F485426

General Info

Members Datasets Scaffolds Average Seq Length
909 395 909 118

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0752296|Ga0501070_0752296_256_663
Length 135
Sequence VCVIDCDQTPSKEQQMPRYVDGFVIPLPKKNLDAYRRIAEECAKIWREHGALEVRECIAEDVKVGKLTSFPRSVQRKPSETVVFSWIVFKSRADRDRINAKVMKDPRMAKMMQEEKAPFDGKRMIYGGFEVLVEA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
100 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
209 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
227 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
247 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
252 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
253 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
254 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
255 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
256 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
261 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
291 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
294 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
295 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
310 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
311 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
317 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
318 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
319 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
323 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
342 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
343 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
344 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
345 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
358 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
359 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
360 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
361 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
362 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
363 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
364 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
365 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
369 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
388 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
389 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
390 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
391 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
392 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.19
Nodule 0.33
Rhizoplane 5.72
Rhizosphere 88.78
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10005342 3300003323 Bacteria 39380
2 JGI25404J52841_10004899 3300003659 Bacteria 2747
3 Ga0055524_1020622 3300003775 Bacteria 2213
4 Ga0055528_1087790 3300003790 Bacteria 537
5 Ga0055531_10000103 3300003794 Bacteria 92298
6 Ga0058863_10086596 3300004799 Bacteria 847
7 Ga0058861_11284509 3300004800 Bacteria 942
8 Ga0065715_10482623 3300005293 Bacteria 796
9 Ga0070658_10043435 3300005327 Bacteria 3630
10 Ga0070658_10174780 3300005327 Bacteria 1806
11 Ga0070658_10205083 3300005327 Bacteria 1664
12 Ga0070658_10292900 3300005327 Bacteria 1387
13 Ga0070676_10009376 3300005328 Bacteria 5290
14 Ga0070676_10456367 3300005328 Bacteria 900
15 Ga0070676_10825564 3300005328 Bacteria 686
16 Ga0070683_100012982 3300005329 Bacteria 7250
17 Ga0070683_100021348 3300005329 Bacteria 5779
18 Ga0070683_100880544 3300005329 Bacteria 859
19 Ga0070690_100087471 3300005330 Bacteria 2046
20 Ga0070690_100862382 3300005330 Bacteria 706
21 Ga0070690_101615912 3300005330 Bacteria 526
22 Ga0070670_100059712 3300005331 Bacteria 3273
23 Ga0070670_100121184 3300005331 Bacteria 2256
24 Ga0070670_100213671 3300005331 Bacteria 1677
25 Ga0070670_102130967 3300005331 Bacteria 517
26 Ga0070677_10005628 3300005333 Bacteria 4134
27 Ga0070677_10410678 3300005333 Bacteria 716
28 Ga0070677_10459765 3300005333 Bacteria 682
29 Ga0068869_100003195 3300005334 Bacteria 10012
30 Ga0068869_100198382 3300005334 Bacteria 1581
31 Ga0068869_100521538 3300005334 Bacteria 994
32 Ga0068869_100719547 3300005334 Bacteria 853
33 Ga0070666_10173409 3300005335 Bacteria 1511
34 Ga0070666_10918393 3300005335 Bacteria 647
35 Ga0070680_100021694 3300005336 Bacteria 5107
36 Ga0070682_100980473 3300005337 Bacteria 700
37 Ga0068868_100153655 3300005338 Bacteria 1897
38 Ga0068868_100476738 3300005338 Bacteria 1089
39 Ga0068868_100611568 3300005338 Bacteria 966
40 Ga0070660_100093354 3300005339 Bacteria 2376
41 Ga0070660_100139499 3300005339 Bacteria 1944
42 Ga0070660_100700288 3300005339 Bacteria 849
43 Ga0070660_100784375 3300005339 Bacteria 801
44 Ga0070689_100351680 3300005340 Bacteria 1236
45 Ga0070689_100536919 3300005340 Bacteria 1006
46 Ga0070691_10065775 3300005341 Bacteria 1751
47 Ga0070687_100045346 3300005343 Bacteria 2245
48 Ga0070687_100246180 3300005343 Bacteria 1108
49 Ga0070661_100117306 3300005344 Bacteria 1991
50 Ga0070661_100815040 3300005344 Bacteria 767
51 Ga0070692_10013522 3300005345 Bacteria 3808
52 Ga0070692_10706976 3300005345 Bacteria 679
53 Ga0070668_100000574 3300005347 Bacteria 24639
54 Ga0070668_100208445 3300005347 Bacteria 1607
55 Ga0070668_100826296 3300005347 Bacteria 824
56 Ga0070669_100000765 3300005353 Bacteria 23385
57 Ga0070669_100826069 3300005353 Bacteria 788
58 Ga0070669_101643669 3300005353 Bacteria 559
59 Ga0070669_102031551 3300005353 Bacteria 502
60 Ga0070675_100049796 3300005354 Bacteria 3439
61 Ga0070675_100098419 3300005354 Bacteria 2460
62 Ga0070675_100246697 3300005354 Bacteria 1561
63 Ga0070675_100517510 3300005354 Bacteria 1076
64 Ga0070671_100015231 3300005355 Bacteria 6210
65 Ga0070671_100118942 3300005355 Bacteria 2223
66 Ga0070671_100223762 3300005355 Bacteria 1596
67 Ga0070671_100241404 3300005355 Bacteria 1534
68 Ga0070671_100471885 3300005355 Bacteria 1078
69 Ga0070671_100874425 3300005355 Bacteria 784
70 Ga0070671_101319157 3300005355 Bacteria 637
71 Ga0070674_100011152 3300005356 Bacteria 5459
72 Ga0070674_100083924 3300005356 Bacteria 2283
73 Ga0070674_100169814 3300005356 Bacteria 1662
74 Ga0070673_100060051 3300005364 Bacteria 3011
75 Ga0070673_100157484 3300005364 Bacteria 1929
76 Ga0070673_100180152 3300005364 Bacteria 1808
77 Ga0070673_100189764 3300005364 Bacteria 1764
78 Ga0070673_101271494 3300005364 Bacteria 691
79 Ga0070673_101742801 3300005364 Bacteria 590
80 Ga0070688_100603694 3300005365 Bacteria 840
81 Ga0070688_101614248 3300005365 Bacteria 530
82 Ga0070659_100074878 3300005366 Bacteria 2698
83 Ga0070659_100112476 3300005366 Bacteria 2199
84 Ga0070659_100175753 3300005366 Bacteria 1756
85 Ga0070659_100238682 3300005366 Bacteria 1503
86 Ga0070659_100835341 3300005366 Bacteria 802
87 Ga0070667_100007739 3300005367 Bacteria 8908
88 Ga0070667_101046320 3300005367 Bacteria 762
89 Ga0070667_101136265 3300005367 Bacteria 730
90 Ga0070667_101659284 3300005367 Bacteria 601
91 Ga0070703_10004258 3300005406 Bacteria 4028
92 Ga0070709_11028668 3300005434 Bacteria 656
93 Ga0070714_100135565 3300005435 Bacteria 2204
94 Ga0070701_10084460 3300005438 Bacteria 1726
95 Ga0070701_10120417 3300005438 Bacteria 1478
96 Ga0070711_100023103 3300005439 Bacteria 4040
97 Ga0070705_100000751 3300005440 Bacteria 18407
98 Ga0070700_100006109 3300005441 Bacteria 6417
99 Ga0070700_100200600 3300005441 Bacteria 1401
100 Ga0070700_100351093 3300005441 Bacteria 1093
101 Ga0070700_100807362 3300005441 Bacteria 756
102 Ga0070694_100013925 3300005444 Bacteria 5030
103 Ga0070694_100155756 3300005444 Bacteria 1672
104 Ga0070663_100020235 3300005455 Bacteria 4402
105 Ga0070663_100074650 3300005455 Bacteria 2476
106 Ga0070663_100486712 3300005455 Bacteria 1022
107 Ga0070678_100040070 3300005456 Bacteria 3312
108 Ga0070678_100093070 3300005456 Bacteria 2317
109 Ga0070678_100656049 3300005456 Bacteria 942
110 Ga0070678_101306888 3300005456 Bacteria 675
111 Ga0070662_100000783 3300005457 Bacteria 19529
112 Ga0070662_100260601 3300005457 Bacteria 1397
113 Ga0070662_100620843 3300005457 Bacteria 910
114 Ga0070681_10050025 3300005458 Bacteria 4171
115 Ga0070681_10823811 3300005458 Bacteria 845
116 Ga0070681_10890925 3300005458 Bacteria 808
117 Ga0068867_100000099 3300005459 Bacteria 55452
118 Ga0068867_100005514 3300005459 Bacteria 8955
119 Ga0068867_100088547 3300005459 Bacteria 2346
120 Ga0068867_100110165 3300005459 Bacteria 2114
121 Ga0070706_100224618 3300005467 Bacteria 1753
122 Ga0070698_100005048 3300005471 Bacteria 14467
123 Ga0070698_100569515 3300005471 Bacteria 1072
124 Ga0070699_100005109 3300005518 Bacteria 11540
125 Ga0070699_100005628 3300005518 Bacteria 10986
126 Ga0070679_100063334 3300005530 Bacteria 3686
127 Ga0070679_100333157 3300005530 Bacteria 1466
128 Ga0070684_100015457 3300005535 Bacteria 6216
129 Ga0070684_100278259 3300005535 Bacteria 1533
130 Ga0070684_100327046 3300005535 Bacteria 1409
131 Ga0070684_100375431 3300005535 Bacteria 1309
132 Ga0070697_100307327 3300005536 Bacteria 1364
133 Ga0070697_100781270 3300005536 Bacteria 844
134 Ga0068853_100433941 3300005539 Bacteria 1234
135 Ga0068853_100518529 3300005539 Bacteria 1127
136 Ga0068853_100643106 3300005539 Bacteria 1009
137 Ga0068853_100874663 3300005539 Bacteria 862
138 Ga0070672_100005134 3300005543 Bacteria 8642
139 Ga0070672_100031238 3300005543 Bacteria 4007
140 Ga0070672_100102545 3300005543 Bacteria 2322
141 Ga0070672_100134897 3300005543 Bacteria 2032
142 Ga0070672_100476313 3300005543 Bacteria 1078
143 Ga0070672_100496343 3300005543 Bacteria 1055
144 Ga0070672_101853509 3300005543 Bacteria 542
145 Ga0070695_100000339 3300005545 Bacteria 24039
146 Ga0070695_100171483 3300005545 Bacteria 1531
147 Ga0070695_100475174 3300005545 Bacteria 962
148 Ga0070695_100752052 3300005545 Bacteria 778
149 Ga0070696_100001139 3300005546 Bacteria 17242
150 Ga0070696_100111458 3300005546 Bacteria 1971
151 Ga0070693_100062205 3300005547 Bacteria 2172
152 Ga0070693_100596713 3300005547 Bacteria 797
153 Ga0070693_101185492 3300005547 Bacteria 586
154 Ga0070704_100022238 3300005549 Bacteria 4124
155 Ga0070704_100188853 3300005549 Bacteria 1654
156 Ga0070704_100962614 3300005549 Unclassified 770
157 Ga0070704_101076522 3300005549 Bacteria 729
158 Ga0068855_100189763 3300005563 Bacteria 2319
159 Ga0068855_100480758 3300005563 Bacteria 1352
160 Ga0068855_100603652 3300005563 Bacteria 1183
161 Ga0070664_100015887 3300005564 Bacteria 6163
162 Ga0070664_100040986 3300005564 Bacteria 3906
163 Ga0070664_100084788 3300005564 Bacteria 2735
164 Ga0070664_100315920 3300005564 Bacteria 1414
165 Ga0070664_101190332 3300005564 Bacteria 719
166 Ga0068857_100174384 3300005577 Bacteria 1955
167 Ga0068857_100194631 3300005577 Bacteria 1847
168 Ga0068857_100247020 3300005577 Bacteria 1635
169 Ga0068857_101361331 3300005577 Bacteria 690
170 Ga0068857_102162670 3300005577 Bacteria 546
171 Ga0068854_100010666 3300005578 Bacteria 5963
172 Ga0068854_100052948 3300005578 Bacteria 2912
173 Ga0068854_100408141 3300005578 Bacteria 1125
174 Ga0068854_100612802 3300005578 Bacteria 931
175 Ga0068854_102067238 3300005578 Bacteria 526
176 Ga0068856_100111519 3300005614 Bacteria 2733
177 Ga0068856_100200622 3300005614 Bacteria 2009
178 Ga0068856_101107860 3300005614 Bacteria 809
179 Ga0068856_101380321 3300005614 Bacteria 719
180 Ga0070702_100193403 3300005615 Bacteria 1340
181 Ga0070702_100448188 3300005615 Bacteria 936
182 Ga0068852_100008232 3300005616 Bacteria 7665
183 Ga0068852_100055860 3300005616 Bacteria 3409
184 Ga0068852_100128386 3300005616 Bacteria 2331
185 Ga0068852_100177778 3300005616 Bacteria 1999
186 Ga0068852_100289206 3300005616 Bacteria 1583
187 Ga0068852_100629953 3300005616 Bacteria 1079
188 Ga0068852_100754458 3300005616 Bacteria 985
189 Ga0068859_100004644 3300005617 Bacteria 13994
190 Ga0068859_100104541 3300005617 Bacteria 2891
191 Ga0068859_100215382 3300005617 Bacteria 2008
192 Ga0068859_100601278 3300005617 Bacteria 1193
193 Ga0068859_102724987 3300005617 Bacteria 543
194 Ga0068864_100019366 3300005618 Bacteria 5691
195 Ga0068864_100154035 3300005618 Bacteria 2085
196 Ga0068864_100172017 3300005618 Bacteria 1975
197 Ga0068864_100272205 3300005618 Bacteria 1578
198 Ga0068864_101327893 3300005618 Bacteria 720
199 Ga0068864_101506775 3300005618 Bacteria 676
200 Ga0068866_10002119 3300005718 Bacteria 8255
201 Ga0068866_10411884 3300005718 Bacteria 875
202 Ga0068861_100004658 3300005719 Bacteria 9211
203 Ga0068861_100042324 3300005719 Bacteria 3413
204 Ga0068861_100226822 3300005719 Bacteria 1582
205 Ga0068861_100314513 3300005719 Bacteria 1362
206 Ga0068851_10000574 3300005834 Bacteria 16016
207 Ga0068851_10015869 3300005834 Bacteria 3595
208 Ga0068851_10204423 3300005834 Bacteria 1104
209 Ga0068851_10734627 3300005834 Bacteria 610
210 Ga0068870_10287766 3300005840 Bacteria 1033
211 Ga0068870_11290453 3300005840 Bacteria 532
212 Ga0068863_100001215 3300005841 Bacteria 25740
213 Ga0068863_100027689 3300005841 Bacteria 5408
214 Ga0068863_100326179 3300005841 Bacteria 1492
215 Ga0068863_100486991 3300005841 Bacteria 1213
216 Ga0068863_101513562 3300005841 Bacteria 680
217 Ga0068858_100011059 3300005842 Bacteria 8532
218 Ga0068858_100287055 3300005842 Bacteria 1568
219 Ga0068858_101874273 3300005842 Bacteria 592
220 Ga0068860_100009850 3300005843 Bacteria 9480
221 Ga0068860_100010922 3300005843 Bacteria 8952
222 Ga0068860_100235990 3300005843 Bacteria 1778
223 Ga0068862_100005698 3300005844 Bacteria 10394
224 Ga0068862_100020474 3300005844 Bacteria 5526
225 Ga0068862_100540129 3300005844 Bacteria 1112
226 Ga0068862_101494533 3300005844 Bacteria 681
227 Ga0081455_10000197 3300005937 Bacteria 76374
228 Ga0081455_10007547 3300005937 Bacteria 11439
229 Ga0081455_10078898 3300005937 Bacteria 2705
230 Ga0081538_10001078 3300005981 Bacteria 29015
231 Ga0081538_10033454 3300005981 Bacteria 3421
232 Ga0081540_1000313 3300005983 Bacteria 50236
233 Ga0070717_10182325 3300006028 Bacteria 1831
234 Ga0070717_10549333 3300006028 Bacteria 1046
235 Ga0075365_10002797 3300006038 Bacteria 8732
236 Ga0075365_10964002 3300006038 Bacteria 601
237 Ga0075364_10063243 3300006051 Bacteria 2429
238 Ga0075364_10353985 3300006051 Bacteria 1001
239 Ga0070715_10162126 3300006163 Bacteria 1106
240 Ga0070716_100130447 3300006173 Bacteria 1588
241 Ga0070716_100306351 3300006173 Bacteria 1107
242 Ga0070712_100646210 3300006175 Bacteria 898
243 Ga0070712_100833112 3300006175 Bacteria 793
244 Ga0075362_10120662 3300006177 Bacteria 1241
245 Ga0075362_10509580 3300006177 Bacteria 616
246 Ga0097621_100026893 3300006237 Bacteria 4519
247 Ga0097621_100566179 3300006237 Bacteria 1035
248 Ga0097621_102080938 3300006237 Bacteria 543
249 Ga0075370_10690263 3300006353 Bacteria 620
250 Ga0068871_100405026 3300006358 Bacteria 1215
251 Ga0068871_100895337 3300006358 Bacteria 822
252 Ga0068871_100932954 3300006358 Bacteria 806
253 Ga0075428_101189089 3300006844 Bacteria 804
254 Ga0075428_102004390 3300006844 Bacteria 600
255 Ga0075430_100022398 3300006846 Bacteria 5376
256 Ga0075430_101310527 3300006846 Bacteria 596
257 Ga0075431_100061319 3300006847 Bacteria 3881
258 Ga0075431_100446269 3300006847 Bacteria 1290
259 Ga0075431_100981751 3300006847 Bacteria 812
260 Ga0075431_101212945 3300006847 Bacteria 717
261 Ga0075433_10356745 3300006852 Bacteria 1292
262 Ga0075433_10569419 3300006852 Unclassified 995
263 Ga0075434_100254525 3300006871 Bacteria 1775
264 Ga0075434_100753133 3300006871 Bacteria 991
265 Ga0075429_100030827 3300006880 Bacteria 4660
266 Ga0068865_100003044 3300006881 Bacteria 10022
267 Ga0068865_100048823 3300006881 Bacteria 2914
268 Ga0068865_100609308 3300006881 Bacteria 924
269 Ga0068865_101355195 3300006881 Bacteria 634
270 Ga0075436_100004893 3300006914 Bacteria 9205
271 Ga0075436_100412316 3300006914 Bacteria 980
272 Ga0097620_100004644 3300006931 Bacteria 13994
273 Ga0097620_100104540 3300006931 Bacteria 2891
274 Ga0097620_100215390 3300006931 Bacteria 2008
275 Ga0097620_100601327 3300006931 Bacteria 1193
276 Ga0097620_102724732 3300006931 Bacteria 543
277 Ga0099824_1036269 3300006942 Bacteria 1443
278 Ga0099823_1000255 3300006944 Bacteria 31191
279 Ga0075435_100112426 3300007076 Bacteria 2266
280 Ga0075435_101308535 3300007076 Bacteria 635
281 Ga0099794_10305066 3300007265 Bacteria 825
282 Ga0111539_10056078 3300009094 Bacteria 4684
283 Ga0111539_10283840 3300009094 Bacteria 1927
284 Ga0111539_10589999 3300009094 Bacteria 1294
285 Ga0111539_10709606 3300009094 Bacteria 1171
286 Ga0105245_10577542 3300009098 Bacteria 1148
287 Ga0105245_10721349 3300009098 Bacteria 1031
288 Ga0105245_13173533 3300009098 Bacteria 509
289 Ga0105247_10010942 3300009101 Bacteria 5477
290 Ga0105247_10507750 3300009101 Bacteria 879
291 Ga0114129_10806966 3300009147 Bacteria 1197
292 Ga0105243_10001373 3300009148 Bacteria 21563
293 Ga0105243_10015973 3300009148 Bacteria 5677
294 Ga0105243_10125137 3300009148 Bacteria 2173
295 Ga0105243_10148299 3300009148 Bacteria 2010
296 Ga0105243_10557522 3300009148 Bacteria 1096
297 Ga0105243_10874423 3300009148 Bacteria 892
298 Ga0105241_10024674 3300009174 Bacteria 4466
299 Ga0105241_10067029 3300009174 Bacteria 2777
300 Ga0105242_10034546 3300009176 Bacteria 4054
301 Ga0105242_11120377 3300009176 Bacteria 802
302 Ga0105242_11537817 3300009176 Bacteria 697
303 Ga0105248_10003918 3300009177 Bacteria 16461
304 Ga0105248_10354820 3300009177 Bacteria 1651
305 Ga0105248_10391094 3300009177 Bacteria 1566
306 Ga0105248_11401112 3300009177 Bacteria 791
307 Ga0105248_11583334 3300009177 Bacteria 742
308 Ga0105237_10199124 3300009545 Bacteria 2002
309 Ga0105237_10734600 3300009545 Bacteria 994
310 Ga0105237_11124416 3300009545 Bacteria 792
311 Ga0105238_10446131 3300009551 Bacteria 1291
312 Ga0105238_12309967 3300009551 Bacteria 573
313 Ga0105238_12733437 3300009551 Bacteria 530
314 Ga0105249_10013028 3300009553 Bacteria 7338
315 Ga0105249_11482395 3300009553 Bacteria 751
316 Ga0099796_10246118 3300010159 Bacteria 741
317 Ga0105239_10255886 3300010375 Bacteria 1967
318 Ga0105239_10360708 3300010375 Bacteria 1641
319 Ga0105239_11549594 3300010375 Bacteria 766
320 Ga0105239_11813876 3300010375 Bacteria 707
321 Ga0105246_10503750 3300011119 Bacteria 1029
322 Ga0157315_1006752 3300012508 Bacteria 908
323 Ga0157373_10003095 3300013100 Bacteria 12569
324 Ga0157373_10291545 3300013100 Bacteria 1157
325 Ga0157373_10392804 3300013100 Bacteria 993
326 Ga0157371_10013703 3300013102 Bacteria 6149
327 Ga0157371_10242714 3300013102 Bacteria 1296
328 Ga0157371_10555853 3300013102 Bacteria 851
329 Ga0157370_10074452 3300013104 Bacteria 3203
330 Ga0157370_10404954 3300013104 Bacteria 1255
331 Ga0157370_11297938 3300013104 Bacteria 656
332 Ga0157369_10308021 3300013105 Bacteria 1647
333 Ga0157369_10503849 3300013105 Bacteria 1252
334 Ga0157369_10533057 3300013105 Bacteria 1214
335 Ga0157369_10597169 3300013105 Bacteria 1140
336 Ga0157374_10201476 3300013296 Bacteria 1949
337 Ga0157374_10337555 3300013296 Bacteria 1495
338 Ga0157374_11196392 3300013296 Bacteria 781
339 Ga0157374_11230360 3300013296 Bacteria 770
340 Ga0157374_11499668 3300013296 Bacteria 698
341 Ga0157374_11559734 3300013296 Bacteria 684
342 Ga0157378_10074037 3300013297 Bacteria 3064
343 Ga0157378_10141889 3300013297 Bacteria 2231
344 Ga0157378_10244120 3300013297 Bacteria 1717
345 Ga0157378_11090793 3300013297 Bacteria 835
346 Ga0163162_10000769 3300013306 Bacteria 29806
347 Ga0163162_10073872 3300013306 Bacteria 3467
348 Ga0163162_10210346 3300013306 Bacteria 2075
349 Ga0163162_12748055 3300013306 Bacteria 567
350 Ga0157372_10211993 3300013307 Bacteria 2245
351 Ga0157372_10245002 3300013307 Bacteria 2080
352 Ga0157372_10507987 3300013307 Bacteria 1405
353 Ga0157372_10678482 3300013307 Bacteria 1199
354 Ga0157372_10695661 3300013307 Bacteria 1183
355 Ga0157375_10002304 3300013308 Bacteria 16487
356 Ga0157375_10004451 3300013308 Bacteria 12165
357 Ga0157375_10075657 3300013308 Bacteria 3392
358 Ga0157375_10098672 3300013308 Bacteria 2998
359 Ga0157375_10739799 3300013308 Bacteria 1135
360 Ga0163163_10364546 3300014325 Bacteria 1502
361 Ga0163163_10741489 3300014325 Bacteria 1046
362 Ga0163163_11493747 3300014325 Bacteria 737
363 Ga0157380_10035506 3300014326 Bacteria 3852
364 Ga0157380_10064490 3300014326 Bacteria 2941
365 Ga0157380_10173324 3300014326 Bacteria 1887
366 Ga0157380_10341416 3300014326 Bacteria 1397
367 Ga0157380_10605430 3300014326 Bacteria 1085
368 Ga0182008_10577309 3300014497 Bacteria 628
369 Ga0157377_10000010 3300014745 Bacteria 380929
370 Ga0157377_10234589 3300014745 Bacteria 1181
371 Ga0157377_10334670 3300014745 Bacteria 1010
372 Ga0157377_10695959 3300014745 Bacteria 737
373 Ga0157379_10053364 3300014968 Bacteria 3610
374 Ga0157379_10121514 3300014968 Bacteria 2349
375 Ga0157379_10175551 3300014968 Bacteria 1935
376 Ga0157379_10534792 3300014968 Bacteria 1089
377 Ga0157379_10722309 3300014968 Bacteria 936
378 Ga0157379_11438568 3300014968 Bacteria 669
379 Ga0157376_10324273 3300014969 Bacteria 1465
380 Ga0157376_10594588 3300014969 Bacteria 1101
381 Ga0157376_10649534 3300014969 Bacteria 1055
382 Ga0182007_10181006 3300015262 Bacteria 729
383 Ga0163161_10002372 3300017792 Bacteria 13495
384 Ga0163161_10183334 3300017792 Bacteria 1606
385 Ga0163161_10326819 3300017792 Bacteria 1214
386 Ga0163161_10450000 3300017792 Bacteria 1041
387 Ga0206356_11645321 3300020070 Bacteria 1092
388 Ga0206352_10674374 3300020078 Bacteria 728
389 Ga0206354_11514788 3300020081 Bacteria 2018
390 Ga0206353_11438233 3300020082 Bacteria 1459
391 Ga0213874_10180310 3300021377 Unclassified 751
392 Ga0209673_1002911 3300025273 Bacteria 10803
393 Ga0209673_1003599 3300025273 Bacteria 9008
394 Ga0209050_1004646 3300025298 Bacteria 9149
395 Ga0209050_1008129 3300025298 Bacteria 5687
396 Ga0209256_1001476 3300025299 Bacteria 24051
397 Ga0209051_1000648 3300025303 Bacteria 39536
398 Ga0209051_1011406 3300025303 Bacteria 4390
399 Ga0209257_1000131 3300025304 Bacteria 211464
400 Ga0209257_1000673 3300025304 Bacteria 53490
401 Ga0207656_10025064 3300025321 Bacteria 2419
402 Ga0207656_10058092 3300025321 Bacteria 1689
403 Ga0207656_10118911 3300025321 Bacteria 1228
404 Ga0207656_10147472 3300025321 Bacteria 1112
405 Ga0207653_10025876 3300025885 Bacteria 1878
406 Ga0207682_10003485 3300025893 Bacteria 6819
407 Ga0207682_10022332 3300025893 Bacteria 2492
408 Ga0207692_10828702 3300025898 Bacteria 606
409 Ga0207642_10027248 3300025899 Bacteria 2337
410 Ga0207710_10032132 3300025900 Bacteria 2299
411 Ga0207688_10120256 3300025901 Bacteria 1532
412 Ga0207688_10143148 3300025901 Bacteria 1408
413 Ga0207688_10639499 3300025901 Bacteria 671
414 Ga0207680_10018348 3300025903 Bacteria 3717
415 Ga0207680_10676439 3300025903 Bacteria 739
416 Ga0207680_11282524 3300025903 Bacteria 521
417 Ga0207647_10546480 3300025904 Bacteria 643
418 Ga0207685_10093140 3300025905 Bacteria 1273
419 Ga0207645_10004020 3300025907 Bacteria 10965
420 Ga0207645_10115349 3300025907 Bacteria 1741
421 Ga0207645_10488211 3300025907 Bacteria 833
422 Ga0207705_11393461 3300025909 Bacteria 533
423 Ga0207684_10113995 3300025910 Bacteria 2315
424 Ga0207654_10013176 3300025911 Bacteria 4248
425 Ga0207654_10119807 3300025911 Bacteria 1651
426 Ga0207707_10009059 3300025912 Bacteria 8645
427 Ga0207707_10392547 3300025912 Bacteria 1192
428 Ga0207695_10168662 3300025913 Bacteria 2116
429 Ga0207671_10213514 3300025914 Bacteria 1510
430 Ga0207671_10481835 3300025914 Bacteria 989
431 Ga0207693_10166318 3300025915 Bacteria 1736
432 Ga0207660_10016006 3300025917 Bacteria 4958
433 Ga0207660_10040090 3300025917 Bacteria 3277
434 Ga0207660_11101651 3300025917 Bacteria 647
435 Ga0207662_10049144 3300025918 Bacteria 2501
436 Ga0207662_10094453 3300025918 Bacteria 1844
437 Ga0207662_10249948 3300025918 Bacteria 1163
438 Ga0207657_10006685 3300025919 Bacteria 11923
439 Ga0207657_10063313 3300025919 Bacteria 3163
440 Ga0207657_10467062 3300025919 Bacteria 990
441 Ga0207649_10199266 3300025920 Bacteria 1413
442 Ga0207652_10018045 3300025921 Bacteria 5784
443 Ga0207652_10023480 3300025921 Bacteria 5110
444 Ga0207652_10700824 3300025921 Bacteria 903
445 Ga0207681_10000340 3300025923 Bacteria 33613
446 Ga0207681_10575148 3300025923 Bacteria 929
447 Ga0207694_10007424 3300025924 Bacteria 8308
448 Ga0207694_10812044 3300025924 Bacteria 790
449 Ga0207650_10056224 3300025925 Bacteria 2923
450 Ga0207650_10084655 3300025925 Bacteria 2411
451 Ga0207650_10469575 3300025925 Bacteria 1049
452 Ga0207650_10574102 3300025925 Bacteria 947
453 Ga0207650_10629929 3300025925 Bacteria 903
454 Ga0207650_10739305 3300025925 Bacteria 832
455 Ga0207659_10016814 3300025926 Bacteria 4769
456 Ga0207659_10089935 3300025926 Bacteria 2290
457 Ga0207659_10382353 3300025926 Bacteria 1174
458 Ga0207687_10224592 3300025927 Bacteria 1480
459 Ga0207687_10546758 3300025927 Bacteria 971
460 Ga0207700_10562754 3300025928 Bacteria 1013
461 Ga0207664_10236895 3300025929 Bacteria 1588
462 Ga0207644_10000042 3300025931 Bacteria 112685
463 Ga0207644_10191727 3300025931 Bacteria 1607
464 Ga0207644_10516397 3300025931 Bacteria 986
465 Ga0207644_10736699 3300025931 Bacteria 823
466 Ga0207690_10012011 3300025932 Bacteria 5179
467 Ga0207690_10266614 3300025932 Bacteria 1329
468 Ga0207690_10538650 3300025932 Bacteria 948
469 Ga0207690_10732169 3300025932 Bacteria 814
470 Ga0207690_11567520 3300025932 Bacteria 550
471 Ga0207706_10136318 3300025933 Bacteria 2159
472 Ga0207706_10160965 3300025933 Bacteria 1973
473 Ga0207706_10334028 3300025933 Bacteria 1318
474 Ga0207706_10535451 3300025933 Bacteria 1009
475 Ga0207706_10771762 3300025933 Bacteria 818
476 Ga0207706_10829901 3300025933 Bacteria 784
477 Ga0207686_10038506 3300025934 Bacteria 2894
478 Ga0207686_10281121 3300025934 Bacteria 1228
479 Ga0207709_10001570 3300025935 Bacteria 15648
480 Ga0207709_10015155 3300025935 Bacteria 4272
481 Ga0207709_10028955 3300025935 Bacteria 3207
482 Ga0207709_11456611 3300025935 Bacteria 568
483 Ga0207670_10216643 3300025936 Bacteria 1463
484 Ga0207669_10005760 3300025937 Bacteria 5594
485 Ga0207669_10124620 3300025937 Bacteria 1757
486 Ga0207669_10397338 3300025937 Bacteria 1079
487 Ga0207669_11063836 3300025937 Bacteria 682
488 Ga0207669_11364316 3300025937 Bacteria 603
489 Ga0207704_10003619 3300025938 Bacteria 7016
490 Ga0207704_10378949 3300025938 Bacteria 1110
491 Ga0207665_10099175 3300025939 Bacteria 2031
492 Ga0207691_10038546 3300025940 Bacteria 4423
493 Ga0207691_10040632 3300025940 Bacteria 4296
494 Ga0207691_10044292 3300025940 Bacteria 4097
495 Ga0207691_10078502 3300025940 Bacteria 2972
496 Ga0207691_10085217 3300025940 Bacteria 2836
497 Ga0207691_10347472 3300025940 Bacteria 1269
498 Ga0207691_10363157 3300025940 Bacteria 1238
499 Ga0207711_10001998 3300025941 Bacteria 18443
500 Ga0207711_10013198 3300025941 Bacteria 6863
501 Ga0207711_10428641 3300025941 Bacteria 1230
502 Ga0207711_10535419 3300025941 Bacteria 1092
503 Ga0207711_10684623 3300025941 Bacteria 956
504 Ga0207689_10002255 3300025942 Bacteria 18068
505 Ga0207689_10194179 3300025942 Bacteria 1675
506 Ga0207689_10238758 3300025942 Bacteria 1502
507 Ga0207689_10257946 3300025942 Bacteria 1442
508 Ga0207689_10463474 3300025942 Bacteria 1060
509 Ga0207689_11578299 3300025942 Bacteria 546
510 Ga0207661_10022644 3300025944 Bacteria 4736
511 Ga0207661_10026865 3300025944 Bacteria 4392
512 Ga0207661_11125468 3300025944 Bacteria 723
513 Ga0207679_10090984 3300025945 Bacteria 2360
514 Ga0207679_10103210 3300025945 Bacteria 2234
515 Ga0207679_10405640 3300025945 Bacteria 1200
516 Ga0207679_11115295 3300025945 Bacteria 724
517 Ga0207679_11474894 3300025945 Bacteria 624
518 Ga0207679_12002488 3300025945 Bacteria 527
519 Ga0207667_10020875 3300025949 Bacteria 7270
520 Ga0207667_10585785 3300025949 Bacteria 1126
521 Ga0207667_10683243 3300025949 Bacteria 1030
522 Ga0207667_11137892 3300025949 Bacteria 762
523 Ga0207651_10010197 3300025960 Bacteria 5194
524 Ga0207651_10284399 3300025960 Bacteria 1368
525 Ga0207651_10309098 3300025960 Bacteria 1317
526 Ga0207712_10003827 3300025961 Bacteria 9501
527 Ga0207712_10025416 3300025961 Bacteria 3934
528 Ga0207668_10471115 3300025972 Bacteria 1075
529 Ga0207640_10016926 3300025981 Bacteria 4253
530 Ga0207640_10128100 3300025981 Bacteria 1830
531 Ga0207640_10138354 3300025981 Bacteria 1771
532 Ga0207658_10000756 3300025986 Bacteria 27753
533 Ga0207658_11234071 3300025986 Bacteria 683
534 Ga0207677_10050233 3300026023 Bacteria 2820
535 Ga0207677_10095899 3300026023 Bacteria 2169
536 Ga0207677_10396723 3300026023 Bacteria 1169
537 Ga0207677_10747224 3300026023 Bacteria 872
538 Ga0207677_11275884 3300026023 Bacteria 674
539 Ga0207677_11680337 3300026023 Bacteria 588
540 Ga0207703_10001349 3300026035 Bacteria 22464
541 Ga0207639_10099819 3300026041 Bacteria 2343
542 Ga0207639_10188721 3300026041 Bacteria 1759
543 Ga0207639_10510642 3300026041 Bacteria 1099
544 Ga0207639_11417227 3300026041 Bacteria 652
545 Ga0207678_10008926 3300026067 Bacteria 8826
546 Ga0207678_10036525 3300026067 Bacteria 4276
547 Ga0207678_10060575 3300026067 Bacteria 3256
548 Ga0207678_10177049 3300026067 Bacteria 1821
549 Ga0207678_10855340 3300026067 Bacteria 804
550 Ga0207708_10000535 3300026075 Bacteria 29316
551 Ga0207708_10002372 3300026075 Bacteria 13837
552 Ga0207708_10048764 3300026075 Bacteria 3224
553 Ga0207708_11117869 3300026075 Bacteria 687
554 Ga0207702_10106581 3300026078 Bacteria 2483
555 Ga0207702_10214358 3300026078 Bacteria 1791
556 Ga0207702_10984053 3300026078 Bacteria 837
557 Ga0207641_10005453 3300026088 Bacteria 10853
558 Ga0207641_10038539 3300026088 Bacteria 3996
559 Ga0207641_10044388 3300026088 Bacteria 3738
560 Ga0207641_10768558 3300026088 Bacteria 952
561 Ga0207641_11035437 3300026088 Bacteria 818
562 Ga0207641_11174425 3300026088 Bacteria 767
563 Ga0207648_10000002 3300026089 Bacteria 307909
564 Ga0207648_10002846 3300026089 Bacteria 18315
565 Ga0207648_10114822 3300026089 Bacteria 2366
566 Ga0207648_10444814 3300026089 Bacteria 1179
567 Ga0207648_10922574 3300026089 Bacteria 816
568 Ga0207676_10012389 3300026095 Bacteria 6109
569 Ga0207676_10049440 3300026095 Bacteria 3271
570 Ga0207676_10098325 3300026095 Bacteria 2419
571 Ga0207676_10159205 3300026095 Bacteria 1954
572 Ga0207676_10227823 3300026095 Bacteria 1664
573 Ga0207676_10746411 3300026095 Bacteria 951
574 Ga0207674_10000253 3300026116 Bacteria 66599
575 Ga0207674_10001583 3300026116 Bacteria 29309
576 Ga0207674_10021790 3300026116 Bacteria 6896
577 Ga0207674_10290191 3300026116 Bacteria 1584
578 Ga0207674_10810473 3300026116 Bacteria 903
579 Ga0207674_11901184 3300026116 Bacteria 561
580 Ga0207675_100003938 3300026118 Bacteria 14411
581 Ga0207675_100274764 3300026118 Bacteria 1636
582 Ga0207675_101367465 3300026118 Bacteria 729
583 Ga0207675_101468824 3300026118 Bacteria 702
584 Ga0207683_10035993 3300026121 Bacteria 4308
585 Ga0207683_10038810 3300026121 Bacteria 4153
586 Ga0207683_10058156 3300026121 Bacteria 3394
587 Ga0207683_10116160 3300026121 Bacteria 2399
588 Ga0207683_10341566 3300026121 Bacteria 1373
589 Ga0207683_10344799 3300026121 Bacteria 1366
590 Ga0207683_10662493 3300026121 Bacteria 967
591 Ga0207683_11163580 3300026121 Bacteria 715
592 Ga0207698_10005678 3300026142 Bacteria 7726
593 Ga0207698_10025684 3300026142 Bacteria 4154
594 Ga0207698_10198889 3300026142 Bacteria 1793
595 Ga0207698_10199879 3300026142 Bacteria 1789
596 Ga0207698_10433323 3300026142 Bacteria 1265
597 Ga0207698_10566792 3300026142 Bacteria 1115
598 Ga0207698_12742589 3300026142 Bacteria 501
599 Ga0209389_1050565 3300027296 Bacteria 2885
600 Ga0209588_1023442 3300027671 Bacteria 1945
601 Ga0209974_10388078 3300027876 Bacteria 546
602 Ga0268266_10076602 3300028379 Bacteria 2907
603 Ga0268265_10003906 3300028380 Bacteria 10506
604 Ga0268265_10080106 3300028380 Bacteria 2574
605 Ga0268265_10091479 3300028380 Bacteria 2433
606 Ga0268264_10011337 3300028381 Bacteria 7365
607 Ga0268264_10062297 3300028381 Bacteria 3131
608 Ga0268264_10186627 3300028381 Bacteria 1887
609 Ga0268264_10974229 3300028381 Bacteria 854
610 Ga0307517_10079232 3300028786 Bacteria 2829
611 Ga0307513_10046140 3300031456 Bacteria 4756
612 Ga0307513_10081906 3300031456 Bacteria 3324
613 Ga0307408_101219277 3300031548 Bacteria 702
614 Ga0307516_10022212 3300031730 Bacteria 6521
615 Ga0307413_10181628 3300031824 Bacteria 1501
616 Ga0307406_10828472 3300031901 Bacteria 783
617 Ga0307412_10162517 3300031911 Bacteria 1661
618 Ga0307412_11171562 3300031911 Bacteria 687
619 Ga0307409_100797121 3300031995 Bacteria 952
620 Ga0307409_102216864 3300031995 Bacteria 579
621 Ga0307416_100020832 3300032002 Bacteria 4690
622 Ga0307414_11159539 3300032004 Bacteria 715
623 Ga0307414_11788897 3300032004 Bacteria 573
624 Ga0307411_10444646 3300032005 Bacteria 1083
625 Ga0316588_1036994 3300033528 Bacteria 1160
626 Ga0373950_0085043 3300034818 Bacteria 665
627 Ga0373958_0034446 3300034819 Bacteria 1009
628 Ga0373926_0053209 3300035083 Bacteria 1465
629 Ga0373946_0088150 3300035171 Bacteria 1371
630 Ga0373962_0128201 3300035242 Bacteria 814
631 Ga0373931_0180663 3300035691 Bacteria 1249
632 Ga0373947_0082407 3300035725 Bacteria 1994
633 Ga0373947_0449084 3300035725 Bacteria 873
634 Ga0373937_1050653 3300036401 Bacteria 763
635 Ga0316582_0702171 3300036647 Bacteria 695
636 Ga0316584_0097316 3300036712 Bacteria 2203
637 Ga0395899_0015319 3300037312 Bacteria 5843
638 Ga0395900_0020353 3300037418 Bacteria 6773
639 Ga0395900_0171446 3300037418 Bacteria 2209
640 Ga0395905_0007590 3300037471 Bacteria 10771
641 Ga0395905_0151634 3300037471 Bacteria 2181
642 Ga0395905_0957003 3300037471 Bacteria 759
643 Ga0395901_0000745 3300038443 Bacteria 36791
644 Ga0395901_0459161 3300038443 Bacteria 1302
645 Ga0400483_056891 3300039062 Bacteria 1596
646 Ga0400483_177311 3300039062 Bacteria 1604
647 Ga0436365_1821131 3300039437 Bacteria 705
648 Ga0436360_0635123 3300039438 Bacteria 672
649 Ga0436361_0527389 3300039447 Bacteria 1159
650 Ga0436361_0649270 3300039447 Bacteria 2565
651 Ga0436363_0466499 3300039450 Bacteria 2483
652 Ga0436363_0909370 3300039450 Unclassified 831
653 Ga0436362_0823712 3300039453 Bacteria 918
654 Ga0451791_0050792 3300041451 Bacteria 874
655 Ga0451800_0566674 3300041459 Bacteria 1238
656 Ga0451807_0932619 3300041486 Bacteria 660
657 Ga0451807_1757683 3300041486 Bacteria 2304
658 Ga0451839_0365329 3300041496 Bacteria 503
659 Ga0451853_0822117 3300041512 Bacteria 652
660 Ga0451853_1186902 3300041512 Bacteria 679
661 Ga0451853_1412040 3300041512 Bacteria 504
662 Ga0451853_3287960 3300041512 Bacteria 1690
663 Ga0439449_0260107 3300042007 Bacteria 653
664 Ga0439451_004856 3300042009 Bacteria 2736
665 Ga0439456_071035 3300042013 Bacteria 771
666 Ga0450914_007071 3300042118 Bacteria 1004
667 Ga0450890_000321 3300042127 Bacteria 6924
668 Ga0450905_059105 3300042142 Bacteria 637
669 Ga0439446_0021282 3300042156 Bacteria 1832
670 Ga0453683_0085215 3300044673 Bacteria 1979
671 Ga0451576_0265175 3300045051 Bacteria 1795
672 Ga0495617_001549 3300046452 Bacteria 9959
673 Ga0495627_002781 3300046453 Bacteria 8126
674 Ga0495592_0270100 3300046454 Bacteria 1116
675 Ga0495590_0001842 3300046457 Bacteria 8974
676 Ga0495590_0003633 3300046457 Bacteria 6281
677 Ga0495590_0198443 3300046457 Bacteria 737
678 Ga0495651_0708151 3300046462 Bacteria 627
679 Ga0495650_0005350 3300046471 Bacteria 8376
680 Ga0495580_0167963 3300046472 Bacteria 1517
681 Ga0495582_0042920 3300046473 Bacteria 2490
682 Ga0495582_0433400 3300046473 Bacteria 759
683 Ga0495605_0011633 3300046474 Bacteria 4898
684 Ga0495639_0020584 3300046475 Bacteria 2883
685 Ga0495662_0180209 3300046476 Bacteria 1041
686 Ga0495664_0024325 3300046477 Bacteria 3519
687 Ga0495584_0003708 3300046491 Bacteria 8327
688 Ga0495584_0011932 3300046491 Bacteria 4442
689 Ga0495585_0000756 3300046492 Bacteria 28639
690 Ga0495607_0000637 3300046501 Bacteria 34042
691 Ga0495607_0065857 3300046501 Bacteria 2041
692 Ga0495606_0542355 3300046507 Bacteria 580
693 Ga0495608_0401764 3300046511 Bacteria 838
694 Ga0495610_0038712 3300046512 Bacteria 2418
695 Ga0495616_0014077 3300046513 Bacteria 4490
696 Ga0495616_0099451 3300046513 Bacteria 1366
697 Ga0495616_0384892 3300046513 Bacteria 579
698 Ga0495618_0230367 3300046514 Bacteria 1166
699 Ga0495620_0106816 3300046515 Bacteria 1112
700 Ga0495630_0035993 3300046517 Bacteria 3700
701 Ga0495630_0336434 3300046517 Bacteria 1155
702 Ga0495631_0394510 3300046518 Bacteria 589
703 Ga0495632_0003848 3300046519 Bacteria 10444
704 Ga0495632_0018955 3300046519 Bacteria 3757
705 Ga0495637_0032976 3300046520 Bacteria 2277
706 Ga0495643_0006334 3300046522 Bacteria 7817
707 Ga0495643_0127363 3300046522 Bacteria 1281
708 Ga0495648_0018965 3300046524 Bacteria 4852
709 Ga0495648_0076588 3300046524 Bacteria 1920
710 Ga0495666_0020379 3300046526 Bacteria 3286
711 Ga0495642_0007901 3300046528 Bacteria 4074
712 Ga0495652_0432079 3300046529 Bacteria 926
713 Ga0495654_0091852 3300046530 Bacteria 1407
714 Ga0495654_0215028 3300046530 Bacteria 816
715 Ga0495665_0126767 3300046531 Bacteria 1337
716 Ga0495640_0052592 3300046533 Bacteria 2796
717 Ga0495586_0040693 3300046535 Bacteria 2501
718 Ga0495609_0005475 3300046538 Bacteria 6655
719 Ga0495621_0010202 3300046539 Bacteria 2868
720 Ga0495621_0158520 3300046539 Bacteria 894
721 Ga0495597_0004785 3300046542 Bacteria 7317
722 Ga0495597_0077320 3300046542 Bacteria 1426
723 Ga0495622_0048833 3300046557 Bacteria 1965
724 Ga0495622_0332190 3300046557 Bacteria 659
725 Ga0495667_0219633 3300046559 Bacteria 1213
726 Ga0495656_0614227 3300046615 Bacteria 582
727 Ga0495634_0008655 3300046642 Bacteria 7550
728 Ga0495611_0003183 3300046648 Bacteria 7269
729 Ga0495635_0616309 3300046663 Bacteria 708
730 Ga0495659_0013203 3300046664 Bacteria 2687
731 Ga0495647_0004407 3300046681 Bacteria 4575
732 Ga0495647_0080337 3300046681 Bacteria 1321
733 Ga0495658_0070648 3300046683 Bacteria 2026
734 Ga0495658_0128881 3300046683 Bacteria 1538
735 Ga0495669_0254979 3300046684 Bacteria 843
736 Ga0495669_0433057 3300046684 Bacteria 638
737 Ga0495613_0402479 3300046689 Bacteria 933
738 Ga0495670_0122488 3300046691 Bacteria 1351
739 Ga0495649_0000086 3300046694 Bacteria 80528
740 Ga0495649_0090734 3300046694 Bacteria 1629
741 Ga0495589_0000636 3300046794 Bacteria 23067
742 Ga0495660_0103786 3300046810 Bacteria 1460
743 Ga0495660_0193200 3300046810 Bacteria 977
744 Ga0495660_0213571 3300046810 Bacteria 913
745 Ga0495636_0001144 3300047318 Bacteria 10001
746 Ga0495674_0037120 3300047319 Bacteria 4380
747 Ga0495674_0309700 3300047319 Bacteria 1288
748 Ga0495672_0001126 3300047320 Bacteria 27097
749 Ga0495680_0188335 3300047322 Bacteria 1485
750 Ga0495687_001073 3300047443 Bacteria 26922
751 Ga0495687_008149 3300047443 Bacteria 6043
752 Ga0495685_003266 3300047447 Bacteria 5165
753 Ga0495673_0004100 3300047469 Bacteria 9247
754 Ga0495681_0005449 3300047470 Bacteria 8510
755 Ga0495681_0111388 3300047470 Bacteria 1185
756 Ga0495684_0033903 3300047471 Bacteria 3917
757 Ga0495686_0001282 3300047472 Bacteria 28414
758 Ga0495686_0004782 3300047472 Bacteria 10943
759 Ga0495686_0146610 3300047472 Bacteria 1389
760 Ga0495615_0307616 3300048090 Bacteria 515
761 Ga0495626_0000490 3300048091 Bacteria 39851
762 Ga0496100_0599007 3300048903 Bacteria 856
763 Ga0496101_0000946 3300048904 Bacteria 17119
764 Ga0496101_0474741 3300048904 Bacteria 987
765 Ga0496102_0006848 3300048905 Bacteria 9726
766 Ga0496102_0010277 3300048905 Bacteria 8047
767 Ga0496102_0014500 3300048905 Bacteria 6847
768 Ga0496102_1073406 3300048905 Bacteria 725
769 Ga0496103_0064719 3300048906 Bacteria 2280
770 Ga0496103_0156155 3300048906 Bacteria 1462
771 Ga0496103_0705608 3300048906 Bacteria 639
772 Ga0496103_0851553 3300048906 Bacteria 573
773 Ga0496104_0030456 3300048907 Bacteria 5014
774 Ga0496104_0499328 3300048907 Bacteria 1128
775 Ga0496104_1826275 3300048907 Bacteria 510
776 Ga0496105_0772589 3300048908 Bacteria 732
777 Ga0496105_0780349 3300048908 Bacteria 728
778 Ga0496105_1096254 3300048908 Bacteria 591
779 Ga0496105_1119061 3300048908 Bacteria 584
780 Ga0496106_0001831 3300048909 Bacteria 15915
781 Ga0496106_0012041 3300048909 Bacteria 6383
782 Ga0496106_0035589 3300048909 Bacteria 3723
783 Ga0496107_0012964 3300048910 Bacteria 5825
784 Ga0496107_0133375 3300048910 Bacteria 1834
785 Ga0496107_0203364 3300048910 Bacteria 1472
786 Ga0496108_0035247 3300048911 Bacteria 4158
787 Ga0496108_0048381 3300048911 Bacteria 3555
788 Ga0496108_0922293 3300048911 Bacteria 749
789 Ga0496108_1135288 3300048911 Bacteria 663
790 Ga0496109_0007810 3300048912 Bacteria 9062
791 Ga0496109_0035054 3300048912 Bacteria 4524
792 Ga0496109_0572379 3300048912 Bacteria 1065
793 Ga0496109_0771267 3300048912 Bacteria 900
794 Ga0496110_0000678 3300048913 Bacteria 23383
795 Ga0496110_0022804 3300048913 Bacteria 5319
796 Ga0496110_0938165 3300048913 Bacteria 772
797 Ga0496111_0008384 3300048914 Bacteria 6835
798 Ga0496112_0515307 3300048915 Bacteria 1131
799 Ga0496112_0636975 3300048915 Bacteria 996
800 Ga0496112_1889146 3300048915 Bacteria 509
801 Ga0496113_0140832 3300048916 Bacteria 1897
802 Ga0496113_0417678 3300048916 Bacteria 1077
803 Ga0496113_0497419 3300048916 Bacteria 979
804 Ga0496114_0264875 3300048917 Bacteria 1514
805 Ga0496114_0295237 3300048917 Bacteria 1430
806 Ga0496114_0327111 3300048917 Bacteria 1355
807 Ga0496115_0076791 3300048918 Bacteria 2715
808 Ga0496115_0282032 3300048918 Bacteria 1364
809 Ga0496115_0420867 3300048918 Bacteria 1082
810 Ga0496118_0121214 3300048921 Bacteria 1704
811 Ga0496124_0017518 3300048927 Bacteria 6747
812 Ga0495678_000437 3300049459 Bacteria 41568
813 Ga0495682_0154673 3300049460 Bacteria 817
814 Ga0501292_029095 3300049515 Bacteria 923
815 Ga0501294_028909 3300049517 Bacteria 637
816 Ga0501031_0029337 3300049568 Bacteria 3589
817 Ga0501031_0508335 3300049568 Bacteria 777
818 Ga0501036_0085824 3300049572 Bacteria 2661
819 Ga0501036_0154343 3300049572 Bacteria 1937
820 Ga0501039_0030524 3300049575 Bacteria 4156
821 Ga0501039_0571487 3300049575 Bacteria 887
822 Ga0501039_1550066 3300049575 Bacteria 509
823 Ga0501040_0010704 3300049576 Bacteria 5998
824 Ga0501041_0045372 3300049577 Bacteria 2672
825 Ga0501041_0225490 3300049577 Bacteria 1176
826 Ga0501041_0253599 3300049577 Bacteria 1106
827 Ga0501042_0018382 3300049578 Bacteria 4838
828 Ga0501042_0025696 3300049578 Bacteria 4138
829 Ga0501042_0042095 3300049578 Bacteria 3250
830 Ga0501042_0223767 3300049578 Bacteria 1357
831 Ga0501042_0449052 3300049578 Bacteria 935
832 Ga0501046_0611471 3300049580 Bacteria 773
833 Ga0501048_0311269 3300049582 Bacteria 1121
834 Ga0501048_0444874 3300049582 Unclassified 928
835 Ga0501048_0537350 3300049582 Bacteria 839
836 Ga0501070_0752296 3300049586 Bacteria 768
837 Ga0501071_0017977 3300049587 Bacteria 4889
838 Ga0501071_0137500 3300049587 Bacteria 1818
839 Ga0501071_0328426 3300049587 Bacteria 1162
840 Ga0501071_1238479 3300049587 Bacteria 577
841 Ga0501072_0012333 3300049588 Bacteria 6531
842 Ga0501073_0017452 3300049589 Bacteria 5199
843 Ga0501073_0608109 3300049589 Bacteria 755
844 Ga0501074_0047129 3300049590 Bacteria 3116
845 Ga0501074_1034318 3300049590 Bacteria 577
846 Ga0501075_0253685 3300049591 Bacteria 1341
847 Ga0501075_0858496 3300049591 Bacteria 690
848 Ga0501075_0901114 3300049591 Bacteria 672
849 Ga0501076_0978515 3300049592 Bacteria 697
850 Ga0501077_0271443 3300049593 Bacteria 1079
851 Ga0501077_0555969 3300049593 Bacteria 736
852 Ga0501206_000997 3300049653 Bacteria 3528
853 Ga0501222_008276 3300049662 Bacteria 1381
854 Ga0501257_012817 3300049686 Bacteria 1920
855 Ga0501261_052684 3300049690 Bacteria 671
856 Ga0501079_0002078 3300049741 Bacteria 14359
857 Ga0501081_0095927 3300049743 Bacteria 2091
858 Ga0501081_0132526 3300049743 Unclassified 1781
859 Ga0501081_0756490 3300049743 Bacteria 730
860 Ga0501083_0944779 3300049744 Unclassified 561
861 Ga0501265_010796 3300049762 Bacteria 1120
862 Ga0501035_0060070 3300049822 Bacteria 3385
863 Ga0501035_0391070 3300049822 Bacteria 1158
864 Ga0501035_0519952 3300049822 Bacteria 978
865 Ga0501045_0026520 3300049824 Bacteria 4169
866 Ga0501045_0104928 3300049824 Bacteria 2094
867 Ga0501045_0153003 3300049824 Bacteria 1716
868 Ga0501045_1419392 3300049824 Bacteria 504
869 nmdc:mga00v17_33166_c1 3300050491 Bacteria 3058
870 nmdc:mga0yw44_106134_c2 3300050492 Bacteria 1489
871 nmdc:mga0k408_444313_c1 3300050493 Bacteria 770
872 nmdc:mga06z11_476289_c1 3300050494 Bacteria 755
873 nmdc:mga07m45_14752_c1 3300050496 Bacteria 4170
874 nmdc:mga05p37_571537_c1 3300050507 Bacteria 1282
875 nmdc:mga05p37_825488_c1 3300050507 Bacteria 1010
876 nmdc:mga09592_63812_c1 3300050508 Unclassified 3118
877 nmdc:mga0qj67_15978_c1 3300050509 Bacteria 5683
878 nmdc:mga0qj67_399888_c1 3300050509 Bacteria 1108
879 nmdc:mga0qj67_654148_c1 3300050509 Bacteria 838
880 nmdc:mga06r32_1160145_c1 3300050510 Bacteria 720
881 nmdc:mga06r32_135379_c1 3300050510 Bacteria 2438
882 nmdc:mga08y16_1215365_c1 3300050511 Bacteria 724
883 nmdc:mga08y16_128079_c1 3300050511 Bacteria 2640
884 nmdc:mga08y16_548632_c1 3300050511 Bacteria 1170
885 nmdc:mga08y16_610785_c1 3300050511 Bacteria 1098
886 nmdc:mga08y16_648543_c1 3300050511 Bacteria 1060
887 nmdc:mga0n895_460071_c1 3300050512 Unclassified 1284
888 nmdc:mga0rr50_196583_c1 3300050513 Bacteria 1655
889 nmdc:mga08x19_256803_c1 3300050514 Bacteria 1207
890 nmdc:mga08x19_62273_c1 3300050514 Bacteria 2419
891 nmdc:mga0a205_44007_c1 3300050515 Bacteria 4303
892 Ga0495601_0505052 3300053077 Unclassified 780
893 Ga0495655_0052590 3300053083 Bacteria 1084
894 Ga0495655_0084467 3300053083 Bacteria 914
895 Ga0495655_0357290 3300053083 Bacteria 512
896 Ga0500578_0043866 3300053086 Bacteria 2871
897 Ga0500583_0305445 3300053092 Bacteria 778
898 Ga0500641_0398486 3300053096 Bacteria 542
899 Ga0500568_0182939 3300053139 Bacteria 770
900 Ga0500645_007433 3300053730 Bacteria 3813
901 Ga0501084_0020668 3300054114 Bacteria 5491
902 Ga0501084_0206361 3300054114 Bacteria 1658
903 Ga0501084_0314841 3300054114 Bacteria 1322
904 Ga0501084_0339597 3300054114 Bacteria 1269
905 Ga0501084_1329676 3300054114 Bacteria 602
906 Ga0590075_079124 3300059424 Bacteria 851
907 Ga0501082_0024896 3300060353 Bacteria 5157
908 Ga0501082_0219027 3300060353 Bacteria 1656
909 Ga0501082_1146821 3300060353 Bacteria 679

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100962614 Ga0070704_1009626142 104
2 3300048906 Ga0496103_0705608 Ga0496103_0705608_285_614 105
3 3300025918 Ga0207662_10249948 Ga0207662_102499482 106
4 3300005335 Ga0070666_10173409 Ga0070666_101734092 115
5 3300005339 Ga0070660_100784375 Ga0070660_1007843751 115
6 3300005340 Ga0070689_100351680 Ga0070689_1003516802 115
7 3300005347 Ga0070668_100208445 Ga0070668_1002084451 115
8 3300005353 Ga0070669_100826069 Ga0070669_1008260692 115
9 3300005355 Ga0070671_100118942 Ga0070671_1001189423 115
10 3300005364 Ga0070673_100060051 Ga0070673_1000600514 115
11 3300005366 Ga0070659_100074878 Ga0070659_1000748783 115
12 3300005367 Ga0070667_101659284 Ga0070667_1016592841 115
13 3300005543 Ga0070672_100031238 Ga0070672_1000312383 115
14 3300005616 Ga0068852_100629953 Ga0068852_1006299532 115
15 3300005617 Ga0068859_100601278 Ga0068859_1006012782 115
16 3300005618 Ga0068864_101327893 Ga0068864_1013278932 115
17 3300005844 Ga0068862_101494533 Ga0068862_1014945332 115
18 3300006353 Ga0075370_10690263 Ga0075370_106902631 115
19 3300006358 Ga0068871_100895337 Ga0068871_1008953372 115
20 3300006931 Ga0097620_100601327 Ga0097620_1006013272 115
21 3300009098 Ga0105245_13173533 Ga0105245_131735331 115
22 3300009177 Ga0105248_10003918 Ga0105248_100039185 115
23 3300013102 Ga0157371_10555853 Ga0157371_105558531 115
24 3300013296 Ga0157374_11559734 Ga0157374_115597341 115
25 3300013297 Ga0157378_11090793 Ga0157378_110907931 115
26 3300013308 Ga0157375_10075657 Ga0157375_100756574 115
27 3300014745 Ga0157377_10695959 Ga0157377_106959592 115
28 3300014968 Ga0157379_10722309 Ga0157379_107223092 115
29 3300025937 Ga0207669_11364316 Ga0207669_113643162 115
30 3300048911 Ga0496108_0922293 Ga0496108_0922293_214_567 115
31 3300003659 JGI25404J52841_10004899 JGI25404J52841_100048994 116
32 3300005340 Ga0070689_100536919 Ga0070689_1005369192 116
33 3300005347 Ga0070668_100826296 Ga0070668_1008262962 116
34 3300005356 Ga0070674_100083924 Ga0070674_1000839243 116
35 3300005365 Ga0070688_101614248 Ga0070688_1016142481 116
36 3300005367 Ga0070667_101046320 Ga0070667_1010463201 116
37 3300005438 Ga0070701_10120417 Ga0070701_101204171 116
38 3300005441 Ga0070700_100200600 Ga0070700_1002006002 116
39 3300005441 Ga0070700_100807362 Ga0070700_1008073621 116
40 3300005444 Ga0070694_100013925 Ga0070694_1000139253 116
41 3300005535 Ga0070684_100278259 Ga0070684_1002782592 116
42 3300005539 Ga0068853_100643106 Ga0068853_1006431062 116
43 3300005545 Ga0070695_100171483 Ga0070695_1001714832 116
44 3300005546 Ga0070696_100111458 Ga0070696_1001114582 116
45 3300005549 Ga0070704_100022238 Ga0070704_1000222383 116
46 3300005563 Ga0068855_100480758 Ga0068855_1004807583 116
47 3300005615 Ga0070702_100193403 Ga0070702_1001934032 116
48 3300005617 Ga0068859_100215382 Ga0068859_1002153822 116
49 3300005719 Ga0068861_100042324 Ga0068861_1000423243 116
50 3300005842 Ga0068858_100287055 Ga0068858_1002870552 116
51 3300005843 Ga0068860_100235990 Ga0068860_1002359902 116
52 3300005844 Ga0068862_100540129 Ga0068862_1005401292 116
53 3300005983 Ga0081540_1000313 Ga0081540_100031342 116
54 3300006844 Ga0075428_101189089 Ga0075428_1011890891 116
55 3300006846 Ga0075430_100022398 Ga0075430_1000223989 116
56 3300006846 Ga0075430_101310527 Ga0075430_1013105272 116
57 3300006847 Ga0075431_101212945 Ga0075431_1012129451 116
58 3300006880 Ga0075429_100030827 Ga0075429_1000308274 116
59 3300006881 Ga0068865_101355195 Ga0068865_1013551952 116
60 3300006931 Ga0097620_100215390 Ga0097620_1002153902 116
61 3300009094 Ga0111539_10283840 Ga0111539_102838402 116
62 3300009101 Ga0105247_10010942 Ga0105247_100109424 116
63 3300009147 Ga0114129_10806966 Ga0114129_108069661 116
64 3300009148 Ga0105243_10125137 Ga0105243_101251372 116
65 3300009176 Ga0105242_11537817 Ga0105242_115378172 116
66 3300013100 Ga0157373_10392804 Ga0157373_103928042 116
67 3300013297 Ga0157378_10074037 Ga0157378_100740372 116
68 3300013307 Ga0157372_10245002 Ga0157372_102450022 116
69 3300014326 Ga0157380_10173324 Ga0157380_101733242 116
70 3300014968 Ga0157379_10053364 Ga0157379_100533642 116
71 3300017792 Ga0163161_10326819 Ga0163161_103268191 116
72 3300025900 Ga0207710_10032132 Ga0207710_100321321 116
73 3300025901 Ga0207688_10639499 Ga0207688_106394992 116
74 3300025932 Ga0207690_10538650 Ga0207690_105386502 116
75 3300025935 Ga0207709_11456611 Ga0207709_114566111 116
76 3300025936 Ga0207670_10216643 Ga0207670_102166432 116
77 3300025942 Ga0207689_11578299 Ga0207689_115782991 116
78 3300025949 Ga0207667_11137892 Ga0207667_111378922 116
79 3300026041 Ga0207639_10188721 Ga0207639_101887213 116
80 3300026075 Ga0207708_10048764 Ga0207708_100487642 116
81 3300026075 Ga0207708_11117869 Ga0207708_111178691 116
82 3300026088 Ga0207641_11174425 Ga0207641_111744252 116
83 3300026089 Ga0207648_10444814 Ga0207648_104448142 116
84 3300028380 Ga0268265_10091479 Ga0268265_100914792 116
85 3300028381 Ga0268264_10062297 Ga0268264_100622973 116
86 3300035242 Ga0373962_0128201 Ga0373962_0128201_155_511 116
87 3300035691 Ga0373931_0180663 Ga0373931_0180663_19_375 116
88 3300035725 Ga0373947_0082407 Ga0373947_0082407_168_518 116
89 3300036401 Ga0373937_1050653 Ga0373937_1050653_342_698 116
90 3300037471 Ga0395905_0151634 Ga0395905_0151634_158_520 116
91 3300042007 Ga0439449_0260107 Ga0439449_0260107_178_528 116
92 3300046454 Ga0495592_0270100 Ga0495592_0270100_469_825 116
93 3300046472 Ga0495580_0167963 Ga0495580_0167963_1014_1370 116
94 3300046473 Ga0495582_0042920 Ga0495582_0042920_756_1112 116
95 3300046475 Ga0495639_0020584 Ga0495639_0020584_2348_2704 116
96 3300046476 Ga0495662_0180209 Ga0495662_0180209_92_448 116
97 3300046477 Ga0495664_0024325 Ga0495664_0024325_931_1287 116
98 3300046511 Ga0495608_0401764 Ga0495608_0401764_19_375 116
99 3300046514 Ga0495618_0230367 Ga0495618_0230367_398_754 116
100 3300046517 Ga0495630_0035993 Ga0495630_0035993_3075_3431 116
101 3300046526 Ga0495666_0020379 Ga0495666_0020379_2442_2798 116
102 3300046529 Ga0495652_0432079 Ga0495652_0432079_491_847 116
103 3300046530 Ga0495654_0215028 Ga0495654_0215028_38_394 116
104 3300046531 Ga0495665_0126767 Ga0495665_0126767_54_410 116
105 3300046533 Ga0495640_0052592 Ga0495640_0052592_2168_2524 116
106 3300046535 Ga0495586_0040693 Ga0495586_0040693_1961_2317 116
107 3300046557 Ga0495622_0332190 Ga0495622_0332190_13_369 116
108 3300046559 Ga0495667_0219633 Ga0495667_0219633_300_656 116
109 3300046642 Ga0495634_0008655 Ga0495634_0008655_6854_7210 116
110 3300046663 Ga0495635_0616309 Ga0495635_0616309_40_396 116
111 3300046681 Ga0495647_0004407 Ga0495647_0004407_464_820 116
112 3300046684 Ga0495669_0254979 Ga0495669_0254979_455_811 116
113 3300046684 Ga0495669_0433057 Ga0495669_0433057_212_571 116
114 3300046689 Ga0495613_0402479 Ga0495613_0402479_89_445 116
115 3300047319 Ga0495674_0309700 Ga0495674_0309700_408_764 116
116 3300047322 Ga0495680_0188335 Ga0495680_0188335_318_674 116
117 3300047471 Ga0495684_0033903 Ga0495684_0033903_1338_1694 116
118 3300048905 Ga0496102_0010277 Ga0496102_0010277_5925_6281 116
119 3300048906 Ga0496103_0064719 Ga0496103_0064719_186_542 116
120 3300048909 Ga0496106_0035589 Ga0496106_0035589_3270_3626 116
121 3300048910 Ga0496107_0203364 Ga0496107_0203364_776_1132 116
122 3300048916 Ga0496113_0497419 Ga0496113_0497419_352_708 116
123 3300049575 Ga0501039_0030524 Ga0501039_0030524_3125_3481 116
124 3300049576 Ga0501040_0010704 Ga0501040_0010704_2006_2362 116
125 3300049577 Ga0501041_0225490 Ga0501041_0225490_363_719 116
126 3300049578 Ga0501042_0025696 Ga0501042_0025696_3441_3797 116
127 3300049578 Ga0501042_0449052 Ga0501042_0449052_415_774 116
128 3300049582 Ga0501048_0444874 Ga0501048_0444874_553_912 116
129 3300049587 Ga0501071_0137500 Ga0501071_0137500_1176_1532 116
130 3300049587 Ga0501071_1238479 Ga0501071_1238479_101_451 116
131 3300049589 Ga0501073_0017452 Ga0501073_0017452_933_1292 116
132 3300049590 Ga0501074_1034318 Ga0501074_1034318_92_448 116
133 3300049591 Ga0501075_0901114 Ga0501075_0901114_188_544 116
134 3300049593 Ga0501077_0555969 Ga0501077_0555969_119_475 116
135 3300049822 Ga0501035_0519952 Ga0501035_0519952_37_393 116
136 3300050507 nmdc:mga05p37_825488_c1 nmdc:mga05p37_825488_c1_540_896 116
137 3300050508 nmdc:mga09592_63812_c1 nmdc:mga09592_63812_c1_1386_1742 116
138 3300050509 nmdc:mga0qj67_15978_c1 nmdc:mga0qj67_15978_c1_206_562 116
139 3300050509 nmdc:mga0qj67_654148_c1 nmdc:mga0qj67_654148_c1_409_765 116
140 3300050510 nmdc:mga06r32_1160145_c1 nmdc:mga06r32_1160145_c1_160_516 116
141 3300050511 nmdc:mga08y16_610785_c1 nmdc:mga08y16_610785_c1_71_427 116
142 3300053083 Ga0495655_0052590 Ga0495655_0052590_255_611 116
143 3300053083 Ga0495655_0357290 Ga0495655_0357290_91_450 116
144 3300003323 rootH1_10005342 rootH1_1000534236 117
145 3300003775 Ga0055524_1020622 Ga0055524_10206224 117
146 3300003790 Ga0055528_1087790 Ga0055528_10877902 117
147 3300003794 Ga0055531_10000103 Ga0055531_1000010369 117
148 3300004799 Ga0058863_10086596 Ga0058863_100865962 117
149 3300004800 Ga0058861_11284509 Ga0058861_112845092 117
150 3300005293 Ga0065715_10482623 Ga0065715_104826231 117
151 3300005327 Ga0070658_10043435 Ga0070658_100434353 117
152 3300005327 Ga0070658_10174780 Ga0070658_101747801 117
153 3300005327 Ga0070658_10205083 Ga0070658_102050832 117
154 3300005327 Ga0070658_10292900 Ga0070658_102929001 117
155 3300005328 Ga0070676_10009376 Ga0070676_100093764 117
156 3300005328 Ga0070676_10456367 Ga0070676_104563672 117
157 3300005328 Ga0070676_10825564 Ga0070676_108255642 117
158 3300005329 Ga0070683_100012982 Ga0070683_1000129824 117
159 3300005329 Ga0070683_100021348 Ga0070683_1000213484 117
160 3300005329 Ga0070683_100880544 Ga0070683_1008805442 117
161 3300005330 Ga0070690_100087471 Ga0070690_1000874712 117
162 3300005330 Ga0070690_100862382 Ga0070690_1008623822 117
163 3300005330 Ga0070690_101615912 Ga0070690_1016159121 117
164 3300005331 Ga0070670_100059712 Ga0070670_1000597124 117
165 3300005331 Ga0070670_100121184 Ga0070670_1001211841 117
166 3300005331 Ga0070670_100213671 Ga0070670_1002136713 117
167 3300005331 Ga0070670_102130967 Ga0070670_1021309671 117
168 3300005333 Ga0070677_10005628 Ga0070677_100056285 117
169 3300005333 Ga0070677_10410678 Ga0070677_104106781 117
170 3300005333 Ga0070677_10459765 Ga0070677_104597652 117
171 3300005334 Ga0068869_100003195 Ga0068869_10000319510 117
172 3300005334 Ga0068869_100198382 Ga0068869_1001983821 117
173 3300005334 Ga0068869_100521538 Ga0068869_1005215382 117
174 3300005334 Ga0068869_100719547 Ga0068869_1007195472 117
175 3300005335 Ga0070666_10918393 Ga0070666_109183932 117
176 3300005336 Ga0070680_100021694 Ga0070680_1000216945 117
177 3300005337 Ga0070682_100980473 Ga0070682_1009804732 117
178 3300005338 Ga0068868_100153655 Ga0068868_1001536552 117
179 3300005338 Ga0068868_100476738 Ga0068868_1004767382 117
180 3300005338 Ga0068868_100611568 Ga0068868_1006115682 117
181 3300005339 Ga0070660_100093354 Ga0070660_1000933542 117
182 3300005339 Ga0070660_100139499 Ga0070660_1001394991 117
183 3300005339 Ga0070660_100700288 Ga0070660_1007002881 117
184 3300005341 Ga0070691_10065775 Ga0070691_100657752 117
185 3300005343 Ga0070687_100045346 Ga0070687_1000453461 117
186 3300005343 Ga0070687_100246180 Ga0070687_1002461801 117
187 3300005344 Ga0070661_100117306 Ga0070661_1001173062 117
188 3300005344 Ga0070661_100815040 Ga0070661_1008150402 117
189 3300005345 Ga0070692_10013522 Ga0070692_100135221 117
190 3300005345 Ga0070692_10706976 Ga0070692_107069761 117
191 3300005347 Ga0070668_100000574 Ga0070668_10000057411 117
192 3300005353 Ga0070669_100000765 Ga0070669_1000007658 117
193 3300005353 Ga0070669_101643669 Ga0070669_1016436691 117
194 3300005353 Ga0070669_102031551 Ga0070669_1020315511 117
195 3300005354 Ga0070675_100049796 Ga0070675_1000497964 117
196 3300005354 Ga0070675_100098419 Ga0070675_1000984192 117
197 3300005354 Ga0070675_100246697 Ga0070675_1002466973 117
198 3300005354 Ga0070675_100517510 Ga0070675_1005175102 117
199 3300005355 Ga0070671_100015231 Ga0070671_1000152314 117
200 3300005355 Ga0070671_100223762 Ga0070671_1002237623 117
201 3300005355 Ga0070671_100241404 Ga0070671_1002414041 117
202 3300005355 Ga0070671_100471885 Ga0070671_1004718852 117
203 3300005355 Ga0070671_100874425 Ga0070671_1008744252 117
204 3300005355 Ga0070671_101319157 Ga0070671_1013191571 117
205 3300005356 Ga0070674_100011152 Ga0070674_1000111522 117
206 3300005356 Ga0070674_100169814 Ga0070674_1001698142 117
207 3300005364 Ga0070673_100157484 Ga0070673_1001574842 117
208 3300005364 Ga0070673_100180152 Ga0070673_1001801523 117
209 3300005364 Ga0070673_100189764 Ga0070673_1001897643 117
210 3300005364 Ga0070673_101271494 Ga0070673_1012714941 117
211 3300005364 Ga0070673_101742801 Ga0070673_1017428011 117
212 3300005365 Ga0070688_100603694 Ga0070688_1006036942 117
213 3300005366 Ga0070659_100112476 Ga0070659_1001124762 117
214 3300005366 Ga0070659_100175753 Ga0070659_1001757531 117
215 3300005366 Ga0070659_100238682 Ga0070659_1002386821 117
216 3300005366 Ga0070659_100835341 Ga0070659_1008353412 117
217 3300005367 Ga0070667_100007739 Ga0070667_1000077395 117
218 3300005367 Ga0070667_101136265 Ga0070667_1011362652 117
219 3300005406 Ga0070703_10004258 Ga0070703_100042583 117
220 3300005434 Ga0070709_11028668 Ga0070709_110286681 117
221 3300005435 Ga0070714_100135565 Ga0070714_1001355651 117
222 3300005438 Ga0070701_10084460 Ga0070701_100844602 117
223 3300005439 Ga0070711_100023103 Ga0070711_1000231032 117
224 3300005440 Ga0070705_100000751 Ga0070705_10000075119 117
225 3300005441 Ga0070700_100006109 Ga0070700_1000061094 117
226 3300005441 Ga0070700_100351093 Ga0070700_1003510932 117
227 3300005444 Ga0070694_100155756 Ga0070694_1001557562 117
228 3300005455 Ga0070663_100020235 Ga0070663_1000202352 117
229 3300005455 Ga0070663_100074650 Ga0070663_1000746501 117
230 3300005455 Ga0070663_100486712 Ga0070663_1004867122 117
231 3300005456 Ga0070678_100040070 Ga0070678_1000400704 117
232 3300005456 Ga0070678_100093070 Ga0070678_1000930704 117
233 3300005456 Ga0070678_100656049 Ga0070678_1006560491 117
234 3300005456 Ga0070678_101306888 Ga0070678_1013068881 117
235 3300005457 Ga0070662_100000783 Ga0070662_10000078310 117
236 3300005457 Ga0070662_100260601 Ga0070662_1002606012 117
237 3300005457 Ga0070662_100620843 Ga0070662_1006208432 117
238 3300005458 Ga0070681_10050025 Ga0070681_100500252 117
239 3300005458 Ga0070681_10823811 Ga0070681_108238111 117
240 3300005458 Ga0070681_10890925 Ga0070681_108909251 117
241 3300005459 Ga0068867_100000099 Ga0068867_10000009956 117
242 3300005459 Ga0068867_100005514 Ga0068867_1000055148 117
243 3300005459 Ga0068867_100088547 Ga0068867_1000885474 117
244 3300005459 Ga0068867_100110165 Ga0068867_1001101652 117
245 3300005467 Ga0070706_100224618 Ga0070706_1002246183 117
246 3300005471 Ga0070698_100005048 Ga0070698_10000504817 117
247 3300005471 Ga0070698_100569515 Ga0070698_1005695152 117
248 3300005518 Ga0070699_100005109 Ga0070699_1000051098 117
249 3300005518 Ga0070699_100005628 Ga0070699_1000056282 117
250 3300005530 Ga0070679_100063334 Ga0070679_1000633342 117
251 3300005530 Ga0070679_100333157 Ga0070679_1003331571 117
252 3300005535 Ga0070684_100015457 Ga0070684_1000154574 117
253 3300005535 Ga0070684_100327046 Ga0070684_1003270461 117
254 3300005535 Ga0070684_100375431 Ga0070684_1003754312 117
255 3300005536 Ga0070697_100307327 Ga0070697_1003073272 117
256 3300005536 Ga0070697_100781270 Ga0070697_1007812701 117
257 3300005539 Ga0068853_100433941 Ga0068853_1004339412 117
258 3300005539 Ga0068853_100518529 Ga0068853_1005185292 117
259 3300005539 Ga0068853_100874663 Ga0068853_1008746631 117
260 3300005543 Ga0070672_100005134 Ga0070672_1000051348 117
261 3300005543 Ga0070672_100102545 Ga0070672_1001025452 117
262 3300005543 Ga0070672_100134897 Ga0070672_1001348973 117
263 3300005543 Ga0070672_100476313 Ga0070672_1004763132 117
264 3300005543 Ga0070672_100496343 Ga0070672_1004963432 117
265 3300005543 Ga0070672_101853509 Ga0070672_1018535091 117
266 3300005545 Ga0070695_100000339 Ga0070695_1000003392 117
267 3300005545 Ga0070695_100475174 Ga0070695_1004751743 117
268 3300005545 Ga0070695_100752052 Ga0070695_1007520522 117
269 3300005546 Ga0070696_100001139 Ga0070696_10000113918 117
270 3300005547 Ga0070693_100062205 Ga0070693_1000622052 117
271 3300005547 Ga0070693_100596713 Ga0070693_1005967132 117
272 3300005547 Ga0070693_101185492 Ga0070693_1011854921 117
273 3300005549 Ga0070704_100188853 Ga0070704_1001888532 117
274 3300005549 Ga0070704_101076522 Ga0070704_1010765222 117
275 3300005563 Ga0068855_100189763 Ga0068855_1001897632 117
276 3300005563 Ga0068855_100603652 Ga0068855_1006036522 117
277 3300005564 Ga0070664_100015887 Ga0070664_1000158873 117
278 3300005564 Ga0070664_100040986 Ga0070664_1000409863 117
279 3300005564 Ga0070664_100084788 Ga0070664_1000847884 117
280 3300005564 Ga0070664_100315920 Ga0070664_1003159202 117
281 3300005564 Ga0070664_101190332 Ga0070664_1011903322 117
282 3300005577 Ga0068857_100174384 Ga0068857_1001743842 117
283 3300005577 Ga0068857_100194631 Ga0068857_1001946313 117
284 3300005577 Ga0068857_100247020 Ga0068857_1002470202 117
285 3300005577 Ga0068857_101361331 Ga0068857_1013613312 117
286 3300005577 Ga0068857_102162670 Ga0068857_1021626701 117
287 3300005578 Ga0068854_100010666 Ga0068854_1000106666 117
288 3300005578 Ga0068854_100052948 Ga0068854_1000529483 117
289 3300005578 Ga0068854_100408141 Ga0068854_1004081412 117
290 3300005578 Ga0068854_100612802 Ga0068854_1006128022 117
291 3300005578 Ga0068854_102067238 Ga0068854_1020672381 117
292 3300005614 Ga0068856_100111519 Ga0068856_1001115193 117
293 3300005614 Ga0068856_100200622 Ga0068856_1002006221 117
294 3300005614 Ga0068856_101107860 Ga0068856_1011078602 117
295 3300005614 Ga0068856_101380321 Ga0068856_1013803212 117
296 3300005615 Ga0070702_100448188 Ga0070702_1004481881 117
297 3300005616 Ga0068852_100008232 Ga0068852_1000082325 117
298 3300005616 Ga0068852_100055860 Ga0068852_1000558602 117
299 3300005616 Ga0068852_100128386 Ga0068852_1001283863 117
300 3300005616 Ga0068852_100177778 Ga0068852_1001777783 117
301 3300005616 Ga0068852_100289206 Ga0068852_1002892063 117
302 3300005616 Ga0068852_100754458 Ga0068852_1007544582 117
303 3300005617 Ga0068859_100004644 Ga0068859_10000464416 117
304 3300005617 Ga0068859_100104541 Ga0068859_1001045414 117
305 3300005617 Ga0068859_102724987 Ga0068859_1027249872 117
306 3300005618 Ga0068864_100019366 Ga0068864_1000193665 117
307 3300005618 Ga0068864_100154035 Ga0068864_1001540353 117
308 3300005618 Ga0068864_100172017 Ga0068864_1001720173 117
309 3300005618 Ga0068864_100272205 Ga0068864_1002722052 117
310 3300005618 Ga0068864_101506775 Ga0068864_1015067752 117
311 3300005718 Ga0068866_10002119 Ga0068866_100021198 117
312 3300005718 Ga0068866_10411884 Ga0068866_104118842 117
313 3300005719 Ga0068861_100004658 Ga0068861_1000046589 117
314 3300005719 Ga0068861_100226822 Ga0068861_1002268223 117
315 3300005719 Ga0068861_100314513 Ga0068861_1003145132 117
316 3300005834 Ga0068851_10000574 Ga0068851_1000057411 117
317 3300005834 Ga0068851_10015869 Ga0068851_100158692 117
318 3300005834 Ga0068851_10204423 Ga0068851_102044232 117
319 3300005834 Ga0068851_10734627 Ga0068851_107346272 117
320 3300005840 Ga0068870_10287766 Ga0068870_102877662 117
321 3300005840 Ga0068870_11290453 Ga0068870_112904532 117
322 3300005841 Ga0068863_100001215 Ga0068863_1000012155 117
323 3300005841 Ga0068863_100027689 Ga0068863_1000276895 117
324 3300005841 Ga0068863_100326179 Ga0068863_1003261792 117
325 3300005841 Ga0068863_100486991 Ga0068863_1004869912 117
326 3300005841 Ga0068863_101513562 Ga0068863_1015135621 117
327 3300005842 Ga0068858_100011059 Ga0068858_1000110593 117
328 3300005842 Ga0068858_101874273 Ga0068858_1018742731 117
329 3300005843 Ga0068860_100009850 Ga0068860_1000098504 117
330 3300005843 Ga0068860_100010922 Ga0068860_10001092210 117
331 3300005844 Ga0068862_100005698 Ga0068862_1000056983 117
332 3300005844 Ga0068862_100020474 Ga0068862_1000204743 117
333 3300005937 Ga0081455_10000197 Ga0081455_100001973 117
334 3300005937 Ga0081455_10007547 Ga0081455_1000754712 117
335 3300005937 Ga0081455_10078898 Ga0081455_100788985 117
336 3300005981 Ga0081538_10001078 Ga0081538_1000107830 117
337 3300005981 Ga0081538_10033454 Ga0081538_100334547 117
338 3300006028 Ga0070717_10182325 Ga0070717_101823253 117
339 3300006028 Ga0070717_10549333 Ga0070717_105493332 117
340 3300006038 Ga0075365_10002797 Ga0075365_100027976 117
341 3300006038 Ga0075365_10964002 Ga0075365_109640022 117
342 3300006051 Ga0075364_10063243 Ga0075364_100632432 117
343 3300006051 Ga0075364_10353985 Ga0075364_103539851 117
344 3300006163 Ga0070715_10162126 Ga0070715_101621262 117
345 3300006173 Ga0070716_100130447 Ga0070716_1001304472 117
346 3300006173 Ga0070716_100306351 Ga0070716_1003063512 117
347 3300006175 Ga0070712_100646210 Ga0070712_1006462102 117
348 3300006175 Ga0070712_100833112 Ga0070712_1008331121 117
349 3300006177 Ga0075362_10120662 Ga0075362_101206622 117
350 3300006177 Ga0075362_10509580 Ga0075362_105095801 117
351 3300006237 Ga0097621_100026893 Ga0097621_1000268932 117
352 3300006237 Ga0097621_100566179 Ga0097621_1005661792 117
353 3300006237 Ga0097621_102080938 Ga0097621_1020809382 117
354 3300006358 Ga0068871_100405026 Ga0068871_1004050262 117
355 3300006358 Ga0068871_100932954 Ga0068871_1009329542 117
356 3300006844 Ga0075428_102004390 Ga0075428_1020043901 117
357 3300006847 Ga0075431_100061319 Ga0075431_1000613194 117
358 3300006847 Ga0075431_100446269 Ga0075431_1004462692 117
359 3300006847 Ga0075431_100981751 Ga0075431_1009817511 117
360 3300006852 Ga0075433_10356745 Ga0075433_103567452 117
361 3300006852 Ga0075433_10569419 Ga0075433_105694192 117
362 3300006871 Ga0075434_100254525 Ga0075434_1002545252 117
363 3300006871 Ga0075434_100753133 Ga0075434_1007531332 117
364 3300006881 Ga0068865_100003044 Ga0068865_1000030448 117
365 3300006881 Ga0068865_100048823 Ga0068865_1000488235 117
366 3300006881 Ga0068865_100609308 Ga0068865_1006093083 117
367 3300006914 Ga0075436_100004893 Ga0075436_1000048939 117
368 3300006914 Ga0075436_100412316 Ga0075436_1004123162 117
369 3300006931 Ga0097620_100004644 Ga0097620_1000046441 117
370 3300006931 Ga0097620_100104540 Ga0097620_1001045404 117
371 3300006931 Ga0097620_102724732 Ga0097620_1027247322 117
372 3300006942 Ga0099824_1036269 Ga0099824_10362693 117
373 3300006944 Ga0099823_1000255 Ga0099823_10002554 117
374 3300007076 Ga0075435_100112426 Ga0075435_1001124262 117
375 3300007076 Ga0075435_101308535 Ga0075435_1013085352 117
376 3300007265 Ga0099794_10305066 Ga0099794_103050662 117
377 3300009094 Ga0111539_10056078 Ga0111539_100560785 117
378 3300009094 Ga0111539_10589999 Ga0111539_105899993 117
379 3300009094 Ga0111539_10709606 Ga0111539_107096061 117
380 3300009098 Ga0105245_10577542 Ga0105245_105775422 117
381 3300009098 Ga0105245_10721349 Ga0105245_107213492 117
382 3300009101 Ga0105247_10507750 Ga0105247_105077502 117
383 3300009148 Ga0105243_10001373 Ga0105243_100013736 117
384 3300009148 Ga0105243_10015973 Ga0105243_100159735 117
385 3300009148 Ga0105243_10148299 Ga0105243_101482992 117
386 3300009148 Ga0105243_10557522 Ga0105243_105575221 117
387 3300009148 Ga0105243_10874423 Ga0105243_108744232 117
388 3300009174 Ga0105241_10024674 Ga0105241_100246743 117
389 3300009174 Ga0105241_10067029 Ga0105241_100670292 117
390 3300009176 Ga0105242_10034546 Ga0105242_100345462 117
391 3300009176 Ga0105242_11120377 Ga0105242_111203772 117
392 3300009177 Ga0105248_10354820 Ga0105248_103548202 117
393 3300009177 Ga0105248_10391094 Ga0105248_103910942 117
394 3300009177 Ga0105248_11401112 Ga0105248_114011122 117
395 3300009177 Ga0105248_11583334 Ga0105248_115833342 117
396 3300009545 Ga0105237_10199124 Ga0105237_101991242 117
397 3300009545 Ga0105237_10734600 Ga0105237_107346002 117
398 3300009545 Ga0105237_11124416 Ga0105237_111244161 117
399 3300009551 Ga0105238_10446131 Ga0105238_104461312 117
400 3300009551 Ga0105238_12309967 Ga0105238_123099672 117
401 3300009551 Ga0105238_12733437 Ga0105238_127334371 117
402 3300009553 Ga0105249_10013028 Ga0105249_100130284 117
403 3300009553 Ga0105249_11482395 Ga0105249_114823952 117
404 3300010159 Ga0099796_10246118 Ga0099796_102461181 117
405 3300010375 Ga0105239_10255886 Ga0105239_102558863 117
406 3300010375 Ga0105239_10360708 Ga0105239_103607082 117
407 3300010375 Ga0105239_11549594 Ga0105239_115495941 117
408 3300010375 Ga0105239_11813876 Ga0105239_118138762 117
409 3300011119 Ga0105246_10503750 Ga0105246_105037502 117
410 3300012508 Ga0157315_1006752 Ga0157315_10067521 117
411 3300013100 Ga0157373_10003095 Ga0157373_1000309514 117
412 3300013100 Ga0157373_10291545 Ga0157373_102915451 117
413 3300013102 Ga0157371_10013703 Ga0157371_100137033 117
414 3300013102 Ga0157371_10242714 Ga0157371_102427143 117
415 3300013104 Ga0157370_10074452 Ga0157370_100744524 117
416 3300013104 Ga0157370_10404954 Ga0157370_104049542 117
417 3300013104 Ga0157370_11297938 Ga0157370_112979381 117
418 3300013105 Ga0157369_10308021 Ga0157369_103080212 117
419 3300013105 Ga0157369_10503849 Ga0157369_105038492 117
420 3300013105 Ga0157369_10533057 Ga0157369_105330572 117
421 3300013105 Ga0157369_10597169 Ga0157369_105971693 117
422 3300013296 Ga0157374_10201476 Ga0157374_102014763 117
423 3300013296 Ga0157374_10337555 Ga0157374_103375551 117
424 3300013296 Ga0157374_11196392 Ga0157374_111963922 117
425 3300013296 Ga0157374_11230360 Ga0157374_112303602 117
426 3300013296 Ga0157374_11499668 Ga0157374_114996682 117
427 3300013297 Ga0157378_10141889 Ga0157378_101418892 117
428 3300013297 Ga0157378_10244120 Ga0157378_102441204 117
429 3300013306 Ga0163162_10000769 Ga0163162_1000076912 117
430 3300013306 Ga0163162_10073872 Ga0163162_100738722 117
431 3300013306 Ga0163162_10210346 Ga0163162_102103462 117
432 3300013306 Ga0163162_12748055 Ga0163162_127480551 117
433 3300013307 Ga0157372_10211993 Ga0157372_102119933 117
434 3300013307 Ga0157372_10507987 Ga0157372_105079872 117
435 3300013307 Ga0157372_10678482 Ga0157372_106784822 117
436 3300013307 Ga0157372_10695661 Ga0157372_106956612 117
437 3300013308 Ga0157375_10002304 Ga0157375_100023047 117
438 3300013308 Ga0157375_10004451 Ga0157375_1000445111 117
439 3300013308 Ga0157375_10098672 Ga0157375_100986723 117
440 3300013308 Ga0157375_10739799 Ga0157375_107397992 117
441 3300014325 Ga0163163_10364546 Ga0163163_103645462 117
442 3300014325 Ga0163163_10741489 Ga0163163_107414892 117
443 3300014325 Ga0163163_11493747 Ga0163163_114937472 117
444 3300014326 Ga0157380_10035506 Ga0157380_100355065 117
445 3300014326 Ga0157380_10064490 Ga0157380_100644904 117
446 3300014326 Ga0157380_10341416 Ga0157380_103414163 117
447 3300014326 Ga0157380_10605430 Ga0157380_106054301 117
448 3300014497 Ga0182008_10577309 Ga0182008_105773091 117
449 3300014745 Ga0157377_10000010 Ga0157377_10000010297 117
450 3300014745 Ga0157377_10234589 Ga0157377_102345892 117
451 3300014745 Ga0157377_10334670 Ga0157377_103346702 117
452 3300014968 Ga0157379_10121514 Ga0157379_101215143 117
453 3300014968 Ga0157379_10175551 Ga0157379_101755511 117
454 3300014968 Ga0157379_10534792 Ga0157379_105347922 117
455 3300014968 Ga0157379_11438568 Ga0157379_114385681 117
456 3300014969 Ga0157376_10324273 Ga0157376_103242732 117
457 3300014969 Ga0157376_10594588 Ga0157376_105945882 117
458 3300014969 Ga0157376_10649534 Ga0157376_106495342 117
459 3300015262 Ga0182007_10181006 Ga0182007_101810061 117
460 3300017792 Ga0163161_10002372 Ga0163161_1000237212 117
461 3300017792 Ga0163161_10183334 Ga0163161_101833342 117
462 3300017792 Ga0163161_10450000 Ga0163161_104500002 117
463 3300020070 Ga0206356_11645321 Ga0206356_116453212 117
464 3300020078 Ga0206352_10674374 Ga0206352_106743741 117
465 3300020081 Ga0206354_11514788 Ga0206354_115147883 117
466 3300020082 Ga0206353_11438233 Ga0206353_114382332 117
467 3300021377 Ga0213874_10180310 Ga0213874_101803102 117
468 3300025273 Ga0209673_1002911 Ga0209673_10029113 117
469 3300025273 Ga0209673_1003599 Ga0209673_10035994 117
470 3300025298 Ga0209050_1004646 Ga0209050_10046466 117
471 3300025298 Ga0209050_1008129 Ga0209050_10081293 117
472 3300025299 Ga0209256_1001476 Ga0209256_100147616 117
473 3300025303 Ga0209051_1000648 Ga0209051_100064815 117
474 3300025303 Ga0209051_1011406 Ga0209051_10114064 117
475 3300025304 Ga0209257_1000131 Ga0209257_1000131198 117
476 3300025304 Ga0209257_1000673 Ga0209257_10006739 117
477 3300025321 Ga0207656_10025064 Ga0207656_100250643 117
478 3300025321 Ga0207656_10058092 Ga0207656_100580922 117
479 3300025321 Ga0207656_10118911 Ga0207656_101189112 117
480 3300025321 Ga0207656_10147472 Ga0207656_101474721 117
481 3300025885 Ga0207653_10025876 Ga0207653_100258762 117
482 3300025893 Ga0207682_10003485 Ga0207682_100034855 117
483 3300025893 Ga0207682_10022332 Ga0207682_100223322 117
484 3300025898 Ga0207692_10828702 Ga0207692_108287022 117
485 3300025899 Ga0207642_10027248 Ga0207642_100272482 117
486 3300025901 Ga0207688_10120256 Ga0207688_101202562 117
487 3300025901 Ga0207688_10143148 Ga0207688_101431482 117
488 3300025903 Ga0207680_10018348 Ga0207680_100183485 117
489 3300025903 Ga0207680_10676439 Ga0207680_106764392 117
490 3300025903 Ga0207680_11282524 Ga0207680_112825242 117
491 3300025904 Ga0207647_10546480 Ga0207647_105464801 117
492 3300025905 Ga0207685_10093140 Ga0207685_100931402 117
493 3300025907 Ga0207645_10004020 Ga0207645_100040205 117
494 3300025907 Ga0207645_10115349 Ga0207645_101153493 117
495 3300025907 Ga0207645_10488211 Ga0207645_104882112 117
496 3300025909 Ga0207705_11393461 Ga0207705_113934611 117
497 3300025910 Ga0207684_10113995 Ga0207684_101139953 117
498 3300025911 Ga0207654_10013176 Ga0207654_100131763 117
499 3300025911 Ga0207654_10119807 Ga0207654_101198072 117
500 3300025912 Ga0207707_10009059 Ga0207707_100090599 117
501 3300025912 Ga0207707_10392547 Ga0207707_103925471 117
502 3300025913 Ga0207695_10168662 Ga0207695_101686622 117
503 3300025914 Ga0207671_10213514 Ga0207671_102135142 117
504 3300025914 Ga0207671_10481835 Ga0207671_104818352 117
505 3300025915 Ga0207693_10166318 Ga0207693_101663182 117
506 3300025917 Ga0207660_10016006 Ga0207660_100160065 117
507 3300025917 Ga0207660_10040090 Ga0207660_100400901 117
508 3300025917 Ga0207660_11101651 Ga0207660_111016511 117
509 3300025918 Ga0207662_10049144 Ga0207662_100491442 117
510 3300025918 Ga0207662_10094453 Ga0207662_100944531 117
511 3300025919 Ga0207657_10006685 Ga0207657_100066856 117
512 3300025919 Ga0207657_10063313 Ga0207657_100633133 117
513 3300025919 Ga0207657_10467062 Ga0207657_104670621 117
514 3300025920 Ga0207649_10199266 Ga0207649_101992663 117
515 3300025921 Ga0207652_10018045 Ga0207652_100180453 117
516 3300025921 Ga0207652_10023480 Ga0207652_100234806 117
517 3300025921 Ga0207652_10700824 Ga0207652_107008242 117
518 3300025923 Ga0207681_10000340 Ga0207681_1000034010 117
519 3300025923 Ga0207681_10575148 Ga0207681_105751481 117
520 3300025924 Ga0207694_10007424 Ga0207694_100074248 117
521 3300025924 Ga0207694_10812044 Ga0207694_108120441 117
522 3300025925 Ga0207650_10056224 Ga0207650_100562242 117
523 3300025925 Ga0207650_10084655 Ga0207650_100846552 117
524 3300025925 Ga0207650_10469575 Ga0207650_104695751 117
525 3300025925 Ga0207650_10574102 Ga0207650_105741022 117
526 3300025925 Ga0207650_10629929 Ga0207650_106299291 117
527 3300025925 Ga0207650_10739305 Ga0207650_107393052 117
528 3300025926 Ga0207659_10016814 Ga0207659_100168145 117
529 3300025926 Ga0207659_10089935 Ga0207659_100899354 117
530 3300025926 Ga0207659_10382353 Ga0207659_103823532 117
531 3300025927 Ga0207687_10224592 Ga0207687_102245922 117
532 3300025927 Ga0207687_10546758 Ga0207687_105467582 117
533 3300025928 Ga0207700_10562754 Ga0207700_105627542 117
534 3300025929 Ga0207664_10236895 Ga0207664_102368952 117
535 3300025931 Ga0207644_10000042 Ga0207644_10000042111 117
536 3300025931 Ga0207644_10191727 Ga0207644_101917271 117
537 3300025931 Ga0207644_10516397 Ga0207644_105163971 117
538 3300025931 Ga0207644_10736699 Ga0207644_107366992 117
539 3300025932 Ga0207690_10012011 Ga0207690_100120114 117
540 3300025932 Ga0207690_10266614 Ga0207690_102666143 117
541 3300025932 Ga0207690_10732169 Ga0207690_107321692 117
542 3300025932 Ga0207690_11567520 Ga0207690_115675201 117
543 3300025933 Ga0207706_10136318 Ga0207706_101363182 117
544 3300025933 Ga0207706_10160965 Ga0207706_101609653 117
545 3300025933 Ga0207706_10334028 Ga0207706_103340282 117
546 3300025933 Ga0207706_10535451 Ga0207706_105354511 117
547 3300025933 Ga0207706_10771762 Ga0207706_107717622 117
548 3300025933 Ga0207706_10829901 Ga0207706_108299012 117
549 3300025934 Ga0207686_10038506 Ga0207686_100385062 117
550 3300025934 Ga0207686_10281121 Ga0207686_102811212 117
551 3300025935 Ga0207709_10001570 Ga0207709_1000157011 117
552 3300025935 Ga0207709_10015155 Ga0207709_100151553 117
553 3300025935 Ga0207709_10028955 Ga0207709_100289553 117
554 3300025937 Ga0207669_10005760 Ga0207669_100057607 117
555 3300025937 Ga0207669_10124620 Ga0207669_101246202 117
556 3300025937 Ga0207669_10397338 Ga0207669_103973382 117
557 3300025937 Ga0207669_11063836 Ga0207669_110638362 117
558 3300025938 Ga0207704_10003619 Ga0207704_100036192 117
559 3300025938 Ga0207704_10378949 Ga0207704_103789492 117
560 3300025939 Ga0207665_10099175 Ga0207665_100991753 117
561 3300025940 Ga0207691_10038546 Ga0207691_100385463 117
562 3300025940 Ga0207691_10040632 Ga0207691_100406322 117
563 3300025940 Ga0207691_10044292 Ga0207691_100442924 117
564 3300025940 Ga0207691_10078502 Ga0207691_100785024 117
565 3300025940 Ga0207691_10085217 Ga0207691_100852172 117
566 3300025940 Ga0207691_10347472 Ga0207691_103474722 117
567 3300025940 Ga0207691_10363157 Ga0207691_103631572 117
568 3300025941 Ga0207711_10001998 Ga0207711_100019984 117
569 3300025941 Ga0207711_10013198 Ga0207711_100131988 117
570 3300025941 Ga0207711_10428641 Ga0207711_104286412 117
571 3300025941 Ga0207711_10535419 Ga0207711_105354192 117
572 3300025941 Ga0207711_10684623 Ga0207711_106846232 117
573 3300025942 Ga0207689_10002255 Ga0207689_100022552 117
574 3300025942 Ga0207689_10194179 Ga0207689_101941791 117
575 3300025942 Ga0207689_10238758 Ga0207689_102387582 117
576 3300025942 Ga0207689_10257946 Ga0207689_102579462 117
577 3300025942 Ga0207689_10463474 Ga0207689_104634742 117
578 3300025944 Ga0207661_10022644 Ga0207661_100226443 117
579 3300025944 Ga0207661_10026865 Ga0207661_100268654 117
580 3300025944 Ga0207661_11125468 Ga0207661_111254682 117
581 3300025945 Ga0207679_10090984 Ga0207679_100909842 117
582 3300025945 Ga0207679_10103210 Ga0207679_101032103 117
583 3300025945 Ga0207679_10405640 Ga0207679_104056402 117
584 3300025945 Ga0207679_11115295 Ga0207679_111152951 117
585 3300025945 Ga0207679_11474894 Ga0207679_114748941 117
586 3300025945 Ga0207679_12002488 Ga0207679_120024881 117
587 3300025949 Ga0207667_10020875 Ga0207667_100208754 117
588 3300025949 Ga0207667_10585785 Ga0207667_105857851 117
589 3300025949 Ga0207667_10683243 Ga0207667_106832431 117
590 3300025960 Ga0207651_10010197 Ga0207651_100101975 117
591 3300025960 Ga0207651_10284399 Ga0207651_102843992 117
592 3300025960 Ga0207651_10309098 Ga0207651_103090981 117
593 3300025961 Ga0207712_10003827 Ga0207712_100038274 117
594 3300025961 Ga0207712_10025416 Ga0207712_100254163 117
595 3300025972 Ga0207668_10471115 Ga0207668_104711152 117
596 3300025981 Ga0207640_10016926 Ga0207640_100169262 117
597 3300025981 Ga0207640_10128100 Ga0207640_101281002 117
598 3300025981 Ga0207640_10138354 Ga0207640_101383543 117
599 3300025986 Ga0207658_10000756 Ga0207658_100007566 117
600 3300025986 Ga0207658_11234071 Ga0207658_112340712 117
601 3300026023 Ga0207677_10050233 Ga0207677_100502333 117
602 3300026023 Ga0207677_10095899 Ga0207677_100958993 117
603 3300026023 Ga0207677_10396723 Ga0207677_103967233 117
604 3300026023 Ga0207677_10747224 Ga0207677_107472242 117
605 3300026023 Ga0207677_11275884 Ga0207677_112758842 117
606 3300026023 Ga0207677_11680337 Ga0207677_116803372 117
607 3300026035 Ga0207703_10001349 Ga0207703_100013496 117
608 3300026041 Ga0207639_10099819 Ga0207639_100998193 117
609 3300026041 Ga0207639_10510642 Ga0207639_105106422 117
610 3300026041 Ga0207639_11417227 Ga0207639_114172272 117
611 3300026067 Ga0207678_10008926 Ga0207678_100089263 117
612 3300026067 Ga0207678_10036525 Ga0207678_100365254 117
613 3300026067 Ga0207678_10060575 Ga0207678_100605754 117
614 3300026067 Ga0207678_10177049 Ga0207678_101770493 117
615 3300026067 Ga0207678_10855340 Ga0207678_108553402 117
616 3300026075 Ga0207708_10000535 Ga0207708_100005351 117
617 3300026075 Ga0207708_10002372 Ga0207708_1000237213 117
618 3300026078 Ga0207702_10106581 Ga0207702_101065813 117
619 3300026078 Ga0207702_10214358 Ga0207702_102143583 117
620 3300026078 Ga0207702_10984053 Ga0207702_109840532 117
621 3300026088 Ga0207641_10005453 Ga0207641_100054537 117
622 3300026088 Ga0207641_10038539 Ga0207641_100385393 117
623 3300026088 Ga0207641_10044388 Ga0207641_100443883 117
624 3300026088 Ga0207641_10768558 Ga0207641_107685582 117
625 3300026088 Ga0207641_11035437 Ga0207641_110354372 117
626 3300026089 Ga0207648_10000002 Ga0207648_10000002234 117
627 3300026089 Ga0207648_10002846 Ga0207648_100028466 117
628 3300026089 Ga0207648_10114822 Ga0207648_101148224 117
629 3300026089 Ga0207648_10922574 Ga0207648_109225742 117
630 3300026095 Ga0207676_10012389 Ga0207676_100123896 117
631 3300026095 Ga0207676_10049440 Ga0207676_100494405 117
632 3300026095 Ga0207676_10098325 Ga0207676_100983252 117
633 3300026095 Ga0207676_10159205 Ga0207676_101592051 117
634 3300026095 Ga0207676_10227823 Ga0207676_102278232 117
635 3300026095 Ga0207676_10746411 Ga0207676_107464112 117
636 3300026116 Ga0207674_10000253 Ga0207674_1000025351 117
637 3300026116 Ga0207674_10001583 Ga0207674_1000158330 117
638 3300026116 Ga0207674_10021790 Ga0207674_100217902 117
639 3300026116 Ga0207674_10290191 Ga0207674_102901912 117
640 3300026116 Ga0207674_10810473 Ga0207674_108104731 117
641 3300026116 Ga0207674_11901184 Ga0207674_119011841 117
642 3300026118 Ga0207675_100003938 Ga0207675_1000039389 117
643 3300026118 Ga0207675_100274764 Ga0207675_1002747643 117
644 3300026118 Ga0207675_101367465 Ga0207675_1013674652 117
645 3300026118 Ga0207675_101468824 Ga0207675_1014688242 117
646 3300026121 Ga0207683_10035993 Ga0207683_100359934 117
647 3300026121 Ga0207683_10038810 Ga0207683_100388104 117
648 3300026121 Ga0207683_10058156 Ga0207683_100581564 117
649 3300026121 Ga0207683_10116160 Ga0207683_101161604 117
650 3300026121 Ga0207683_10341566 Ga0207683_103415663 117
651 3300026121 Ga0207683_10344799 Ga0207683_103447991 117
652 3300026121 Ga0207683_10662493 Ga0207683_106624932 117
653 3300026121 Ga0207683_11163580 Ga0207683_111635801 117
654 3300026142 Ga0207698_10005678 Ga0207698_100056785 117
655 3300026142 Ga0207698_10025684 Ga0207698_100256843 117
656 3300026142 Ga0207698_10198889 Ga0207698_101988893 117
657 3300026142 Ga0207698_10199879 Ga0207698_101998792 117
658 3300026142 Ga0207698_10433323 Ga0207698_104333233 117
659 3300026142 Ga0207698_10566792 Ga0207698_105667922 117
660 3300026142 Ga0207698_12742589 Ga0207698_127425891 117
661 3300027296 Ga0209389_1050565 Ga0209389_10505654 117
662 3300027671 Ga0209588_1023442 Ga0209588_10234422 117
663 3300027876 Ga0209974_10388078 Ga0209974_103880781 117
664 3300028379 Ga0268266_10076602 Ga0268266_100766024 117
665 3300028380 Ga0268265_10003906 Ga0268265_100039062 117
666 3300028380 Ga0268265_10080106 Ga0268265_100801062 117
667 3300028381 Ga0268264_10011337 Ga0268264_100113378 117
668 3300028381 Ga0268264_10186627 Ga0268264_101866273 117
669 3300028381 Ga0268264_10974229 Ga0268264_109742291 117
670 3300028786 Ga0307517_10079232 Ga0307517_100792322 117
671 3300031456 Ga0307513_10046140 Ga0307513_100461402 117
672 3300031456 Ga0307513_10081906 Ga0307513_100819063 117
673 3300031548 Ga0307408_101219277 Ga0307408_1012192772 117
674 3300031730 Ga0307516_10022212 Ga0307516_100222125 117
675 3300031824 Ga0307413_10181628 Ga0307413_101816282 117
676 3300031901 Ga0307406_10828472 Ga0307406_108284721 117
677 3300031911 Ga0307412_10162517 Ga0307412_101625172 117
678 3300031911 Ga0307412_11171562 Ga0307412_111715622 117
679 3300031995 Ga0307409_100797121 Ga0307409_1007971212 117
680 3300031995 Ga0307409_102216864 Ga0307409_1022168641 117
681 3300032002 Ga0307416_100020832 Ga0307416_1000208323 117
682 3300032004 Ga0307414_11159539 Ga0307414_111595392 117
683 3300032004 Ga0307414_11788897 Ga0307414_117888972 117
684 3300032005 Ga0307411_10444646 Ga0307411_104446462 117
685 3300033528 Ga0316588_1036994 Ga0316588_10369942 117
686 3300034818 Ga0373950_0085043 Ga0373950_0085043_264_626 117
687 3300034819 Ga0373958_0034446 Ga0373958_0034446_13_375 117
688 3300035083 Ga0373926_0053209 Ga0373926_0053209_764_1123 117
689 3300035171 Ga0373946_0088150 Ga0373946_0088150_294_647 117
690 3300035725 Ga0373947_0449084 Ga0373947_0449084_341_700 117
691 3300036647 Ga0316582_0702171 Ga0316582_0702171_280_633 117
692 3300036712 Ga0316584_0097316 Ga0316584_0097316_1446_1799 117
693 3300037312 Ga0395899_0015319 Ga0395899_0015319_2797_3150 117
694 3300037418 Ga0395900_0020353 Ga0395900_0020353_3781_4134 117
695 3300037418 Ga0395900_0171446 Ga0395900_0171446_924_1295 117
696 3300037471 Ga0395905_0007590 Ga0395905_0007590_7909_8262 117
697 3300037471 Ga0395905_0957003 Ga0395905_0957003_55_426 117
698 3300038443 Ga0395901_0000745 Ga0395901_0000745_24371_24724 117
699 3300038443 Ga0395901_0459161 Ga0395901_0459161_80_451 117
700 3300039062 Ga0400483_056891 Ga0400483_056891_196_549 117
701 3300039062 Ga0400483_177311 Ga0400483_177311_347_700 117
702 3300039437 Ga0436365_1821131 Ga0436365_1821131_280_633 117
703 3300039438 Ga0436360_0635123 Ga0436360_0635123_231_590 117
704 3300039447 Ga0436361_0527389 Ga0436361_0527389_298_651 117
705 3300039447 Ga0436361_0649270 Ga0436361_0649270_1882_2235 117
706 3300039450 Ga0436363_0466499 Ga0436363_0466499_1889_2242 117
707 3300039450 Ga0436363_0909370 Ga0436363_0909370_156_509 117
708 3300039453 Ga0436362_0823712 Ga0436362_0823712_152_505 117
709 3300041451 Ga0451791_0050792 Ga0451791_0050792_231_584 117
710 3300041459 Ga0451800_0566674 Ga0451800_0566674_626_979 117
711 3300041486 Ga0451807_0932619 Ga0451807_0932619_36_389 117
712 3300041486 Ga0451807_1757683 Ga0451807_1757683_1267_1620 117
713 3300041496 Ga0451839_0365329 Ga0451839_0365329_56_409 117
714 3300041512 Ga0451853_0822117 Ga0451853_0822117_165_518 117
715 3300041512 Ga0451853_1186902 Ga0451853_1186902_247_600 117
716 3300041512 Ga0451853_1412040 Ga0451853_1412040_72_437 117
717 3300041512 Ga0451853_3287960 Ga0451853_3287960_1110_1463 117
718 3300042009 Ga0439451_004856 Ga0439451_004856_1787_2140 117
719 3300042013 Ga0439456_071035 Ga0439456_071035_184_537 117
720 3300042118 Ga0450914_007071 Ga0450914_007071_373_726 117
721 3300042127 Ga0450890_000321 Ga0450890_000321_2032_2385 117
722 3300042142 Ga0450905_059105 Ga0450905_059105_273_626 117
723 3300042156 Ga0439446_0021282 Ga0439446_0021282_1148_1501 117
724 3300044673 Ga0453683_0085215 Ga0453683_0085215_1594_1947 117
725 3300045051 Ga0451576_0265175 Ga0451576_0265175_157_510 117
726 3300046452 Ga0495617_001549 Ga0495617_001549_7878_8231 117
727 3300046453 Ga0495627_002781 Ga0495627_002781_780_1133 117
728 3300046457 Ga0495590_0001842 Ga0495590_0001842_8368_8721 117
729 3300046457 Ga0495590_0003633 Ga0495590_0003633_4184_4537 117
730 3300046457 Ga0495590_0198443 Ga0495590_0198443_249_602 117
731 3300046462 Ga0495651_0708151 Ga0495651_0708151_100_456 117
732 3300046471 Ga0495650_0005350 Ga0495650_0005350_6461_6814 117
733 3300046473 Ga0495582_0433400 Ga0495582_0433400_235_588 117
734 3300046474 Ga0495605_0011633 Ga0495605_0011633_3518_3871 117
735 3300046491 Ga0495584_0003708 Ga0495584_0003708_1691_2044 117
736 3300046491 Ga0495584_0011932 Ga0495584_0011932_374_727 117
737 3300046492 Ga0495585_0000756 Ga0495585_0000756_1429_1782 117
738 3300046501 Ga0495607_0000637 Ga0495607_0000637_29113_29466 117
739 3300046501 Ga0495607_0065857 Ga0495607_0065857_702_1055 117
740 3300046507 Ga0495606_0542355 Ga0495606_0542355_99_452 117
741 3300046512 Ga0495610_0038712 Ga0495610_0038712_1545_1898 117
742 3300046513 Ga0495616_0014077 Ga0495616_0014077_2684_3037 117
743 3300046513 Ga0495616_0099451 Ga0495616_0099451_94_447 117
744 3300046513 Ga0495616_0384892 Ga0495616_0384892_163_525 117
745 3300046515 Ga0495620_0106816 Ga0495620_0106816_354_707 117
746 3300046517 Ga0495630_0336434 Ga0495630_0336434_50_406 117
747 3300046518 Ga0495631_0394510 Ga0495631_0394510_185_538 117
748 3300046519 Ga0495632_0003848 Ga0495632_0003848_3220_3573 117
749 3300046519 Ga0495632_0018955 Ga0495632_0018955_1158_1511 117
750 3300046520 Ga0495637_0032976 Ga0495637_0032976_1399_1752 117
751 3300046522 Ga0495643_0006334 Ga0495643_0006334_1028_1381 117
752 3300046522 Ga0495643_0127363 Ga0495643_0127363_248_601 117
753 3300046524 Ga0495648_0018965 Ga0495648_0018965_4432_4785 117
754 3300046524 Ga0495648_0076588 Ga0495648_0076588_678_1031 117
755 3300046528 Ga0495642_0007901 Ga0495642_0007901_1876_2229 117
756 3300046530 Ga0495654_0091852 Ga0495654_0091852_832_1185 117
757 3300046538 Ga0495609_0005475 Ga0495609_0005475_2795_3148 117
758 3300046539 Ga0495621_0010202 Ga0495621_0010202_2249_2602 117
759 3300046539 Ga0495621_0158520 Ga0495621_0158520_396_749 117
760 3300046542 Ga0495597_0004785 Ga0495597_0004785_6633_6986 117
761 3300046542 Ga0495597_0077320 Ga0495597_0077320_68_421 117
762 3300046557 Ga0495622_0048833 Ga0495622_0048833_1135_1488 117
763 3300046615 Ga0495656_0614227 Ga0495656_0614227_125_478 117
764 3300046648 Ga0495611_0003183 Ga0495611_0003183_5604_5957 117
765 3300046664 Ga0495659_0013203 Ga0495659_0013203_696_1049 117
766 3300046681 Ga0495647_0080337 Ga0495647_0080337_12_365 117
767 3300046683 Ga0495658_0070648 Ga0495658_0070648_972_1325 117
768 3300046683 Ga0495658_0128881 Ga0495658_0128881_735_1088 117
769 3300046691 Ga0495670_0122488 Ga0495670_0122488_869_1222 117
770 3300046694 Ga0495649_0000086 Ga0495649_0000086_4109_4462 117
771 3300046694 Ga0495649_0090734 Ga0495649_0090734_529_882 117
772 3300046794 Ga0495589_0000636 Ga0495589_0000636_18484_18837 117
773 3300046810 Ga0495660_0103786 Ga0495660_0103786_889_1242 117
774 3300046810 Ga0495660_0193200 Ga0495660_0193200_572_925 117
775 3300046810 Ga0495660_0213571 Ga0495660_0213571_256_609 117
776 3300047318 Ga0495636_0001144 Ga0495636_0001144_7828_8181 117
777 3300047319 Ga0495674_0037120 Ga0495674_0037120_2752_3105 117
778 3300047320 Ga0495672_0001126 Ga0495672_0001126_6558_6911 117
779 3300047443 Ga0495687_001073 Ga0495687_001073_23319_23672 117
780 3300047443 Ga0495687_008149 Ga0495687_008149_3685_4038 117
781 3300047447 Ga0495685_003266 Ga0495685_003266_223_576 117
782 3300047469 Ga0495673_0004100 Ga0495673_0004100_7477_7830 117
783 3300047470 Ga0495681_0005449 Ga0495681_0005449_1152_1505 117
784 3300047470 Ga0495681_0111388 Ga0495681_0111388_141_494 117
785 3300047472 Ga0495686_0001282 Ga0495686_0001282_26771_27124 117
786 3300047472 Ga0495686_0004782 Ga0495686_0004782_3825_4178 117
787 3300047472 Ga0495686_0146610 Ga0495686_0146610_11_364 117
788 3300048090 Ga0495615_0307616 Ga0495615_0307616_104_457 117
789 3300048091 Ga0495626_0000490 Ga0495626_0000490_37953_38306 117
790 3300048903 Ga0496100_0599007 Ga0496100_0599007_47_400 117
791 3300048904 Ga0496101_0000946 Ga0496101_0000946_7043_7399 117
792 3300048904 Ga0496101_0474741 Ga0496101_0474741_110_472 117
793 3300048905 Ga0496102_0006848 Ga0496102_0006848_2036_2392 117
794 3300048905 Ga0496102_0014500 Ga0496102_0014500_5681_6043 117
795 3300048905 Ga0496102_1073406 Ga0496102_1073406_94_447 117
796 3300048906 Ga0496103_0156155 Ga0496103_0156155_307_669 117
797 3300048906 Ga0496103_0851553 Ga0496103_0851553_31_387 117
798 3300048907 Ga0496104_0030456 Ga0496104_0030456_168_524 117
799 3300048907 Ga0496104_0499328 Ga0496104_0499328_500_853 117
800 3300048907 Ga0496104_1826275 Ga0496104_1826275_83_436 117
801 3300048908 Ga0496105_0772589 Ga0496105_0772589_184_540 117
802 3300048908 Ga0496105_0780349 Ga0496105_0780349_87_458 117
803 3300048908 Ga0496105_1096254 Ga0496105_1096254_22_375 117
804 3300048908 Ga0496105_1119061 Ga0496105_1119061_111_464 117
805 3300048909 Ga0496106_0001831 Ga0496106_0001831_15220_15576 117
806 3300048909 Ga0496106_0012041 Ga0496106_0012041_323_685 117
807 3300048910 Ga0496107_0012964 Ga0496107_0012964_445_801 117
808 3300048910 Ga0496107_0133375 Ga0496107_0133375_808_1170 117
809 3300048911 Ga0496108_0035247 Ga0496108_0035247_250_606 117
810 3300048911 Ga0496108_0048381 Ga0496108_0048381_2703_3059 117
811 3300048911 Ga0496108_1135288 Ga0496108_1135288_69_422 117
812 3300048912 Ga0496109_0007810 Ga0496109_0007810_4577_4933 117
813 3300048912 Ga0496109_0035054 Ga0496109_0035054_3410_3766 117
814 3300048912 Ga0496109_0572379 Ga0496109_0572379_660_1013 117
815 3300048912 Ga0496109_0771267 Ga0496109_0771267_75_437 117
816 3300048913 Ga0496110_0000678 Ga0496110_0000678_1057_1413 117
817 3300048913 Ga0496110_0022804 Ga0496110_0022804_1259_1615 117
818 3300048913 Ga0496110_0938165 Ga0496110_0938165_146_499 117
819 3300048914 Ga0496111_0008384 Ga0496111_0008384_4238_4594 117
820 3300048915 Ga0496112_0515307 Ga0496112_0515307_731_1096 117
821 3300048915 Ga0496112_0636975 Ga0496112_0636975_244_600 117
822 3300048915 Ga0496112_1889146 Ga0496112_1889146_25_384 117
823 3300048916 Ga0496113_0140832 Ga0496113_0140832_1483_1839 117
824 3300048916 Ga0496113_0417678 Ga0496113_0417678_195_551 117
825 3300048917 Ga0496114_0264875 Ga0496114_0264875_44_397 117
826 3300048917 Ga0496114_0295237 Ga0496114_0295237_774_1130 117
827 3300048917 Ga0496114_0327111 Ga0496114_0327111_24_377 117
828 3300048918 Ga0496115_0076791 Ga0496115_0076791_1111_1470 117
829 3300048918 Ga0496115_0282032 Ga0496115_0282032_222_578 117
830 3300048918 Ga0496115_0420867 Ga0496115_0420867_508_870 117
831 3300048921 Ga0496118_0121214 Ga0496118_0121214_906_1268 117
832 3300048927 Ga0496124_0017518 Ga0496124_0017518_1522_1875 117
833 3300049459 Ga0495678_000437 Ga0495678_000437_3287_3640 117
834 3300049460 Ga0495682_0154673 Ga0495682_0154673_418_771 117
835 3300049515 Ga0501292_029095 Ga0501292_029095_260_613 117
836 3300049517 Ga0501294_028909 Ga0501294_028909_163_516 117
837 3300049568 Ga0501031_0029337 Ga0501031_0029337_1994_2347 117
838 3300049568 Ga0501031_0508335 Ga0501031_0508335_227_580 117
839 3300049572 Ga0501036_0085824 Ga0501036_0085824_943_1296 117
840 3300049572 Ga0501036_0154343 Ga0501036_0154343_446_808 117
841 3300049575 Ga0501039_0571487 Ga0501039_0571487_154_507 117
842 3300049575 Ga0501039_1550066 Ga0501039_1550066_131_484 117
843 3300049577 Ga0501041_0045372 Ga0501041_0045372_183_542 117
844 3300049577 Ga0501041_0253599 Ga0501041_0253599_448_810 117
845 3300049578 Ga0501042_0018382 Ga0501042_0018382_4443_4802 117
846 3300049578 Ga0501042_0042095 Ga0501042_0042095_1594_1947 117
847 3300049578 Ga0501042_0223767 Ga0501042_0223767_735_1088 117
848 3300049580 Ga0501046_0611471 Ga0501046_0611471_216_617 117
849 3300049582 Ga0501048_0311269 Ga0501048_0311269_491_844 117
850 3300049582 Ga0501048_0537350 Ga0501048_0537350_104_457 117
851 3300049586 Ga0501070_0752296 Ga0501070_0752296_256_663 117
852 3300049587 Ga0501071_0017977 Ga0501071_0017977_2357_2716 117
853 3300049587 Ga0501071_0328426 Ga0501071_0328426_269_622 117
854 3300049588 Ga0501072_0012333 Ga0501072_0012333_1624_1983 117
855 3300049589 Ga0501073_0608109 Ga0501073_0608109_78_440 117
856 3300049590 Ga0501074_0047129 Ga0501074_0047129_1942_2301 117
857 3300049591 Ga0501075_0253685 Ga0501075_0253685_89_451 117
858 3300049591 Ga0501075_0858496 Ga0501075_0858496_73_426 117
859 3300049592 Ga0501076_0978515 Ga0501076_0978515_248_601 117
860 3300049593 Ga0501077_0271443 Ga0501077_0271443_31_438 117
861 3300049653 Ga0501206_000997 Ga0501206_000997_3068_3421 117
862 3300049662 Ga0501222_008276 Ga0501222_008276_264_617 117
863 3300049686 Ga0501257_012817 Ga0501257_012817_1298_1651 117
864 3300049690 Ga0501261_052684 Ga0501261_052684_213_566 117
865 3300049741 Ga0501079_0002078 Ga0501079_0002078_12473_12832 117
866 3300049743 Ga0501081_0095927 Ga0501081_0095927_808_1167 117
867 3300049743 Ga0501081_0132526 Ga0501081_0132526_14_376 117
868 3300049743 Ga0501081_0756490 Ga0501081_0756490_231_638 117
869 3300049744 Ga0501083_0944779 Ga0501083_0944779_35_397 117
870 3300049762 Ga0501265_010796 Ga0501265_010796_438_791 117
871 3300049822 Ga0501035_0060070 Ga0501035_0060070_1497_1850 117
872 3300049822 Ga0501035_0391070 Ga0501035_0391070_726_1085 117
873 3300049824 Ga0501045_0026520 Ga0501045_0026520_2852_3211 117
874 3300049824 Ga0501045_0104928 Ga0501045_0104928_1726_2079 117
875 3300049824 Ga0501045_0153003 Ga0501045_0153003_1098_1460 117
876 3300049824 Ga0501045_1419392 Ga0501045_1419392_123_476 117
877 3300050491 nmdc:mga00v17_33166_c1 nmdc:mga00v17_33166_c1_11_370 117
878 3300050492 nmdc:mga0yw44_106134_c2 nmdc:mga0yw44_106134_c2_663_1022 117
879 3300050493 nmdc:mga0k408_444313_c1 nmdc:mga0k408_444313_c1_394_747 117
880 3300050494 nmdc:mga06z11_476289_c1 nmdc:mga06z11_476289_c1_85_444 117
881 3300050496 nmdc:mga07m45_14752_c1 nmdc:mga07m45_14752_c1_957_1310 117
882 3300050507 nmdc:mga05p37_571537_c1 nmdc:mga05p37_571537_c1_169_531 117
883 3300050509 nmdc:mga0qj67_399888_c1 nmdc:mga0qj67_399888_c1_145_498 117
884 3300050510 nmdc:mga06r32_135379_c1 nmdc:mga06r32_135379_c1_1693_2055 117
885 3300050511 nmdc:mga08y16_1215365_c1 nmdc:mga08y16_1215365_c1_336_713 117
886 3300050511 nmdc:mga08y16_128079_c1 nmdc:mga08y16_128079_c1_113_490 117
887 3300050511 nmdc:mga08y16_548632_c1 nmdc:mga08y16_548632_c1_571_924 117
888 3300050511 nmdc:mga08y16_648543_c1 nmdc:mga08y16_648543_c1_61_414 117
889 3300050512 nmdc:mga0n895_460071_c1 nmdc:mga0n895_460071_c1_526_894 117
890 3300050513 nmdc:mga0rr50_196583_c1 nmdc:mga0rr50_196583_c1_1186_1539 117
891 3300050514 nmdc:mga08x19_256803_c1 nmdc:mga08x19_256803_c1_283_636 117
892 3300050514 nmdc:mga08x19_62273_c1 nmdc:mga08x19_62273_c1_699_1052 117
893 3300050515 nmdc:mga0a205_44007_c1 nmdc:mga0a205_44007_c1_2670_3029 117
894 3300053077 Ga0495601_0505052 Ga0495601_0505052_64_417 117
895 3300053083 Ga0495655_0084467 Ga0495655_0084467_210_563 117
896 3300053086 Ga0500578_0043866 Ga0500578_0043866_1775_2128 117
897 3300053092 Ga0500583_0305445 Ga0500583_0305445_88_447 117
898 3300053096 Ga0500641_0398486 Ga0500641_0398486_103_462 117
899 3300053139 Ga0500568_0182939 Ga0500568_0182939_210_563 117
900 3300053730 Ga0500645_007433 Ga0500645_007433_2789_3142 117
901 3300054114 Ga0501084_0020668 Ga0501084_0020668_4115_4474 117
902 3300054114 Ga0501084_0206361 Ga0501084_0206361_1089_1451 117
903 3300054114 Ga0501084_0314841 Ga0501084_0314841_897_1250 117
904 3300054114 Ga0501084_0339597 Ga0501084_0339597_874_1233 117
905 3300054114 Ga0501084_1329676 Ga0501084_1329676_41_442 117
906 3300059424 Ga0590075_079124 Ga0590075_079124_401_754 117
907 3300060353 Ga0501082_0024896 Ga0501082_0024896_1106_1465 117
908 3300060353 Ga0501082_0219027 Ga0501082_0219027_345_707 117
909 3300060353 Ga0501082_1146821 Ga0501082_1146821_108_461 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

18

121

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9565 1 117
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.951 1 117
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9432 1 117
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8854 1 117
1xbw-assembly2.cif.gz_C 1.9a crystal structure of the protein isdg from staphylococcus aureus aureus, structural genomics, mcsg 0.7641 1 117
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9593 1 117 3.30.70.100
af_P9WLA3_114_212_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8045 2 88 3.30.70.100
3mcsA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7556 2 92 3.30.70.100
2pgcA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7214 3 114 3.30.70.100
1xbwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7196 1 117 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4R2I8P8-F1-model_v4 Uncharacterized protein YbaA (DUF1428 family) 0.9884 1 117
AF-A0A0Q6JVN0-F1-model_v4 RNA signal recognition particle 0.9853 2 117
AF-A0A2T3X314-F1-model_v4 deleted 0.9841 1 117
AF-A0A658NKC3-F1-model_v4 DUF1428 domain-containing protein 0.9822 9 90
AF-A0A520Y529-F1-model_v4 DUF1428 domain-containing protein 0.9814 1 92

Feature Viewer

pLDDT pTM Quality
94.28 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map