44_406627_c1 | 3300050492 | Bacteria | 921 |
| 788 | nmdc:mga0yw44_411809_c1 | 3300050492 | Bacteria | 915 |
| 789 | nmdc:mga0yw44_46306_c1 | 3300050492 | Bacteria | 2611 |
| 790 | nmdc:mga0yw44_53656_c1 | 3300050492 | Bacteria | 2448 |
| 791 | nmdc:mga0yw44_746_c1 | 3300050492 | Bacteria | 12040 |
| 792 | nmdc:mga0yw44_91179_c1 | 3300050492 | Bacteria | 1926 |
| 793 | nmdc:mga0yw44_9146_c1 | 3300050492 | Bacteria | 4985 |
| 794 | nmdc:mga06z11_152480_c1 | 3300050494 | Bacteria | 1315 |
| 795 | nmdc:mga06z11_2345_c1 | 3300050494 | Bacteria | 7216 |
| 796 | nmdc:mga06z11_366885_c1 | 3300050494 | Bacteria | 864 |
| 797 | nmdc:mga04h51_15119_c1 | 3300050495 | Bacteria | 2219 |
| 798 | nmdc:mga07m45_134999_c1 | 3300050496 | Bacteria | 1428 |
| 799 | nmdc:mga07m45_13854_c1 | 3300050496 | Bacteria | 4285 |
| 800 | nmdc:mga07m45_147052_c1 | 3300050496 | Bacteria | 1366 |
| 801 | nmdc:mga07m45_4164_c1 | 3300050496 | Bacteria | 7064 |
| 802 | nmdc:mga07m45_75985_c1 | 3300050496 | Bacteria | 1915 |
| 803 | nmdc:mga05p37_125501_c1 | 3300050507 | Bacteria | 3152 |
| 804 | nmdc:mga05p37_153476_c1 | 3300050507 | Bacteria | 2815 |
| 805 | nmdc:mga05p37_613169_c1 | 3300050507 | Bacteria | 1226 |
| 806 | nmdc:mga09592_9965_c1 | 3300050508 | Bacteria | 7730 |
| 807 | nmdc:mga06r32_239510_c1 | 3300050510 | Bacteria | 1802 |
| 808 | nmdc:mga08y16_488886_c1 | 3300050511 | Bacteria | 1252 |
| 809 | nmdc:mga0n895_130027_c1 | 3300050512 | Bacteria | 2543 |
| 810 | nmdc:mga08x19_7683_c1 | 3300050514 | Bacteria | 6402 |
| 811 | nmdc:mga0a205_62866_c1 | 3300050515 | Bacteria | 3586 |
| 812 | nmdc:mga0sz30_6878_c2 | 3300050516 | Bacteria | 3368 |
| 813 | Ga0500635_0142687 | 3300053080 | Bacteria | 909 |
| 814 | Ga0495595_0093442 | 3300053084 | Bacteria | 1445 |
| 815 | Ga0495595_0101718 | 3300053084 | Bacteria | 1388 |
| 816 | Ga0495595_0126560 | 3300053084 | Bacteria | 1247 |
| 817 | Ga0495619_0135319 | 3300053085 | Bacteria | 1695 |
| 818 | Ga0495619_0324102 | 3300053085 | Bacteria | 1066 |
| 819 | Ga0500644_0000143 | 3300053088 | Bacteria | 44243 |
| 820 | Ga0500644_0140846 | 3300053088 | Bacteria | 958 |
| 821 | Ga0500556_0000502 | 3300053104 | Bacteria | 27054 |
| 822 | Ga0500593_000518 | 3300053117 | Bacteria | 15122 |
| 823 | Ga0500608_048138 | 3300053122 | Bacteria | 2048 |
| 824 | Ga0500618_006516 | 3300053125 | Bacteria | 3417 |
| 825 | Ga0500618_012194 | 3300053125 | Bacteria | 2256 |
| 826 | Ga0500655_054436 | 3300053133 | Bacteria | 800 |
| 827 | Ga0500559_0002295 | 3300053136 | Bacteria | 10052 |
| 828 | Ga0500568_0056513 | 3300053139 | Bacteria | 1530 |
| 829 | Ga0500573_0030579 | 3300053140 | Bacteria | 3106 |
| 830 | Ga0500573_0038905 | 3300053140 | Bacteria | 2748 |
| 831 | Ga0500603_135235 | 3300053150 | Bacteria | 756 |
| 832 | Ga0500622_0001044 | 3300053156 | Bacteria | 23122 |
| 833 | Ga0501084_0003690 | 3300054114 | Bacteria | 12430 |
| 834 | Ga0501084_0042123 | 3300054114 | Bacteria | 3819 |
| 835 | Ga0501084_0589844 | 3300054114 | Bacteria | 939 |
| 836 | Ga0501082_0271445 | 3300060353 | Bacteria | 1476 |
| 837 | Ga0466962_0000302 | 3300061719 | Bacteria | 21145 |
| 838 | Ga0466962_0085480 | 3300061719 | Bacteria | 1510 |
| 839 | Ga0466962_0152746 | 3300061719 | Bacteria | 1120 |
| 840 | Ga0466962_0216167 | 3300061719 | Bacteria | 938 |
| 841 | Ga0530510_0260945 | 3300061734 | Bacteria | 1292 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003761 | Ga0055535_1001381 | Ga0055535_10013815 | 195 |
| 2 | 3300044719 | Ga0466971_0162883 | Ga0466971_0162883_10_639 | 208 |
| 3 | 3300044842 | Ga0466957_0801025 | Ga0466957_0801025_18_644 | 208 |
| 4 | 3300045976 | Ga0466967_0191434 | Ga0466967_0191434_12_638 | 208 |
| 5 | iso_pu_bacteria | 2643221599 | 2644004481 | 209 |
| 6 | 3300005435 | Ga0070714_100123250 | Ga0070714_1001232502 | 210 |
| 7 | iso_pu_bacteria | 2524023129 | 2524187488 | 210 |
| 8 | iso_pu_bacteria | 2671180694 | 2673821067 | 210 |
| 9 | iso_pu_bacteria | 2744054657 | 2745166211 | 210 |
| 10 | iso_pu_bacteria | 2816332336 | 2817618104 | 210 |
| 11 | iso_pu_bacteria | 2818991459 | 2819674456 | 210 |
| 12 | 3300005339 | Ga0070660_100166576 | Ga0070660_1001665761 | 211 |
| 13 | 3300005341 | Ga0070691_10057368 | Ga0070691_100573682 | 211 |
| 14 | 3300005457 | Ga0070662_100109898 | Ga0070662_1001098982 | 211 |
| 15 | 3300005615 | Ga0070702_100066152 | Ga0070702_1000661522 | 211 |
| 16 | 3300005718 | Ga0068866_10003247 | Ga0068866_100032477 | 211 |
| 17 | 3300005719 | Ga0068861_100111931 | Ga0068861_1001119312 | 211 |
| 18 | 3300005981 | Ga0081538_10022577 | Ga0081538_100225775 | 211 |
| 19 | 3300006881 | Ga0068865_100007888 | Ga0068865_1000078882 | 211 |
| 20 | 3300009148 | Ga0105243_10104527 | Ga0105243_101045271 | 211 |
| 21 | 3300009551 | Ga0105238_10523649 | Ga0105238_105236491 | 211 |
| 22 | 3300009553 | Ga0105249_10380398 | Ga0105249_103803981 | 211 |
| 23 | 3300010375 | Ga0105239_10116670 | Ga0105239_101166702 | 211 |
| 24 | 3300013307 | Ga0157372_10024536 | Ga0157372_100245368 | 211 |
| 25 | 3300014326 | Ga0157380_10804425 | Ga0157380_108044251 | 211 |
| 26 | 3300014497 | Ga0182008_10099700 | Ga0182008_100997002 | 211 |
| 27 | 3300031731 | Ga0307405_10061467 | Ga0307405_100614672 | 211 |
| 28 | 3300047445 | Ga0495677_0088318 | Ga0495677_0088318_330_1067 | 211 |
| 29 | 3300025224 | Ga0209784_102716 | Ga0209784_1027162 | 212 |
| 30 | 3300025242 | Ga0209258_100713 | Ga0209258_10071310 | 212 |
| 31 | 3300025294 | Ga0209025_1027911 | Ga0209025_10279114 | 212 |
| 32 | 3300027111 | Ga0209281_1000097 | Ga0209281_1000097141 | 212 |
| 33 | 3300027111 | Ga0209281_1002422 | Ga0209281_10024222 | 212 |
| 34 | 3300048925 | Ga0496122_0042752 | Ga0496122_0042752_1568_2233 | 212 |
| 35 | 3300048925 | Ga0496122_0143398 | Ga0496122_0143398_157_822 | 212 |
| 36 | 3300005434 | Ga0070709_10019568 | Ga0070709_100195684 | 213 |
| 37 | 3300006028 | Ga0070717_10186285 | Ga0070717_101862852 | 213 |
| 38 | 3300025929 | Ga0207664_10213691 | Ga0207664_102136912 | 213 |
| 39 | iso_pu_bacteria | 2558860983 | 2561467930 | 213 |
| 40 | 3300005356 | Ga0070674_100240561 | Ga0070674_1002405612 | 214 |
| 41 | iso_pu_bacteria | 8005658619 | 8005661459 | 214 |
| 42 | iso_pu_bacteria | 8055431914 | 8055433756 | 214 |
| 43 | 3300005843 | Ga0068860_100114307 | Ga0068860_1001143072 | 215 |
| 44 | 3300006163 | Ga0070715_10046904 | Ga0070715_100469042 | 215 |
| 45 | 3300025905 | Ga0207685_10107858 | Ga0207685_101078582 | 215 |
| 46 | 3300025906 | Ga0207699_10139336 | Ga0207699_101393362 | 215 |
| 47 | 3300026035 | Ga0207703_10279525 | Ga0207703_102795252 | 215 |
| 48 | 3300027111 | Ga0209281_1000844 | Ga0209281_100084424 | 215 |
| 49 | 3300048911 | Ga0496108_0735993 | Ga0496108_0735993_21_668 | 215 |
| 50 | 3300048918 | Ga0496115_0800883 | Ga0496115_0800883_20_667 | 215 |
| 51 | 3300049570 | Ga0501033_0188305 | Ga0501033_0188305_199_846 | 215 |
| 52 | 3300049572 | Ga0501036_0002042 | Ga0501036_0002042_13827_14474 | 215 |
| 53 | 3300049573 | Ga0501037_0043979 | Ga0501037_0043979_2074_2721 | 215 |
| 54 | 3300049575 | Ga0501039_0013991 | Ga0501039_0013991_4921_5568 | 215 |
| 55 | 3300049579 | Ga0501043_0023904 | Ga0501043_0023904_3705_4352 | 215 |
| 56 | 3300049580 | Ga0501046_0028827 | Ga0501046_0028827_1112_1759 | 215 |
| 57 | 3300049582 | Ga0501048_0102397 | Ga0501048_0102397_480_1127 | 215 |
| 58 | 3300049583 | Ga0501067_0001915 | Ga0501067_0001915_10369_11016 | 215 |
| 59 | 3300049584 | Ga0501068_0198980 | Ga0501068_0198980_389_1036 | 215 |
| 60 | 3300049585 | Ga0501069_0055912 | Ga0501069_0055912_1224_1871 | 215 |
| 61 | 3300049587 | Ga0501071_0120107 | Ga0501071_0120107_919_1566 | 215 |
| 62 | 3300049589 | Ga0501073_0029715 | Ga0501073_0029715_544_1191 | 215 |
| 63 | 3300049590 | Ga0501074_0051005 | Ga0501074_0051005_225_872 | 215 |
| 64 | 3300049744 | Ga0501083_0034257 | Ga0501083_0034257_1884_2531 | 215 |
| 65 | 3300049822 | Ga0501035_0044188 | Ga0501035_0044188_2118_2765 | 215 |
| 66 | 3300049823 | Ga0501044_0034809 | Ga0501044_0034809_1225_1872 | 215 |
| 67 | 3300049824 | Ga0501045_0106765 | Ga0501045_0106765_600_1247 | 215 |
| 68 | 3300054114 | Ga0501084_0042123 | Ga0501084_0042123_3093_3740 | 215 |
| 69 | iso_pu_bacteria | 2510917028 | 2511185394 | 215 |
| 70 | iso_pu_bacteria | 2516143018 | 2516204785 | 215 |
| 71 | iso_pu_bacteria | 2534681796 | 2535514638 | 215 |
| 72 | iso_pu_bacteria | 2582581294 | 2585201212 | 215 |
| 73 | iso_pu_bacteria | 2600254933 | 2600373975 | 215 |
| 74 | iso_pu_bacteria | 2643221557 | 2643805835 | 215 |
| 75 | iso_pu_bacteria | 2643221607 | 2644048699 | 215 |
| 76 | iso_pu_bacteria | 2643221610 | 2644066011 | 215 |
| 77 | iso_pu_bacteria | 2643221636 | 2644201982 | 215 |
| 78 | iso_pu_bacteria | 2643221668 | 2644380315 | 215 |
| 79 | iso_pu_bacteria | 2643221675 | 2644417342 | 215 |
| 80 | iso_pu_bacteria | 2643221680 | 2644450738 | 215 |
| 81 | iso_pu_bacteria | 2643221686 | 2644481501 | 215 |
| 82 | iso_pu_bacteria | 2643221726 | 2644692837 | 215 |
| 83 | iso_pu_bacteria | 2643221731 | 2644718534 | 215 |
| 84 | iso_pu_bacteria | 2690316117 | 2692317704 | 215 |
| 85 | iso_pu_bacteria | 2751185821 | 2753459907 | 215 |
| 86 | iso_pu_bacteria | 2791355091 | 2792621015 | 215 |
| 87 | iso_pu_bacteria | 2791355092 | 2792625230 | 215 |
| 88 | iso_pu_bacteria | 2791355094 | 2792637658 | 215 |
| 89 | iso_pu_bacteria | 2818991461 | 2819686766 | 215 |
| 90 | iso_pu_bacteria | 2818991465 | 2819712129 | 215 |
| 91 | iso_pu_bacteria | 2842882022 | 2842887992 | 215 |
| 92 | iso_pu_bacteria | 2847417321 | 2847421317 | 215 |
| 93 | iso_pu_bacteria | 2848992105 | 2848996104 | 215 |
| 94 | iso_pu_bacteria | 2855872281 | 2855877812 | 215 |
| 95 | iso_pu_bacteria | 2904524088 | 2904530242 | 215 |
| 96 | iso_pu_bacteria | 2919143609 | 2919149516 | 215 |
| 97 | iso_pu_bacteria | 2919517244 | 2919523078 | 215 |
| 98 | iso_pu_bacteria | 2919720352 | 2919726235 | 215 |
| 99 | iso_pu_bacteria | 2920822456 | 2920822873 | 215 |
| 100 | iso_pu_bacteria | 2928093941 | 2928099745 | 215 |
| 101 | iso_pu_bacteria | 2929004312 | 2929010255 | 215 |
| 102 | iso_pu_bacteria | 2960319331 | 2960323196 | 215 |
| 103 | iso_pu_bacteria | 2960375949 | 2960379820 | 215 |
| 104 | iso_pu_bacteria | 643692032 | 643827807 | 215 |
| 105 | iso_pu_bacteria | 8005542996 | 8005543301 | 215 |
| 106 | iso_pu_bacteria | 8022893055 | 8022896416 | 215 |
| 107 | iso_pu_bacteria | 8022914991 | 8022918160 | 215 |
| 108 | 3300005339 | Ga0070660_100354405 | Ga0070660_1003544051 | 216 |
| 109 | 3300005355 | Ga0070671_100238271 | Ga0070671_1002382712 | 216 |
| 110 | 3300005434 | Ga0070709_10061181 | Ga0070709_100611811 | 216 |
| 111 | 3300005434 | Ga0070709_10476318 | Ga0070709_104763181 | 216 |
| 112 | 3300005435 | Ga0070714_100085997 | Ga0070714_1000859973 | 216 |
| 113 | 3300005436 | Ga0070713_100049430 | Ga0070713_1000494304 | 216 |
| 114 | 3300005436 | Ga0070713_100247463 | Ga0070713_1002474632 | 216 |
| 115 | 3300005437 | Ga0070710_10001036 | Ga0070710_1000103617 | 216 |
| 116 | 3300005439 | Ga0070711_100057175 | Ga0070711_1000571753 | 216 |
| 117 | 3300005439 | Ga0070711_100210221 | Ga0070711_1002102212 | 216 |
| 118 | 3300005439 | Ga0070711_100462342 | Ga0070711_1004623422 | 216 |
| 119 | 3300005458 | Ga0070681_10717680 | Ga0070681_107176801 | 216 |
| 120 | 3300005468 | Ga0070707_100420649 | Ga0070707_1004206492 | 216 |
| 121 | 3300005535 | Ga0070684_100501214 | Ga0070684_1005012142 | 216 |
| 122 | 3300005545 | Ga0070695_100834399 | Ga0070695_1008343991 | 216 |
| 123 | 3300005546 | Ga0070696_100036428 | Ga0070696_1000364283 | 216 |
| 124 | 3300006173 | Ga0070716_100048576 | Ga0070716_1000485762 | 216 |
| 125 | 3300009093 | Ga0105240_10033798 | Ga0105240_100337984 | 216 |
| 126 | 3300009093 | Ga0105240_10317937 | Ga0105240_103179372 | 216 |
| 127 | 3300009098 | Ga0105245_10205224 | Ga0105245_102052242 | 216 |
| 128 | 3300009176 | Ga0105242_10432278 | Ga0105242_104322782 | 216 |
| 129 | 3300009545 | Ga0105237_10013297 | Ga0105237_100132978 | 216 |
| 130 | 3300009545 | Ga0105237_10225311 | Ga0105237_102253113 | 216 |
| 131 | 3300011119 | Ga0105246_10127366 | Ga0105246_101273663 | 216 |
| 132 | 3300013105 | Ga0157369_10744742 | Ga0157369_107447421 | 216 |
| 133 | 3300013296 | Ga0157374_10122402 | Ga0157374_101224022 | 216 |
| 134 | 3300013297 | Ga0157378_10317988 | Ga0157378_103179882 | 216 |
| 135 | 3300014968 | Ga0157379_10188016 | Ga0157379_101880161 | 216 |
| 136 | 3300014969 | Ga0157376_10105516 | Ga0157376_101055162 | 216 |
| 137 | 3300025911 | Ga0207654_10024058 | Ga0207654_100240582 | 216 |
| 138 | 3300025928 | Ga0207700_10203761 | Ga0207700_102037611 | 216 |
| 139 | 3300026089 | Ga0207648_10619589 | Ga0207648_106195892 | 216 |
| 140 | 3300035114 | Ga0373939_0089614 | Ga0373939_0089614_83_733 | 216 |
| 141 | 3300035115 | Ga0373941_0210546 | Ga0373941_0210546_58_708 | 216 |
| 142 | 3300037466 | Ga0395898_0406943 | Ga0395898_0406943_533_1183 | 216 |
| 143 | 3300044901 | Ga0466960_0084883 | Ga0466960_0084883_862_1530 | 216 |
| 144 | 3300045976 | Ga0466967_0027096 | Ga0466967_0027096_3464_4132 | 216 |
| 145 | 3300046517 | Ga0495630_0128973 | Ga0495630_0128973_789_1439 | 216 |
| 146 | 3300046559 | Ga0495667_0096875 | Ga0495667_0096875_423_1073 | 216 |
| 147 | 3300046674 | Ga0495588_0079974 | Ga0495588_0079974_763_1413 | 216 |
| 148 | 3300046675 | Ga0495657_0080879 | Ga0495657_0080879_1129_1779 | 216 |
| 149 | 3300048903 | Ga0496100_0060664 | Ga0496100_0060664_1338_1988 | 216 |
| 150 | 3300048903 | Ga0496100_0569188 | Ga0496100_0569188_171_821 | 216 |
| 151 | 3300048904 | Ga0496101_0073020 | Ga0496101_0073020_1368_2018 | 216 |
| 152 | 3300048904 | Ga0496101_0449525 | Ga0496101_0449525_61_711 | 216 |
| 153 | 3300048905 | Ga0496102_0026325 | Ga0496102_0026325_3297_3947 | 216 |
| 154 | 3300048905 | Ga0496102_0092320 | Ga0496102_0092320_1760_2410 | 216 |
| 155 | 3300048906 | Ga0496103_0018836 | Ga0496103_0018836_2464_3114 | 216 |
| 156 | 3300048906 | Ga0496103_0215215 | Ga0496103_0215215_189_839 | 216 |
| 157 | 3300048906 | Ga0496103_0363717 | Ga0496103_0363717_191_841 | 216 |
| 158 | 3300048907 | Ga0496104_0025841 | Ga0496104_0025841_2216_2866 | 216 |
| 159 | 3300048907 | Ga0496104_0211661 | Ga0496104_0211661_444_1094 | 216 |
| 160 | 3300048907 | Ga0496104_0235060 | Ga0496104_0235060_442_1092 | 216 |
| 161 | 3300048908 | Ga0496105_0043182 | Ga0496105_0043182_1512_2162 | 216 |
| 162 | 3300048908 | Ga0496105_0059563 | Ga0496105_0059563_1719_2369 | 216 |
| 163 | 3300048908 | Ga0496105_0093282 | Ga0496105_0093282_1311_1961 | 216 |
| 164 | 3300048908 | Ga0496105_0255147 | Ga0496105_0255147_37_687 | 216 |
| 165 | 3300048909 | Ga0496106_0322211 | Ga0496106_0322211_505_1155 | 216 |
| 166 | 3300048911 | Ga0496108_0020230 | Ga0496108_0020230_4167_4817 | 216 |
| 167 | 3300048912 | Ga0496109_0029534 | Ga0496109_0029534_733_1383 | 216 |
| 168 | 3300048912 | Ga0496109_0621770 | Ga0496109_0621770_47_697 | 216 |
| 169 | 3300048913 | Ga0496110_0092490 | Ga0496110_0092490_1981_2631 | 216 |
| 170 | 3300048915 | Ga0496112_0095533 | Ga0496112_0095533_1184_1834 | 216 |
| 171 | 3300048916 | Ga0496113_0027299 | Ga0496113_0027299_1113_1763 | 216 |
| 172 | 3300048916 | Ga0496113_0197557 | Ga0496113_0197557_554_1204 | 216 |
| 173 | 3300048917 | Ga0496114_0526195 | Ga0496114_0526195_204_854 | 216 |
| 174 | 3300048918 | Ga0496115_0096587 | Ga0496115_0096587_1347_1997 | 216 |
| 175 | 3300048918 | Ga0496115_0236370 | Ga0496115_0236370_555_1205 | 216 |
| 176 | 3300053084 | Ga0495595_0093442 | Ga0495595_0093442_750_1400 | 216 |
| 177 | 3300053084 | Ga0495595_0101718 | Ga0495595_0101718_104_754 | 216 |
| 178 | iso_pu_bacteria | 2582581304 | 2585256345 | 216 |
| 179 | iso_pu_bacteria | 2881636855 | 2881637515 | 216 |
| 180 | iso_pu_bacteria | 3005452660 | 3005456427 | 216 |
| 181 | 3300032126 | Ga0307415_100600606 | Ga0307415_1006006062 | 217 |
| 182 | 3300044658 | Ga0466972_0015450 | Ga0466972_0015450_1087_1851 | 217 |
| 183 | 3300044683 | Ga0466965_0001364 | Ga0466965_0001364_6916_7680 | 217 |
| 184 | 3300044684 | Ga0466966_0014690 | Ga0466966_0014690_293_1057 | 217 |
| 185 | 3300044693 | Ga0466961_0000223 | Ga0466961_0000223_35970_36734 | 217 |
| 186 | 3300044694 | Ga0466963_0013564 | Ga0466963_0013564_3030_3794 | 217 |
| 187 | 3300044719 | Ga0466971_0006327 | Ga0466971_0006327_1744_2508 | 217 |
| 188 | 3300044765 | Ga0466970_0009805 | Ga0466970_0009805_2484_3248 | 217 |
| 189 | 3300044842 | Ga0466957_0000283 | Ga0466957_0000283_6648_7412 | 217 |
| 190 | 3300045049 | Ga0466959_0064828 | Ga0466959_0064828_116_880 | 217 |
| 191 | 3300045976 | Ga0466967_0010091 | Ga0466967_0010091_3794_4558 | 217 |
| 192 | 3300061719 | Ga0466962_0000302 | Ga0466962_0000302_1056_1820 | 217 |
| 193 | 3300032133 | Ga0316583_10006272 | Ga0316583_100062724 | 218 |
| 194 | 3300049568 | Ga0501031_0011081 | Ga0501031_0011081_213_938 | 218 |
| 195 | 3300049569 | Ga0501032_0017772 | Ga0501032_0017772_3794_4519 | 218 |
| 196 | 3300049570 | Ga0501033_0002108 | Ga0501033_0002108_9356_10081 | 218 |
| 197 | 3300049570 | Ga0501033_0104850 | Ga0501033_0104850_199_924 | 218 |
| 198 | 3300049571 | Ga0501034_0185334 | Ga0501034_0185334_630_1355 | 218 |
| 199 | 3300049572 | Ga0501036_0008657 | Ga0501036_0008657_48_773 | 218 |
| 200 | 3300049573 | Ga0501037_0008086 | Ga0501037_0008086_4539_5264 | 218 |
| 201 | 3300049574 | Ga0501038_0005982 | Ga0501038_0005982_8667_9392 | 218 |
| 202 | 3300049575 | Ga0501039_0015698 | Ga0501039_0015698_562_1287 | 218 |
| 203 | 3300049576 | Ga0501040_0192006 | Ga0501040_0192006_356_1081 | 218 |
| 204 | 3300049578 | Ga0501042_0138665 | Ga0501042_0138665_360_1085 | 218 |
| 205 | 3300049579 | Ga0501043_0018008 | Ga0501043_0018008_461_1186 | 218 |
| 206 | 3300049579 | Ga0501043_0027990 | Ga0501043_0027990_275_1000 | 218 |
| 207 | 3300049580 | Ga0501046_0000841 | Ga0501046_0000841_14652_15377 | 218 |
| 208 | 3300049580 | Ga0501046_0109419 | Ga0501046_0109419_1218_1943 | 218 |
| 209 | 3300049581 | Ga0501047_0026928 | Ga0501047_0026928_4171_4896 | 218 |
| 210 | 3300049582 | Ga0501048_0062411 | Ga0501048_0062411_1703_2428 | 218 |
| 211 | 3300049586 | Ga0501070_0019148 | Ga0501070_0019148_755_1480 | 218 |
| 212 | 3300049742 | Ga0501080_0380359 | Ga0501080_0380359_199_924 | 218 |
| 213 | 3300049822 | Ga0501035_0322122 | Ga0501035_0322122_170_895 | 218 |
| 214 | 3300049823 | Ga0501044_0077818 | Ga0501044_0077818_170_895 | 218 |
| 215 | 3300050508 | nmdc:mga09592_9965_c1 | nmdc:mga09592_9965_c1_4215_4895 | 218 |
| 216 | 3300003320 | rootH2_10091126 | rootH2_100911262 | 219 |
| 217 | 3300003322 | rootL2_10113871 | rootL2_101138714 | 219 |
| 218 | 3300003322 | rootL2_10310571 | rootL2_103105712 | 219 |
| 219 | 3300003323 | rootH1_10302260 | rootH1_103022602 | 219 |
| 220 | 3300003578 | Ga0006562J51391_1000951 | Ga0006562J51391_10009517 | 219 |
| 221 | 3300003758 | Ga0055532_1002555 | Ga0055532_10025553 | 219 |
| 222 | 3300003771 | Ga0055526_1050140 | Ga0055526_10501402 | 219 |
| 223 | 3300003775 | Ga0055524_1006468 | Ga0055524_10064684 | 219 |
| 224 | 3300003775 | Ga0055524_1026783 | Ga0055524_10267832 | 219 |
| 225 | 3300003790 | Ga0055528_1001799 | Ga0055528_100179911 | 219 |
| 226 | 3300003790 | Ga0055528_1002733 | Ga0055528_10027334 | 219 |
| 227 | 3300003790 | Ga0055528_1003910 | Ga0055528_10039107 | 219 |
| 228 | 3300003792 | Ga0055540_1007921 | Ga0055540_10079212 | 219 |
| 229 | 3300005262 | Ga0065165_1001643 | Ga0065165_10016435 | 219 |
| 230 | 3300005331 | Ga0070670_100320646 | Ga0070670_1003206461 | 219 |
| 231 | 3300005337 | Ga0070682_100150477 | Ga0070682_1001504772 | 219 |
| 232 | 3300005340 | Ga0070689_100502596 | Ga0070689_1005025962 | 219 |
| 233 | 3300005347 | Ga0070668_100043923 | Ga0070668_1000439232 | 219 |
| 234 | 3300005355 | Ga0070671_100021523 | Ga0070671_1000215233 | 219 |
| 235 | 3300005355 | Ga0070671_100059731 | Ga0070671_1000597312 | 219 |
| 236 | 3300005367 | Ga0070667_100548481 | Ga0070667_1005484812 | 219 |
| 237 | 3300005455 | Ga0070663_100164502 | Ga0070663_1001645022 | 219 |
| 238 | 3300005457 | Ga0070662_100321813 | Ga0070662_1003218131 | 219 |
| 239 | 3300006048 | Ga0075363_100217149 | Ga0075363_1002171492 | 219 |
| 240 | 3300006353 | Ga0075370_10011633 | Ga0075370_100116336 | 219 |
| 241 | 3300006353 | Ga0075370_10126608 | Ga0075370_101266082 | 219 |
| 242 | 3300006847 | Ga0075431_100283624 | Ga0075431_1002836242 | 219 |
| 243 | 3300009011 | Ga0105251_10005738 | Ga0105251_100057386 | 219 |
| 244 | 3300009011 | Ga0105251_10013084 | Ga0105251_100130845 | 219 |
| 245 | 3300009011 | Ga0105251_10023032 | Ga0105251_100230323 | 219 |
| 246 | 3300009036 | Ga0105244_10018182 | Ga0105244_100181822 | 219 |
| 247 | 3300009036 | Ga0105244_10221586 | Ga0105244_102215861 | 219 |
| 248 | 3300009092 | Ga0105250_10009562 | Ga0105250_100095623 | 219 |
| 249 | 3300009092 | Ga0105250_10066317 | Ga0105250_100663172 | 219 |
| 250 | 3300009098 | Ga0105245_10270432 | Ga0105245_102704322 | 219 |
| 251 | 3300009101 | Ga0105247_10049742 | Ga0105247_100497423 | 219 |
| 252 | 3300009148 | Ga0105243_10029624 | Ga0105243_100296243 | 219 |
| 253 | 3300009148 | Ga0105243_10989414 | Ga0105243_109894142 | 219 |
| 254 | 3300009176 | Ga0105242_10081241 | Ga0105242_100812412 | 219 |
| 255 | 3300009553 | Ga0105249_10072069 | Ga0105249_100720695 | 219 |
| 256 | 3300009765 | Ga0123341_1078622 | Ga0123341_10786222 | 219 |
| 257 | 3300010375 | Ga0105239_10083189 | Ga0105239_100831895 | 219 |
| 258 | 3300011119 | Ga0105246_10048722 | Ga0105246_100487222 | 219 |
| 259 | 3300013104 | Ga0157370_10177274 | Ga0157370_101772742 | 219 |
| 260 | 3300013104 | Ga0157370_10380170 | Ga0157370_103801702 | 219 |
| 261 | 3300013296 | Ga0157374_10129426 | Ga0157374_101294262 | 219 |
| 262 | 3300013296 | Ga0157374_10885746 | Ga0157374_108857461 | 219 |
| 263 | 3300013297 | Ga0157378_10026724 | Ga0157378_100267243 | 219 |
| 264 | 3300013307 | Ga0157372_10816815 | Ga0157372_108168151 | 219 |
| 265 | 3300014745 | Ga0157377_10006626 | Ga0157377_100066263 | 219 |
| 266 | 3300014969 | Ga0157376_10004054 | Ga0157376_100040548 | 219 |
| 267 | 3300015690 | Ga0183363_1146 | Ga0183363_11464 | 219 |
| 268 | 3300025229 | Ga0209147_100640 | Ga0209147_10064014 | 219 |
| 269 | 3300025258 | Ga0209129_1000066 | Ga0209129_100006699 | 219 |
| 270 | 3300025258 | Ga0209129_1016456 | Ga0209129_10164562 | 219 |
| 271 | 3300025273 | Ga0209673_1000024 | Ga0209673_1000024165 | 219 |
| 272 | 3300025273 | Ga0209673_1002852 | Ga0209673_100285211 | 219 |
| 273 | 3300025273 | Ga0209673_1008252 | Ga0209673_10082525 | 219 |
| 274 | 3300025273 | Ga0209673_1008507 | Ga0209673_10085072 | 219 |
| 275 | 3300025273 | Ga0209673_1011187 | Ga0209673_10111875 | 219 |
| 276 | 3300025284 | Ga0209130_1033406 | Ga0209130_10334062 | 219 |
| 277 | 3300025294 | Ga0209025_1000275 | Ga0209025_10002752 | 219 |
| 278 | 3300025294 | Ga0209025_1008812 | Ga0209025_100881210 | 219 |
| 279 | 3300025294 | Ga0209025_1018920 | Ga0209025_10189202 | 219 |
| 280 | 3300025294 | Ga0209025_1022379 | Ga0209025_10223792 | 219 |
| 281 | 3300025294 | Ga0209025_1033755 | Ga0209025_10337552 | 219 |
| 282 | 3300025295 | Ga0209564_1003535 | Ga0209564_10035359 | 219 |
| 283 | 3300025295 | Ga0209564_1007247 | Ga0209564_10072472 | 219 |
| 284 | 3300025295 | Ga0209564_1012018 | Ga0209564_10120184 | 219 |
| 285 | 3300025297 | Ga0209758_1036365 | Ga0209758_10363652 | 219 |
| 286 | 3300025299 | Ga0209256_1000027 | Ga0209256_100002710 | 219 |
| 287 | 3300025299 | Ga0209256_1001674 | Ga0209256_100167416 | 219 |
| 288 | 3300025299 | Ga0209256_1003288 | Ga0209256_100328813 | 219 |
| 289 | 3300025299 | Ga0209256_1018687 | Ga0209256_10186874 | 219 |
| 290 | 3300025302 | Ga0207426_1002707 | Ga0207426_10027079 | 219 |
| 291 | 3300025303 | Ga0209051_1006208 | Ga0209051_10062084 | 219 |
| 292 | 3300025303 | Ga0209051_1079549 | Ga0209051_10795492 | 219 |
| 293 | 3300025711 | Ga0207696_1004609 | Ga0207696_10046096 | 219 |
| 294 | 3300025711 | Ga0207696_1016935 | Ga0207696_10169352 | 219 |
| 295 | 3300025728 | Ga0207655_1018102 | Ga0207655_10181025 | 219 |
| 296 | 3300025728 | Ga0207655_1018154 | Ga0207655_10181544 | 219 |
| 297 | 3300025728 | Ga0207655_1032487 | Ga0207655_10324873 | 219 |
| 298 | 3300025735 | Ga0207713_1000851 | Ga0207713_100085126 | 219 |
| 299 | 3300025735 | Ga0207713_1012854 | Ga0207713_10128545 | 219 |
| 300 | 3300025735 | Ga0207713_1022059 | Ga0207713_10220592 | 219 |
| 301 | 3300025900 | Ga0207710_10023764 | Ga0207710_100237643 | 219 |
| 302 | 3300025923 | Ga0207681_10171079 | Ga0207681_101710792 | 219 |
| 303 | 3300025931 | Ga0207644_10025762 | Ga0207644_100257623 | 219 |
| 304 | 3300025931 | Ga0207644_10119931 | Ga0207644_101199312 | 219 |
| 305 | 3300025934 | Ga0207686_10106637 | Ga0207686_101066372 | 219 |
| 306 | 3300025935 | Ga0207709_10003100 | Ga0207709_100031002 | 219 |
| 307 | 3300025961 | Ga0207712_10229157 | Ga0207712_102291572 | 219 |
| 308 | 3300025972 | Ga0207668_10011452 | Ga0207668_100114525 | 219 |
| 309 | 3300025986 | Ga0207658_10433697 | Ga0207658_104336972 | 219 |
| 310 | 3300028794 | Ga0307515_10200098 | Ga0307515_102000982 | 219 |
| 311 | 3300031733 | Ga0316577_10170089 | Ga0316577_101700892 | 219 |
| 312 | 3300032004 | Ga0307414_10025067 | Ga0307414_100250671 | 219 |
| 313 | 3300035692 | Ga0373935_0288305 | Ga0373935_0288305_298_963 | 219 |
| 314 | 3300035695 | Ga0373927_0000048 | Ga0373927_0000048_69350_70015 | 219 |
| 315 | 3300036647 | Ga0316582_0012397 | Ga0316582_0012397_253_918 | 219 |
| 316 | 3300036647 | Ga0316582_0273334 | Ga0316582_0273334_392_1057 | 219 |
| 317 | 3300037068 | Ga0373925_0000668 | Ga0373925_0000668_31144_31809 | 219 |
| 318 | 3300037418 | Ga0395900_0225426 | Ga0395900_0225426_1048_1713 | 219 |
| 319 | 3300037471 | Ga0395905_0000608 | Ga0395905_0000608_15506_16171 | 219 |
| 320 | 3300037471 | Ga0395905_0043829 | Ga0395905_0043829_1354_2019 | 219 |
| 321 | 3300038443 | Ga0395901_0150818 | Ga0395901_0150818_225_890 | 219 |
| 322 | 3300042007 | Ga0439449_0019048 | Ga0439449_0019048_1656_2321 | 219 |
| 323 | 3300046455 | Ga0495603_0113446 | Ga0495603_0113446_521_1198 | 219 |
| 324 | 3300046460 | Ga0495638_0033750 | Ga0495638_0033750_1174_1839 | 219 |
| 325 | 3300046492 | Ga0495585_0169031 | Ga0495585_0169031_287_964 | 219 |
| 326 | 3300046501 | Ga0495607_0039385 | Ga0495607_0039385_1900_2565 | 219 |
| 327 | 3300046810 | Ga0495660_0093620 | Ga0495660_0093620_178_849 | 219 |
| 328 | 3300047323 | Ga0495683_0064813 | Ga0495683_0064813_301_978 | 219 |
| 329 | 3300048904 | Ga0496101_0005998 | Ga0496101_0005998_4744_5421 | 219 |
| 330 | 3300048905 | Ga0496102_0001253 | Ga0496102_0001253_8038_8715 | 219 |
| 331 | 3300048905 | Ga0496102_0077997 | Ga0496102_0077997_2252_2917 | 219 |
| 332 | 3300048906 | Ga0496103_0002461 | Ga0496103_0002461_7795_8472 | 219 |
| 333 | 3300048906 | Ga0496103_0014248 | Ga0496103_0014248_1795_2460 | 219 |
| 334 | 3300048907 | Ga0496104_0000546 | Ga0496104_0000546_25642_26319 | 219 |
| 335 | 3300048907 | Ga0496104_0051975 | Ga0496104_0051975_2441_3106 | 219 |
| 336 | 3300048908 | Ga0496105_0001973 | Ga0496105_0001973_1469_2146 | 219 |
| 337 | 3300048909 | Ga0496106_0005321 | Ga0496106_0005321_363_1040 | 219 |
| 338 | 3300048909 | Ga0496106_0029362 | Ga0496106_0029362_2337_3002 | 219 |
| 339 | 3300048910 | Ga0496107_0001086 | Ga0496107_0001086_1743_2420 | 219 |
| 340 | 3300048911 | Ga0496108_0004135 | Ga0496108_0004135_4872_5549 | 219 |
| 341 | 3300048911 | Ga0496108_0155121 | Ga0496108_0155121_1144_1809 | 219 |
| 342 | 3300048912 | Ga0496109_0000938 | Ga0496109_0000938_22886_23563 | 219 |
| 343 | 3300048912 | Ga0496109_0070633 | Ga0496109_0070633_1915_2580 | 219 |
| 344 | 3300048913 | Ga0496110_0035553 | Ga0496110_0035553_2493_3158 | 219 |
| 345 | 3300048913 | Ga0496110_0068137 | Ga0496110_0068137_1583_2260 | 219 |
| 346 | 3300048913 | Ga0496110_0397628 | Ga0496110_0397628_553_1218 | 219 |
| 347 | 3300048914 | Ga0496111_0006183 | Ga0496111_0006183_6445_7122 | 219 |
| 348 | 3300048914 | Ga0496111_0040563 | Ga0496111_0040563_1169_1834 | 219 |
| 349 | 3300048915 | Ga0496112_0000907 | Ga0496112_0000907_15907_16584 | 219 |
| 350 | 3300048916 | Ga0496113_0000155 | Ga0496113_0000155_28268_28945 | 219 |
| 351 | 3300048917 | Ga0496114_0089913 | Ga0496114_0089913_501_1166 | 219 |
| 352 | 3300048917 | Ga0496114_0574761 | Ga0496114_0574761_24_689 | 219 |
| 353 | 3300048919 | Ga0496116_0034283 | Ga0496116_0034283_1541_2206 | 219 |
| 354 | 3300048920 | Ga0496117_0038338 | Ga0496117_0038338_770_1447 | 219 |
| 355 | 3300048920 | Ga0496117_0188302 | Ga0496117_0188302_200_865 | 219 |
| 356 | 3300048922 | Ga0496119_0006558 | Ga0496119_0006558_7208_7885 | 219 |
| 357 | 3300048923 | Ga0496120_0032458 | Ga0496120_0032458_1302_1967 | 219 |
| 358 | 3300048923 | Ga0496120_0058898 | Ga0496120_0058898_111_788 | 219 |
| 359 | 3300048924 | Ga0496121_0065339 | Ga0496121_0065339_1271_1936 | 219 |
| 360 | 3300048924 | Ga0496121_0066205 | Ga0496121_0066205_585_1250 | 219 |
| 361 | 3300048925 | Ga0496122_0038832 | Ga0496122_0038832_2618_3295 | 219 |
| 362 | 3300048926 | Ga0496123_0141033 | Ga0496123_0141033_501_1166 | 219 |
| 363 | 3300048927 | Ga0496124_0168982 | Ga0496124_0168982_976_1641 | 219 |
| 364 | 3300048927 | Ga0496124_0437447 | Ga0496124_0437447_156_824 | 219 |
| 365 | 3300048928 | Ga0496125_0004429 | Ga0496125_0004429_8292_8969 | 219 |
| 366 | 3300048929 | Ga0496126_0022478 | Ga0496126_0022478_2647_3312 | 219 |
| 367 | 3300048929 | Ga0496126_0059163 | Ga0496126_0059163_1087_1752 | 219 |
| 368 | 3300048929 | Ga0496126_0095773 | Ga0496126_0095773_392_1069 | 219 |
| 369 | 3300050492 | nmdc:mga0yw44_46306_c1 | nmdc:mga0yw44_46306_c1_1646_2311 | 219 |
| 370 | 3300050516 | nmdc:mga0sz30_6878_c2 | nmdc:mga0sz30_6878_c2_1014_1679 | 219 |
| 371 | 3300053088 | Ga0500644_0140846 | Ga0500644_0140846_130_795 | 219 |
| 372 | 3300053122 | Ga0500608_048138 | Ga0500608_048138_1243_1908 | 219 |
| 373 | 3300053125 | Ga0500618_006516 | Ga0500618_006516_1225_1890 | 219 |
| 374 | 3300053125 | Ga0500618_012194 | Ga0500618_012194_641_1306 | 219 |
| 375 | 3300053136 | Ga0500559_0002295 | Ga0500559_0002295_415_1080 | 219 |
| 376 | 3300053156 | Ga0500622_0001044 | Ga0500622_0001044_15965_16630 | 219 |
| 377 | 3300005434 | Ga0070709_10070867 | Ga0070709_100708672 | 220 |
| 378 | 3300005467 | Ga0070706_100523643 | Ga0070706_1005236432 | 220 |
| 379 | 3300005471 | Ga0070698_100013398 | Ga0070698_1000133984 | 220 |
| 380 | 3300005546 | Ga0070696_100211116 | Ga0070696_1002111162 | 220 |
| 381 | 3300005844 | Ga0068862_100731289 | Ga0068862_1007312891 | 220 |
| 382 | 3300006880 | Ga0075429_100179802 | Ga0075429_1001798022 | 220 |
| 383 | 3300009147 | Ga0114129_10525904 | Ga0114129_105259042 | 220 |
| 384 | 3300009176 | Ga0105242_10207134 | Ga0105242_102071342 | 220 |
| 385 | 3300013297 | Ga0157378_10242493 | Ga0157378_102424931 | 220 |
| 386 | 3300014968 | Ga0157379_10024932 | Ga0157379_100249322 | 220 |
| 387 | 3300037471 | Ga0395905_1016739 | Ga0395905_1016739_25_702 | 220 |
| 388 | 3300048903 | Ga0496100_0372494 | Ga0496100_0372494_124_795 | 220 |
| 389 | 3300048905 | Ga0496102_0102732 | Ga0496102_0102732_342_1013 | 220 |
| 390 | 3300048909 | Ga0496106_0014231 | Ga0496106_0014231_4778_5449 | 220 |
| 391 | 3300048919 | Ga0496116_0111385 | Ga0496116_0111385_96_890 | 220 |
| 392 | 3300048927 | Ga0496124_0005559 | Ga0496124_0005559_5511_6215 | 220 |
| 393 | 3300048927 | Ga0496124_0018229 | Ga0496124_0018229_1088_1756 | 220 |
| 394 | 3300048927 | Ga0496124_0095692 | Ga0496124_0095692_1162_1830 | 220 |
| 395 | 3300049589 | Ga0501073_0316134 | Ga0501073_0316134_220_894 | 220 |
| 396 | 3300049590 | Ga0501074_0037812 | Ga0501074_0037812_508_1233 | 220 |
| 397 | 3300049593 | Ga0501077_0024498 | Ga0501077_0024498_634_1308 | 220 |
| 398 | 3300050507 | nmdc:mga05p37_613169_c1 | nmdc:mga05p37_613169_c1_182_886 | 220 |
| 399 | 3300050510 | nmdc:mga06r32_239510_c1 | nmdc:mga06r32_239510_c1_585_1289 | 220 |
| 400 | 3300005338 | Ga0068868_100024281 | Ga0068868_1000242814 | 221 |
| 401 | 3300005366 | Ga0070659_100046567 | Ga0070659_1000465672 | 221 |
| 402 | 3300005458 | Ga0070681_10051905 | Ga0070681_100519053 | 221 |
| 403 | 3300005530 | Ga0070679_100081739 | Ga0070679_1000817393 | 221 |
| 404 | 3300006051 | Ga0075364_10326450 | Ga0075364_103264501 | 221 |
| 405 | 3300006871 | Ga0075434_100000592 | Ga0075434_10000059223 | 221 |
| 406 | 3300006914 | Ga0075436_100005286 | Ga0075436_1000052868 | 221 |
| 407 | 3300007076 | Ga0075435_100000398 | Ga0075435_10000039824 | 221 |
| 408 | 3300025912 | Ga0207707_10040469 | Ga0207707_100404693 | 221 |
| 409 | 3300025913 | Ga0207695_10011324 | Ga0207695_100113245 | 221 |
| 410 | 3300025914 | Ga0207671_10110197 | Ga0207671_101101972 | 221 |
| 411 | 3300025917 | Ga0207660_10008889 | Ga0207660_100088895 | 221 |
| 412 | 3300025920 | Ga0207649_10135236 | Ga0207649_101352362 | 221 |
| 413 | 3300025921 | Ga0207652_10100213 | Ga0207652_101002133 | 221 |
| 414 | 3300025927 | Ga0207687_10026416 | Ga0207687_100264162 | 221 |
| 415 | 3300025931 | Ga0207644_10389458 | Ga0207644_103894582 | 221 |
| 416 | 3300026023 | Ga0207677_10015540 | Ga0207677_100155403 | 221 |
| 417 | 3300044683 | Ga0466965_0124705 | Ga0466965_0124705_528_1202 | 221 |
| 418 | 3300044694 | Ga0466963_0010684 | Ga0466963_0010684_1458_2132 | 221 |
| 419 | 3300044706 | Ga0466964_0049085 | Ga0466964_0049085_760_1434 | 221 |
| 420 | 3300044719 | Ga0466971_0091970 | Ga0466971_0091970_86_760 | 221 |
| 421 | 3300044842 | Ga0466957_0296013 | Ga0466957_0296013_396_1070 | 221 |
| 422 | 3300045836 | Ga0466958_0036234 | Ga0466958_0036234_2072_2746 | 221 |
| 423 | 3300045976 | Ga0466967_0002748 | Ga0466967_0002748_6933_7607 | 221 |
| 424 | 3300046463 | Ga0495653_0315502 | Ga0495653_0315502_314_988 | 221 |
| 425 | 3300046529 | Ga0495652_0381177 | Ga0495652_0381177_23_697 | 221 |
| 426 | 3300046536 | Ga0495587_0072618 | Ga0495587_0072618_1131_1805 | 221 |
| 427 | 3300046663 | Ga0495635_0482803 | Ga0495635_0482803_51_725 | 221 |
| 428 | 3300050491 | nmdc:mga00v17_281529_c1 | nmdc:mga00v17_281529_c1_158_832 | 221 |
| 429 | 3300050494 | nmdc:mga06z11_366885_c1 | nmdc:mga06z11_366885_c1_48_713 | 221 |
| 430 | 3300053084 | Ga0495595_0126560 | Ga0495595_0126560_246_920 | 221 |
| 431 | 3300053085 | Ga0495619_0324102 | Ga0495619_0324102_109_783 | 221 |
| 432 | 3300061719 | Ga0466962_0152746 | Ga0466962_0152746_368_1042 | 221 |
| 433 | 3300005441 | Ga0070700_100433488 | Ga0070700_1004334881 | 222 |
| 434 | 3300044683 | Ga0466965_0055705 | Ga0466965_0055705_1114_1782 | 222 |
| 435 | 3300044684 | Ga0466966_0030866 | Ga0466966_0030866_1765_2466 | 222 |
| 436 | 3300044693 | Ga0466961_0062701 | Ga0466961_0062701_1041_1742 | 222 |
| 437 | 3300044693 | Ga0466961_0306375 | Ga0466961_0306375_101_769 | 222 |
| 438 | 3300044719 | Ga0466971_0022623 | Ga0466971_0022623_1267_1968 | 222 |
| 439 | 3300045836 | Ga0466958_0029237 | Ga0466958_0029237_1302_2003 | 222 |
| 440 | 3300045836 | Ga0466958_0069805 | Ga0466958_0069805_596_1267 | 222 |
| 441 | 3300048913 | Ga0496110_0629315 | Ga0496110_0629315_228_914 | 222 |
| 442 | 3300061719 | Ga0466962_0085480 | Ga0466962_0085480_406_1107 | 222 |
| 443 | 3300005337 | Ga0070682_100053384 | Ga0070682_1000533843 | 223 |
| 444 | 3300005435 | Ga0070714_100008917 | Ga0070714_1000089176 | 223 |
| 445 | 3300005439 | Ga0070711_100178845 | Ga0070711_1001788452 | 223 |
| 446 | 3300005444 | Ga0070694_100046393 | Ga0070694_1000463933 | 223 |
| 447 | 3300005530 | Ga0070679_100130043 | Ga0070679_1001300433 | 223 |
| 448 | 3300005545 | Ga0070695_100000424 | Ga0070695_1000004244 | 223 |
| 449 | 3300005577 | Ga0068857_100972639 | Ga0068857_1009726391 | 223 |
| 450 | 3300006028 | Ga0070717_10179566 | Ga0070717_101795661 | 223 |
| 451 | 3300006163 | Ga0070715_10018015 | Ga0070715_100180152 | 223 |
| 452 | 3300006173 | Ga0070716_100016572 | Ga0070716_1000165722 | 223 |
| 453 | 3300006175 | Ga0070712_100041445 | Ga0070712_1000414453 | 223 |
| 454 | 3300006175 | Ga0070712_100129626 | Ga0070712_1001296263 | 223 |
| 455 | 3300006237 | Ga0097621_100192601 | Ga0097621_1001926013 | 223 |
| 456 | 3300013105 | Ga0157369_10445357 | Ga0157369_104453573 | 223 |
| 457 | 3300013307 | Ga0157372_10080102 | Ga0157372_100801024 | 223 |
| 458 | 3300025898 | Ga0207692_10229892 | Ga0207692_102298921 | 223 |
| 459 | 3300025905 | Ga0207685_10056840 | Ga0207685_100568403 | 223 |
| 460 | 3300025906 | Ga0207699_10095587 | Ga0207699_100955873 | 223 |
| 461 | 3300025913 | Ga0207695_10082209 | Ga0207695_100822094 | 223 |
| 462 | 3300025914 | Ga0207671_10256806 | Ga0207671_102568061 | 223 |
| 463 | 3300025915 | Ga0207693_10031290 | Ga0207693_100312902 | 223 |
| 464 | 3300025915 | Ga0207693_10079013 | Ga0207693_100790132 | 223 |
| 465 | 3300025916 | Ga0207663_10008339 | Ga0207663_100083395 | 223 |
| 466 | 3300025916 | Ga0207663_10032814 | Ga0207663_100328144 | 223 |
| 467 | 3300025928 | Ga0207700_10000001 | Ga0207700_10000001405 | 223 |
| 468 | 3300025928 | Ga0207700_10436363 | Ga0207700_104363632 | 223 |
| 469 | 3300025929 | Ga0207664_10039097 | Ga0207664_100390972 | 223 |
| 470 | 3300025931 | Ga0207644_10261525 | Ga0207644_102615253 | 223 |
| 471 | 3300025939 | Ga0207665_10011508 | Ga0207665_100115086 | 223 |
| 472 | 3300025944 | Ga0207661_10241311 | Ga0207661_102413112 | 223 |
| 473 | 3300026067 | Ga0207678_10140684 | Ga0207678_101406842 | 223 |
| 474 | 3300026078 | Ga0207702_10004876 | Ga0207702_100048765 | 223 |
| 475 | 3300026088 | Ga0207641_10398101 | Ga0207641_103981012 | 223 |
| 476 | 3300035083 | Ga0373926_0058903 | Ga0373926_0058903_20_781 | 223 |
| 477 | 3300045049 | Ga0466959_0050275 | Ga0466959_0050275_2368_3039 | 223 |
| 478 | 3300046514 | Ga0495618_0214576 | Ga0495618_0214576_403_1092 | 223 |
| 479 | 3300046559 | Ga0495667_0109447 | Ga0495667_0109447_788_1477 | 223 |
| 480 | 3300046642 | Ga0495634_0461204 | Ga0495634_0461204_51_722 | 223 |
| 481 | 3300046679 | Ga0495623_0240463 | Ga0495623_0240463_123_812 | 223 |
| 482 | 3300047317 | Ga0495604_0034954 | Ga0495604_0034954_697_1386 | 223 |
| 483 | 3300047319 | Ga0495674_0036983 | Ga0495674_0036983_2954_3643 | 223 |
| 484 | 3300047444 | Ga0495675_0227666 | Ga0495675_0227666_396_1085 | 223 |
| 485 | 3300047471 | Ga0495684_0254644 | Ga0495684_0254644_532_1203 | 223 |
| 486 | 3300048907 | Ga0496104_0681297 | Ga0496104_0681297_49_720 | 223 |
| 487 | 3300048908 | Ga0496105_0415361 | Ga0496105_0415361_205_876 | 223 |
| 488 | 3300048918 | Ga0496115_0175492 | Ga0496115_0175492_852_1523 | 223 |
| 489 | 3300006038 | Ga0075365_10002593 | Ga0075365_100025934 | 224 |
| 490 | 3300006844 | Ga0075428_100082457 | Ga0075428_1000824574 | 224 |
| 491 | 3300025912 | Ga0207707_10450124 | Ga0207707_104501241 | 224 |
| 492 | 3300045976 | Ga0466967_0300066 | Ga0466967_0300066_28_702 | 224 |
| 493 | 3300048907 | Ga0496104_0189627 | Ga0496104_0189627_738_1415 | 224 |
| 494 | 3300048915 | Ga0496112_0016652 | Ga0496112_0016652_1117_1794 | 224 |
| 495 | 3300048915 | Ga0496112_0051244 | Ga0496112_0051244_276_953 | 224 |
| 496 | 3300049569 | Ga0501032_0028361 | Ga0501032_0028361_2507_3250 | 224 |
| 497 | 3300049570 | Ga0501033_0133672 | Ga0501033_0133672_515_1258 | 224 |
| 498 | 3300049571 | Ga0501034_0029177 | Ga0501034_0029177_679_1422 | 224 |
| 499 | 3300049572 | Ga0501036_0022863 | Ga0501036_0022863_2820_3563 | 224 |
| 500 | 3300049573 | Ga0501037_0018431 | Ga0501037_0018431_4122_4865 | 224 |
| 501 | 3300049574 | Ga0501038_0001411 | Ga0501038_0001411_11587_12330 | 224 |
| 502 | 3300049575 | Ga0501039_0188489 | Ga0501039_0188489_660_1343 | 224 |
| 503 | 3300049576 | Ga0501040_0194023 | Ga0501040_0194023_76_759 | 224 |
| 504 | 3300049578 | Ga0501042_0114176 | Ga0501042_0114176_399_1082 | 224 |
| 505 | 3300049579 | Ga0501043_0408040 | Ga0501043_0408040_255_938 | 224 |
| 506 | 3300049581 | Ga0501047_0004414 | Ga0501047_0004414_11592_12335 | 224 |
| 507 | 3300049588 | Ga0501072_0124490 | Ga0501072_0124490_908_1591 | 224 |
| 508 | 3300049589 | Ga0501073_0226931 | Ga0501073_0226931_494_1237 | 224 |
| 509 | 3300049592 | Ga0501076_0456106 | Ga0501076_0456106_73_756 | 224 |
| 510 | 3300049822 | Ga0501035_0010212 | Ga0501035_0010212_1570_2313 | 224 |
| 511 | 3300049823 | Ga0501044_0024097 | Ga0501044_0024097_32_775 | 224 |
| 512 | 3300050492 | nmdc:mga0yw44_746_c1 | nmdc:mga0yw44_746_c1_7068_7751 | 224 |
| 513 | iso_pu_bacteria | 2576861424 | 2578337164 | 224 |
| 514 | iso_pu_bacteria | 2600255286 | 2601637815 | 224 |
| 515 | iso_pu_bacteria | 2971511577 | 2971511639 | 224 |
| 516 | iso_pu_bacteria | 2980176882 | 2980182051 | 224 |
| 517 | 3300025981 | Ga0207640_10885556 | Ga0207640_108855561 | 225 |
| 518 | 3300045049 | Ga0466959_0416024 | Ga0466959_0416024_92_790 | 225 |
| 519 | 3300045836 | Ga0466958_0028047 | Ga0466958_0028047_718_1416 | 225 |
| 520 | 3300047320 | Ga0495672_0096930 | Ga0495672_0096930_65_751 | 225 |
| 521 | 3300048913 | Ga0496110_0540906 | Ga0496110_0540906_326_1006 | 225 |
| 522 | 3300053080 | Ga0500635_0142687 | Ga0500635_0142687_39_725 | 225 |
| 523 | 3300053133 | Ga0500655_054436 | Ga0500655_054436_84_770 | 225 |
| 524 | 3300053150 | Ga0500603_135235 | Ga0500603_135235_19_705 | 225 |
| 525 | 3300048905 | Ga0496102_0671372 | Ga0496102_0671372_24_704 | 226 |
| 526 | 3300054114 | Ga0501084_0589844 | Ga0501084_0589844_55_753 | 226 |
| 527 | 3300006038 | Ga0075365_10002498 | Ga0075365_1000249811 | 227 |
| 528 | 3300006186 | Ga0075369_10111481 | Ga0075369_101114812 | 227 |
| 529 | 3300046461 | Ga0495641_0131012 | Ga0495641_0131012_405_1100 | 227 |
| 530 | 3300006175 | Ga0070712_100129790 | Ga0070712_1001297902 | 228 |
| 531 | 3300009093 | Ga0105240_10037358 | Ga0105240_100373585 | 228 |
| 532 | 3300009098 | Ga0105245_10051192 | Ga0105245_100511923 | 228 |
| 533 | 3300009545 | Ga0105237_10084955 | Ga0105237_100849552 | 228 |
| 534 | 3300009551 | Ga0105238_10033763 | Ga0105238_100337632 | 228 |
| 535 | 3300010375 | Ga0105239_10542585 | Ga0105239_105425851 | 228 |
| 536 | 3300010375 | Ga0105239_11017153 | Ga0105239_110171532 | 228 |
| 537 | 3300013105 | Ga0157369_10106512 | Ga0157369_101065123 | 228 |
| 538 | 3300013307 | Ga0157372_10037050 | Ga0157372_100370502 | 228 |
| 539 | 3300014745 | Ga0157377_10028872 | Ga0157377_100288722 | 228 |
| 540 | 3300025915 | Ga0207693_10121398 | Ga0207693_101213982 | 228 |
| 541 | 3300025929 | Ga0207664_10204092 | Ga0207664_102040922 | 228 |
| 542 | 3300044658 | Ga0466972_0213377 | Ga0466972_0213377_94_789 | 228 |
| 543 | 3300044694 | Ga0466963_0001004 | Ga0466963_0001004_11359_12054 | 228 |
| 544 | 3300044842 | Ga0466957_0418923 | Ga0466957_0418923_63_758 | 228 |
| 545 | 3300044901 | Ga0466960_0074590 | Ga0466960_0074590_285_980 | 228 |
| 546 | 3300045976 | Ga0466967_0001608 | Ga0466967_0001608_6546_7241 | 228 |
| 547 | 3300048903 | Ga0496100_0009970 | Ga0496100_0009970_2020_2715 | 228 |
| 548 | 3300048904 | Ga0496101_0003395 | Ga0496101_0003395_2349_3044 | 228 |
| 549 | 3300048907 | Ga0496104_0048838 | Ga0496104_0048838_569_1264 | 228 |
| 550 | 3300048909 | Ga0496106_0012196 | Ga0496106_0012196_5045_5740 | 228 |
| 551 | 3300048910 | Ga0496107_0016640 | Ga0496107_0016640_2491_3186 | 228 |
| 552 | 3300048911 | Ga0496108_0014544 | Ga0496108_0014544_4267_4962 | 228 |
| 553 | 3300048912 | Ga0496109_0033180 | Ga0496109_0033180_2100_2795 | 228 |
| 554 | 3300048914 | Ga0496111_0014466 | Ga0496111_0014466_3459_4154 | 228 |
| 555 | 3300048915 | Ga0496112_0106534 | Ga0496112_0106534_589_1284 | 228 |
| 556 | 3300048917 | Ga0496114_0002377 | Ga0496114_0002377_7316_8011 | 228 |
| 557 | 3300048918 | Ga0496115_0022593 | Ga0496115_0022593_1516_2211 | 228 |
| 558 | 3300048927 | Ga0496124_0083478 | Ga0496124_0083478_716_1420 | 228 |
| 559 | 3300049583 | Ga0501067_0004983 | Ga0501067_0004983_2987_3682 | 228 |
| 560 | 3300049585 | Ga0501069_0003084 | Ga0501069_0003084_111_806 | 228 |
| 561 | 3300050512 | nmdc:mga0n895_130027_c1 | nmdc:mga0n895_130027_c1_83_778 | 228 |
| 562 | 3300050514 | nmdc:mga08x19_7683_c1 | nmdc:mga08x19_7683_c1_415_1110 | 228 |
| 563 | 3300050515 | nmdc:mga0a205_62866_c1 | nmdc:mga0a205_62866_c1_2712_3407 | 228 |
| 564 | 3300037312 | Ga0395899_0049006 | Ga0395899_0049006_1105_1851 | 231 |
| 565 | 3300037418 | Ga0395900_0030791 | Ga0395900_0030791_2360_3106 | 231 |
| 566 | 3300037466 | Ga0395898_0110391 | Ga0395898_0110391_916_1662 | 231 |
| 567 | 3300037471 | Ga0395905_0025393 | Ga0395905_0025393_2207_2953 | 231 |
| 568 | 3300038443 | Ga0395901_0301708 | Ga0395901_0301708_895_1641 | 231 |
| 569 | 3300050507 | nmdc:mga05p37_125501_c1 | nmdc:mga05p37_125501_c1_2214_3008 | 231 |
| 570 | iso_pu_bacteria | 2643221561 | 2643827666 | 231 |
| 571 | iso_pu_bacteria | 2643221696 | 2644534918 | 231 |
| 572 | 3300005548 | Ga0070665_100341705 | Ga0070665_1003417052 | 232 |
| 573 | 3300005618 | Ga0068864_100197285 | Ga0068864_1001972853 | 232 |
| 574 | 3300005841 | Ga0068863_100012869 | Ga0068863_1000128694 | 232 |
| 575 | 3300014325 | Ga0163163_10057861 | Ga0163163_100578613 | 232 |
| 576 | 3300028379 | Ga0268266_10176800 | Ga0268266_101768003 | 232 |
| 577 | 3300046499 | Ga0495594_0061561 | Ga0495594_0061561_30_734 | 232 |
| 578 | 3300046694 | Ga0495649_0174188 | Ga0495649_0174188_14_724 | 232 |
| 579 | iso_pu_bacteria | 2643221615 | 2644091530 | 232 |
| 580 | iso_pu_bacteria | 2643221657 | 2644321333 | 232 |
| 581 | 3300005563 | Ga0068855_100163274 | Ga0068855_1001632742 | 234 |
| 582 | 3300010375 | Ga0105239_10015690 | Ga0105239_100156904 | 234 |
| 583 | 3300025909 | Ga0207705_10237154 | Ga0207705_102371542 | 234 |
| 584 | 3300038443 | Ga0395901_0304985 | Ga0395901_0304985_500_1219 | 234 |
| 585 | 3300044658 | Ga0466972_0016907 | Ga0466972_0016907_1496_2227 | 234 |
| 586 | 3300044683 | Ga0466965_0142777 | Ga0466965_0142777_14_718 | 234 |
| 587 | 3300044765 | Ga0466970_0034147 | Ga0466970_0034147_1135_1866 | 234 |
| 588 | 3300044901 | Ga0466960_0015523 | Ga0466960_0015523_1644_2360 | 234 |
| 589 | 3300045049 | Ga0466959_0183669 | Ga0466959_0183669_152_907 | 234 |
| 590 | 3300006038 | Ga0075365_10039757 | Ga0075365_100397574 | 235 |
| 591 | 3300006038 | Ga0075365_10120011 | Ga0075365_101200112 | 235 |
| 592 | 3300006048 | Ga0075363_100033187 | Ga0075363_1000331872 | 235 |
| 593 | 3300020069 | Ga0197907_10860015 | Ga0197907_108600151 | 235 |
| 594 | 3300020070 | Ga0206356_11782609 | Ga0206356_117826092 | 235 |
| 595 | 3300020081 | Ga0206354_11178818 | Ga0206354_111788182 | 235 |
| 596 | 3300020082 | Ga0206353_10100660 | Ga0206353_101006609 | 235 |
| 597 | 3300025944 | Ga0207661_10198017 | Ga0207661_101980172 | 235 |
| 598 | 3300037418 | Ga0395900_0122675 | Ga0395900_0122675_1713_2450 | 235 |
| 599 | 3300037466 | Ga0395898_0203763 | Ga0395898_0203763_1105_1851 | 235 |
| 600 | 3300037466 | Ga0395898_0233971 | Ga0395898_0233971_452_1189 | 235 |
| 601 | 3300037471 | Ga0395905_0004534 | Ga0395905_0004534_13619_14344 | 235 |
| 602 | 3300044656 | Ga0466969_0154633 | Ga0466969_0154633_13_750 | 235 |
| 603 | 3300044694 | Ga0466963_0013066 | Ga0466963_0013066_85_828 | 235 |
| 604 | 3300044694 | Ga0466963_0063820 | Ga0466963_0063820_1613_2356 | 235 |
| 605 | 3300044694 | Ga0466963_0150169 | Ga0466963_0150169_418_1164 | 235 |
| 606 | 3300044719 | Ga0466971_0193155 | Ga0466971_0193155_19_765 | 235 |
| 607 | 3300044735 | Ga0466968_0018631 | Ga0466968_0018631_1306_2052 | 235 |
| 608 | 3300044765 | Ga0466970_0092599 | Ga0466970_0092599_214_963 | 235 |
| 609 | 3300044765 | Ga0466970_0244643 | Ga0466970_0244643_217_939 | 235 |
| 610 | 3300044901 | Ga0466960_0062821 | Ga0466960_0062821_140_883 | 235 |
| 611 | 3300044901 | Ga0466960_0314518 | Ga0466960_0314518_110_865 | 235 |
| 612 | 3300045049 | Ga0466959_0039510 | Ga0466959_0039510_2028_2774 | 235 |
| 613 | 3300045049 | Ga0466959_0156111 | Ga0466959_0156111_312_1058 | 235 |
| 614 | 3300045049 | Ga0466959_0212991 | Ga0466959_0212991_551_1297 | 235 |
| 615 | 3300045049 | Ga0466959_0352142 | Ga0466959_0352142_34_756 | 235 |
| 616 | 3300045976 | Ga0466967_0017214 | Ga0466967_0017214_2399_3133 | 235 |
| 617 | 3300045976 | Ga0466967_0163423 | Ga0466967_0163423_687_1433 | 235 |
| 618 | 3300046461 | Ga0495641_0054335 | Ga0495641_0054335_673_1380 | 235 |
| 619 | 3300046473 | Ga0495582_0033385 | Ga0495582_0033385_1008_1715 | 235 |
| 620 | 3300048907 | Ga0496104_0164726 | Ga0496104_0164726_415_1137 | 235 |
| 621 | 3300049583 | Ga0501067_0102813 | Ga0501067_0102813_576_1298 | 235 |
| 622 | 3300049742 | Ga0501080_0707807 | Ga0501080_0707807_151_873 | 235 |
| 623 | 3300050492 | nmdc:mga0yw44_411809_c1 | nmdc:mga0yw44_411809_c1_20_754 | 235 |
| 624 | 3300061719 | Ga0466962_0216167 | Ga0466962_0216167_170_916 | 235 |
| 625 | iso_pu_bacteria | 2857481737 | 2857485408 | 235 |
| 626 | 3300001979 | JGI24740J21852_10030464 | JGI24740J21852_100304641 | 236 |
| 627 | 3300002067 | JGI24735J21928_10039867 | JGI24735J21928_100398672 | 236 |
| 628 | 3300005327 | Ga0070658_10072444 | Ga0070658_100724443 | 236 |
| 629 | 3300005329 | Ga0070683_100001398 | Ga0070683_1000013987 | 236 |
| 630 | 3300005329 | Ga0070683_100177228 | Ga0070683_1001772282 | 236 |
| 631 | 3300005334 | Ga0068869_100389611 | Ga0068869_1003896112 | 236 |
| 632 | 3300005337 | Ga0070682_100044716 | Ga0070682_1000447162 | 236 |
| 633 | 3300005337 | Ga0070682_100090767 | Ga0070682_1000907673 | 236 |
| 634 | 3300005338 | Ga0068868_100135729 | Ga0068868_1001357292 | 236 |
| 635 | 3300005339 | Ga0070660_100099906 | Ga0070660_1000999062 | 236 |
| 636 | 3300005339 | Ga0070660_100193937 | Ga0070660_1001939372 | 236 |
| 637 | 3300005366 | Ga0070659_100021855 | Ga0070659_1000218554 | 236 |
| 638 | 3300005366 | Ga0070659_100205406 | Ga0070659_1002054062 | 236 |
| 639 | 3300005367 | Ga0070667_100222972 | Ga0070667_1002229722 | 236 |
| 640 | 3300005458 | Ga0070681_10088284 | Ga0070681_100882842 | 236 |
| 641 | 3300005530 | Ga0070679_100007581 | Ga0070679_1000075818 | 236 |
| 642 | 3300005530 | Ga0070679_100177120 | Ga0070679_1001771203 | 236 |
| 643 | 3300005535 | Ga0070684_100028739 | Ga0070684_1000287393 | 236 |
| 644 | 3300005535 | Ga0070684_100062194 | Ga0070684_1000621942 | 236 |
| 645 | 3300005535 | Ga0070684_100078482 | Ga0070684_1000784822 | 236 |
| 646 | 3300005548 | Ga0070665_100000606 | Ga0070665_1000006065 | 236 |
| 647 | 3300005548 | Ga0070665_100220582 | Ga0070665_1002205823 | 236 |
| 648 | 3300005548 | Ga0070665_100609893 | Ga0070665_1006098932 | 236 |
| 649 | 3300005564 | Ga0070664_100190809 | Ga0070664_1001908092 | 236 |
| 650 | 3300005577 | Ga0068857_100050660 | Ga0068857_1000506603 | 236 |
| 651 | 3300005577 | Ga0068857_100438709 | Ga0068857_1004387092 | 236 |
| 652 | 3300005614 | Ga0068856_100049227 | Ga0068856_1000492272 | 236 |
| 653 | 3300005615 | Ga0070702_100183201 | Ga0070702_1001832012 | 236 |
| 654 | 3300005615 | Ga0070702_100189326 | Ga0070702_1001893261 | 236 |
| 655 | 3300005616 | Ga0068852_100146478 | Ga0068852_1001464782 | 236 |
| 656 | 3300005616 | Ga0068852_100268834 | Ga0068852_1002688342 | 236 |
| 657 | 3300005719 | Ga0068861_100012663 | Ga0068861_1000126632 | 236 |
| 658 | 3300005719 | Ga0068861_100329691 | Ga0068861_1003296912 | 236 |
| 659 | 3300005841 | Ga0068863_100101492 | Ga0068863_1001014922 | 236 |
| 660 | 3300005843 | Ga0068860_100004939 | Ga0068860_1000049399 | 236 |
| 661 | 3300005843 | Ga0068860_100145433 | Ga0068860_1001454332 | 236 |
| 662 | 3300006038 | Ga0075365_10013292 | Ga0075365_100132925 | 236 |
| 663 | 3300006038 | Ga0075365_10025219 | Ga0075365_100252192 | 236 |
| 664 | 3300006038 | Ga0075365_10028760 | Ga0075365_100287602 | 236 |
| 665 | 3300006038 | Ga0075365_10043437 | Ga0075365_100434373 | 236 |
| 666 | 3300006038 | Ga0075365_10049405 | Ga0075365_100494052 | 236 |
| 667 | 3300006038 | Ga0075365_10110747 | Ga0075365_101107472 | 236 |
| 668 | 3300006038 | Ga0075365_10181532 | Ga0075365_101815322 | 236 |
| 669 | 3300006042 | Ga0075368_10000787 | Ga0075368_100007873 | 236 |
| 670 | 3300006042 | Ga0075368_10001808 | Ga0075368_100018084 | 236 |
| 671 | 3300006042 | Ga0075368_10184297 | Ga0075368_101842971 | 236 |
| 672 | 3300006048 | Ga0075363_100001556 | Ga0075363_1000015566 | 236 |
| 673 | 3300006048 | Ga0075363_100016538 | Ga0075363_1000165382 | 236 |
| 674 | 3300006048 | Ga0075363_100031177 | Ga0075363_1000311772 | 236 |
| 675 | 3300006048 | Ga0075363_100046692 | Ga0075363_1000466922 | 236 |
| 676 | 3300006048 | Ga0075363_100059210 | Ga0075363_1000592102 | 236 |
| 677 | 3300006051 | Ga0075364_10023355 | Ga0075364_100233552 | 236 |
| 678 | 3300006051 | Ga0075364_10029727 | Ga0075364_100297271 | 236 |
| 679 | 3300006051 | Ga0075364_10034908 | Ga0075364_100349084 | 236 |
| 680 | 3300006051 | Ga0075364_10051396 | Ga0075364_100513962 | 236 |
| 681 | 3300006051 | Ga0075364_10115458 | Ga0075364_101154582 | 236 |
| 682 | 3300006051 | Ga0075364_10203960 | Ga0075364_102039602 | 236 |
| 683 | 3300006178 | Ga0075367_10004044 | Ga0075367_100040443 | 236 |
| 684 | 3300006178 | Ga0075367_10018252 | Ga0075367_100182524 | 236 |
| 685 | 3300006178 | Ga0075367_10135628 | Ga0075367_101356282 | 236 |
| 686 | 3300006178 | Ga0075367_10163715 | Ga0075367_101637152 | 236 |
| 687 | 3300006353 | Ga0075370_10003503 | Ga0075370_100035036 | 236 |
| 688 | 3300006353 | Ga0075370_10005399 | Ga0075370_100053992 | 236 |
| 689 | 3300006353 | Ga0075370_10012237 | Ga0075370_100122372 | 236 |
| 690 | 3300006353 | Ga0075370_10152029 | Ga0075370_101520292 | 236 |
| 691 | 3300006844 | Ga0075428_100068912 | Ga0075428_1000689123 | 236 |
| 692 | 3300006844 | Ga0075428_100192794 | Ga0075428_1001927942 | 236 |
| 693 | 3300006844 | Ga0075428_100257779 | Ga0075428_1002577792 | 236 |
| 694 | 3300006880 | Ga0075429_100131704 | Ga0075429_1001317042 | 236 |
| 695 | 3300009094 | Ga0111539_10055190 | Ga0111539_100551903 | 236 |
| 696 | 3300009098 | Ga0105245_10013028 | Ga0105245_100130286 | 236 |
| 697 | 3300009098 | Ga0105245_10016541 | Ga0105245_100165416 | 236 |
| 698 | 3300009148 | Ga0105243_10045271 | Ga0105243_100452716 | 236 |
| 699 | 3300009148 | Ga0105243_10130425 | Ga0105243_101304252 | 236 |
| 700 | 3300009174 | Ga0105241_10563474 | Ga0105241_105634741 | 236 |
| 701 | 3300009545 | Ga0105237_10114878 | Ga0105237_101148783 | 236 |
| 702 | 3300009553 | Ga0105249_10118507 | Ga0105249_101185072 | 236 |
| 703 | 3300010375 | Ga0105239_10088214 | Ga0105239_100882144 | 236 |
| 704 | 3300010375 | Ga0105239_10586379 | Ga0105239_105863792 | 236 |
| 705 | 3300010375 | Ga0105239_11139124 | Ga0105239_111391241 | 236 |
| 706 | 3300011119 | Ga0105246_10042792 | Ga0105246_100427923 | 236 |
| 707 | 3300013105 | Ga0157369_10105097 | Ga0157369_101050972 | 236 |
| 708 | 3300013296 | Ga0157374_10177972 | Ga0157374_101779722 | 236 |
| 709 | 3300013306 | Ga0163162_11033150 | Ga0163162_110331501 | 236 |
| 710 | 3300013307 | Ga0157372_10003630 | Ga0157372_100036308 | 236 |
| 711 | 3300013307 | Ga0157372_10118962 | Ga0157372_101189624 | 236 |
| 712 | 3300013308 | Ga0157375_10032119 | Ga0157375_100321192 | 236 |
| 713 | 3300013308 | Ga0157375_10104454 | Ga0157375_101044543 | 236 |
| 714 | 3300014325 | Ga0163163_10054312 | Ga0163163_100543122 | 236 |
| 715 | 3300014325 | Ga0163163_10057376 | Ga0163163_100573766 | 236 |
| 716 | 3300014325 | Ga0163163_10219473 | Ga0163163_102194732 | 236 |
| 717 | 3300014325 | Ga0163163_10329415 | Ga0163163_103294152 | 236 |
| 718 | 3300014497 | Ga0182008_10115104 | Ga0182008_101151041 | 236 |
| 719 | 3300014968 | Ga0157379_10131725 | Ga0157379_101317252 | 236 |
| 720 | 3300015688 | Ga0183367_1010 | Ga0183367_1010296 | 236 |
| 721 | 3300017792 | Ga0163161_10333526 | Ga0163161_103335262 | 236 |
| 722 | 3300020082 | Ga0206353_10113132 | Ga0206353_101131321 | 236 |
| 723 | 3300025297 | Ga0209758_1006866 | Ga0209758_10068664 | 236 |
| 724 | 3300025901 | Ga0207688_10116111 | Ga0207688_101161111 | 236 |
| 725 | 3300025904 | Ga0207647_10024844 | Ga0207647_100248441 | 236 |
| 726 | 3300025904 | Ga0207647_10119706 | Ga0207647_101197062 | 236 |
| 727 | 3300025909 | Ga0207705_10265401 | Ga0207705_102654012 | 236 |
| 728 | 3300025909 | Ga0207705_10470546 | Ga0207705_104705462 | 236 |
| 729 | 3300025912 | Ga0207707_10099380 | Ga0207707_100993802 | 236 |
| 730 | 3300025919 | Ga0207657_10014605 | Ga0207657_100146053 | 236 |
| 731 | 3300025919 | Ga0207657_10466087 | Ga0207657_104660872 | 236 |
| 732 | 3300025921 | Ga0207652_10018333 | Ga0207652_100183334 | 236 |
| 733 | 3300025921 | Ga0207652_10452277 | Ga0207652_104522772 | 236 |
| 734 | 3300025927 | Ga0207687_10006661 | Ga0207687_100066616 | 236 |
| 735 | 3300025932 | Ga0207690_10017620 | Ga0207690_100176203 | 236 |
| 736 | 3300025932 | Ga0207690_10158099 | Ga0207690_101580992 | 236 |
| 737 | 3300025935 | Ga0207709_10072287 | Ga0207709_100722873 | 236 |
| 738 | 3300025938 | Ga0207704_10397920 | Ga0207704_103979202 | 236 |
| 739 | 3300025940 | Ga0207691_10583397 | Ga0207691_105833971 | 236 |
| 740 | 3300025944 | Ga0207661_10010691 | Ga0207661_100106917 | 236 |
| 741 | 3300025945 | Ga0207679_10213334 | Ga0207679_102133342 | 236 |
| 742 | 3300025961 | Ga0207712_10199038 | Ga0207712_101990382 | 236 |
| 743 | 3300025986 | Ga0207658_10044226 | Ga0207658_100442263 | 236 |
| 744 | 3300026023 | Ga0207677_10084067 | Ga0207677_100840672 | 236 |
| 745 | 3300026067 | Ga0207678_10242930 | Ga0207678_102429303 | 236 |
| 746 | 3300026078 | Ga0207702_10058818 | Ga0207702_100588185 | 236 |
| 747 | 3300026088 | Ga0207641_10083296 | Ga0207641_100832962 | 236 |
| 748 | 3300026116 | Ga0207674_10064533 | Ga0207674_100645333 | 236 |
| 749 | 3300026116 | Ga0207674_10598818 | Ga0207674_105988182 | 236 |
| 750 | 3300026116 | Ga0207674_10860340 | Ga0207674_108603401 | 236 |
| 751 | 3300027866 | Ga0209813_10000655 | Ga0209813_100006556 | 236 |
| 752 | 3300027866 | Ga0209813_10018905 | Ga0209813_100189052 | 236 |
| 753 | 3300028379 | Ga0268266_10001445 | Ga0268266_1000144515 | 236 |
| 754 | 3300028379 | Ga0268266_10189044 | Ga0268266_101890442 | 236 |
| 755 | 3300028379 | Ga0268266_10199074 | Ga0268266_101990741 | 236 |
| 756 | 3300028381 | Ga0268264_10361836 | Ga0268264_103618361 | 236 |
| 757 | 3300031241 | Ga0265325_10022060 | Ga0265325_100220602 | 236 |
| 758 | 3300031249 | Ga0265339_10100581 | Ga0265339_101005812 | 236 |
| 759 | 3300031595 | Ga0265313_10030991 | Ga0265313_100309913 | 236 |
| 760 | 3300031731 | Ga0307405_10020553 | Ga0307405_100205532 | 236 |
| 761 | 3300031852 | Ga0307410_10151679 | Ga0307410_101516791 | 236 |
| 762 | 3300031852 | Ga0307410_10275338 | Ga0307410_102753382 | 236 |
| 763 | 3300031852 | Ga0307410_10731037 | Ga0307410_107310371 | 236 |
| 764 | 3300031903 | Ga0307407_10042566 | Ga0307407_100425662 | 236 |
| 765 | 3300031911 | Ga0307412_10103488 | Ga0307412_101034882 | 236 |
| 766 | 3300031995 | Ga0307409_100006011 | Ga0307409_1000060112 | 236 |
| 767 | 3300031995 | Ga0307409_100142136 | Ga0307409_1001421362 | 236 |
| 768 | 3300031995 | Ga0307409_100342641 | Ga0307409_1003426412 | 236 |
| 769 | 3300031995 | Ga0307409_100868708 | Ga0307409_1008687081 | 236 |
| 770 | 3300032002 | Ga0307416_100000221 | Ga0307416_10000022126 | 236 |
| 771 | 3300032002 | Ga0307416_100766571 | Ga0307416_1007665711 | 236 |
| 772 | 3300032126 | Ga0307415_100000455 | Ga0307415_1000004557 | 236 |
| 773 | 3300032126 | Ga0307415_100077285 | Ga0307415_1000772852 | 236 |
| 774 | 3300032126 | Ga0307415_100114766 | Ga0307415_1001147662 | 236 |
| 775 | 3300035112 | Ga0373932_0096425 | Ga0373932_0096425_90_821 | 236 |
| 776 | 3300035207 | Ga0373942_0110937 | Ga0373942_0110937_97_828 | 236 |
| 777 | 3300037418 | Ga0395900_0125710 | Ga0395900_0125710_915_1640 | 236 |
| 778 | 3300037466 | Ga0395898_0043916 | Ga0395898_0043916_3586_4341 | 236 |
| 779 | 3300038443 | Ga0395901_0128825 | Ga0395901_0128825_512_1252 | 236 |
| 780 | 3300044683 | Ga0466965_0018571 | Ga0466965_0018571_712_1440 | 236 |
| 781 | 3300044683 | Ga0466965_0024379 | Ga0466965_0024379_1653_2405 | 236 |
| 782 | 3300044694 | Ga0466963_0016836 | Ga0466963_0016836_2639_3349 | 236 |
| 783 | 3300044694 | Ga0466963_0292434 | Ga0466963_0292434_387_1097 | 236 |
| 784 | 3300044706 | Ga0466964_0225495 | Ga0466964_0225495_19_729 | 236 |
| 785 | 3300044765 | Ga0466970_0023123 | Ga0466970_0023123_1162_1914 | 236 |
| 786 | 3300044842 | Ga0466957_0026854 | Ga0466957_0026854_113_865 | 236 |
| 787 | 3300044901 | Ga0466960_0034517 | Ga0466960_0034517_1468_2199 | 236 |
| 788 | 3300044901 | Ga0466960_0062407 | Ga0466960_0062407_1048_1779 | 236 |
| 789 | 3300045976 | Ga0466967_0003756 | Ga0466967_0003756_6684_7424 | 236 |
| 790 | 3300045976 | Ga0466967_0056887 | Ga0466967_0056887_231_941 | 236 |
| 791 | 3300045976 | Ga0466967_0125229 | Ga0466967_0125229_580_1290 | 236 |
| 792 | 3300046461 | Ga0495641_0137199 | Ga0495641_0137199_266_982 | 236 |
| 793 | 3300046461 | Ga0495641_0209925 | Ga0495641_0209925_49_783 | 236 |
| 794 | 3300046663 | Ga0495635_0157853 | Ga0495635_0157853_388_1113 | 236 |
| 795 | 3300046663 | Ga0495635_0220097 | Ga0495635_0220097_416_1144 | 236 |
| 796 | 3300048903 | Ga0496100_0153190 | Ga0496100_0153190_515_1246 | 236 |
| 797 | 3300048904 | Ga0496101_0053137 | Ga0496101_0053137_2023_2754 | 236 |
| 798 | 3300048905 | Ga0496102_0016004 | Ga0496102_0016004_1613_2323 | 236 |
| 799 | 3300048905 | Ga0496102_0135297 | Ga0496102_0135297_1289_2065 | 236 |
| 800 | 3300048905 | Ga0496102_0162939 | Ga0496102_0162939_883_1593 | 236 |
| 801 | 3300048905 | Ga0496102_0548759 | Ga0496102_0548759_91_822 | 236 |
| 802 | 3300048906 | Ga0496103_0016086 | Ga0496103_0016086_2221_2952 | 236 |
| 803 | 3300048906 | Ga0496103_0027563 | Ga0496103_0027563_280_990 | 236 |
| 804 | 3300048906 | Ga0496103_0221477 | Ga0496103_0221477_132_908 | 236 |
| 805 | 3300048907 | Ga0496104_0418304 | Ga0496104_0418304_388_1119 | 236 |
| 806 | 3300048909 | Ga0496106_0034894 | Ga0496106_0034894_2789_3520 | 236 |
| 807 | 3300048910 | Ga0496107_0196684 | Ga0496107_0196684_520_1230 | 236 |
| 808 | 3300048911 | Ga0496108_0038858 | Ga0496108_0038858_3081_3812 | 236 |
| 809 | 3300048911 | Ga0496108_0090774 | Ga0496108_0090774_300_1010 | 236 |
| 810 | 3300048912 | Ga0496109_0293617 | Ga0496109_0293617_393_1124 | 236 |
| 811 | 3300048912 | Ga0496109_0365111 | Ga0496109_0365111_92_802 | 236 |
| 812 | 3300048913 | Ga0496110_0031715 | Ga0496110_0031715_816_1526 | 236 |
| 813 | 3300048913 | Ga0496110_0475743 | Ga0496110_0475743_249_974 | 236 |
| 814 | 3300048914 | Ga0496111_0003428 | Ga0496111_0003428_1921_2631 | 236 |
| 815 | 3300048915 | Ga0496112_0003202 | Ga0496112_0003202_5669_6415 | 236 |
| 816 | 3300048915 | Ga0496112_0018621 | Ga0496112_0018621_982_1728 | 236 |
| 817 | 3300048916 | Ga0496113_0161877 | Ga0496113_0161877_543_1289 | 236 |
| 818 | 3300048916 | Ga0496113_0324352 | Ga0496113_0324352_377_1108 | 236 |
| 819 | 3300048917 | Ga0496114_0031017 | Ga0496114_0031017_311_1036 | 236 |
| 820 | 3300048922 | Ga0496119_0000055 | Ga0496119_0000055_161738_162514 | 236 |
| 821 | 3300048923 | Ga0496120_0033598 | Ga0496120_0033598_1389_2165 | 236 |
| 822 | 3300049568 | Ga0501031_0000752 | Ga0501031_0000752_15367_16110 | 236 |
| 823 | 3300049569 | Ga0501032_0002341 | Ga0501032_0002341_9798_10541 | 236 |
| 824 | 3300049570 | Ga0501033_0001065 | Ga0501033_0001065_4422_5165 | 236 |
| 825 | 3300049571 | Ga0501034_0027325 | Ga0501034_0027325_2439_3182 | 236 |
| 826 | 3300049571 | Ga0501034_0029851 | Ga0501034_0029851_192_920 | 236 |
| 827 | 3300049572 | Ga0501036_0000867 | Ga0501036_0000867_6052_6795 | 236 |
| 828 | 3300049572 | Ga0501036_0174250 | Ga0501036_0174250_790_1518 | 236 |
| 829 | 3300049573 | Ga0501037_0010476 | Ga0501037_0010476_1593_2336 | 236 |
| 830 | 3300049574 | Ga0501038_0000675 | Ga0501038_0000675_18191_18934 | 236 |
| 831 | 3300049574 | Ga0501038_0099140 | Ga0501038_0099140_382_1092 | 236 |
| 832 | 3300049575 | Ga0501039_0001531 | Ga0501039_0001531_5874_6617 | 236 |
| 833 | 3300049575 | Ga0501039_0106664 | Ga0501039_0106664_471_1181 | 236 |
| 834 | 3300049576 | Ga0501040_0084886 | Ga0501040_0084886_1420_2163 | 236 |
| 835 | 3300049577 | Ga0501041_0040277 | Ga0501041_0040277_942_1652 | 236 |
| 836 | 3300049578 | Ga0501042_0014307 | Ga0501042_0014307_3181_3924 | 236 |
| 837 | 3300049579 | Ga0501043_0002968 | Ga0501043_0002968_11591_12334 | 236 |
| 838 | 3300049580 | Ga0501046_0007097 | Ga0501046_0007097_5902_6645 | 236 |
| 839 | 3300049581 | Ga0501047_0029239 | Ga0501047_0029239_2439_3182 | 236 |
| 840 | 3300049582 | Ga0501048_0001346 | Ga0501048_0001346_15495_16238 | 236 |
| 841 | 3300049583 | Ga0501067_0004646 | Ga0501067_0004646_1254_1997 | 236 |
| 842 | 3300049583 | Ga0501067_0035724 | Ga0501067_0035724_976_1686 | 236 |
| 843 | 3300049583 | Ga0501067_0146652 | Ga0501067_0146652_230_940 | 236 |
| 844 | 3300049584 | Ga0501068_0018161 | Ga0501068_0018161_140_877 | 236 |
| 845 | 3300049585 | Ga0501069_0000486 | Ga0501069_0000486_12360_13070 | 236 |
| 846 | 3300049585 | Ga0501069_0001048 | Ga0501069_0001048_10681_11424 | 236 |
| 847 | 3300049586 | Ga0501070_0008158 | Ga0501070_0008158_1806_2549 | 236 |
| 848 | 3300049586 | Ga0501070_0058761 | Ga0501070_0058761_2156_2866 | 236 |
| 849 | 3300049587 | Ga0501071_0063746 | Ga0501071_0063746_138_881 | 236 |
| 850 | 3300049588 | Ga0501072_0037972 | Ga0501072_0037972_1426_2136 | 236 |
| 851 | 3300049589 | Ga0501073_0125320 | Ga0501073_0125320_146_874 | 236 |
| 852 | 3300049590 | Ga0501074_0000833 | Ga0501074_0000833_3378_4121 | 236 |
| 853 | 3300049590 | Ga0501074_0004359 | Ga0501074_0004359_9254_9964 | 236 |
| 854 | 3300049590 | Ga0501074_0014170 | Ga0501074_0014170_3051_3761 | 236 |
| 855 | 3300049592 | Ga0501076_0792511 | Ga0501076_0792511_42_752 | 236 |
| 856 | 3300049593 | Ga0501077_0079251 | Ga0501077_0079251_660_1388 | 236 |
| 857 | 3300049656 | Ga0501209_112440 | Ga0501209_112440_52_783 | 236 |
| 858 | 3300049741 | Ga0501079_0370950 | Ga0501079_0370950_62_790 | 236 |
| 859 | 3300049742 | Ga0501080_0005335 | Ga0501080_0005335_5670_6413 | 236 |
| 860 | 3300049742 | Ga0501080_0046143 | Ga0501080_0046143_652_1362 | 236 |
| 861 | 3300049744 | Ga0501083_0027945 | Ga0501083_0027945_1933_2676 | 236 |
| 862 | 3300049744 | Ga0501083_0069875 | Ga0501083_0069875_1612_2322 | 236 |
| 863 | 3300049822 | Ga0501035_0002522 | Ga0501035_0002522_11468_12211 | 236 |
| 864 | 3300049823 | Ga0501044_0043242 | Ga0501044_0043242_2133_2876 | 236 |
| 865 | 3300050490 | nmdc:mga03n38_1320_c1 | nmdc:mga03n38_1320_c1_940_1668 | 236 |
| 866 | 3300050490 | nmdc:mga03n38_148739_c1 | nmdc:mga03n38_148739_c1_194_922 | 236 |
| 867 | 3300050490 | nmdc:mga03n38_216782_c1 | nmdc:mga03n38_216782_c1_156_896 | 236 |
| 868 | 3300050490 | nmdc:mga03n38_281064_c1 | nmdc:mga03n38_281064_c1_51_779 | 236 |
| 869 | 3300050491 | nmdc:mga00v17_113448_c1 | nmdc:mga00v17_113448_c1_415_1158 | 236 |
| 870 | 3300050491 | nmdc:mga00v17_15144_c1 | nmdc:mga00v17_15144_c1_1058_1783 | 236 |
| 871 | 3300050491 | nmdc:mga00v17_17946_c2 | nmdc:mga00v17_17946_c2_431_1159 | 236 |
| 872 | 3300050491 | nmdc:mga00v17_203894_c1 | nmdc:mga00v17_203894_c1_187_915 | 236 |
| 873 | 3300050491 | nmdc:mga00v17_72469_c1 | nmdc:mga00v17_72469_c1_716_1444 | 236 |
| 874 | 3300050492 | nmdc:mga0yw44_101340_c1 | nmdc:mga0yw44_101340_c1_1032_1742 | 236 |
| 875 | 3300050492 | nmdc:mga0yw44_14440_c1 | nmdc:mga0yw44_14440_c1_1592_2320 | 236 |
| 876 | 3300050492 | nmdc:mga0yw44_3123_c1 | nmdc:mga0yw44_3123_c1_233_943 | 236 |
| 877 | 3300050492 | nmdc:mga0yw44_393927_c1 | nmdc:mga0yw44_393927_c1_102_830 | 236 |
| 878 | 3300050492 | nmdc:mga0yw44_406627_c1 | nmdc:mga0yw44_406627_c1_100_825 | 236 |
| 879 | 3300050492 | nmdc:mga0yw44_53656_c1 | nmdc:mga0yw44_53656_c1_793_1518 | 236 |
| 880 | 3300050492 | nmdc:mga0yw44_91179_c1 | nmdc:mga0yw44_91179_c1_1137_1847 | 236 |
| 881 | 3300050492 | nmdc:mga0yw44_9146_c1 | nmdc:mga0yw44_9146_c1_1697_2410 | 236 |
| 882 | 3300050494 | nmdc:mga06z11_152480_c1 | nmdc:mga06z11_152480_c1_419_1147 | 236 |
| 883 | 3300050494 | nmdc:mga06z11_2345_c1 | nmdc:mga06z11_2345_c1_1151_1879 | 236 |
| 884 | 3300050495 | nmdc:mga04h51_15119_c1 | nmdc:mga04h51_15119_c1_1276_2001 | 236 |
| 885 | 3300050496 | nmdc:mga07m45_134999_c1 | nmdc:mga07m45_134999_c1_650_1378 | 236 |
| 886 | 3300050496 | nmdc:mga07m45_13854_c1 | nmdc:mga07m45_13854_c1_1595_2320 | 236 |
| 887 | 3300050496 | nmdc:mga07m45_147052_c1 | nmdc:mga07m45_147052_c1_548_1273 | 236 |
| 888 | 3300050496 | nmdc:mga07m45_4164_c1 | nmdc:mga07m45_4164_c1_6208_6936 | 236 |
| 889 | 3300050496 | nmdc:mga07m45_75985_c1 | nmdc:mga07m45_75985_c1_1029_1757 | 236 |
| 890 | 3300050507 | nmdc:mga05p37_153476_c1 | nmdc:mga05p37_153476_c1_702_1451 | 236 |
| 891 | 3300050511 | nmdc:mga08y16_488886_c1 | nmdc:mga08y16_488886_c1_410_1141 | 236 |
| 892 | 3300053085 | Ga0495619_0135319 | Ga0495619_0135319_763_1494 | 236 |
| 893 | 3300053088 | Ga0500644_0000143 | Ga0500644_0000143_26871_27596 | 236 |
| 894 | 3300053104 | Ga0500556_0000502 | Ga0500556_0000502_9169_9879 | 236 |
| 895 | 3300053117 | Ga0500593_000518 | Ga0500593_000518_14274_14984 | 236 |
| 896 | 3300053139 | Ga0500568_0056513 | Ga0500568_0056513_370_1200 | 236 |
| 897 | 3300053140 | Ga0500573_0030579 | Ga0500573_0030579_441_1169 | 236 |
| 898 | 3300053140 | Ga0500573_0038905 | Ga0500573_0038905_1899_2609 | 236 |
| 899 | 3300054114 | Ga0501084_0003690 | Ga0501084_0003690_5027_5770 | 236 |
| 900 | 3300060353 | Ga0501082_0271445 | Ga0501082_0271445_441_1184 | 236 |
| 901 | 3300061734 | Ga0530510_0260945 | Ga0530510_0260945_420_1130 | 236 |
| 902 | iso_pu_bacteria | 2728369276 | 2729904885 | 236 |
| 903 | iso_pu_bacteria | 2773857759 | 2774384022 | 236 |
| 904 | iso_pu_bacteria | 2784746768 | 2785367233 | 236 |
| 905 | iso_pu_bacteria | 2795385472 | 2795796036 | 236 |
| 906 | iso_pu_bacteria | 2852635781 | 2852637797 | 236 |
| 907 | iso_pu_bacteria | 2855386786 | 2855390519 | 236 |
| 908 | iso_pu_bacteria | 2912723979 | 2912726033 | 236 |
| 909 | iso_pu_bacteria | 2947224130 | 2947231744 | 236 |
| 910 | iso_pu_bacteria | 2977251589 | 2977254450 | 236 |
| 911 | iso_pu_bacteria | 3006393351 | 3006399471 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ftk-assembly2.cif.gz_H | berylloflouride spo0f complex with spo0b | 0.9757 | 11 | 125 |
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.9726 | 11 | 127 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9688 | 12 | 128 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9687 | 12 | 128 |
| 2pmu-assembly1.cif.gz_C | crystal structure of the dna-binding domain of phop | 0.9676 | 138 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9967 | 10 | 90 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9846 | 10 | 90 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9779 | 11 | 90 | 3.40.50.2300 |
| af_L7N689_150_256_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9749 | 139 | 234 | 1.10.10.10 |
| af_O07776_147_246_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9739 | 139 | 233 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5WFG4-F1-model_v4 | Response regulator transcription factor | 0.977 | 3 | 130 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-G2FSB7-F1-model_v4 | Stage 0 sporulation protein A homolog | 0.9747 | 10 | 133 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |
| AF-A0A7G3D9R8-F1-model_v4 | deleted | 0.9743 | 2 | 130 |
|
| AF-N0E2E3-F1-model_v4 | Response regulatory domain-containing protein | 0.9616 | 2 | 136 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2T3FE36-F1-model_v4 | Stage 0 sporulation protein A homolog | 0.9322 | 26 | 232 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar