F485426
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 909 | 395 | 909 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0752296|Ga0501070_0752296_256_663 |
| Length | 135 |
| Sequence | VCVIDCDQTPSKEQQMPRYVDGFVIPLPKKNLDAYRRIAEECAKIWREHGALEVRECIAEDVKVGKLTSFPRSVQRKPSETVVFSWIVFKSRADRDRINAKVMKDPRMAKMMQEEKAPFDGKRMIYGGFEVLVEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 100 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 246 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 252 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 253 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 254 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 255 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 256 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 257 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 258 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 328 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 329 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 330 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 331 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 341 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 342 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 345 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 346 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 363 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 364 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 365 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 366 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 370 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 375 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 389 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 390 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 391 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.23 |
| Metatranscriptomes | 0.77 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.19 |
| Nodule | 0.33 |
| Rhizoplane | 5.72 |
| Rhizosphere | 88.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10005342 | 3300003323 | Bacteria | 39380 |
| 2 | JGI25404J52841_10004899 | 3300003659 | Bacteria | 2747 |
| 3 | Ga0055524_1020622 | 3300003775 | Bacteria | 2213 |
| 4 | Ga0055528_1087790 | 3300003790 | Bacteria | 537 |
| 5 | Ga0055531_10000103 | 3300003794 | Bacteria | 92298 |
| 6 | Ga0058863_10086596 | 3300004799 | Bacteria | 847 |
| 7 | Ga0058861_11284509 | 3300004800 | Bacteria | 942 |
| 8 | Ga0065715_10482623 | 3300005293 | Bacteria | 796 |
| 9 | Ga0070658_10043435 | 3300005327 | Bacteria | 3630 |
| 10 | Ga0070658_10174780 | 3300005327 | Bacteria | 1806 |
| 11 | Ga0070658_10205083 | 3300005327 | Bacteria | 1664 |
| 12 | Ga0070658_10292900 | 3300005327 | Bacteria | 1387 |
| 13 | Ga0070676_10009376 | 3300005328 | Bacteria | 5290 |
| 14 | Ga0070676_10456367 | 3300005328 | Bacteria | 900 |
| 15 | Ga0070676_10825564 | 3300005328 | Bacteria | 686 |
| 16 | Ga0070683_100012982 | 3300005329 | Bacteria | 7250 |
| 17 | Ga0070683_100021348 | 3300005329 | Bacteria | 5779 |
| 18 | Ga0070683_100880544 | 3300005329 | Bacteria | 859 |
| 19 | Ga0070690_100087471 | 3300005330 | Bacteria | 2046 |
| 20 | Ga0070690_100862382 | 3300005330 | Bacteria | 706 |
| 21 | Ga0070690_101615912 | 3300005330 | Bacteria | 526 |
| 22 | Ga0070670_100059712 | 3300005331 | Bacteria | 3273 |
| 23 | Ga0070670_100121184 | 3300005331 | Bacteria | 2256 |
| 24 | Ga0070670_100213671 | 3300005331 | Bacteria | 1677 |
| 25 | Ga0070670_102130967 | 3300005331 | Bacteria | 517 |
| 26 | Ga0070677_10005628 | 3300005333 | Bacteria | 4134 |
| 27 | Ga0070677_10410678 | 3300005333 | Bacteria | 716 |
| 28 | Ga0070677_10459765 | 3300005333 | Bacteria | 682 |
| 29 | Ga0068869_100003195 | 3300005334 | Bacteria | 10012 |
| 30 | Ga0068869_100198382 | 3300005334 | Bacteria | 1581 |
| 31 | Ga0068869_100521538 | 3300005334 | Bacteria | 994 |
| 32 | Ga0068869_100719547 | 3300005334 | Bacteria | 853 |
| 33 | Ga0070666_10173409 | 3300005335 | Bacteria | 1511 |
| 34 | Ga0070666_10918393 | 3300005335 | Bacteria | 647 |
| 35 | Ga0070680_100021694 | 3300005336 | Bacteria | 5107 |
| 36 | Ga0070682_100980473 | 3300005337 | Bacteria | 700 |
| 37 | Ga0068868_100153655 | 3300005338 | Bacteria | 1897 |
| 38 | Ga0068868_100476738 | 3300005338 | Bacteria | 1089 |
| 39 | Ga0068868_100611568 | 3300005338 | Bacteria | 966 |
| 40 | Ga0070660_100093354 | 3300005339 | Bacteria | 2376 |
| 41 | Ga0070660_100139499 | 3300005339 | Bacteria | 1944 |
| 42 | Ga0070660_100700288 | 3300005339 | Bacteria | 849 |
| 43 | Ga0070660_100784375 | 3300005339 | Bacteria | 801 |
| 44 | Ga0070689_100351680 | 3300005340 | Bacteria | 1236 |
| 45 | Ga0070689_100536919 | 3300005340 | Bacteria | 1006 |
| 46 | Ga0070691_10065775 | 3300005341 | Bacteria | 1751 |
| 47 | Ga0070687_100045346 | 3300005343 | Bacteria | 2245 |
| 48 | Ga0070687_100246180 | 3300005343 | Bacteria | 1108 |
| 49 | Ga0070661_100117306 | 3300005344 | Bacteria | 1991 |
| 50 | Ga0070661_100815040 | 3300005344 | Bacteria | 767 |
| 51 | Ga0070692_10013522 | 3300005345 | Bacteria | 3808 |
| 52 | Ga0070692_10706976 | 3300005345 | Bacteria | 679 |
| 53 | Ga0070668_100000574 | 3300005347 | Bacteria | 24639 |
| 54 | Ga0070668_100208445 | 3300005347 | Bacteria | 1607 |
| 55 | Ga0070668_100826296 | 3300005347 | Bacteria | 824 |
| 56 | Ga0070669_100000765 | 3300005353 | Bacteria | 23385 |
| 57 | Ga0070669_100826069 | 3300005353 | Bacteria | 788 |
| 58 | Ga0070669_101643669 | 3300005353 | Bacteria | 559 |
| 59 | Ga0070669_102031551 | 3300005353 | Bacteria | 502 |
| 60 | Ga0070675_100049796 | 3300005354 | Bacteria | 3439 |
| 61 | Ga0070675_100098419 | 3300005354 | Bacteria | 2460 |
| 62 | Ga0070675_100246697 | 3300005354 | Bacteria | 1561 |
| 63 | Ga0070675_100517510 | 3300005354 | Bacteria | 1076 |
| 64 | Ga0070671_100015231 | 3300005355 | Bacteria | 6210 |
| 65 | Ga0070671_100118942 | 3300005355 | Bacteria | 2223 |
| 66 | Ga0070671_100223762 | 3300005355 | Bacteria | 1596 |
| 67 | Ga0070671_100241404 | 3300005355 | Bacteria | 1534 |
| 68 | Ga0070671_100471885 | 3300005355 | Bacteria | 1078 |
| 69 | Ga0070671_100874425 | 3300005355 | Bacteria | 784 |
| 70 | Ga0070671_101319157 | 3300005355 | Bacteria | 637 |
| 71 | Ga0070674_100011152 | 3300005356 | Bacteria | 5459 |
| 72 | Ga0070674_100083924 | 3300005356 | Bacteria | 2283 |
| 73 | Ga0070674_100169814 | 3300005356 | Bacteria | 1662 |
| 74 | Ga0070673_100060051 | 3300005364 | Bacteria | 3011 |
| 75 | Ga0070673_100157484 | 3300005364 | Bacteria | 1929 |
| 76 | Ga0070673_100180152 | 3300005364 | Bacteria | 1808 |
| 77 | Ga0070673_100189764 | 3300005364 | Bacteria | 1764 |
| 78 | Ga0070673_101271494 | 3300005364 | Bacteria | 691 |
| 79 | Ga0070673_101742801 | 3300005364 | Bacteria | 590 |
| 80 | Ga0070688_100603694 | 3300005365 | Bacteria | 840 |
| 81 | Ga0070688_101614248 | 3300005365 | Bacteria | 530 |
| 82 | Ga0070659_100074878 | 3300005366 | Bacteria | 2698 |
| 83 | Ga0070659_100112476 | 3300005366 | Bacteria | 2199 |
| 84 | Ga0070659_100175753 | 3300005366 | Bacteria | 1756 |
| 85 | Ga0070659_100238682 | 3300005366 | Bacteria | 1503 |
| 86 | Ga0070659_100835341 | 3300005366 | Bacteria | 802 |
| 87 | Ga0070667_100007739 | 3300005367 | Bacteria | 8908 |
| 88 | Ga0070667_101046320 | 3300005367 | Bacteria | 762 |
| 89 | Ga0070667_101136265 | 3300005367 | Bacteria | 730 |
| 90 | Ga0070667_101659284 | 3300005367 | Bacteria | 601 |
| 91 | Ga0070703_10004258 | 3300005406 | Bacteria | 4028 |
| 92 | Ga0070709_11028668 | 3300005434 | Bacteria | 656 |
| 93 | Ga0070714_100135565 | 3300005435 | Bacteria | 2204 |
| 94 | Ga0070701_10084460 | 3300005438 | Bacteria | 1726 |
| 95 | Ga0070701_10120417 | 3300005438 | Bacteria | 1478 |
| 96 | Ga0070711_100023103 | 3300005439 | Bacteria | 4040 |
| 97 | Ga0070705_100000751 | 3300005440 | Bacteria | 18407 |
| 98 | Ga0070700_100006109 | 3300005441 | Bacteria | 6417 |
| 99 | Ga0070700_100200600 | 3300005441 | Bacteria | 1401 |
| 100 | Ga0070700_100351093 | 3300005441 | Bacteria | 1093 |
| 101 | Ga0070700_100807362 | 3300005441 | Bacteria | 756 |
| 102 | Ga0070694_100013925 | 3300005444 | Bacteria | 5030 |
| 103 | Ga0070694_100155756 | 3300005444 | Bacteria | 1672 |
| 104 | Ga0070663_100020235 | 3300005455 | Bacteria | 4402 |
| 105 | Ga0070663_100074650 | 3300005455 | Bacteria | 2476 |
| 106 | Ga0070663_100486712 | 3300005455 | Bacteria | 1022 |
| 107 | Ga0070678_100040070 | 3300005456 | Bacteria | 3312 |
| 108 | Ga0070678_100093070 | 3300005456 | Bacteria | 2317 |
| 109 | Ga0070678_100656049 | 3300005456 | Bacteria | 942 |
| 110 | Ga0070678_101306888 | 3300005456 | Bacteria | 675 |
| 111 | Ga0070662_100000783 | 3300005457 | Bacteria | 19529 |
| 112 | Ga0070662_100260601 | 3300005457 | Bacteria | 1397 |
| 113 | Ga0070662_100620843 | 3300005457 | Bacteria | 910 |
| 114 | Ga0070681_10050025 | 3300005458 | Bacteria | 4171 |
| 115 | Ga0070681_10823811 | 3300005458 | Bacteria | 845 |
| 116 | Ga0070681_10890925 | 3300005458 | Bacteria | 808 |
| 117 | Ga0068867_100000099 | 3300005459 | Bacteria | 55452 |
| 118 | Ga0068867_100005514 | 3300005459 | Bacteria | 8955 |
| 119 | Ga0068867_100088547 | 3300005459 | Bacteria | 2346 |
| 120 | Ga0068867_100110165 | 3300005459 | Bacteria | 2114 |
| 121 | Ga0070706_100224618 | 3300005467 | Bacteria | 1753 |
| 122 | Ga0070698_100005048 | 3300005471 | Bacteria | 14467 |
| 123 | Ga0070698_100569515 | 3300005471 | Bacteria | 1072 |
| 124 | Ga0070699_100005109 | 3300005518 | Bacteria | 11540 |
| 125 | Ga0070699_100005628 | 3300005518 | Bacteria | 10986 |
| 126 | Ga0070679_100063334 | 3300005530 | Bacteria | 3686 |
| 127 | Ga0070679_100333157 | 3300005530 | Bacteria | 1466 |
| 128 | Ga0070684_100015457 | 3300005535 | Bacteria | 6216 |
| 129 | Ga0070684_100278259 | 3300005535 | Bacteria | 1533 |
| 130 | Ga0070684_100327046 | 3300005535 | Bacteria | 1409 |
| 131 | Ga0070684_100375431 | 3300005535 | Bacteria | 1309 |
| 132 | Ga0070697_100307327 | 3300005536 | Bacteria | 1364 |
| 133 | Ga0070697_100781270 | 3300005536 | Bacteria | 844 |
| 134 | Ga0068853_100433941 | 3300005539 | Bacteria | 1234 |
| 135 | Ga0068853_100518529 | 3300005539 | Bacteria | 1127 |
| 136 | Ga0068853_100643106 | 3300005539 | Bacteria | 1009 |
| 137 | Ga0068853_100874663 | 3300005539 | Bacteria | 862 |
| 138 | Ga0070672_100005134 | 3300005543 | Bacteria | 8642 |
| 139 | Ga0070672_100031238 | 3300005543 | Bacteria | 4007 |
| 140 | Ga0070672_100102545 | 3300005543 | Bacteria | 2322 |
| 141 | Ga0070672_100134897 | 3300005543 | Bacteria | 2032 |
| 142 | Ga0070672_100476313 | 3300005543 | Bacteria | 1078 |
| 143 | Ga0070672_100496343 | 3300005543 | Bacteria | 1055 |
| 144 | Ga0070672_101853509 | 3300005543 | Bacteria | 542 |
| 145 | Ga0070695_100000339 | 3300005545 | Bacteria | 24039 |
| 146 | Ga0070695_100171483 | 3300005545 | Bacteria | 1531 |
| 147 | Ga0070695_100475174 | 3300005545 | Bacteria | 962 |
| 148 | Ga0070695_100752052 | 3300005545 | Bacteria | 778 |
| 149 | Ga0070696_100001139 | 3300005546 | Bacteria | 17242 |
| 150 | Ga0070696_100111458 | 3300005546 | Bacteria | 1971 |
| 151 | Ga0070693_100062205 | 3300005547 | Bacteria | 2172 |
| 152 | Ga0070693_100596713 | 3300005547 | Bacteria | 797 |
| 153 | Ga0070693_101185492 | 3300005547 | Bacteria | 586 |
| 154 | Ga0070704_100022238 | 3300005549 | Bacteria | 4124 |
| 155 | Ga0070704_100188853 | 3300005549 | Bacteria | 1654 |
| 156 | Ga0070704_100962614 | 3300005549 | Unclassified | 770 |
| 157 | Ga0070704_101076522 | 3300005549 | Bacteria | 729 |
| 158 | Ga0068855_100189763 | 3300005563 | Bacteria | 2319 |
| 159 | Ga0068855_100480758 | 3300005563 | Bacteria | 1352 |
| 160 | Ga0068855_100603652 | 3300005563 | Bacteria | 1183 |
| 161 | Ga0070664_100015887 | 3300005564 | Bacteria | 6163 |
| 162 | Ga0070664_100040986 | 3300005564 | Bacteria | 3906 |
| 163 | Ga0070664_100084788 | 3300005564 | Bacteria | 2735 |
| 164 | Ga0070664_100315920 | 3300005564 | Bacteria | 1414 |
| 165 | Ga0070664_101190332 | 3300005564 | Bacteria | 719 |
| 166 | Ga0068857_100174384 | 3300005577 | Bacteria | 1955 |
| 167 | Ga0068857_100194631 | 3300005577 | Bacteria | 1847 |
| 168 | Ga0068857_100247020 | 3300005577 | Bacteria | 1635 |
| 169 | Ga0068857_101361331 | 3300005577 | Bacteria | 690 |
| 170 | Ga0068857_102162670 | 3300005577 | Bacteria | 546 |
| 171 | Ga0068854_100010666 | 3300005578 | Bacteria | 5963 |
| 172 | Ga0068854_100052948 | 3300005578 | Bacteria | 2912 |
| 173 | Ga0068854_100408141 | 3300005578 | Bacteria | 1125 |
| 174 | Ga0068854_100612802 | 3300005578 | Bacteria | 931 |
| 175 | Ga0068854_102067238 | 3300005578 | Bacteria | 526 |
| 176 | Ga0068856_100111519 | 3300005614 | Bacteria | 2733 |
| 177 | Ga0068856_100200622 | 3300005614 | Bacteria | 2009 |
| 178 | Ga0068856_101107860 | 3300005614 | Bacteria | 809 |
| 179 | Ga0068856_101380321 | 3300005614 | Bacteria | 719 |
| 180 | Ga0070702_100193403 | 3300005615 | Bacteria | 1340 |
| 181 | Ga0070702_100448188 | 3300005615 | Bacteria | 936 |
| 182 | Ga0068852_100008232 | 3300005616 | Bacteria | 7665 |
| 183 | Ga0068852_100055860 | 3300005616 | Bacteria | 3409 |
| 184 | Ga0068852_100128386 | 3300005616 | Bacteria | 2331 |
| 185 | Ga0068852_100177778 | 3300005616 | Bacteria | 1999 |
| 186 | Ga0068852_100289206 | 3300005616 | Bacteria | 1583 |
| 187 | Ga0068852_100629953 | 3300005616 | Bacteria | 1079 |
| 188 | Ga0068852_100754458 | 3300005616 | Bacteria | 985 |
| 189 | Ga0068859_100004644 | 3300005617 | Bacteria | 13994 |
| 190 | Ga0068859_100104541 | 3300005617 | Bacteria | 2891 |
| 191 | Ga0068859_100215382 | 3300005617 | Bacteria | 2008 |
| 192 | Ga0068859_100601278 | 3300005617 | Bacteria | 1193 |
| 193 | Ga0068859_102724987 | 3300005617 | Bacteria | 543 |
| 194 | Ga0068864_100019366 | 3300005618 | Bacteria | 5691 |
| 195 | Ga0068864_100154035 | 3300005618 | Bacteria | 2085 |
| 196 | Ga0068864_100172017 | 3300005618 | Bacteria | 1975 |
| 197 | Ga0068864_100272205 | 3300005618 | Bacteria | 1578 |
| 198 | Ga0068864_101327893 | 3300005618 | Bacteria | 720 |
| 199 | Ga0068864_101506775 | 3300005618 | Bacteria | 676 |
| 200 | Ga0068866_10002119 | 3300005718 | Bacteria | 8255 |
| 201 | Ga0068866_10411884 | 3300005718 | Bacteria | 875 |
| 202 | Ga0068861_100004658 | 3300005719 | Bacteria | 9211 |
| 203 | Ga0068861_100042324 | 3300005719 | Bacteria | 3413 |
| 204 | Ga0068861_100226822 | 3300005719 | Bacteria | 1582 |
| 205 | Ga0068861_100314513 | 3300005719 | Bacteria | 1362 |
| 206 | Ga0068851_10000574 | 3300005834 | Bacteria | 16016 |
| 207 | Ga0068851_10015869 | 3300005834 | Bacteria | 3595 |
| 208 | Ga0068851_10204423 | 3300005834 | Bacteria | 1104 |
| 209 | Ga0068851_10734627 | 3300005834 | Bacteria | 610 |
| 210 | Ga0068870_10287766 | 3300005840 | Bacteria | 1033 |
| 211 | Ga0068870_11290453 | 3300005840 | Bacteria | 532 |
| 212 | Ga0068863_100001215 | 3300005841 | Bacteria | 25740 |
| 213 | Ga0068863_100027689 | 3300005841 | Bacteria | 5408 |
| 214 | Ga0068863_100326179 | 3300005841 | Bacteria | 1492 |
| 215 | Ga0068863_100486991 | 3300005841 | Bacteria | 1213 |
| 216 | Ga0068863_101513562 | 3300005841 | Bacteria | 680 |
| 217 | Ga0068858_100011059 | 3300005842 | Bacteria | 8532 |
| 218 | Ga0068858_100287055 | 3300005842 | Bacteria | 1568 |
| 219 | Ga0068858_101874273 | 3300005842 | Bacteria | 592 |
| 220 | Ga0068860_100009850 | 3300005843 | Bacteria | 9480 |
| 221 | Ga0068860_100010922 | 3300005843 | Bacteria | 8952 |
| 222 | Ga0068860_100235990 | 3300005843 | Bacteria | 1778 |
| 223 | Ga0068862_100005698 | 3300005844 | Bacteria | 10394 |
| 224 | Ga0068862_100020474 | 3300005844 | Bacteria | 5526 |
| 225 | Ga0068862_100540129 | 3300005844 | Bacteria | 1112 |
| 226 | Ga0068862_101494533 | 3300005844 | Bacteria | 681 |
| 227 | Ga0081455_10000197 | 3300005937 | Bacteria | 76374 |
| 228 | Ga0081455_10007547 | 3300005937 | Bacteria | 11439 |
| 229 | Ga0081455_10078898 | 3300005937 | Bacteria | 2705 |
| 230 | Ga0081538_10001078 | 3300005981 | Bacteria | 29015 |
| 231 | Ga0081538_10033454 | 3300005981 | Bacteria | 3421 |
| 232 | Ga0081540_1000313 | 3300005983 | Bacteria | 50236 |
| 233 | Ga0070717_10182325 | 3300006028 | Bacteria | 1831 |
| 234 | Ga0070717_10549333 | 3300006028 | Bacteria | 1046 |
| 235 | Ga0075365_10002797 | 3300006038 | Bacteria | 8732 |
| 236 | Ga0075365_10964002 | 3300006038 | Bacteria | 601 |
| 237 | Ga0075364_10063243 | 3300006051 | Bacteria | 2429 |
| 238 | Ga0075364_10353985 | 3300006051 | Bacteria | 1001 |
| 239 | Ga0070715_10162126 | 3300006163 | Bacteria | 1106 |
| 240 | Ga0070716_100130447 | 3300006173 | Bacteria | 1588 |
| 241 | Ga0070716_100306351 | 3300006173 | Bacteria | 1107 |
| 242 | Ga0070712_100646210 | 3300006175 | Bacteria | 898 |
| 243 | Ga0070712_100833112 | 3300006175 | Bacteria | 793 |
| 244 | Ga0075362_10120662 | 3300006177 | Bacteria | 1241 |
| 245 | Ga0075362_10509580 | 3300006177 | Bacteria | 616 |
| 246 | Ga0097621_100026893 | 3300006237 | Bacteria | 4519 |
| 247 | Ga0097621_100566179 | 3300006237 | Bacteria | 1035 |
| 248 | Ga0097621_102080938 | 3300006237 | Bacteria | 543 |
| 249 | Ga0075370_10690263 | 3300006353 | Bacteria | 620 |
| 250 | Ga0068871_100405026 | 3300006358 | Bacteria | 1215 |
| 251 | Ga0068871_100895337 | 3300006358 | Bacteria | 822 |
| 252 | Ga0068871_100932954 | 3300006358 | Bacteria | 806 |
| 253 | Ga0075428_101189089 | 3300006844 | Bacteria | 804 |
| 254 | Ga0075428_102004390 | 3300006844 | Bacteria | 600 |
| 255 | Ga0075430_100022398 | 3300006846 | Bacteria | 5376 |
| 256 | Ga0075430_101310527 | 3300006846 | Bacteria | 596 |
| 257 | Ga0075431_100061319 | 3300006847 | Bacteria | 3881 |
| 258 | Ga0075431_100446269 | 3300006847 | Bacteria | 1290 |
| 259 | Ga0075431_100981751 | 3300006847 | Bacteria | 812 |
| 260 | Ga0075431_101212945 | 3300006847 | Bacteria | 717 |
| 261 | Ga0075433_10356745 | 3300006852 | Bacteria | 1292 |
| 262 | Ga0075433_10569419 | 3300006852 | Unclassified | 995 |
| 263 | Ga0075434_100254525 | 3300006871 | Bacteria | 1775 |
| 264 | Ga0075434_100753133 | 3300006871 | Bacteria | 991 |
| 265 | Ga0075429_100030827 | 3300006880 | Bacteria | 4660 |
| 266 | Ga0068865_100003044 | 3300006881 | Bacteria | 10022 |
| 267 | Ga0068865_100048823 | 3300006881 | Bacteria | 2914 |
| 268 | Ga0068865_100609308 | 3300006881 | Bacteria | 924 |
| 269 | Ga0068865_101355195 | 3300006881 | Bacteria | 634 |
| 270 | Ga0075436_100004893 | 3300006914 | Bacteria | 9205 |
| 271 | Ga0075436_100412316 | 3300006914 | Bacteria | 980 |
| 272 | Ga0097620_100004644 | 3300006931 | Bacteria | 13994 |
| 273 | Ga0097620_100104540 | 3300006931 | Bacteria | 2891 |
| 274 | Ga0097620_100215390 | 3300006931 | Bacteria | 2008 |
| 275 | Ga0097620_100601327 | 3300006931 | Bacteria | 1193 |
| 276 | Ga0097620_102724732 | 3300006931 | Bacteria | 543 |
| 277 | Ga0099824_1036269 | 3300006942 | Bacteria | 1443 |
| 278 | Ga0099823_1000255 | 3300006944 | Bacteria | 31191 |
| 279 | Ga0075435_100112426 | 3300007076 | Bacteria | 2266 |
| 280 | Ga0075435_101308535 | 3300007076 | Bacteria | 635 |
| 281 | Ga0099794_10305066 | 3300007265 | Bacteria | 825 |
| 282 | Ga0111539_10056078 | 3300009094 | Bacteria | 4684 |
| 283 | Ga0111539_10283840 | 3300009094 | Bacteria | 1927 |
| 284 | Ga0111539_10589999 | 3300009094 | Bacteria | 1294 |
| 285 | Ga0111539_10709606 | 3300009094 | Bacteria | 1171 |
| 286 | Ga0105245_10577542 | 3300009098 | Bacteria | 1148 |
| 287 | Ga0105245_10721349 | 3300009098 | Bacteria | 1031 |
| 288 | Ga0105245_13173533 | 3300009098 | Bacteria | 509 |
| 289 | Ga0105247_10010942 | 3300009101 | Bacteria | 5477 |
| 290 | Ga0105247_10507750 | 3300009101 | Bacteria | 879 |
| 291 | Ga0114129_10806966 | 3300009147 | Bacteria | 1197 |
| 292 | Ga0105243_10001373 | 3300009148 | Bacteria | 21563 |
| 293 | Ga0105243_10015973 | 3300009148 | Bacteria | 5677 |
| 294 | Ga0105243_10125137 | 3300009148 | Bacteria | 2173 |
| 295 | Ga0105243_10148299 | 3300009148 | Bacteria | 2010 |
| 296 | Ga0105243_10557522 | 3300009148 | Bacteria | 1096 |
| 297 | Ga0105243_10874423 | 3300009148 | Bacteria | 892 |
| 298 | Ga0105241_10024674 | 3300009174 | Bacteria | 4466 |
| 299 | Ga0105241_10067029 | 3300009174 | Bacteria | 2777 |
| 300 | Ga0105242_10034546 | 3300009176 | Bacteria | 4054 |
| 301 | Ga0105242_11120377 | 3300009176 | Bacteria | 802 |
| 302 | Ga0105242_11537817 | 3300009176 | Bacteria | 697 |
| 303 | Ga0105248_10003918 | 3300009177 | Bacteria | 16461 |
| 304 | Ga0105248_10354820 | 3300009177 | Bacteria | 1651 |
| 305 | Ga0105248_10391094 | 3300009177 | Bacteria | 1566 |
| 306 | Ga0105248_11401112 | 3300009177 | Bacteria | 791 |
| 307 | Ga0105248_11583334 | 3300009177 | Bacteria | 742 |
| 308 | Ga0105237_10199124 | 3300009545 | Bacteria | 2002 |
| 309 | Ga0105237_10734600 | 3300009545 | Bacteria | 994 |
| 310 | Ga0105237_11124416 | 3300009545 | Bacteria | 792 |
| 311 | Ga0105238_10446131 | 3300009551 | Bacteria | 1291 |
| 312 | Ga0105238_12309967 | 3300009551 | Bacteria | 573 |
| 313 | Ga0105238_12733437 | 3300009551 | Bacteria | 530 |
| 314 | Ga0105249_10013028 | 3300009553 | Bacteria | 7338 |
| 315 | Ga0105249_11482395 | 3300009553 | Bacteria | 751 |
| 316 | Ga0099796_10246118 | 3300010159 | Bacteria | 741 |
| 317 | Ga0105239_10255886 | 3300010375 | Bacteria | 1967 |
| 318 | Ga0105239_10360708 | 3300010375 | Bacteria | 1641 |
| 319 | Ga0105239_11549594 | 3300010375 | Bacteria | 766 |
| 320 | Ga0105239_11813876 | 3300010375 | Bacteria | 707 |
| 321 | Ga0105246_10503750 | 3300011119 | Bacteria | 1029 |
| 322 | Ga0157315_1006752 | 3300012508 | Bacteria | 908 |
| 323 | Ga0157373_10003095 | 3300013100 | Bacteria | 12569 |
| 324 | Ga0157373_10291545 | 3300013100 | Bacteria | 1157 |
| 325 | Ga0157373_10392804 | 3300013100 | Bacteria | 993 |
| 326 | Ga0157371_10013703 | 3300013102 | Bacteria | 6149 |
| 327 | Ga0157371_10242714 | 3300013102 | Bacteria | 1296 |
| 328 | Ga0157371_10555853 | 3300013102 | Bacteria | 851 |
| 329 | Ga0157370_10074452 | 3300013104 | Bacteria | 3203 |
| 330 | Ga0157370_10404954 | 3300013104 | Bacteria | 1255 |
| 331 | Ga0157370_11297938 | 3300013104 | Bacteria | 656 |
| 332 | Ga0157369_10308021 | 3300013105 | Bacteria | 1647 |
| 333 | Ga0157369_10503849 | 3300013105 | Bacteria | 1252 |
| 334 | Ga0157369_10533057 | 3300013105 | Bacteria | 1214 |
| 335 | Ga0157369_10597169 | 3300013105 | Bacteria | 1140 |
| 336 | Ga0157374_10201476 | 3300013296 | Bacteria | 1949 |
| 337 | Ga0157374_10337555 | 3300013296 | Bacteria | 1495 |
| 338 | Ga0157374_11196392 | 3300013296 | Bacteria | 781 |
| 339 | Ga0157374_11230360 | 3300013296 | Bacteria | 770 |
| 340 | Ga0157374_11499668 | 3300013296 | Bacteria | 698 |
| 341 | Ga0157374_11559734 | 3300013296 | Bacteria | 684 |
| 342 | Ga0157378_10074037 | 3300013297 | Bacteria | 3064 |
| 343 | Ga0157378_10141889 | 3300013297 | Bacteria | 2231 |
| 344 | Ga0157378_10244120 | 3300013297 | Bacteria | 1717 |
| 345 | Ga0157378_11090793 | 3300013297 | Bacteria | 835 |
| 346 | Ga0163162_10000769 | 3300013306 | Bacteria | 29806 |
| 347 | Ga0163162_10073872 | 3300013306 | Bacteria | 3467 |
| 348 | Ga0163162_10210346 | 3300013306 | Bacteria | 2075 |
| 349 | Ga0163162_12748055 | 3300013306 | Bacteria | 567 |
| 350 | Ga0157372_10211993 | 3300013307 | Bacteria | 2245 |
| 351 | Ga0157372_10245002 | 3300013307 | Bacteria | 2080 |
| 352 | Ga0157372_10507987 | 3300013307 | Bacteria | 1405 |
| 353 | Ga0157372_10678482 | 3300013307 | Bacteria | 1199 |
| 354 | Ga0157372_10695661 | 3300013307 | Bacteria | 1183 |
| 355 | Ga0157375_10002304 | 3300013308 | Bacteria | 16487 |
| 356 | Ga0157375_10004451 | 3300013308 | Bacteria | 12165 |
| 357 | Ga0157375_10075657 | 3300013308 | Bacteria | 3392 |
| 358 | Ga0157375_10098672 | 3300013308 | Bacteria | 2998 |
| 359 | Ga0157375_10739799 | 3300013308 | Bacteria | 1135 |
| 360 | Ga0163163_10364546 | 3300014325 | Bacteria | 1502 |
| 361 | Ga0163163_10741489 | 3300014325 | Bacteria | 1046 |
| 362 | Ga0163163_11493747 | 3300014325 | Bacteria | 737 |
| 363 | Ga0157380_10035506 | 3300014326 | Bacteria | 3852 |
| 364 | Ga0157380_10064490 | 3300014326 | Bacteria | 2941 |
| 365 | Ga0157380_10173324 | 3300014326 | Bacteria | 1887 |
| 366 | Ga0157380_10341416 | 3300014326 | Bacteria | 1397 |
| 367 | Ga0157380_10605430 | 3300014326 | Bacteria | 1085 |
| 368 | Ga0182008_10577309 | 3300014497 | Bacteria | 628 |
| 369 | Ga0157377_10000010 | 3300014745 | Bacteria | 380929 |
| 370 | Ga0157377_10234589 | 3300014745 | Bacteria | 1181 |
| 371 | Ga0157377_10334670 | 3300014745 | Bacteria | 1010 |
| 372 | Ga0157377_10695959 | 3300014745 | Bacteria | 737 |
| 373 | Ga0157379_10053364 | 3300014968 | Bacteria | 3610 |
| 374 | Ga0157379_10121514 | 3300014968 | Bacteria | 2349 |
| 375 | Ga0157379_10175551 | 3300014968 | Bacteria | 1935 |
| 376 | Ga0157379_10534792 | 3300014968 | Bacteria | 1089 |
| 377 | Ga0157379_10722309 | 3300014968 | Bacteria | 936 |
| 378 | Ga0157379_11438568 | 3300014968 | Bacteria | 669 |
| 379 | Ga0157376_10324273 | 3300014969 | Bacteria | 1465 |
| 380 | Ga0157376_10594588 | 3300014969 | Bacteria | 1101 |
| 381 | Ga0157376_10649534 | 3300014969 | Bacteria | 1055 |
| 382 | Ga0182007_10181006 | 3300015262 | Bacteria | 729 |
| 383 | Ga0163161_10002372 | 3300017792 | Bacteria | 13495 |
| 384 | Ga0163161_10183334 | 3300017792 | Bacteria | 1606 |
| 385 | Ga0163161_10326819 | 3300017792 | Bacteria | 1214 |
| 386 | Ga0163161_10450000 | 3300017792 | Bacteria | 1041 |
| 387 | Ga0206356_11645321 | 3300020070 | Bacteria | 1092 |
| 388 | Ga0206352_10674374 | 3300020078 | Bacteria | 728 |
| 389 | Ga0206354_11514788 | 3300020081 | Bacteria | 2018 |
| 390 | Ga0206353_11438233 | 3300020082 | Bacteria | 1459 |
| 391 | Ga0213874_10180310 | 3300021377 | Unclassified | 751 |
| 392 | Ga0209673_1002911 | 3300025273 | Bacteria | 10803 |
| 393 | Ga0209673_1003599 | 3300025273 | Bacteria | 9008 |
| 394 | Ga0209050_1004646 | 3300025298 | Bacteria | 9149 |
| 395 | Ga0209050_1008129 | 3300025298 | Bacteria | 5687 |
| 396 | Ga0209256_1001476 | 3300025299 | Bacteria | 24051 |
| 397 | Ga0209051_1000648 | 3300025303 | Bacteria | 39536 |
| 398 | Ga0209051_1011406 | 3300025303 | Bacteria | 4390 |
| 399 | Ga0209257_1000131 | 3300025304 | Bacteria | 211464 |
| 400 | Ga0209257_1000673 | 3300025304 | Bacteria | 53490 |
| 401 | Ga0207656_10025064 | 3300025321 | Bacteria | 2419 |
| 402 | Ga0207656_10058092 | 3300025321 | Bacteria | 1689 |
| 403 | Ga0207656_10118911 | 3300025321 | Bacteria | 1228 |
| 404 | Ga0207656_10147472 | 3300025321 | Bacteria | 1112 |
| 405 | Ga0207653_10025876 | 3300025885 | Bacteria | 1878 |
| 406 | Ga0207682_10003485 | 3300025893 | Bacteria | 6819 |
| 407 | Ga0207682_10022332 | 3300025893 | Bacteria | 2492 |
| 408 | Ga0207692_10828702 | 3300025898 | Bacteria | 606 |
| 409 | Ga0207642_10027248 | 3300025899 | Bacteria | 2337 |
| 410 | Ga0207710_10032132 | 3300025900 | Bacteria | 2299 |
| 411 | Ga0207688_10120256 | 3300025901 | Bacteria | 1532 |
| 412 | Ga0207688_10143148 | 3300025901 | Bacteria | 1408 |
| 413 | Ga0207688_10639499 | 3300025901 | Bacteria | 671 |
| 414 | Ga0207680_10018348 | 3300025903 | Bacteria | 3717 |
| 415 | Ga0207680_10676439 | 3300025903 | Bacteria | 739 |
| 416 | Ga0207680_11282524 | 3300025903 | Bacteria | 521 |
| 417 | Ga0207647_10546480 | 3300025904 | Bacteria | 643 |
| 418 | Ga0207685_10093140 | 3300025905 | Bacteria | 1273 |
| 419 | Ga0207645_10004020 | 3300025907 | Bacteria | 10965 |
| 420 | Ga0207645_10115349 | 3300025907 | Bacteria | 1741 |
| 421 | Ga0207645_10488211 | 3300025907 | Bacteria | 833 |
| 422 | Ga0207705_11393461 | 3300025909 | Bacteria | 533 |
| 423 | Ga0207684_10113995 | 3300025910 | Bacteria | 2315 |
| 424 | Ga0207654_10013176 | 3300025911 | Bacteria | 4248 |
| 425 | Ga0207654_10119807 | 3300025911 | Bacteria | 1651 |
| 426 | Ga0207707_10009059 | 3300025912 | Bacteria | 8645 |
| 427 | Ga0207707_10392547 | 3300025912 | Bacteria | 1192 |
| 428 | Ga0207695_10168662 | 3300025913 | Bacteria | 2116 |
| 429 | Ga0207671_10213514 | 3300025914 | Bacteria | 1510 |
| 430 | Ga0207671_10481835 | 3300025914 | Bacteria | 989 |
| 431 | Ga0207693_10166318 | 3300025915 | Bacteria | 1736 |
| 432 | Ga0207660_10016006 | 3300025917 | Bacteria | 4958 |
| 433 | Ga0207660_10040090 | 3300025917 | Bacteria | 3277 |
| 434 | Ga0207660_11101651 | 3300025917 | Bacteria | 647 |
| 435 | Ga0207662_10049144 | 3300025918 | Bacteria | 2501 |
| 436 | Ga0207662_10094453 | 3300025918 | Bacteria | 1844 |
| 437 | Ga0207662_10249948 | 3300025918 | Bacteria | 1163 |
| 438 | Ga0207657_10006685 | 3300025919 | Bacteria | 11923 |
| 439 | Ga0207657_10063313 | 3300025919 | Bacteria | 3163 |
| 440 | Ga0207657_10467062 | 3300025919 | Bacteria | 990 |
| 441 | Ga0207649_10199266 | 3300025920 | Bacteria | 1413 |
| 442 | Ga0207652_10018045 | 3300025921 | Bacteria | 5784 |
| 443 | Ga0207652_10023480 | 3300025921 | Bacteria | 5110 |
| 444 | Ga0207652_10700824 | 3300025921 | Bacteria | 903 |
| 445 | Ga0207681_10000340 | 3300025923 | Bacteria | 33613 |
| 446 | Ga0207681_10575148 | 3300025923 | Bacteria | 929 |
| 447 | Ga0207694_10007424 | 3300025924 | Bacteria | 8308 |
| 448 | Ga0207694_10812044 | 3300025924 | Bacteria | 790 |
| 449 | Ga0207650_10056224 | 3300025925 | Bacteria | 2923 |
| 450 | Ga0207650_10084655 | 3300025925 | Bacteria | 2411 |
| 451 | Ga0207650_10469575 | 3300025925 | Bacteria | 1049 |
| 452 | Ga0207650_10574102 | 3300025925 | Bacteria | 947 |
| 453 | Ga0207650_10629929 | 3300025925 | Bacteria | 903 |
| 454 | Ga0207650_10739305 | 3300025925 | Bacteria | 832 |
| 455 | Ga0207659_10016814 | 3300025926 | Bacteria | 4769 |
| 456 | Ga0207659_10089935 | 3300025926 | Bacteria | 2290 |
| 457 | Ga0207659_10382353 | 3300025926 | Bacteria | 1174 |
| 458 | Ga0207687_10224592 | 3300025927 | Bacteria | 1480 |
| 459 | Ga0207687_10546758 | 3300025927 | Bacteria | 971 |
| 460 | Ga0207700_10562754 | 3300025928 | Bacteria | 1013 |
| 461 | Ga0207664_10236895 | 3300025929 | Bacteria | 1588 |
| 462 | Ga0207644_10000042 | 3300025931 | Bacteria | 112685 |
| 463 | Ga0207644_10191727 | 3300025931 | Bacteria | 1607 |
| 464 | Ga0207644_10516397 | 3300025931 | Bacteria | 986 |
| 465 | Ga0207644_10736699 | 3300025931 | Bacteria | 823 |
| 466 | Ga0207690_10012011 | 3300025932 | Bacteria | 5179 |
| 467 | Ga0207690_10266614 | 3300025932 | Bacteria | 1329 |
| 468 | Ga0207690_10538650 | 3300025932 | Bacteria | 948 |
| 469 | Ga0207690_10732169 | 3300025932 | Bacteria | 814 |
| 470 | Ga0207690_11567520 | 3300025932 | Bacteria | 550 |
| 471 | Ga0207706_10136318 | 3300025933 | Bacteria | 2159 |
| 472 | Ga0207706_10160965 | 3300025933 | Bacteria | 1973 |
| 473 | Ga0207706_10334028 | 3300025933 | Bacteria | 1318 |
| 474 | Ga0207706_10535451 | 3300025933 | Bacteria | 1009 |
| 475 | Ga0207706_10771762 | 3300025933 | Bacteria | 818 |
| 476 | Ga0207706_10829901 | 3300025933 | Bacteria | 784 |
| 477 | Ga0207686_10038506 | 3300025934 | Bacteria | 2894 |
| 478 | Ga0207686_10281121 | 3300025934 | Bacteria | 1228 |
| 479 | Ga0207709_10001570 | 3300025935 | Bacteria | 15648 |
| 480 | Ga0207709_10015155 | 3300025935 | Bacteria | 4272 |
| 481 | Ga0207709_10028955 | 3300025935 | Bacteria | 3207 |
| 482 | Ga0207709_11456611 | 3300025935 | Bacteria | 568 |
| 483 | Ga0207670_10216643 | 3300025936 | Bacteria | 1463 |
| 484 | Ga0207669_10005760 | 3300025937 | Bacteria | 5594 |
| 485 | Ga0207669_10124620 | 3300025937 | Bacteria | 1757 |
| 486 | Ga0207669_10397338 | 3300025937 | Bacteria | 1079 |
| 487 | Ga0207669_11063836 | 3300025937 | Bacteria | 682 |
| 488 | Ga0207669_11364316 | 3300025937 | Bacteria | 603 |
| 489 | Ga0207704_10003619 | 3300025938 | Bacteria | 7016 |
| 490 | Ga0207704_10378949 | 3300025938 | Bacteria | 1110 |
| 491 | Ga0207665_10099175 | 3300025939 | Bacteria | 2031 |
| 492 | Ga0207691_10038546 | 3300025940 | Bacteria | 4423 |
| 493 | Ga0207691_10040632 | 3300025940 | Bacteria | 4296 |
| 494 | Ga0207691_10044292 | 3300025940 | Bacteria | 4097 |
| 495 | Ga0207691_10078502 | 3300025940 | Bacteria | 2972 |
| 496 | Ga0207691_10085217 | 3300025940 | Bacteria | 2836 |
| 497 | Ga0207691_10347472 | 3300025940 | Bacteria | 1269 |
| 498 | Ga0207691_10363157 | 3300025940 | Bacteria | 1238 |
| 499 | Ga0207711_10001998 | 3300025941 | Bacteria | 18443 |
| 500 | Ga0207711_10013198 | 3300025941 | Bacteria | 6863 |
| 501 | Ga0207711_10428641 | 3300025941 | Bacteria | 1230 |
| 502 | Ga0207711_10535419 | 3300025941 | Bacteria | 1092 |
| 503 | Ga0207711_10684623 | 3300025941 | Bacteria | 956 |
| 504 | Ga0207689_10002255 | 3300025942 | Bacteria | 18068 |
| 505 | Ga0207689_10194179 | 3300025942 | Bacteria | 1675 |
| 506 | Ga0207689_10238758 | 3300025942 | Bacteria | 1502 |
| 507 | Ga0207689_10257946 | 3300025942 | Bacteria | 1442 |
| 508 | Ga0207689_10463474 | 3300025942 | Bacteria | 1060 |
| 509 | Ga0207689_11578299 | 3300025942 | Bacteria | 546 |
| 510 | Ga0207661_10022644 | 3300025944 | Bacteria | 4736 |
| 511 | Ga0207661_10026865 | 3300025944 | Bacteria | 4392 |
| 512 | Ga0207661_11125468 | 3300025944 | Bacteria | 723 |
| 513 | Ga0207679_10090984 | 3300025945 | Bacteria | 2360 |
| 514 | Ga0207679_10103210 | 3300025945 | Bacteria | 2234 |
| 515 | Ga0207679_10405640 | 3300025945 | Bacteria | 1200 |
| 516 | Ga0207679_11115295 | 3300025945 | Bacteria | 724 |
| 517 | Ga0207679_11474894 | 3300025945 | Bacteria | 624 |
| 518 | Ga0207679_12002488 | 3300025945 | Bacteria | 527 |
| 519 | Ga0207667_10020875 | 3300025949 | Bacteria | 7270 |
| 520 | Ga0207667_10585785 | 3300025949 | Bacteria | 1126 |
| 521 | Ga0207667_10683243 | 3300025949 | Bacteria | 1030 |
| 522 | Ga0207667_11137892 | 3300025949 | Bacteria | 762 |
| 523 | Ga0207651_10010197 | 3300025960 | Bacteria | 5194 |
| 524 | Ga0207651_10284399 | 3300025960 | Bacteria | 1368 |
| 525 | Ga0207651_10309098 | 3300025960 | Bacteria | 1317 |
| 526 | Ga0207712_10003827 | 3300025961 | Bacteria | 9501 |
| 527 | Ga0207712_10025416 | 3300025961 | Bacteria | 3934 |
| 528 | Ga0207668_10471115 | 3300025972 | Bacteria | 1075 |
| 529 | Ga0207640_10016926 | 3300025981 | Bacteria | 4253 |
| 530 | Ga0207640_10128100 | 3300025981 | Bacteria | 1830 |
| 531 | Ga0207640_10138354 | 3300025981 | Bacteria | 1771 |
| 532 | Ga0207658_10000756 | 3300025986 | Bacteria | 27753 |
| 533 | Ga0207658_11234071 | 3300025986 | Bacteria | 683 |
| 534 | Ga0207677_10050233 | 3300026023 | Bacteria | 2820 |
| 535 | Ga0207677_10095899 | 3300026023 | Bacteria | 2169 |
| 536 | Ga0207677_10396723 | 3300026023 | Bacteria | 1169 |
| 537 | Ga0207677_10747224 | 3300026023 | Bacteria | 872 |
| 538 | Ga0207677_11275884 | 3300026023 | Bacteria | 674 |
| 539 | Ga0207677_11680337 | 3300026023 | Bacteria | 588 |
| 540 | Ga0207703_10001349 | 3300026035 | Bacteria | 22464 |
| 541 | Ga0207639_10099819 | 3300026041 | Bacteria | 2343 |
| 542 | Ga0207639_10188721 | 3300026041 | Bacteria | 1759 |
| 543 | Ga0207639_10510642 | 3300026041 | Bacteria | 1099 |
| 544 | Ga0207639_11417227 | 3300026041 | Bacteria | 652 |
| 545 | Ga0207678_10008926 | 3300026067 | Bacteria | 8826 |
| 546 | Ga0207678_10036525 | 3300026067 | Bacteria | 4276 |
| 547 | Ga0207678_10060575 | 3300026067 | Bacteria | 3256 |
| 548 | Ga0207678_10177049 | 3300026067 | Bacteria | 1821 |
| 549 | Ga0207678_10855340 | 3300026067 | Bacteria | 804 |
| 550 | Ga0207708_10000535 | 3300026075 | Bacteria | 29316 |
| 551 | Ga0207708_10002372 | 3300026075 | Bacteria | 13837 |
| 552 | Ga0207708_10048764 | 3300026075 | Bacteria | 3224 |
| 553 | Ga0207708_11117869 | 3300026075 | Bacteria | 687 |
| 554 | Ga0207702_10106581 | 3300026078 | Bacteria | 2483 |
| 555 | Ga0207702_10214358 | 3300026078 | Bacteria | 1791 |
| 556 | Ga0207702_10984053 | 3300026078 | Bacteria | 837 |
| 557 | Ga0207641_10005453 | 3300026088 | Bacteria | 10853 |
| 558 | Ga0207641_10038539 | 3300026088 | Bacteria | 3996 |
| 559 | Ga0207641_10044388 | 3300026088 | Bacteria | 3738 |
| 560 | Ga0207641_10768558 | 3300026088 | Bacteria | 952 |
| 561 | Ga0207641_11035437 | 3300026088 | Bacteria | 818 |
| 562 | Ga0207641_11174425 | 3300026088 | Bacteria | 767 |
| 563 | Ga0207648_10000002 | 3300026089 | Bacteria | 307909 |
| 564 | Ga0207648_10002846 | 3300026089 | Bacteria | 18315 |
| 565 | Ga0207648_10114822 | 3300026089 | Bacteria | 2366 |
| 566 | Ga0207648_10444814 | 3300026089 | Bacteria | 1179 |
| 567 | Ga0207648_10922574 | 3300026089 | Bacteria | 816 |
| 568 | Ga0207676_10012389 | 3300026095 | Bacteria | 6109 |
| 569 | Ga0207676_10049440 | 3300026095 | Bacteria | 3271 |
| 570 | Ga0207676_10098325 | 3300026095 | Bacteria | 2419 |
| 571 | Ga0207676_10159205 | 3300026095 | Bacteria | 1954 |
| 572 | Ga0207676_10227823 | 3300026095 | Bacteria | 1664 |
| 573 | Ga0207676_10746411 | 3300026095 | Bacteria | 951 |
| 574 | Ga0207674_10000253 | 3300026116 | Bacteria | 66599 |
| 575 | Ga0207674_10001583 | 3300026116 | Bacteria | 29309 |
| 576 | Ga0207674_10021790 | 3300026116 | Bacteria | 6896 |
| 577 | Ga0207674_10290191 | 3300026116 | Bacteria | 1584 |
| 578 | Ga0207674_10810473 | 3300026116 | Bacteria | 903 |
| 579 | Ga0207674_11901184 | 3300026116 | Bacteria | 561 |
| 580 | Ga0207675_100003938 | 3300026118 | Bacteria | 14411 |
| 581 | Ga0207675_100274764 | 3300026118 | Bacteria | 1636 |
| 582 | Ga0207675_101367465 | 3300026118 | Bacteria | 729 |
| 583 | Ga0207675_101468824 | 3300026118 | Bacteria | 702 |
| 584 | Ga0207683_10035993 | 3300026121 | Bacteria | 4308 |
| 585 | Ga0207683_10038810 | 3300026121 | Bacteria | 4153 |
| 586 | Ga0207683_10058156 | 3300026121 | Bacteria | 3394 |
| 587 | Ga0207683_10116160 | 3300026121 | Bacteria | 2399 |
| 588 | Ga0207683_10341566 | 3300026121 | Bacteria | 1373 |
| 589 | Ga0207683_10344799 | 3300026121 | Bacteria | 1366 |
| 590 | Ga0207683_10662493 | 3300026121 | Bacteria | 967 |
| 591 | Ga0207683_11163580 | 3300026121 | Bacteria | 715 |
| 592 | Ga0207698_10005678 | 3300026142 | Bacteria | 7726 |
| 593 | Ga0207698_10025684 | 3300026142 | Bacteria | 4154 |
| 594 | Ga0207698_10198889 | 3300026142 | Bacteria | 1793 |
| 595 | Ga0207698_10199879 | 3300026142 | Bacteria | 1789 |
| 596 | Ga0207698_10433323 | 3300026142 | Bacteria | 1265 |
| 597 | Ga0207698_10566792 | 3300026142 | Bacteria | 1115 |
| 598 | Ga0207698_12742589 | 3300026142 | Bacteria | 501 |
| 599 | Ga0209389_1050565 | 3300027296 | Bacteria | 2885 |
| 600 | Ga0209588_1023442 | 3300027671 | Bacteria | 1945 |
| 601 | Ga0209974_10388078 | 3300027876 | Bacteria | 546 |
| 602 | Ga0268266_10076602 | 3300028379 | Bacteria | 2907 |
| 603 | Ga0268265_10003906 | 3300028380 | Bacteria | 10506 |
| 604 | Ga0268265_10080106 | 3300028380 | Bacteria | 2574 |
| 605 | Ga0268265_10091479 | 3300028380 | Bacteria | 2433 |
| 606 | Ga0268264_10011337 | 3300028381 | Bacteria | 7365 |
| 607 | Ga0268264_10062297 | 3300028381 | Bacteria | 3131 |
| 608 | Ga0268264_10186627 | 3300028381 | Bacteria | 1887 |
| 609 | Ga0268264_10974229 | 3300028381 | Bacteria | 854 |
| 610 | Ga0307517_10079232 | 3300028786 | Bacteria | 2829 |
| 611 | Ga0307513_10046140 | 3300031456 | Bacteria | 4756 |
| 612 | Ga0307513_10081906 | 3300031456 | Bacteria | 3324 |
| 613 | Ga0307408_101219277 | 3300031548 | Bacteria | 702 |
| 614 | Ga0307516_10022212 | 3300031730 | Bacteria | 6521 |
| 615 | Ga0307413_10181628 | 3300031824 | Bacteria | 1501 |
| 616 | Ga0307406_10828472 | 3300031901 | Bacteria | 783 |
| 617 | Ga0307412_10162517 | 3300031911 | Bacteria | 1661 |
| 618 | Ga0307412_11171562 | 3300031911 | Bacteria | 687 |
| 619 | Ga0307409_100797121 | 3300031995 | Bacteria | 952 |
| 620 | Ga0307409_102216864 | 3300031995 | Bacteria | 579 |
| 621 | Ga0307416_100020832 | 3300032002 | Bacteria | 4690 |
| 622 | Ga0307414_11159539 | 3300032004 | Bacteria | 715 |
| 623 | Ga0307414_11788897 | 3300032004 | Bacteria | 573 |
| 624 | Ga0307411_10444646 | 3300032005 | Bacteria | 1083 |
| 625 | Ga0316588_1036994 | 3300033528 | Bacteria | 1160 |
| 626 | Ga0373950_0085043 | 3300034818 | Bacteria | 665 |
| 627 | Ga0373958_0034446 | 3300034819 | Bacteria | 1009 |
| 628 | Ga0373926_0053209 | 3300035083 | Bacteria | 1465 |
| 629 | Ga0373946_0088150 | 3300035171 | Bacteria | 1371 |
| 630 | Ga0373962_0128201 | 3300035242 | Bacteria | 814 |
| 631 | Ga0373931_0180663 | 3300035691 | Bacteria | 1249 |
| 632 | Ga0373947_0082407 | 3300035725 | Bacteria | 1994 |
| 633 | Ga0373947_0449084 | 3300035725 | Bacteria | 873 |
| 634 | Ga0373937_1050653 | 3300036401 | Bacteria | 763 |
| 635 | Ga0316582_0702171 | 3300036647 | Bacteria | 695 |
| 636 | Ga0316584_0097316 | 3300036712 | Bacteria | 2203 |
| 637 | Ga0395899_0015319 | 3300037312 | Bacteria | 5843 |
| 638 | Ga0395900_0020353 | 3300037418 | Bacteria | 6773 |
| 639 | Ga0395900_0171446 | 3300037418 | Bacteria | 2209 |
| 640 | Ga0395905_0007590 | 3300037471 | Bacteria | 10771 |
| 641 | Ga0395905_0151634 | 3300037471 | Bacteria | 2181 |
| 642 | Ga0395905_0957003 | 3300037471 | Bacteria | 759 |
| 643 | Ga0395901_0000745 | 3300038443 | Bacteria | 36791 |
| 644 | Ga0395901_0459161 | 3300038443 | Bacteria | 1302 |
| 645 | Ga0400483_056891 | 3300039062 | Bacteria | 1596 |
| 646 | Ga0400483_177311 | 3300039062 | Bacteria | 1604 |
| 647 | Ga0436365_1821131 | 3300039437 | Bacteria | 705 |
| 648 | Ga0436360_0635123 | 3300039438 | Bacteria | 672 |
| 649 | Ga0436361_0527389 | 3300039447 | Bacteria | 1159 |
| 650 | Ga0436361_0649270 | 3300039447 | Bacteria | 2565 |
| 651 | Ga0436363_0466499 | 3300039450 | Bacteria | 2483 |
| 652 | Ga0436363_0909370 | 3300039450 | Unclassified | 831 |
| 653 | Ga0436362_0823712 | 3300039453 | Bacteria | 918 |
| 654 | Ga0451791_0050792 | 3300041451 | Bacteria | 874 |
| 655 | Ga0451800_0566674 | 3300041459 | Bacteria | 1238 |
| 656 | Ga0451807_0932619 | 3300041486 | Bacteria | 660 |
| 657 | Ga0451807_1757683 | 3300041486 | Bacteria | 2304 |
| 658 | Ga0451839_0365329 | 3300041496 | Bacteria | 503 |
| 659 | Ga0451853_0822117 | 3300041512 | Bacteria | 652 |
| 660 | Ga0451853_1186902 | 3300041512 | Bacteria | 679 |
| 661 | Ga0451853_1412040 | 3300041512 | Bacteria | 504 |
| 662 | Ga0451853_3287960 | 3300041512 | Bacteria | 1690 |
| 663 | Ga0439449_0260107 | 3300042007 | Bacteria | 653 |
| 664 | Ga0439451_004856 | 3300042009 | Bacteria | 2736 |
| 665 | Ga0439456_071035 | 3300042013 | Bacteria | 771 |
| 666 | Ga0450914_007071 | 3300042118 | Bacteria | 1004 |
| 667 | Ga0450890_000321 | 3300042127 | Bacteria | 6924 |
| 668 | Ga0450905_059105 | 3300042142 | Bacteria | 637 |
| 669 | Ga0439446_0021282 | 3300042156 | Bacteria | 1832 |
| 670 | Ga0453683_0085215 | 3300044673 | Bacteria | 1979 |
| 671 | Ga0451576_0265175 | 3300045051 | Bacteria | 1795 |
| 672 | Ga0495617_001549 | 3300046452 | Bacteria | 9959 |
| 673 | Ga0495627_002781 | 3300046453 | Bacteria | 8126 |
| 674 | Ga0495592_0270100 | 3300046454 | Bacteria | 1116 |
| 675 | Ga0495590_0001842 | 3300046457 | Bacteria | 8974 |
| 676 | Ga0495590_0003633 | 3300046457 | Bacteria | 6281 |
| 677 | Ga0495590_0198443 | 3300046457 | Bacteria | 737 |
| 678 | Ga0495651_0708151 | 3300046462 | Bacteria | 627 |
| 679 | Ga0495650_0005350 | 3300046471 | Bacteria | 8376 |
| 680 | Ga0495580_0167963 | 3300046472 | Bacteria | 1517 |
| 681 | Ga0495582_0042920 | 3300046473 | Bacteria | 2490 |
| 682 | Ga0495582_0433400 | 3300046473 | Bacteria | 759 |
| 683 | Ga0495605_0011633 | 3300046474 | Bacteria | 4898 |
| 684 | Ga0495639_0020584 | 3300046475 | Bacteria | 2883 |
| 685 | Ga0495662_0180209 | 3300046476 | Bacteria | 1041 |
| 686 | Ga0495664_0024325 | 3300046477 | Bacteria | 3519 |
| 687 | Ga0495584_0003708 | 3300046491 | Bacteria | 8327 |
| 688 | Ga0495584_0011932 | 3300046491 | Bacteria | 4442 |
| 689 | Ga0495585_0000756 | 3300046492 | Bacteria | 28639 |
| 690 | Ga0495607_0000637 | 3300046501 | Bacteria | 34042 |
| 691 | Ga0495607_0065857 | 3300046501 | Bacteria | 2041 |
| 692 | Ga0495606_0542355 | 3300046507 | Bacteria | 580 |
| 693 | Ga0495608_0401764 | 3300046511 | Bacteria | 838 |
| 694 | Ga0495610_0038712 | 3300046512 | Bacteria | 2418 |
| 695 | Ga0495616_0014077 | 3300046513 | Bacteria | 4490 |
| 696 | Ga0495616_0099451 | 3300046513 | Bacteria | 1366 |
| 697 | Ga0495616_0384892 | 3300046513 | Bacteria | 579 |
| 698 | Ga0495618_0230367 | 3300046514 | Bacteria | 1166 |
| 699 | Ga0495620_0106816 | 3300046515 | Bacteria | 1112 |
| 700 | Ga0495630_0035993 | 3300046517 | Bacteria | 3700 |
| 701 | Ga0495630_0336434 | 3300046517 | Bacteria | 1155 |
| 702 | Ga0495631_0394510 | 3300046518 | Bacteria | 589 |
| 703 | Ga0495632_0003848 | 3300046519 | Bacteria | 10444 |
| 704 | Ga0495632_0018955 | 3300046519 | Bacteria | 3757 |
| 705 | Ga0495637_0032976 | 3300046520 | Bacteria | 2277 |
| 706 | Ga0495643_0006334 | 3300046522 | Bacteria | 7817 |
| 707 | Ga0495643_0127363 | 3300046522 | Bacteria | 1281 |
| 708 | Ga0495648_0018965 | 3300046524 | Bacteria | 4852 |
| 709 | Ga0495648_0076588 | 3300046524 | Bacteria | 1920 |
| 710 | Ga0495666_0020379 | 3300046526 | Bacteria | 3286 |
| 711 | Ga0495642_0007901 | 3300046528 | Bacteria | 4074 |
| 712 | Ga0495652_0432079 | 3300046529 | Bacteria | 926 |
| 713 | Ga0495654_0091852 | 3300046530 | Bacteria | 1407 |
| 714 | Ga0495654_0215028 | 3300046530 | Bacteria | 816 |
| 715 | Ga0495665_0126767 | 3300046531 | Bacteria | 1337 |
| 716 | Ga0495640_0052592 | 3300046533 | Bacteria | 2796 |
| 717 | Ga0495586_0040693 | 3300046535 | Bacteria | 2501 |
| 718 | Ga0495609_0005475 | 3300046538 | Bacteria | 6655 |
| 719 | Ga0495621_0010202 | 3300046539 | Bacteria | 2868 |
| 720 | Ga0495621_0158520 | 3300046539 | Bacteria | 894 |
| 721 | Ga0495597_0004785 | 3300046542 | Bacteria | 7317 |
| 722 | Ga0495597_0077320 | 3300046542 | Bacteria | 1426 |
| 723 | Ga0495622_0048833 | 3300046557 | Bacteria | 1965 |
| 724 | Ga0495622_0332190 | 3300046557 | Bacteria | 659 |
| 725 | Ga0495667_0219633 | 3300046559 | Bacteria | 1213 |
| 726 | Ga0495656_0614227 | 3300046615 | Bacteria | 582 |
| 727 | Ga0495634_0008655 | 3300046642 | Bacteria | 7550 |
| 728 | Ga0495611_0003183 | 3300046648 | Bacteria | 7269 |
| 729 | Ga0495635_0616309 | 3300046663 | Bacteria | 708 |
| 730 | Ga0495659_0013203 | 3300046664 | Bacteria | 2687 |
| 731 | Ga0495647_0004407 | 3300046681 | Bacteria | 4575 |
| 732 | Ga0495647_0080337 | 3300046681 | Bacteria | 1321 |
| 733 | Ga0495658_0070648 | 3300046683 | Bacteria | 2026 |
| 734 | Ga0495658_0128881 | 3300046683 | Bacteria | 1538 |
| 735 | Ga0495669_0254979 | 3300046684 | Bacteria | 843 |
| 736 | Ga0495669_0433057 | 3300046684 | Bacteria | 638 |
| 737 | Ga0495613_0402479 | 3300046689 | Bacteria | 933 |
| 738 | Ga0495670_0122488 | 3300046691 | Bacteria | 1351 |
| 739 | Ga0495649_0000086 | 3300046694 | Bacteria | 80528 |
| 740 | Ga0495649_0090734 | 3300046694 | Bacteria | 1629 |
| 741 | Ga0495589_0000636 | 3300046794 | Bacteria | 23067 |
| 742 | Ga0495660_0103786 | 3300046810 | Bacteria | 1460 |
| 743 | Ga0495660_0193200 | 3300046810 | Bacteria | 977 |
| 744 | Ga0495660_0213571 | 3300046810 | Bacteria | 913 |
| 745 | Ga0495636_0001144 | 3300047318 | Bacteria | 10001 |
| 746 | Ga0495674_0037120 | 3300047319 | Bacteria | 4380 |
| 747 | Ga0495674_0309700 | 3300047319 | Bacteria | 1288 |
| 748 | Ga0495672_0001126 | 3300047320 | Bacteria | 27097 |
| 749 | Ga0495680_0188335 | 3300047322 | Bacteria | 1485 |
| 750 | Ga0495687_001073 | 3300047443 | Bacteria | 26922 |
| 751 | Ga0495687_008149 | 3300047443 | Bacteria | 6043 |
| 752 | Ga0495685_003266 | 3300047447 | Bacteria | 5165 |
| 753 | Ga0495673_0004100 | 3300047469 | Bacteria | 9247 |
| 754 | Ga0495681_0005449 | 3300047470 | Bacteria | 8510 |
| 755 | Ga0495681_0111388 | 3300047470 | Bacteria | 1185 |
| 756 | Ga0495684_0033903 | 3300047471 | Bacteria | 3917 |
| 757 | Ga0495686_0001282 | 3300047472 | Bacteria | 28414 |
| 758 | Ga0495686_0004782 | 3300047472 | Bacteria | 10943 |
| 759 | Ga0495686_0146610 | 3300047472 | Bacteria | 1389 |
| 760 | Ga0495615_0307616 | 3300048090 | Bacteria | 515 |
| 761 | Ga0495626_0000490 | 3300048091 | Bacteria | 39851 |
| 762 | Ga0496100_0599007 | 3300048903 | Bacteria | 856 |
| 763 | Ga0496101_0000946 | 3300048904 | Bacteria | 17119 |
| 764 | Ga0496101_0474741 | 3300048904 | Bacteria | 987 |
| 765 | Ga0496102_0006848 | 3300048905 | Bacteria | 9726 |
| 766 | Ga0496102_0010277 | 3300048905 | Bacteria | 8047 |
| 767 | Ga0496102_0014500 | 3300048905 | Bacteria | 6847 |
| 768 | Ga0496102_1073406 | 3300048905 | Bacteria | 725 |
| 769 | Ga0496103_0064719 | 3300048906 | Bacteria | 2280 |
| 770 | Ga0496103_0156155 | 3300048906 | Bacteria | 1462 |
| 771 | Ga0496103_0705608 | 3300048906 | Bacteria | 639 |
| 772 | Ga0496103_0851553 | 3300048906 | Bacteria | 573 |
| 773 | Ga0496104_0030456 | 3300048907 | Bacteria | 5014 |
| 774 | Ga0496104_0499328 | 3300048907 | Bacteria | 1128 |
| 775 | Ga0496104_1826275 | 3300048907 | Bacteria | 510 |
| 776 | Ga0496105_0772589 | 3300048908 | Bacteria | 732 |
| 777 | Ga0496105_0780349 | 3300048908 | Bacteria | 728 |
| 778 | Ga0496105_1096254 | 3300048908 | Bacteria | 591 |
| 779 | Ga0496105_1119061 | 3300048908 | Bacteria | 584 |
| 780 | Ga0496106_0001831 | 3300048909 | Bacteria | 15915 |
| 781 | Ga0496106_0012041 | 3300048909 | Bacteria | 6383 |
| 782 | Ga0496106_0035589 | 3300048909 | Bacteria | 3723 |
| 783 | Ga0496107_0012964 | 3300048910 | Bacteria | 5825 |
| 784 | Ga0496107_0133375 | 3300048910 | Bacteria | 1834 |
| 785 | Ga0496107_0203364 | 3300048910 | Bacteria | 1472 |
| 786 | Ga0496108_0035247 | 3300048911 | Bacteria | 4158 |
| 787 | Ga0496108_0048381 | 3300048911 | Bacteria | 3555 |
| 788 | Ga0496108_0922293 | 3300048911 | Bacteria | 749 |
| 789 | Ga0496108_1135288 | 3300048911 | Bacteria | 663 |
| 790 | Ga0496109_0007810 | 3300048912 | Bacteria | 9062 |
| 791 | Ga0496109_0035054 | 3300048912 | Bacteria | 4524 |
| 792 | Ga0496109_0572379 | 3300048912 | Bacteria | 1065 |
| 793 | Ga0496109_0771267 | 3300048912 | Bacteria | 900 |
| 794 | Ga0496110_0000678 | 3300048913 | Bacteria | 23383 |
| 795 | Ga0496110_0022804 | 3300048913 | Bacteria | 5319 |
| 796 | Ga0496110_0938165 | 3300048913 | Bacteria | 772 |
| 797 | Ga0496111_0008384 | 3300048914 | Bacteria | 6835 |
| 798 | Ga0496112_0515307 | 3300048915 | Bacteria | 1131 |
| 799 | Ga0496112_0636975 | 3300048915 | Bacteria | 996 |
| 800 | Ga0496112_1889146 | 3300048915 | Bacteria | 509 |
| 801 | Ga0496113_0140832 | 3300048916 | Bacteria | 1897 |
| 802 | Ga0496113_0417678 | 3300048916 | Bacteria | 1077 |
| 803 | Ga0496113_0497419 | 3300048916 | Bacteria | 979 |
| 804 | Ga0496114_0264875 | 3300048917 | Bacteria | 1514 |
| 805 | Ga0496114_0295237 | 3300048917 | Bacteria | 1430 |
| 806 | Ga0496114_0327111 | 3300048917 | Bacteria | 1355 |
| 807 | Ga0496115_0076791 | 3300048918 | Bacteria | 2715 |
| 808 | Ga0496115_0282032 | 3300048918 | Bacteria | 1364 |
| 809 | Ga0496115_0420867 | 3300048918 | Bacteria | 1082 |
| 810 | Ga0496118_0121214 | 3300048921 | Bacteria | 1704 |
| 811 | Ga0496124_0017518 | 3300048927 | Bacteria | 6747 |
| 812 | Ga0495678_000437 | 3300049459 | Bacteria | 41568 |
| 813 | Ga0495682_0154673 | 3300049460 | Bacteria | 817 |
| 814 | Ga0501292_029095 | 3300049515 | Bacteria | 923 |
| 815 | Ga0501294_028909 | 3300049517 | Bacteria | 637 |
| 816 | Ga0501031_0029337 | 3300049568 | Bacteria | 3589 |
| 817 | Ga0501031_0508335 | 3300049568 | Bacteria | 777 |
| 818 | Ga0501036_0085824 | 3300049572 | Bacteria | 2661 |
| 819 | Ga0501036_0154343 | 3300049572 | Bacteria | 1937 |
| 820 | Ga0501039_0030524 | 3300049575 | Bacteria | 4156 |
| 821 | Ga0501039_0571487 | 3300049575 | Bacteria | 887 |
| 822 | Ga0501039_1550066 | 3300049575 | Bacteria | 509 |
| 823 | Ga0501040_0010704 | 3300049576 | Bacteria | 5998 |
| 824 | Ga0501041_0045372 | 3300049577 | Bacteria | 2672 |
| 825 | Ga0501041_0225490 | 3300049577 | Bacteria | 1176 |
| 826 | Ga0501041_0253599 | 3300049577 | Bacteria | 1106 |
| 827 | Ga0501042_0018382 | 3300049578 | Bacteria | 4838 |
| 828 | Ga0501042_0025696 | 3300049578 | Bacteria | 4138 |
| 829 | Ga0501042_0042095 | 3300049578 | Bacteria | 3250 |
| 830 | Ga0501042_0223767 | 3300049578 | Bacteria | 1357 |
| 831 | Ga0501042_0449052 | 3300049578 | Bacteria | 935 |
| 832 | Ga0501046_0611471 | 3300049580 | Bacteria | 773 |
| 833 | Ga0501048_0311269 | 3300049582 | Bacteria | 1121 |
| 834 | Ga0501048_0444874 | 3300049582 | Unclassified | 928 |
| 835 | Ga0501048_0537350 | 3300049582 | Bacteria | 839 |
| 836 | Ga0501070_0752296 | 3300049586 | Bacteria | 768 |
| 837 | Ga0501071_0017977 | 3300049587 | Bacteria | 4889 |
| 838 | Ga0501071_0137500 | 3300049587 | Bacteria | 1818 |
| 839 | Ga0501071_0328426 | 3300049587 | Bacteria | 1162 |
| 840 | Ga0501071_1238479 | 3300049587 | Bacteria | 577 |
| 841 | Ga0501072_0012333 | 3300049588 | Bacteria | 6531 |
| 842 | Ga0501073_0017452 | 3300049589 | Bacteria | 5199 |
| 843 | Ga0501073_0608109 | 3300049589 | Bacteria | 755 |
| 844 | Ga0501074_0047129 | 3300049590 | Bacteria | 3116 |
| 845 | Ga0501074_1034318 | 3300049590 | Bacteria | 577 |
| 846 | Ga0501075_0253685 | 3300049591 | Bacteria | 1341 |
| 847 | Ga0501075_0858496 | 3300049591 | Bacteria | 690 |
| 848 | Ga0501075_0901114 | 3300049591 | Bacteria | 672 |
| 849 | Ga0501076_0978515 | 3300049592 | Bacteria | 697 |
| 850 | Ga0501077_0271443 | 3300049593 | Bacteria | 1079 |
| 851 | Ga0501077_0555969 | 3300049593 | Bacteria | 736 |
| 852 | Ga0501206_000997 | 3300049653 | Bacteria | 3528 |
| 853 | Ga0501222_008276 | 3300049662 | Bacteria | 1381 |
| 854 | Ga0501257_012817 | 3300049686 | Bacteria | 1920 |
| 855 | Ga0501261_052684 | 3300049690 | Bacteria | 671 |
| 856 | Ga0501079_0002078 | 3300049741 | Bacteria | 14359 |
| 857 | Ga0501081_0095927 | 3300049743 | Bacteria | 2091 |
| 858 | Ga0501081_0132526 | 3300049743 | Unclassified | 1781 |
| 859 | Ga0501081_0756490 | 3300049743 | Bacteria | 730 |
| 860 | Ga0501083_0944779 | 3300049744 | Unclassified | 561 |
| 861 | Ga0501265_010796 | 3300049762 | Bacteria | 1120 |
| 862 | Ga0501035_0060070 | 3300049822 | Bacteria | 3385 |
| 863 | Ga0501035_0391070 | 3300049822 | Bacteria | 1158 |
| 864 | Ga0501035_0519952 | 3300049822 | Bacteria | 978 |
| 865 | Ga0501045_0026520 | 3300049824 | Bacteria | 4169 |
| 866 | Ga0501045_0104928 | 3300049824 | Bacteria | 2094 |
| 867 | Ga0501045_0153003 | 3300049824 | Bacteria | 1716 |
| 868 | Ga0501045_1419392 | 3300049824 | Bacteria | 504 |
| 869 | nmdc:mga00v17_33166_c1 | 3300050491 | Bacteria | 3058 |
| 870 | nmdc:mga0yw44_106134_c2 | 3300050492 | Bacteria | 1489 |
| 871 | nmdc:mga0k408_444313_c1 | 3300050493 | Bacteria | 770 |
| 872 | nmdc:mga06z11_476289_c1 | 3300050494 | Bacteria | 755 |
| 873 | nmdc:mga07m45_14752_c1 | 3300050496 | Bacteria | 4170 |
| 874 | nmdc:mga05p37_571537_c1 | 3300050507 | Bacteria | 1282 |
| 875 | nmdc:mga05p37_825488_c1 | 3300050507 | Bacteria | 1010 |
| 876 | nmdc:mga09592_63812_c1 | 3300050508 | Unclassified | 3118 |
| 877 | nmdc:mga0qj67_15978_c1 | 3300050509 | Bacteria | 5683 |
| 878 | nmdc:mga0qj67_399888_c1 | 3300050509 | Bacteria | 1108 |
| 879 | nmdc:mga0qj67_654148_c1 | 3300050509 | Bacteria | 838 |
| 880 | nmdc:mga06r32_1160145_c1 | 3300050510 | Bacteria | 720 |
| 881 | nmdc:mga06r32_135379_c1 | 3300050510 | Bacteria | 2438 |
| 882 | nmdc:mga08y16_1215365_c1 | 3300050511 | Bacteria | 724 |
| 883 | nmdc:mga08y16_128079_c1 | 3300050511 | Bacteria | 2640 |
| 884 | nmdc:mga08y16_548632_c1 | 3300050511 | Bacteria | 1170 |
| 885 | nmdc:mga08y16_610785_c1 | 3300050511 | Bacteria | 1098 |
| 886 | nmdc:mga08y16_648543_c1 | 3300050511 | Bacteria | 1060 |
| 887 | nmdc:mga0n895_460071_c1 | 3300050512 | Unclassified | 1284 |
| 888 | nmdc:mga0rr50_196583_c1 | 3300050513 | Bacteria | 1655 |
| 889 | nmdc:mga08x19_256803_c1 | 3300050514 | Bacteria | 1207 |
| 890 | nmdc:mga08x19_62273_c1 | 3300050514 | Bacteria | 2419 |
| 891 | nmdc:mga0a205_44007_c1 | 3300050515 | Bacteria | 4303 |
| 892 | Ga0495601_0505052 | 3300053077 | Unclassified | 780 |
| 893 | Ga0495655_0052590 | 3300053083 | Bacteria | 1084 |
| 894 | Ga0495655_0084467 | 3300053083 | Bacteria | 914 |
| 895 | Ga0495655_0357290 | 3300053083 | Bacteria | 512 |
| 896 | Ga0500578_0043866 | 3300053086 | Bacteria | 2871 |
| 897 | Ga0500583_0305445 | 3300053092 | Bacteria | 778 |
| 898 | Ga0500641_0398486 | 3300053096 | Bacteria | 542 |
| 899 | Ga0500568_0182939 | 3300053139 | Bacteria | 770 |
| 900 | Ga0500645_007433 | 3300053730 | Bacteria | 3813 |
| 901 | Ga0501084_0020668 | 3300054114 | Bacteria | 5491 |
| 902 | Ga0501084_0206361 | 3300054114 | Bacteria | 1658 |
| 903 | Ga0501084_0314841 | 3300054114 | Bacteria | 1322 |
| 904 | Ga0501084_0339597 | 3300054114 | Bacteria | 1269 |
| 905 | Ga0501084_1329676 | 3300054114 | Bacteria | 602 |
| 906 | Ga0590075_079124 | 3300059424 | Bacteria | 851 |
| 907 | Ga0501082_0024896 | 3300060353 | Bacteria | 5157 |
| 908 | Ga0501082_0219027 | 3300060353 | Bacteria | 1656 |
| 909 | Ga0501082_1146821 | 3300060353 | Bacteria | 679 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005549 | Ga0070704_100962614 | Ga0070704_1009626142 | 104 |
| 2 | 3300048906 | Ga0496103_0705608 | Ga0496103_0705608_285_614 | 105 |
| 3 | 3300025918 | Ga0207662_10249948 | Ga0207662_102499482 | 106 |
| 4 | 3300005335 | Ga0070666_10173409 | Ga0070666_101734092 | 115 |
| 5 | 3300005339 | Ga0070660_100784375 | Ga0070660_1007843751 | 115 |
| 6 | 3300005340 | Ga0070689_100351680 | Ga0070689_1003516802 | 115 |
| 7 | 3300005347 | Ga0070668_100208445 | Ga0070668_1002084451 | 115 |
| 8 | 3300005353 | Ga0070669_100826069 | Ga0070669_1008260692 | 115 |
| 9 | 3300005355 | Ga0070671_100118942 | Ga0070671_1001189423 | 115 |
| 10 | 3300005364 | Ga0070673_100060051 | Ga0070673_1000600514 | 115 |
| 11 | 3300005366 | Ga0070659_100074878 | Ga0070659_1000748783 | 115 |
| 12 | 3300005367 | Ga0070667_101659284 | Ga0070667_1016592841 | 115 |
| 13 | 3300005543 | Ga0070672_100031238 | Ga0070672_1000312383 | 115 |
| 14 | 3300005616 | Ga0068852_100629953 | Ga0068852_1006299532 | 115 |
| 15 | 3300005617 | Ga0068859_100601278 | Ga0068859_1006012782 | 115 |
| 16 | 3300005618 | Ga0068864_101327893 | Ga0068864_1013278932 | 115 |
| 17 | 3300005844 | Ga0068862_101494533 | Ga0068862_1014945332 | 115 |
| 18 | 3300006353 | Ga0075370_10690263 | Ga0075370_106902631 | 115 |
| 19 | 3300006358 | Ga0068871_100895337 | Ga0068871_1008953372 | 115 |
| 20 | 3300006931 | Ga0097620_100601327 | Ga0097620_1006013272 | 115 |
| 21 | 3300009098 | Ga0105245_13173533 | Ga0105245_131735331 | 115 |
| 22 | 3300009177 | Ga0105248_10003918 | Ga0105248_100039185 | 115 |
| 23 | 3300013102 | Ga0157371_10555853 | Ga0157371_105558531 | 115 |
| 24 | 3300013296 | Ga0157374_11559734 | Ga0157374_115597341 | 115 |
| 25 | 3300013297 | Ga0157378_11090793 | Ga0157378_110907931 | 115 |
| 26 | 3300013308 | Ga0157375_10075657 | Ga0157375_100756574 | 115 |
| 27 | 3300014745 | Ga0157377_10695959 | Ga0157377_106959592 | 115 |
| 28 | 3300014968 | Ga0157379_10722309 | Ga0157379_107223092 | 115 |
| 29 | 3300025937 | Ga0207669_11364316 | Ga0207669_113643162 | 115 |
| 30 | 3300048911 | Ga0496108_0922293 | Ga0496108_0922293_214_567 | 115 |
| 31 | 3300003659 | JGI25404J52841_10004899 | JGI25404J52841_100048994 | 116 |
| 32 | 3300005340 | Ga0070689_100536919 | Ga0070689_1005369192 | 116 |
| 33 | 3300005347 | Ga0070668_100826296 | Ga0070668_1008262962 | 116 |
| 34 | 3300005356 | Ga0070674_100083924 | Ga0070674_1000839243 | 116 |
| 35 | 3300005365 | Ga0070688_101614248 | Ga0070688_1016142481 | 116 |
| 36 | 3300005367 | Ga0070667_101046320 | Ga0070667_1010463201 | 116 |
| 37 | 3300005438 | Ga0070701_10120417 | Ga0070701_101204171 | 116 |
| 38 | 3300005441 | Ga0070700_100200600 | Ga0070700_1002006002 | 116 |
| 39 | 3300005441 | Ga0070700_100807362 | Ga0070700_1008073621 | 116 |
| 40 | 3300005444 | Ga0070694_100013925 | Ga0070694_1000139253 | 116 |
| 41 | 3300005535 | Ga0070684_100278259 | Ga0070684_1002782592 | 116 |
| 42 | 3300005539 | Ga0068853_100643106 | Ga0068853_1006431062 | 116 |
| 43 | 3300005545 | Ga0070695_100171483 | Ga0070695_1001714832 | 116 |
| 44 | 3300005546 | Ga0070696_100111458 | Ga0070696_1001114582 | 116 |
| 45 | 3300005549 | Ga0070704_100022238 | Ga0070704_1000222383 | 116 |
| 46 | 3300005563 | Ga0068855_100480758 | Ga0068855_1004807583 | 116 |
| 47 | 3300005615 | Ga0070702_100193403 | Ga0070702_1001934032 | 116 |
| 48 | 3300005617 | Ga0068859_100215382 | Ga0068859_1002153822 | 116 |
| 49 | 3300005719 | Ga0068861_100042324 | Ga0068861_1000423243 | 116 |
| 50 | 3300005842 | Ga0068858_100287055 | Ga0068858_1002870552 | 116 |
| 51 | 3300005843 | Ga0068860_100235990 | Ga0068860_1002359902 | 116 |
| 52 | 3300005844 | Ga0068862_100540129 | Ga0068862_1005401292 | 116 |
| 53 | 3300005983 | Ga0081540_1000313 | Ga0081540_100031342 | 116 |
| 54 | 3300006844 | Ga0075428_101189089 | Ga0075428_1011890891 | 116 |
| 55 | 3300006846 | Ga0075430_100022398 | Ga0075430_1000223989 | 116 |
| 56 | 3300006846 | Ga0075430_101310527 | Ga0075430_1013105272 | 116 |
| 57 | 3300006847 | Ga0075431_101212945 | Ga0075431_1012129451 | 116 |
| 58 | 3300006880 | Ga0075429_100030827 | Ga0075429_1000308274 | 116 |
| 59 | 3300006881 | Ga0068865_101355195 | Ga0068865_1013551952 | 116 |
| 60 | 3300006931 | Ga0097620_100215390 | Ga0097620_1002153902 | 116 |
| 61 | 3300009094 | Ga0111539_10283840 | Ga0111539_102838402 | 116 |
| 62 | 3300009101 | Ga0105247_10010942 | Ga0105247_100109424 | 116 |
| 63 | 3300009147 | Ga0114129_10806966 | Ga0114129_108069661 | 116 |
| 64 | 3300009148 | Ga0105243_10125137 | Ga0105243_101251372 | 116 |
| 65 | 3300009176 | Ga0105242_11537817 | Ga0105242_115378172 | 116 |
| 66 | 3300013100 | Ga0157373_10392804 | Ga0157373_103928042 | 116 |
| 67 | 3300013297 | Ga0157378_10074037 | Ga0157378_100740372 | 116 |
| 68 | 3300013307 | Ga0157372_10245002 | Ga0157372_102450022 | 116 |
| 69 | 3300014326 | Ga0157380_10173324 | Ga0157380_101733242 | 116 |
| 70 | 3300014968 | Ga0157379_10053364 | Ga0157379_100533642 | 116 |
| 71 | 3300017792 | Ga0163161_10326819 | Ga0163161_103268191 | 116 |
| 72 | 3300025900 | Ga0207710_10032132 | Ga0207710_100321321 | 116 |
| 73 | 3300025901 | Ga0207688_10639499 | Ga0207688_106394992 | 116 |
| 74 | 3300025932 | Ga0207690_10538650 | Ga0207690_105386502 | 116 |
| 75 | 3300025935 | Ga0207709_11456611 | Ga0207709_114566111 | 116 |
| 76 | 3300025936 | Ga0207670_10216643 | Ga0207670_102166432 | 116 |
| 77 | 3300025942 | Ga0207689_11578299 | Ga0207689_115782991 | 116 |
| 78 | 3300025949 | Ga0207667_11137892 | Ga0207667_111378922 | 116 |
| 79 | 3300026041 | Ga0207639_10188721 | Ga0207639_101887213 | 116 |
| 80 | 3300026075 | Ga0207708_10048764 | Ga0207708_100487642 | 116 |
| 81 | 3300026075 | Ga0207708_11117869 | Ga0207708_111178691 | 116 |
| 82 | 3300026088 | Ga0207641_11174425 | Ga0207641_111744252 | 116 |
| 83 | 3300026089 | Ga0207648_10444814 | Ga0207648_104448142 | 116 |
| 84 | 3300028380 | Ga0268265_10091479 | Ga0268265_100914792 | 116 |
| 85 | 3300028381 | Ga0268264_10062297 | Ga0268264_100622973 | 116 |
| 86 | 3300035242 | Ga0373962_0128201 | Ga0373962_0128201_155_511 | 116 |
| 87 | 3300035691 | Ga0373931_0180663 | Ga0373931_0180663_19_375 | 116 |
| 88 | 3300035725 | Ga0373947_0082407 | Ga0373947_0082407_168_518 | 116 |
| 89 | 3300036401 | Ga0373937_1050653 | Ga0373937_1050653_342_698 | 116 |
| 90 | 3300037471 | Ga0395905_0151634 | Ga0395905_0151634_158_520 | 116 |
| 91 | 3300042007 | Ga0439449_0260107 | Ga0439449_0260107_178_528 | 116 |
| 92 | 3300046454 | Ga0495592_0270100 | Ga0495592_0270100_469_825 | 116 |
| 93 | 3300046472 | Ga0495580_0167963 | Ga0495580_0167963_1014_1370 | 116 |
| 94 | 3300046473 | Ga0495582_0042920 | Ga0495582_0042920_756_1112 | 116 |
| 95 | 3300046475 | Ga0495639_0020584 | Ga0495639_0020584_2348_2704 | 116 |
| 96 | 3300046476 | Ga0495662_0180209 | Ga0495662_0180209_92_448 | 116 |
| 97 | 3300046477 | Ga0495664_0024325 | Ga0495664_0024325_931_1287 | 116 |
| 98 | 3300046511 | Ga0495608_0401764 | Ga0495608_0401764_19_375 | 116 |
| 99 | 3300046514 | Ga0495618_0230367 | Ga0495618_0230367_398_754 | 116 |
| 100 | 3300046517 | Ga0495630_0035993 | Ga0495630_0035993_3075_3431 | 116 |
| 101 | 3300046526 | Ga0495666_0020379 | Ga0495666_0020379_2442_2798 | 116 |
| 102 | 3300046529 | Ga0495652_0432079 | Ga0495652_0432079_491_847 | 116 |
| 103 | 3300046530 | Ga0495654_0215028 | Ga0495654_0215028_38_394 | 116 |
| 104 | 3300046531 | Ga0495665_0126767 | Ga0495665_0126767_54_410 | 116 |
| 105 | 3300046533 | Ga0495640_0052592 | Ga0495640_0052592_2168_2524 | 116 |
| 106 | 3300046535 | Ga0495586_0040693 | Ga0495586_0040693_1961_2317 | 116 |
| 107 | 3300046557 | Ga0495622_0332190 | Ga0495622_0332190_13_369 | 116 |
| 108 | 3300046559 | Ga0495667_0219633 | Ga0495667_0219633_300_656 | 116 |
| 109 | 3300046642 | Ga0495634_0008655 | Ga0495634_0008655_6854_7210 | 116 |
| 110 | 3300046663 | Ga0495635_0616309 | Ga0495635_0616309_40_396 | 116 |
| 111 | 3300046681 | Ga0495647_0004407 | Ga0495647_0004407_464_820 | 116 |
| 112 | 3300046684 | Ga0495669_0254979 | Ga0495669_0254979_455_811 | 116 |
| 113 | 3300046684 | Ga0495669_0433057 | Ga0495669_0433057_212_571 | 116 |
| 114 | 3300046689 | Ga0495613_0402479 | Ga0495613_0402479_89_445 | 116 |
| 115 | 3300047319 | Ga0495674_0309700 | Ga0495674_0309700_408_764 | 116 |
| 116 | 3300047322 | Ga0495680_0188335 | Ga0495680_0188335_318_674 | 116 |
| 117 | 3300047471 | Ga0495684_0033903 | Ga0495684_0033903_1338_1694 | 116 |
| 118 | 3300048905 | Ga0496102_0010277 | Ga0496102_0010277_5925_6281 | 116 |
| 119 | 3300048906 | Ga0496103_0064719 | Ga0496103_0064719_186_542 | 116 |
| 120 | 3300048909 | Ga0496106_0035589 | Ga0496106_0035589_3270_3626 | 116 |
| 121 | 3300048910 | Ga0496107_0203364 | Ga0496107_0203364_776_1132 | 116 |
| 122 | 3300048916 | Ga0496113_0497419 | Ga0496113_0497419_352_708 | 116 |
| 123 | 3300049575 | Ga0501039_0030524 | Ga0501039_0030524_3125_3481 | 116 |
| 124 | 3300049576 | Ga0501040_0010704 | Ga0501040_0010704_2006_2362 | 116 |
| 125 | 3300049577 | Ga0501041_0225490 | Ga0501041_0225490_363_719 | 116 |
| 126 | 3300049578 | Ga0501042_0025696 | Ga0501042_0025696_3441_3797 | 116 |
| 127 | 3300049578 | Ga0501042_0449052 | Ga0501042_0449052_415_774 | 116 |
| 128 | 3300049582 | Ga0501048_0444874 | Ga0501048_0444874_553_912 | 116 |
| 129 | 3300049587 | Ga0501071_0137500 | Ga0501071_0137500_1176_1532 | 116 |
| 130 | 3300049587 | Ga0501071_1238479 | Ga0501071_1238479_101_451 | 116 |
| 131 | 3300049589 | Ga0501073_0017452 | Ga0501073_0017452_933_1292 | 116 |
| 132 | 3300049590 | Ga0501074_1034318 | Ga0501074_1034318_92_448 | 116 |
| 133 | 3300049591 | Ga0501075_0901114 | Ga0501075_0901114_188_544 | 116 |
| 134 | 3300049593 | Ga0501077_0555969 | Ga0501077_0555969_119_475 | 116 |
| 135 | 3300049822 | Ga0501035_0519952 | Ga0501035_0519952_37_393 | 116 |
| 136 | 3300050507 | nmdc:mga05p37_825488_c1 | nmdc:mga05p37_825488_c1_540_896 | 116 |
| 137 | 3300050508 | nmdc:mga09592_63812_c1 | nmdc:mga09592_63812_c1_1386_1742 | 116 |
| 138 | 3300050509 | nmdc:mga0qj67_15978_c1 | nmdc:mga0qj67_15978_c1_206_562 | 116 |
| 139 | 3300050509 | nmdc:mga0qj67_654148_c1 | nmdc:mga0qj67_654148_c1_409_765 | 116 |
| 140 | 3300050510 | nmdc:mga06r32_1160145_c1 | nmdc:mga06r32_1160145_c1_160_516 | 116 |
| 141 | 3300050511 | nmdc:mga08y16_610785_c1 | nmdc:mga08y16_610785_c1_71_427 | 116 |
| 142 | 3300053083 | Ga0495655_0052590 | Ga0495655_0052590_255_611 | 116 |
| 143 | 3300053083 | Ga0495655_0357290 | Ga0495655_0357290_91_450 | 116 |
| 144 | 3300003323 | rootH1_10005342 | rootH1_1000534236 | 117 |
| 145 | 3300003775 | Ga0055524_1020622 | Ga0055524_10206224 | 117 |
| 146 | 3300003790 | Ga0055528_1087790 | Ga0055528_10877902 | 117 |
| 147 | 3300003794 | Ga0055531_10000103 | Ga0055531_1000010369 | 117 |
| 148 | 3300004799 | Ga0058863_10086596 | Ga0058863_100865962 | 117 |
| 149 | 3300004800 | Ga0058861_11284509 | Ga0058861_112845092 | 117 |
| 150 | 3300005293 | Ga0065715_10482623 | Ga0065715_104826231 | 117 |
| 151 | 3300005327 | Ga0070658_10043435 | Ga0070658_100434353 | 117 |
| 152 | 3300005327 | Ga0070658_10174780 | Ga0070658_101747801 | 117 |
| 153 | 3300005327 | Ga0070658_10205083 | Ga0070658_102050832 | 117 |
| 154 | 3300005327 | Ga0070658_10292900 | Ga0070658_102929001 | 117 |
| 155 | 3300005328 | Ga0070676_10009376 | Ga0070676_100093764 | 117 |
| 156 | 3300005328 | Ga0070676_10456367 | Ga0070676_104563672 | 117 |
| 157 | 3300005328 | Ga0070676_10825564 | Ga0070676_108255642 | 117 |
| 158 | 3300005329 | Ga0070683_100012982 | Ga0070683_1000129824 | 117 |
| 159 | 3300005329 | Ga0070683_100021348 | Ga0070683_1000213484 | 117 |
| 160 | 3300005329 | Ga0070683_100880544 | Ga0070683_1008805442 | 117 |
| 161 | 3300005330 | Ga0070690_100087471 | Ga0070690_1000874712 | 117 |
| 162 | 3300005330 | Ga0070690_100862382 | Ga0070690_1008623822 | 117 |
| 163 | 3300005330 | Ga0070690_101615912 | Ga0070690_1016159121 | 117 |
| 164 | 3300005331 | Ga0070670_100059712 | Ga0070670_1000597124 | 117 |
| 165 | 3300005331 | Ga0070670_100121184 | Ga0070670_1001211841 | 117 |
| 166 | 3300005331 | Ga0070670_100213671 | Ga0070670_1002136713 | 117 |
| 167 | 3300005331 | Ga0070670_102130967 | Ga0070670_1021309671 | 117 |
| 168 | 3300005333 | Ga0070677_10005628 | Ga0070677_100056285 | 117 |
| 169 | 3300005333 | Ga0070677_10410678 | Ga0070677_104106781 | 117 |
| 170 | 3300005333 | Ga0070677_10459765 | Ga0070677_104597652 | 117 |
| 171 | 3300005334 | Ga0068869_100003195 | Ga0068869_10000319510 | 117 |
| 172 | 3300005334 | Ga0068869_100198382 | Ga0068869_1001983821 | 117 |
| 173 | 3300005334 | Ga0068869_100521538 | Ga0068869_1005215382 | 117 |
| 174 | 3300005334 | Ga0068869_100719547 | Ga0068869_1007195472 | 117 |
| 175 | 3300005335 | Ga0070666_10918393 | Ga0070666_109183932 | 117 |
| 176 | 3300005336 | Ga0070680_100021694 | Ga0070680_1000216945 | 117 |
| 177 | 3300005337 | Ga0070682_100980473 | Ga0070682_1009804732 | 117 |
| 178 | 3300005338 | Ga0068868_100153655 | Ga0068868_1001536552 | 117 |
| 179 | 3300005338 | Ga0068868_100476738 | Ga0068868_1004767382 | 117 |
| 180 | 3300005338 | Ga0068868_100611568 | Ga0068868_1006115682 | 117 |
| 181 | 3300005339 | Ga0070660_100093354 | Ga0070660_1000933542 | 117 |
| 182 | 3300005339 | Ga0070660_100139499 | Ga0070660_1001394991 | 117 |
| 183 | 3300005339 | Ga0070660_100700288 | Ga0070660_1007002881 | 117 |
| 184 | 3300005341 | Ga0070691_10065775 | Ga0070691_100657752 | 117 |
| 185 | 3300005343 | Ga0070687_100045346 | Ga0070687_1000453461 | 117 |
| 186 | 3300005343 | Ga0070687_100246180 | Ga0070687_1002461801 | 117 |
| 187 | 3300005344 | Ga0070661_100117306 | Ga0070661_1001173062 | 117 |
| 188 | 3300005344 | Ga0070661_100815040 | Ga0070661_1008150402 | 117 |
| 189 | 3300005345 | Ga0070692_10013522 | Ga0070692_100135221 | 117 |
| 190 | 3300005345 | Ga0070692_10706976 | Ga0070692_107069761 | 117 |
| 191 | 3300005347 | Ga0070668_100000574 | Ga0070668_10000057411 | 117 |
| 192 | 3300005353 | Ga0070669_100000765 | Ga0070669_1000007658 | 117 |
| 193 | 3300005353 | Ga0070669_101643669 | Ga0070669_1016436691 | 117 |
| 194 | 3300005353 | Ga0070669_102031551 | Ga0070669_1020315511 | 117 |
| 195 | 3300005354 | Ga0070675_100049796 | Ga0070675_1000497964 | 117 |
| 196 | 3300005354 | Ga0070675_100098419 | Ga0070675_1000984192 | 117 |
| 197 | 3300005354 | Ga0070675_100246697 | Ga0070675_1002466973 | 117 |
| 198 | 3300005354 | Ga0070675_100517510 | Ga0070675_1005175102 | 117 |
| 199 | 3300005355 | Ga0070671_100015231 | Ga0070671_1000152314 | 117 |
| 200 | 3300005355 | Ga0070671_100223762 | Ga0070671_1002237623 | 117 |
| 201 | 3300005355 | Ga0070671_100241404 | Ga0070671_1002414041 | 117 |
| 202 | 3300005355 | Ga0070671_100471885 | Ga0070671_1004718852 | 117 |
| 203 | 3300005355 | Ga0070671_100874425 | Ga0070671_1008744252 | 117 |
| 204 | 3300005355 | Ga0070671_101319157 | Ga0070671_1013191571 | 117 |
| 205 | 3300005356 | Ga0070674_100011152 | Ga0070674_1000111522 | 117 |
| 206 | 3300005356 | Ga0070674_100169814 | Ga0070674_1001698142 | 117 |
| 207 | 3300005364 | Ga0070673_100157484 | Ga0070673_1001574842 | 117 |
| 208 | 3300005364 | Ga0070673_100180152 | Ga0070673_1001801523 | 117 |
| 209 | 3300005364 | Ga0070673_100189764 | Ga0070673_1001897643 | 117 |
| 210 | 3300005364 | Ga0070673_101271494 | Ga0070673_1012714941 | 117 |
| 211 | 3300005364 | Ga0070673_101742801 | Ga0070673_1017428011 | 117 |
| 212 | 3300005365 | Ga0070688_100603694 | Ga0070688_1006036942 | 117 |
| 213 | 3300005366 | Ga0070659_100112476 | Ga0070659_1001124762 | 117 |
| 214 | 3300005366 | Ga0070659_100175753 | Ga0070659_1001757531 | 117 |
| 215 | 3300005366 | Ga0070659_100238682 | Ga0070659_1002386821 | 117 |
| 216 | 3300005366 | Ga0070659_100835341 | Ga0070659_1008353412 | 117 |
| 217 | 3300005367 | Ga0070667_100007739 | Ga0070667_1000077395 | 117 |
| 218 | 3300005367 | Ga0070667_101136265 | Ga0070667_1011362652 | 117 |
| 219 | 3300005406 | Ga0070703_10004258 | Ga0070703_100042583 | 117 |
| 220 | 3300005434 | Ga0070709_11028668 | Ga0070709_110286681 | 117 |
| 221 | 3300005435 | Ga0070714_100135565 | Ga0070714_1001355651 | 117 |
| 222 | 3300005438 | Ga0070701_10084460 | Ga0070701_100844602 | 117 |
| 223 | 3300005439 | Ga0070711_100023103 | Ga0070711_1000231032 | 117 |
| 224 | 3300005440 | Ga0070705_100000751 | Ga0070705_10000075119 | 117 |
| 225 | 3300005441 | Ga0070700_100006109 | Ga0070700_1000061094 | 117 |
| 226 | 3300005441 | Ga0070700_100351093 | Ga0070700_1003510932 | 117 |
| 227 | 3300005444 | Ga0070694_100155756 | Ga0070694_1001557562 | 117 |
| 228 | 3300005455 | Ga0070663_100020235 | Ga0070663_1000202352 | 117 |
| 229 | 3300005455 | Ga0070663_100074650 | Ga0070663_1000746501 | 117 |
| 230 | 3300005455 | Ga0070663_100486712 | Ga0070663_1004867122 | 117 |
| 231 | 3300005456 | Ga0070678_100040070 | Ga0070678_1000400704 | 117 |
| 232 | 3300005456 | Ga0070678_100093070 | Ga0070678_1000930704 | 117 |
| 233 | 3300005456 | Ga0070678_100656049 | Ga0070678_1006560491 | 117 |
| 234 | 3300005456 | Ga0070678_101306888 | Ga0070678_1013068881 | 117 |
| 235 | 3300005457 | Ga0070662_100000783 | Ga0070662_10000078310 | 117 |
| 236 | 3300005457 | Ga0070662_100260601 | Ga0070662_1002606012 | 117 |
| 237 | 3300005457 | Ga0070662_100620843 | Ga0070662_1006208432 | 117 |
| 238 | 3300005458 | Ga0070681_10050025 | Ga0070681_100500252 | 117 |
| 239 | 3300005458 | Ga0070681_10823811 | Ga0070681_108238111 | 117 |
| 240 | 3300005458 | Ga0070681_10890925 | Ga0070681_108909251 | 117 |
| 241 | 3300005459 | Ga0068867_100000099 | Ga0068867_10000009956 | 117 |
| 242 | 3300005459 | Ga0068867_100005514 | Ga0068867_1000055148 | 117 |
| 243 | 3300005459 | Ga0068867_100088547 | Ga0068867_1000885474 | 117 |
| 244 | 3300005459 | Ga0068867_100110165 | Ga0068867_1001101652 | 117 |
| 245 | 3300005467 | Ga0070706_100224618 | Ga0070706_1002246183 | 117 |
| 246 | 3300005471 | Ga0070698_100005048 | Ga0070698_10000504817 | 117 |
| 247 | 3300005471 | Ga0070698_100569515 | Ga0070698_1005695152 | 117 |
| 248 | 3300005518 | Ga0070699_100005109 | Ga0070699_1000051098 | 117 |
| 249 | 3300005518 | Ga0070699_100005628 | Ga0070699_1000056282 | 117 |
| 250 | 3300005530 | Ga0070679_100063334 | Ga0070679_1000633342 | 117 |
| 251 | 3300005530 | Ga0070679_100333157 | Ga0070679_1003331571 | 117 |
| 252 | 3300005535 | Ga0070684_100015457 | Ga0070684_1000154574 | 117 |
| 253 | 3300005535 | Ga0070684_100327046 | Ga0070684_1003270461 | 117 |
| 254 | 3300005535 | Ga0070684_100375431 | Ga0070684_1003754312 | 117 |
| 255 | 3300005536 | Ga0070697_100307327 | Ga0070697_1003073272 | 117 |
| 256 | 3300005536 | Ga0070697_100781270 | Ga0070697_1007812701 | 117 |
| 257 | 3300005539 | Ga0068853_100433941 | Ga0068853_1004339412 | 117 |
| 258 | 3300005539 | Ga0068853_100518529 | Ga0068853_1005185292 | 117 |
| 259 | 3300005539 | Ga0068853_100874663 | Ga0068853_1008746631 | 117 |
| 260 | 3300005543 | Ga0070672_100005134 | Ga0070672_1000051348 | 117 |
| 261 | 3300005543 | Ga0070672_100102545 | Ga0070672_1001025452 | 117 |
| 262 | 3300005543 | Ga0070672_100134897 | Ga0070672_1001348973 | 117 |
| 263 | 3300005543 | Ga0070672_100476313 | Ga0070672_1004763132 | 117 |
| 264 | 3300005543 | Ga0070672_100496343 | Ga0070672_1004963432 | 117 |
| 265 | 3300005543 | Ga0070672_101853509 | Ga0070672_1018535091 | 117 |
| 266 | 3300005545 | Ga0070695_100000339 | Ga0070695_1000003392 | 117 |
| 267 | 3300005545 | Ga0070695_100475174 | Ga0070695_1004751743 | 117 |
| 268 | 3300005545 | Ga0070695_100752052 | Ga0070695_1007520522 | 117 |
| 269 | 3300005546 | Ga0070696_100001139 | Ga0070696_10000113918 | 117 |
| 270 | 3300005547 | Ga0070693_100062205 | Ga0070693_1000622052 | 117 |
| 271 | 3300005547 | Ga0070693_100596713 | Ga0070693_1005967132 | 117 |
| 272 | 3300005547 | Ga0070693_101185492 | Ga0070693_1011854921 | 117 |
| 273 | 3300005549 | Ga0070704_100188853 | Ga0070704_1001888532 | 117 |
| 274 | 3300005549 | Ga0070704_101076522 | Ga0070704_1010765222 | 117 |
| 275 | 3300005563 | Ga0068855_100189763 | Ga0068855_1001897632 | 117 |
| 276 | 3300005563 | Ga0068855_100603652 | Ga0068855_1006036522 | 117 |
| 277 | 3300005564 | Ga0070664_100015887 | Ga0070664_1000158873 | 117 |
| 278 | 3300005564 | Ga0070664_100040986 | Ga0070664_1000409863 | 117 |
| 279 | 3300005564 | Ga0070664_100084788 | Ga0070664_1000847884 | 117 |
| 280 | 3300005564 | Ga0070664_100315920 | Ga0070664_1003159202 | 117 |
| 281 | 3300005564 | Ga0070664_101190332 | Ga0070664_1011903322 | 117 |
| 282 | 3300005577 | Ga0068857_100174384 | Ga0068857_1001743842 | 117 |
| 283 | 3300005577 | Ga0068857_100194631 | Ga0068857_1001946313 | 117 |
| 284 | 3300005577 | Ga0068857_100247020 | Ga0068857_1002470202 | 117 |
| 285 | 3300005577 | Ga0068857_101361331 | Ga0068857_1013613312 | 117 |
| 286 | 3300005577 | Ga0068857_102162670 | Ga0068857_1021626701 | 117 |
| 287 | 3300005578 | Ga0068854_100010666 | Ga0068854_1000106666 | 117 |
| 288 | 3300005578 | Ga0068854_100052948 | Ga0068854_1000529483 | 117 |
| 289 | 3300005578 | Ga0068854_100408141 | Ga0068854_1004081412 | 117 |
| 290 | 3300005578 | Ga0068854_100612802 | Ga0068854_1006128022 | 117 |
| 291 | 3300005578 | Ga0068854_102067238 | Ga0068854_1020672381 | 117 |
| 292 | 3300005614 | Ga0068856_100111519 | Ga0068856_1001115193 | 117 |
| 293 | 3300005614 | Ga0068856_100200622 | Ga0068856_1002006221 | 117 |
| 294 | 3300005614 | Ga0068856_101107860 | Ga0068856_1011078602 | 117 |
| 295 | 3300005614 | Ga0068856_101380321 | Ga0068856_1013803212 | 117 |
| 296 | 3300005615 | Ga0070702_100448188 | Ga0070702_1004481881 | 117 |
| 297 | 3300005616 | Ga0068852_100008232 | Ga0068852_1000082325 | 117 |
| 298 | 3300005616 | Ga0068852_100055860 | Ga0068852_1000558602 | 117 |
| 299 | 3300005616 | Ga0068852_100128386 | Ga0068852_1001283863 | 117 |
| 300 | 3300005616 | Ga0068852_100177778 | Ga0068852_1001777783 | 117 |
| 301 | 3300005616 | Ga0068852_100289206 | Ga0068852_1002892063 | 117 |
| 302 | 3300005616 | Ga0068852_100754458 | Ga0068852_1007544582 | 117 |
| 303 | 3300005617 | Ga0068859_100004644 | Ga0068859_10000464416 | 117 |
| 304 | 3300005617 | Ga0068859_100104541 | Ga0068859_1001045414 | 117 |
| 305 | 3300005617 | Ga0068859_102724987 | Ga0068859_1027249872 | 117 |
| 306 | 3300005618 | Ga0068864_100019366 | Ga0068864_1000193665 | 117 |
| 307 | 3300005618 | Ga0068864_100154035 | Ga0068864_1001540353 | 117 |
| 308 | 3300005618 | Ga0068864_100172017 | Ga0068864_1001720173 | 117 |
| 309 | 3300005618 | Ga0068864_100272205 | Ga0068864_1002722052 | 117 |
| 310 | 3300005618 | Ga0068864_101506775 | Ga0068864_1015067752 | 117 |
| 311 | 3300005718 | Ga0068866_10002119 | Ga0068866_100021198 | 117 |
| 312 | 3300005718 | Ga0068866_10411884 | Ga0068866_104118842 | 117 |
| 313 | 3300005719 | Ga0068861_100004658 | Ga0068861_1000046589 | 117 |
| 314 | 3300005719 | Ga0068861_100226822 | Ga0068861_1002268223 | 117 |
| 315 | 3300005719 | Ga0068861_100314513 | Ga0068861_1003145132 | 117 |
| 316 | 3300005834 | Ga0068851_10000574 | Ga0068851_1000057411 | 117 |
| 317 | 3300005834 | Ga0068851_10015869 | Ga0068851_100158692 | 117 |
| 318 | 3300005834 | Ga0068851_10204423 | Ga0068851_102044232 | 117 |
| 319 | 3300005834 | Ga0068851_10734627 | Ga0068851_107346272 | 117 |
| 320 | 3300005840 | Ga0068870_10287766 | Ga0068870_102877662 | 117 |
| 321 | 3300005840 | Ga0068870_11290453 | Ga0068870_112904532 | 117 |
| 322 | 3300005841 | Ga0068863_100001215 | Ga0068863_1000012155 | 117 |
| 323 | 3300005841 | Ga0068863_100027689 | Ga0068863_1000276895 | 117 |
| 324 | 3300005841 | Ga0068863_100326179 | Ga0068863_1003261792 | 117 |
| 325 | 3300005841 | Ga0068863_100486991 | Ga0068863_1004869912 | 117 |
| 326 | 3300005841 | Ga0068863_101513562 | Ga0068863_1015135621 | 117 |
| 327 | 3300005842 | Ga0068858_100011059 | Ga0068858_1000110593 | 117 |
| 328 | 3300005842 | Ga0068858_101874273 | Ga0068858_1018742731 | 117 |
| 329 | 3300005843 | Ga0068860_100009850 | Ga0068860_1000098504 | 117 |
| 330 | 3300005843 | Ga0068860_100010922 | Ga0068860_10001092210 | 117 |
| 331 | 3300005844 | Ga0068862_100005698 | Ga0068862_1000056983 | 117 |
| 332 | 3300005844 | Ga0068862_100020474 | Ga0068862_1000204743 | 117 |
| 333 | 3300005937 | Ga0081455_10000197 | Ga0081455_100001973 | 117 |
| 334 | 3300005937 | Ga0081455_10007547 | Ga0081455_1000754712 | 117 |
| 335 | 3300005937 | Ga0081455_10078898 | Ga0081455_100788985 | 117 |
| 336 | 3300005981 | Ga0081538_10001078 | Ga0081538_1000107830 | 117 |
| 337 | 3300005981 | Ga0081538_10033454 | Ga0081538_100334547 | 117 |
| 338 | 3300006028 | Ga0070717_10182325 | Ga0070717_101823253 | 117 |
| 339 | 3300006028 | Ga0070717_10549333 | Ga0070717_105493332 | 117 |
| 340 | 3300006038 | Ga0075365_10002797 | Ga0075365_100027976 | 117 |
| 341 | 3300006038 | Ga0075365_10964002 | Ga0075365_109640022 | 117 |
| 342 | 3300006051 | Ga0075364_10063243 | Ga0075364_100632432 | 117 |
| 343 | 3300006051 | Ga0075364_10353985 | Ga0075364_103539851 | 117 |
| 344 | 3300006163 | Ga0070715_10162126 | Ga0070715_101621262 | 117 |
| 345 | 3300006173 | Ga0070716_100130447 | Ga0070716_1001304472 | 117 |
| 346 | 3300006173 | Ga0070716_100306351 | Ga0070716_1003063512 | 117 |
| 347 | 3300006175 | Ga0070712_100646210 | Ga0070712_1006462102 | 117 |
| 348 | 3300006175 | Ga0070712_100833112 | Ga0070712_1008331121 | 117 |
| 349 | 3300006177 | Ga0075362_10120662 | Ga0075362_101206622 | 117 |
| 350 | 3300006177 | Ga0075362_10509580 | Ga0075362_105095801 | 117 |
| 351 | 3300006237 | Ga0097621_100026893 | Ga0097621_1000268932 | 117 |
| 352 | 3300006237 | Ga0097621_100566179 | Ga0097621_1005661792 | 117 |
| 353 | 3300006237 | Ga0097621_102080938 | Ga0097621_1020809382 | 117 |
| 354 | 3300006358 | Ga0068871_100405026 | Ga0068871_1004050262 | 117 |
| 355 | 3300006358 | Ga0068871_100932954 | Ga0068871_1009329542 | 117 |
| 356 | 3300006844 | Ga0075428_102004390 | Ga0075428_1020043901 | 117 |
| 357 | 3300006847 | Ga0075431_100061319 | Ga0075431_1000613194 | 117 |
| 358 | 3300006847 | Ga0075431_100446269 | Ga0075431_1004462692 | 117 |
| 359 | 3300006847 | Ga0075431_100981751 | Ga0075431_1009817511 | 117 |
| 360 | 3300006852 | Ga0075433_10356745 | Ga0075433_103567452 | 117 |
| 361 | 3300006852 | Ga0075433_10569419 | Ga0075433_105694192 | 117 |
| 362 | 3300006871 | Ga0075434_100254525 | Ga0075434_1002545252 | 117 |
| 363 | 3300006871 | Ga0075434_100753133 | Ga0075434_1007531332 | 117 |
| 364 | 3300006881 | Ga0068865_100003044 | Ga0068865_1000030448 | 117 |
| 365 | 3300006881 | Ga0068865_100048823 | Ga0068865_1000488235 | 117 |
| 366 | 3300006881 | Ga0068865_100609308 | Ga0068865_1006093083 | 117 |
| 367 | 3300006914 | Ga0075436_100004893 | Ga0075436_1000048939 | 117 |
| 368 | 3300006914 | Ga0075436_100412316 | Ga0075436_1004123162 | 117 |
| 369 | 3300006931 | Ga0097620_100004644 | Ga0097620_1000046441 | 117 |
| 370 | 3300006931 | Ga0097620_100104540 | Ga0097620_1001045404 | 117 |
| 371 | 3300006931 | Ga0097620_102724732 | Ga0097620_1027247322 | 117 |
| 372 | 3300006942 | Ga0099824_1036269 | Ga0099824_10362693 | 117 |
| 373 | 3300006944 | Ga0099823_1000255 | Ga0099823_10002554 | 117 |
| 374 | 3300007076 | Ga0075435_100112426 | Ga0075435_1001124262 | 117 |
| 375 | 3300007076 | Ga0075435_101308535 | Ga0075435_1013085352 | 117 |
| 376 | 3300007265 | Ga0099794_10305066 | Ga0099794_103050662 | 117 |
| 377 | 3300009094 | Ga0111539_10056078 | Ga0111539_100560785 | 117 |
| 378 | 3300009094 | Ga0111539_10589999 | Ga0111539_105899993 | 117 |
| 379 | 3300009094 | Ga0111539_10709606 | Ga0111539_107096061 | 117 |
| 380 | 3300009098 | Ga0105245_10577542 | Ga0105245_105775422 | 117 |
| 381 | 3300009098 | Ga0105245_10721349 | Ga0105245_107213492 | 117 |
| 382 | 3300009101 | Ga0105247_10507750 | Ga0105247_105077502 | 117 |
| 383 | 3300009148 | Ga0105243_10001373 | Ga0105243_100013736 | 117 |
| 384 | 3300009148 | Ga0105243_10015973 | Ga0105243_100159735 | 117 |
| 385 | 3300009148 | Ga0105243_10148299 | Ga0105243_101482992 | 117 |
| 386 | 3300009148 | Ga0105243_10557522 | Ga0105243_105575221 | 117 |
| 387 | 3300009148 | Ga0105243_10874423 | Ga0105243_108744232 | 117 |
| 388 | 3300009174 | Ga0105241_10024674 | Ga0105241_100246743 | 117 |
| 389 | 3300009174 | Ga0105241_10067029 | Ga0105241_100670292 | 117 |
| 390 | 3300009176 | Ga0105242_10034546 | Ga0105242_100345462 | 117 |
| 391 | 3300009176 | Ga0105242_11120377 | Ga0105242_111203772 | 117 |
| 392 | 3300009177 | Ga0105248_10354820 | Ga0105248_103548202 | 117 |
| 393 | 3300009177 | Ga0105248_10391094 | Ga0105248_103910942 | 117 |
| 394 | 3300009177 | Ga0105248_11401112 | Ga0105248_114011122 | 117 |
| 395 | 3300009177 | Ga0105248_11583334 | Ga0105248_115833342 | 117 |
| 396 | 3300009545 | Ga0105237_10199124 | Ga0105237_101991242 | 117 |
| 397 | 3300009545 | Ga0105237_10734600 | Ga0105237_107346002 | 117 |
| 398 | 3300009545 | Ga0105237_11124416 | Ga0105237_111244161 | 117 |
| 399 | 3300009551 | Ga0105238_10446131 | Ga0105238_104461312 | 117 |
| 400 | 3300009551 | Ga0105238_12309967 | Ga0105238_123099672 | 117 |
| 401 | 3300009551 | Ga0105238_12733437 | Ga0105238_127334371 | 117 |
| 402 | 3300009553 | Ga0105249_10013028 | Ga0105249_100130284 | 117 |
| 403 | 3300009553 | Ga0105249_11482395 | Ga0105249_114823952 | 117 |
| 404 | 3300010159 | Ga0099796_10246118 | Ga0099796_102461181 | 117 |
| 405 | 3300010375 | Ga0105239_10255886 | Ga0105239_102558863 | 117 |
| 406 | 3300010375 | Ga0105239_10360708 | Ga0105239_103607082 | 117 |
| 407 | 3300010375 | Ga0105239_11549594 | Ga0105239_115495941 | 117 |
| 408 | 3300010375 | Ga0105239_11813876 | Ga0105239_118138762 | 117 |
| 409 | 3300011119 | Ga0105246_10503750 | Ga0105246_105037502 | 117 |
| 410 | 3300012508 | Ga0157315_1006752 | Ga0157315_10067521 | 117 |
| 411 | 3300013100 | Ga0157373_10003095 | Ga0157373_1000309514 | 117 |
| 412 | 3300013100 | Ga0157373_10291545 | Ga0157373_102915451 | 117 |
| 413 | 3300013102 | Ga0157371_10013703 | Ga0157371_100137033 | 117 |
| 414 | 3300013102 | Ga0157371_10242714 | Ga0157371_102427143 | 117 |
| 415 | 3300013104 | Ga0157370_10074452 | Ga0157370_100744524 | 117 |
| 416 | 3300013104 | Ga0157370_10404954 | Ga0157370_104049542 | 117 |
| 417 | 3300013104 | Ga0157370_11297938 | Ga0157370_112979381 | 117 |
| 418 | 3300013105 | Ga0157369_10308021 | Ga0157369_103080212 | 117 |
| 419 | 3300013105 | Ga0157369_10503849 | Ga0157369_105038492 | 117 |
| 420 | 3300013105 | Ga0157369_10533057 | Ga0157369_105330572 | 117 |
| 421 | 3300013105 | Ga0157369_10597169 | Ga0157369_105971693 | 117 |
| 422 | 3300013296 | Ga0157374_10201476 | Ga0157374_102014763 | 117 |
| 423 | 3300013296 | Ga0157374_10337555 | Ga0157374_103375551 | 117 |
| 424 | 3300013296 | Ga0157374_11196392 | Ga0157374_111963922 | 117 |
| 425 | 3300013296 | Ga0157374_11230360 | Ga0157374_112303602 | 117 |
| 426 | 3300013296 | Ga0157374_11499668 | Ga0157374_114996682 | 117 |
| 427 | 3300013297 | Ga0157378_10141889 | Ga0157378_101418892 | 117 |
| 428 | 3300013297 | Ga0157378_10244120 | Ga0157378_102441204 | 117 |
| 429 | 3300013306 | Ga0163162_10000769 | Ga0163162_1000076912 | 117 |
| 430 | 3300013306 | Ga0163162_10073872 | Ga0163162_100738722 | 117 |
| 431 | 3300013306 | Ga0163162_10210346 | Ga0163162_102103462 | 117 |
| 432 | 3300013306 | Ga0163162_12748055 | Ga0163162_127480551 | 117 |
| 433 | 3300013307 | Ga0157372_10211993 | Ga0157372_102119933 | 117 |
| 434 | 3300013307 | Ga0157372_10507987 | Ga0157372_105079872 | 117 |
| 435 | 3300013307 | Ga0157372_10678482 | Ga0157372_106784822 | 117 |
| 436 | 3300013307 | Ga0157372_10695661 | Ga0157372_106956612 | 117 |
| 437 | 3300013308 | Ga0157375_10002304 | Ga0157375_100023047 | 117 |
| 438 | 3300013308 | Ga0157375_10004451 | Ga0157375_1000445111 | 117 |
| 439 | 3300013308 | Ga0157375_10098672 | Ga0157375_100986723 | 117 |
| 440 | 3300013308 | Ga0157375_10739799 | Ga0157375_107397992 | 117 |
| 441 | 3300014325 | Ga0163163_10364546 | Ga0163163_103645462 | 117 |
| 442 | 3300014325 | Ga0163163_10741489 | Ga0163163_107414892 | 117 |
| 443 | 3300014325 | Ga0163163_11493747 | Ga0163163_114937472 | 117 |
| 444 | 3300014326 | Ga0157380_10035506 | Ga0157380_100355065 | 117 |
| 445 | 3300014326 | Ga0157380_10064490 | Ga0157380_100644904 | 117 |
| 446 | 3300014326 | Ga0157380_10341416 | Ga0157380_103414163 | 117 |
| 447 | 3300014326 | Ga0157380_10605430 | Ga0157380_106054301 | 117 |
| 448 | 3300014497 | Ga0182008_10577309 | Ga0182008_105773091 | 117 |
| 449 | 3300014745 | Ga0157377_10000010 | Ga0157377_10000010297 | 117 |
| 450 | 3300014745 | Ga0157377_10234589 | Ga0157377_102345892 | 117 |
| 451 | 3300014745 | Ga0157377_10334670 | Ga0157377_103346702 | 117 |
| 452 | 3300014968 | Ga0157379_10121514 | Ga0157379_101215143 | 117 |
| 453 | 3300014968 | Ga0157379_10175551 | Ga0157379_101755511 | 117 |
| 454 | 3300014968 | Ga0157379_10534792 | Ga0157379_105347922 | 117 |
| 455 | 3300014968 | Ga0157379_11438568 | Ga0157379_114385681 | 117 |
| 456 | 3300014969 | Ga0157376_10324273 | Ga0157376_103242732 | 117 |
| 457 | 3300014969 | Ga0157376_10594588 | Ga0157376_105945882 | 117 |
| 458 | 3300014969 | Ga0157376_10649534 | Ga0157376_106495342 | 117 |
| 459 | 3300015262 | Ga0182007_10181006 | Ga0182007_101810061 | 117 |
| 460 | 3300017792 | Ga0163161_10002372 | Ga0163161_1000237212 | 117 |
| 461 | 3300017792 | Ga0163161_10183334 | Ga0163161_101833342 | 117 |
| 462 | 3300017792 | Ga0163161_10450000 | Ga0163161_104500002 | 117 |
| 463 | 3300020070 | Ga0206356_11645321 | Ga0206356_116453212 | 117 |
| 464 | 3300020078 | Ga0206352_10674374 | Ga0206352_106743741 | 117 |
| 465 | 3300020081 | Ga0206354_11514788 | Ga0206354_115147883 | 117 |
| 466 | 3300020082 | Ga0206353_11438233 | Ga0206353_114382332 | 117 |
| 467 | 3300021377 | Ga0213874_10180310 | Ga0213874_101803102 | 117 |
| 468 | 3300025273 | Ga0209673_1002911 | Ga0209673_10029113 | 117 |
| 469 | 3300025273 | Ga0209673_1003599 | Ga0209673_10035994 | 117 |
| 470 | 3300025298 | Ga0209050_1004646 | Ga0209050_10046466 | 117 |
| 471 | 3300025298 | Ga0209050_1008129 | Ga0209050_10081293 | 117 |
| 472 | 3300025299 | Ga0209256_1001476 | Ga0209256_100147616 | 117 |
| 473 | 3300025303 | Ga0209051_1000648 | Ga0209051_100064815 | 117 |
| 474 | 3300025303 | Ga0209051_1011406 | Ga0209051_10114064 | 117 |
| 475 | 3300025304 | Ga0209257_1000131 | Ga0209257_1000131198 | 117 |
| 476 | 3300025304 | Ga0209257_1000673 | Ga0209257_10006739 | 117 |
| 477 | 3300025321 | Ga0207656_10025064 | Ga0207656_100250643 | 117 |
| 478 | 3300025321 | Ga0207656_10058092 | Ga0207656_100580922 | 117 |
| 479 | 3300025321 | Ga0207656_10118911 | Ga0207656_101189112 | 117 |
| 480 | 3300025321 | Ga0207656_10147472 | Ga0207656_101474721 | 117 |
| 481 | 3300025885 | Ga0207653_10025876 | Ga0207653_100258762 | 117 |
| 482 | 3300025893 | Ga0207682_10003485 | Ga0207682_100034855 | 117 |
| 483 | 3300025893 | Ga0207682_10022332 | Ga0207682_100223322 | 117 |
| 484 | 3300025898 | Ga0207692_10828702 | Ga0207692_108287022 | 117 |
| 485 | 3300025899 | Ga0207642_10027248 | Ga0207642_100272482 | 117 |
| 486 | 3300025901 | Ga0207688_10120256 | Ga0207688_101202562 | 117 |
| 487 | 3300025901 | Ga0207688_10143148 | Ga0207688_101431482 | 117 |
| 488 | 3300025903 | Ga0207680_10018348 | Ga0207680_100183485 | 117 |
| 489 | 3300025903 | Ga0207680_10676439 | Ga0207680_106764392 | 117 |
| 490 | 3300025903 | Ga0207680_11282524 | Ga0207680_112825242 | 117 |
| 491 | 3300025904 | Ga0207647_10546480 | Ga0207647_105464801 | 117 |
| 492 | 3300025905 | Ga0207685_10093140 | Ga0207685_100931402 | 117 |
| 493 | 3300025907 | Ga0207645_10004020 | Ga0207645_100040205 | 117 |
| 494 | 3300025907 | Ga0207645_10115349 | Ga0207645_101153493 | 117 |
| 495 | 3300025907 | Ga0207645_10488211 | Ga0207645_104882112 | 117 |
| 496 | 3300025909 | Ga0207705_11393461 | Ga0207705_113934611 | 117 |
| 497 | 3300025910 | Ga0207684_10113995 | Ga0207684_101139953 | 117 |
| 498 | 3300025911 | Ga0207654_10013176 | Ga0207654_100131763 | 117 |
| 499 | 3300025911 | Ga0207654_10119807 | Ga0207654_101198072 | 117 |
| 500 | 3300025912 | Ga0207707_10009059 | Ga0207707_100090599 | 117 |
| 501 | 3300025912 | Ga0207707_10392547 | Ga0207707_103925471 | 117 |
| 502 | 3300025913 | Ga0207695_10168662 | Ga0207695_101686622 | 117 |
| 503 | 3300025914 | Ga0207671_10213514 | Ga0207671_102135142 | 117 |
| 504 | 3300025914 | Ga0207671_10481835 | Ga0207671_104818352 | 117 |
| 505 | 3300025915 | Ga0207693_10166318 | Ga0207693_101663182 | 117 |
| 506 | 3300025917 | Ga0207660_10016006 | Ga0207660_100160065 | 117 |
| 507 | 3300025917 | Ga0207660_10040090 | Ga0207660_100400901 | 117 |
| 508 | 3300025917 | Ga0207660_11101651 | Ga0207660_111016511 | 117 |
| 509 | 3300025918 | Ga0207662_10049144 | Ga0207662_100491442 | 117 |
| 510 | 3300025918 | Ga0207662_10094453 | Ga0207662_100944531 | 117 |
| 511 | 3300025919 | Ga0207657_10006685 | Ga0207657_100066856 | 117 |
| 512 | 3300025919 | Ga0207657_10063313 | Ga0207657_100633133 | 117 |
| 513 | 3300025919 | Ga0207657_10467062 | Ga0207657_104670621 | 117 |
| 514 | 3300025920 | Ga0207649_10199266 | Ga0207649_101992663 | 117 |
| 515 | 3300025921 | Ga0207652_10018045 | Ga0207652_100180453 | 117 |
| 516 | 3300025921 | Ga0207652_10023480 | Ga0207652_100234806 | 117 |
| 517 | 3300025921 | Ga0207652_10700824 | Ga0207652_107008242 | 117 |
| 518 | 3300025923 | Ga0207681_10000340 | Ga0207681_1000034010 | 117 |
| 519 | 3300025923 | Ga0207681_10575148 | Ga0207681_105751481 | 117 |
| 520 | 3300025924 | Ga0207694_10007424 | Ga0207694_100074248 | 117 |
| 521 | 3300025924 | Ga0207694_10812044 | Ga0207694_108120441 | 117 |
| 522 | 3300025925 | Ga0207650_10056224 | Ga0207650_100562242 | 117 |
| 523 | 3300025925 | Ga0207650_10084655 | Ga0207650_100846552 | 117 |
| 524 | 3300025925 | Ga0207650_10469575 | Ga0207650_104695751 | 117 |
| 525 | 3300025925 | Ga0207650_10574102 | Ga0207650_105741022 | 117 |
| 526 | 3300025925 | Ga0207650_10629929 | Ga0207650_106299291 | 117 |
| 527 | 3300025925 | Ga0207650_10739305 | Ga0207650_107393052 | 117 |
| 528 | 3300025926 | Ga0207659_10016814 | Ga0207659_100168145 | 117 |
| 529 | 3300025926 | Ga0207659_10089935 | Ga0207659_100899354 | 117 |
| 530 | 3300025926 | Ga0207659_10382353 | Ga0207659_103823532 | 117 |
| 531 | 3300025927 | Ga0207687_10224592 | Ga0207687_102245922 | 117 |
| 532 | 3300025927 | Ga0207687_10546758 | Ga0207687_105467582 | 117 |
| 533 | 3300025928 | Ga0207700_10562754 | Ga0207700_105627542 | 117 |
| 534 | 3300025929 | Ga0207664_10236895 | Ga0207664_102368952 | 117 |
| 535 | 3300025931 | Ga0207644_10000042 | Ga0207644_10000042111 | 117 |
| 536 | 3300025931 | Ga0207644_10191727 | Ga0207644_101917271 | 117 |
| 537 | 3300025931 | Ga0207644_10516397 | Ga0207644_105163971 | 117 |
| 538 | 3300025931 | Ga0207644_10736699 | Ga0207644_107366992 | 117 |
| 539 | 3300025932 | Ga0207690_10012011 | Ga0207690_100120114 | 117 |
| 540 | 3300025932 | Ga0207690_10266614 | Ga0207690_102666143 | 117 |
| 541 | 3300025932 | Ga0207690_10732169 | Ga0207690_107321692 | 117 |
| 542 | 3300025932 | Ga0207690_11567520 | Ga0207690_115675201 | 117 |
| 543 | 3300025933 | Ga0207706_10136318 | Ga0207706_101363182 | 117 |
| 544 | 3300025933 | Ga0207706_10160965 | Ga0207706_101609653 | 117 |
| 545 | 3300025933 | Ga0207706_10334028 | Ga0207706_103340282 | 117 |
| 546 | 3300025933 | Ga0207706_10535451 | Ga0207706_105354511 | 117 |
| 547 | 3300025933 | Ga0207706_10771762 | Ga0207706_107717622 | 117 |
| 548 | 3300025933 | Ga0207706_10829901 | Ga0207706_108299012 | 117 |
| 549 | 3300025934 | Ga0207686_10038506 | Ga0207686_100385062 | 117 |
| 550 | 3300025934 | Ga0207686_10281121 | Ga0207686_102811212 | 117 |
| 551 | 3300025935 | Ga0207709_10001570 | Ga0207709_1000157011 | 117 |
| 552 | 3300025935 | Ga0207709_10015155 | Ga0207709_100151553 | 117 |
| 553 | 3300025935 | Ga0207709_10028955 | Ga0207709_100289553 | 117 |
| 554 | 3300025937 | Ga0207669_10005760 | Ga0207669_100057607 | 117 |
| 555 | 3300025937 | Ga0207669_10124620 | Ga0207669_101246202 | 117 |
| 556 | 3300025937 | Ga0207669_10397338 | Ga0207669_103973382 | 117 |
| 557 | 3300025937 | Ga0207669_11063836 | Ga0207669_110638362 | 117 |
| 558 | 3300025938 | Ga0207704_10003619 | Ga0207704_100036192 | 117 |
| 559 | 3300025938 | Ga0207704_10378949 | Ga0207704_103789492 | 117 |
| 560 | 3300025939 | Ga0207665_10099175 | Ga0207665_100991753 | 117 |
| 561 | 3300025940 | Ga0207691_10038546 | Ga0207691_100385463 | 117 |
| 562 | 3300025940 | Ga0207691_10040632 | Ga0207691_100406322 | 117 |
| 563 | 3300025940 | Ga0207691_10044292 | Ga0207691_100442924 | 117 |
| 564 | 3300025940 | Ga0207691_10078502 | Ga0207691_100785024 | 117 |
| 565 | 3300025940 | Ga0207691_10085217 | Ga0207691_100852172 | 117 |
| 566 | 3300025940 | Ga0207691_10347472 | Ga0207691_103474722 | 117 |
| 567 | 3300025940 | Ga0207691_10363157 | Ga0207691_103631572 | 117 |
| 568 | 3300025941 | Ga0207711_10001998 | Ga0207711_100019984 | 117 |
| 569 | 3300025941 | Ga0207711_10013198 | Ga0207711_100131988 | 117 |
| 570 | 3300025941 | Ga0207711_10428641 | Ga0207711_104286412 | 117 |
| 571 | 3300025941 | Ga0207711_10535419 | Ga0207711_105354192 | 117 |
| 572 | 3300025941 | Ga0207711_10684623 | Ga0207711_106846232 | 117 |
| 573 | 3300025942 | Ga0207689_10002255 | Ga0207689_100022552 | 117 |
| 574 | 3300025942 | Ga0207689_10194179 | Ga0207689_101941791 | 117 |
| 575 | 3300025942 | Ga0207689_10238758 | Ga0207689_102387582 | 117 |
| 576 | 3300025942 | Ga0207689_10257946 | Ga0207689_102579462 | 117 |
| 577 | 3300025942 | Ga0207689_10463474 | Ga0207689_104634742 | 117 |
| 578 | 3300025944 | Ga0207661_10022644 | Ga0207661_100226443 | 117 |
| 579 | 3300025944 | Ga0207661_10026865 | Ga0207661_100268654 | 117 |
| 580 | 3300025944 | Ga0207661_11125468 | Ga0207661_111254682 | 117 |
| 581 | 3300025945 | Ga0207679_10090984 | Ga0207679_100909842 | 117 |
| 582 | 3300025945 | Ga0207679_10103210 | Ga0207679_101032103 | 117 |
| 583 | 3300025945 | Ga0207679_10405640 | Ga0207679_104056402 | 117 |
| 584 | 3300025945 | Ga0207679_11115295 | Ga0207679_111152951 | 117 |
| 585 | 3300025945 | Ga0207679_11474894 | Ga0207679_114748941 | 117 |
| 586 | 3300025945 | Ga0207679_12002488 | Ga0207679_120024881 | 117 |
| 587 | 3300025949 | Ga0207667_10020875 | Ga0207667_100208754 | 117 |
| 588 | 3300025949 | Ga0207667_10585785 | Ga0207667_105857851 | 117 |
| 589 | 3300025949 | Ga0207667_10683243 | Ga0207667_106832431 | 117 |
| 590 | 3300025960 | Ga0207651_10010197 | Ga0207651_100101975 | 117 |
| 591 | 3300025960 | Ga0207651_10284399 | Ga0207651_102843992 | 117 |
| 592 | 3300025960 | Ga0207651_10309098 | Ga0207651_103090981 | 117 |
| 593 | 3300025961 | Ga0207712_10003827 | Ga0207712_100038274 | 117 |
| 594 | 3300025961 | Ga0207712_10025416 | Ga0207712_100254163 | 117 |
| 595 | 3300025972 | Ga0207668_10471115 | Ga0207668_104711152 | 117 |
| 596 | 3300025981 | Ga0207640_10016926 | Ga0207640_100169262 | 117 |
| 597 | 3300025981 | Ga0207640_10128100 | Ga0207640_101281002 | 117 |
| 598 | 3300025981 | Ga0207640_10138354 | Ga0207640_101383543 | 117 |
| 599 | 3300025986 | Ga0207658_10000756 | Ga0207658_100007566 | 117 |
| 600 | 3300025986 | Ga0207658_11234071 | Ga0207658_112340712 | 117 |
| 601 | 3300026023 | Ga0207677_10050233 | Ga0207677_100502333 | 117 |
| 602 | 3300026023 | Ga0207677_10095899 | Ga0207677_100958993 | 117 |
| 603 | 3300026023 | Ga0207677_10396723 | Ga0207677_103967233 | 117 |
| 604 | 3300026023 | Ga0207677_10747224 | Ga0207677_107472242 | 117 |
| 605 | 3300026023 | Ga0207677_11275884 | Ga0207677_112758842 | 117 |
| 606 | 3300026023 | Ga0207677_11680337 | Ga0207677_116803372 | 117 |
| 607 | 3300026035 | Ga0207703_10001349 | Ga0207703_100013496 | 117 |
| 608 | 3300026041 | Ga0207639_10099819 | Ga0207639_100998193 | 117 |
| 609 | 3300026041 | Ga0207639_10510642 | Ga0207639_105106422 | 117 |
| 610 | 3300026041 | Ga0207639_11417227 | Ga0207639_114172272 | 117 |
| 611 | 3300026067 | Ga0207678_10008926 | Ga0207678_100089263 | 117 |
| 612 | 3300026067 | Ga0207678_10036525 | Ga0207678_100365254 | 117 |
| 613 | 3300026067 | Ga0207678_10060575 | Ga0207678_100605754 | 117 |
| 614 | 3300026067 | Ga0207678_10177049 | Ga0207678_101770493 | 117 |
| 615 | 3300026067 | Ga0207678_10855340 | Ga0207678_108553402 | 117 |
| 616 | 3300026075 | Ga0207708_10000535 | Ga0207708_100005351 | 117 |
| 617 | 3300026075 | Ga0207708_10002372 | Ga0207708_1000237213 | 117 |
| 618 | 3300026078 | Ga0207702_10106581 | Ga0207702_101065813 | 117 |
| 619 | 3300026078 | Ga0207702_10214358 | Ga0207702_102143583 | 117 |
| 620 | 3300026078 | Ga0207702_10984053 | Ga0207702_109840532 | 117 |
| 621 | 3300026088 | Ga0207641_10005453 | Ga0207641_100054537 | 117 |
| 622 | 3300026088 | Ga0207641_10038539 | Ga0207641_100385393 | 117 |
| 623 | 3300026088 | Ga0207641_10044388 | Ga0207641_100443883 | 117 |
| 624 | 3300026088 | Ga0207641_10768558 | Ga0207641_107685582 | 117 |
| 625 | 3300026088 | Ga0207641_11035437 | Ga0207641_110354372 | 117 |
| 626 | 3300026089 | Ga0207648_10000002 | Ga0207648_10000002234 | 117 |
| 627 | 3300026089 | Ga0207648_10002846 | Ga0207648_100028466 | 117 |
| 628 | 3300026089 | Ga0207648_10114822 | Ga0207648_101148224 | 117 |
| 629 | 3300026089 | Ga0207648_10922574 | Ga0207648_109225742 | 117 |
| 630 | 3300026095 | Ga0207676_10012389 | Ga0207676_100123896 | 117 |
| 631 | 3300026095 | Ga0207676_10049440 | Ga0207676_100494405 | 117 |
| 632 | 3300026095 | Ga0207676_10098325 | Ga0207676_100983252 | 117 |
| 633 | 3300026095 | Ga0207676_10159205 | Ga0207676_101592051 | 117 |
| 634 | 3300026095 | Ga0207676_10227823 | Ga0207676_102278232 | 117 |
| 635 | 3300026095 | Ga0207676_10746411 | Ga0207676_107464112 | 117 |
| 636 | 3300026116 | Ga0207674_10000253 | Ga0207674_1000025351 | 117 |
| 637 | 3300026116 | Ga0207674_10001583 | Ga0207674_1000158330 | 117 |
| 638 | 3300026116 | Ga0207674_10021790 | Ga0207674_100217902 | 117 |
| 639 | 3300026116 | Ga0207674_10290191 | Ga0207674_102901912 | 117 |
| 640 | 3300026116 | Ga0207674_10810473 | Ga0207674_108104731 | 117 |
| 641 | 3300026116 | Ga0207674_11901184 | Ga0207674_119011841 | 117 |
| 642 | 3300026118 | Ga0207675_100003938 | Ga0207675_1000039389 | 117 |
| 643 | 3300026118 | Ga0207675_100274764 | Ga0207675_1002747643 | 117 |
| 644 | 3300026118 | Ga0207675_101367465 | Ga0207675_1013674652 | 117 |
| 645 | 3300026118 | Ga0207675_101468824 | Ga0207675_1014688242 | 117 |
| 646 | 3300026121 | Ga0207683_10035993 | Ga0207683_100359934 | 117 |
| 647 | 3300026121 | Ga0207683_10038810 | Ga0207683_100388104 | 117 |
| 648 | 3300026121 | Ga0207683_10058156 | Ga0207683_100581564 | 117 |
| 649 | 3300026121 | Ga0207683_10116160 | Ga0207683_101161604 | 117 |
| 650 | 3300026121 | Ga0207683_10341566 | Ga0207683_103415663 | 117 |
| 651 | 3300026121 | Ga0207683_10344799 | Ga0207683_103447991 | 117 |
| 652 | 3300026121 | Ga0207683_10662493 | Ga0207683_106624932 | 117 |
| 653 | 3300026121 | Ga0207683_11163580 | Ga0207683_111635801 | 117 |
| 654 | 3300026142 | Ga0207698_10005678 | Ga0207698_100056785 | 117 |
| 655 | 3300026142 | Ga0207698_10025684 | Ga0207698_100256843 | 117 |
| 656 | 3300026142 | Ga0207698_10198889 | Ga0207698_101988893 | 117 |
| 657 | 3300026142 | Ga0207698_10199879 | Ga0207698_101998792 | 117 |
| 658 | 3300026142 | Ga0207698_10433323 | Ga0207698_104333233 | 117 |
| 659 | 3300026142 | Ga0207698_10566792 | Ga0207698_105667922 | 117 |
| 660 | 3300026142 | Ga0207698_12742589 | Ga0207698_127425891 | 117 |
| 661 | 3300027296 | Ga0209389_1050565 | Ga0209389_10505654 | 117 |
| 662 | 3300027671 | Ga0209588_1023442 | Ga0209588_10234422 | 117 |
| 663 | 3300027876 | Ga0209974_10388078 | Ga0209974_103880781 | 117 |
| 664 | 3300028379 | Ga0268266_10076602 | Ga0268266_100766024 | 117 |
| 665 | 3300028380 | Ga0268265_10003906 | Ga0268265_100039062 | 117 |
| 666 | 3300028380 | Ga0268265_10080106 | Ga0268265_100801062 | 117 |
| 667 | 3300028381 | Ga0268264_10011337 | Ga0268264_100113378 | 117 |
| 668 | 3300028381 | Ga0268264_10186627 | Ga0268264_101866273 | 117 |
| 669 | 3300028381 | Ga0268264_10974229 | Ga0268264_109742291 | 117 |
| 670 | 3300028786 | Ga0307517_10079232 | Ga0307517_100792322 | 117 |
| 671 | 3300031456 | Ga0307513_10046140 | Ga0307513_100461402 | 117 |
| 672 | 3300031456 | Ga0307513_10081906 | Ga0307513_100819063 | 117 |
| 673 | 3300031548 | Ga0307408_101219277 | Ga0307408_1012192772 | 117 |
| 674 | 3300031730 | Ga0307516_10022212 | Ga0307516_100222125 | 117 |
| 675 | 3300031824 | Ga0307413_10181628 | Ga0307413_101816282 | 117 |
| 676 | 3300031901 | Ga0307406_10828472 | Ga0307406_108284721 | 117 |
| 677 | 3300031911 | Ga0307412_10162517 | Ga0307412_101625172 | 117 |
| 678 | 3300031911 | Ga0307412_11171562 | Ga0307412_111715622 | 117 |
| 679 | 3300031995 | Ga0307409_100797121 | Ga0307409_1007971212 | 117 |
| 680 | 3300031995 | Ga0307409_102216864 | Ga0307409_1022168641 | 117 |
| 681 | 3300032002 | Ga0307416_100020832 | Ga0307416_1000208323 | 117 |
| 682 | 3300032004 | Ga0307414_11159539 | Ga0307414_111595392 | 117 |
| 683 | 3300032004 | Ga0307414_11788897 | Ga0307414_117888972 | 117 |
| 684 | 3300032005 | Ga0307411_10444646 | Ga0307411_104446462 | 117 |
| 685 | 3300033528 | Ga0316588_1036994 | Ga0316588_10369942 | 117 |
| 686 | 3300034818 | Ga0373950_0085043 | Ga0373950_0085043_264_626 | 117 |
| 687 | 3300034819 | Ga0373958_0034446 | Ga0373958_0034446_13_375 | 117 |
| 688 | 3300035083 | Ga0373926_0053209 | Ga0373926_0053209_764_1123 | 117 |
| 689 | 3300035171 | Ga0373946_0088150 | Ga0373946_0088150_294_647 | 117 |
| 690 | 3300035725 | Ga0373947_0449084 | Ga0373947_0449084_341_700 | 117 |
| 691 | 3300036647 | Ga0316582_0702171 | Ga0316582_0702171_280_633 | 117 |
| 692 | 3300036712 | Ga0316584_0097316 | Ga0316584_0097316_1446_1799 | 117 |
| 693 | 3300037312 | Ga0395899_0015319 | Ga0395899_0015319_2797_3150 | 117 |
| 694 | 3300037418 | Ga0395900_0020353 | Ga0395900_0020353_3781_4134 | 117 |
| 695 | 3300037418 | Ga0395900_0171446 | Ga0395900_0171446_924_1295 | 117 |
| 696 | 3300037471 | Ga0395905_0007590 | Ga0395905_0007590_7909_8262 | 117 |
| 697 | 3300037471 | Ga0395905_0957003 | Ga0395905_0957003_55_426 | 117 |
| 698 | 3300038443 | Ga0395901_0000745 | Ga0395901_0000745_24371_24724 | 117 |
| 699 | 3300038443 | Ga0395901_0459161 | Ga0395901_0459161_80_451 | 117 |
| 700 | 3300039062 | Ga0400483_056891 | Ga0400483_056891_196_549 | 117 |
| 701 | 3300039062 | Ga0400483_177311 | Ga0400483_177311_347_700 | 117 |
| 702 | 3300039437 | Ga0436365_1821131 | Ga0436365_1821131_280_633 | 117 |
| 703 | 3300039438 | Ga0436360_0635123 | Ga0436360_0635123_231_590 | 117 |
| 704 | 3300039447 | Ga0436361_0527389 | Ga0436361_0527389_298_651 | 117 |
| 705 | 3300039447 | Ga0436361_0649270 | Ga0436361_0649270_1882_2235 | 117 |
| 706 | 3300039450 | Ga0436363_0466499 | Ga0436363_0466499_1889_2242 | 117 |
| 707 | 3300039450 | Ga0436363_0909370 | Ga0436363_0909370_156_509 | 117 |
| 708 | 3300039453 | Ga0436362_0823712 | Ga0436362_0823712_152_505 | 117 |
| 709 | 3300041451 | Ga0451791_0050792 | Ga0451791_0050792_231_584 | 117 |
| 710 | 3300041459 | Ga0451800_0566674 | Ga0451800_0566674_626_979 | 117 |
| 711 | 3300041486 | Ga0451807_0932619 | Ga0451807_0932619_36_389 | 117 |
| 712 | 3300041486 | Ga0451807_1757683 | Ga0451807_1757683_1267_1620 | 117 |
| 713 | 3300041496 | Ga0451839_0365329 | Ga0451839_0365329_56_409 | 117 |
| 714 | 3300041512 | Ga0451853_0822117 | Ga0451853_0822117_165_518 | 117 |
| 715 | 3300041512 | Ga0451853_1186902 | Ga0451853_1186902_247_600 | 117 |
| 716 | 3300041512 | Ga0451853_1412040 | Ga0451853_1412040_72_437 | 117 |
| 717 | 3300041512 | Ga0451853_3287960 | Ga0451853_3287960_1110_1463 | 117 |
| 718 | 3300042009 | Ga0439451_004856 | Ga0439451_004856_1787_2140 | 117 |
| 719 | 3300042013 | Ga0439456_071035 | Ga0439456_071035_184_537 | 117 |
| 720 | 3300042118 | Ga0450914_007071 | Ga0450914_007071_373_726 | 117 |
| 721 | 3300042127 | Ga0450890_000321 | Ga0450890_000321_2032_2385 | 117 |
| 722 | 3300042142 | Ga0450905_059105 | Ga0450905_059105_273_626 | 117 |
| 723 | 3300042156 | Ga0439446_0021282 | Ga0439446_0021282_1148_1501 | 117 |
| 724 | 3300044673 | Ga0453683_0085215 | Ga0453683_0085215_1594_1947 | 117 |
| 725 | 3300045051 | Ga0451576_0265175 | Ga0451576_0265175_157_510 | 117 |
| 726 | 3300046452 | Ga0495617_001549 | Ga0495617_001549_7878_8231 | 117 |
| 727 | 3300046453 | Ga0495627_002781 | Ga0495627_002781_780_1133 | 117 |
| 728 | 3300046457 | Ga0495590_0001842 | Ga0495590_0001842_8368_8721 | 117 |
| 729 | 3300046457 | Ga0495590_0003633 | Ga0495590_0003633_4184_4537 | 117 |
| 730 | 3300046457 | Ga0495590_0198443 | Ga0495590_0198443_249_602 | 117 |
| 731 | 3300046462 | Ga0495651_0708151 | Ga0495651_0708151_100_456 | 117 |
| 732 | 3300046471 | Ga0495650_0005350 | Ga0495650_0005350_6461_6814 | 117 |
| 733 | 3300046473 | Ga0495582_0433400 | Ga0495582_0433400_235_588 | 117 |
| 734 | 3300046474 | Ga0495605_0011633 | Ga0495605_0011633_3518_3871 | 117 |
| 735 | 3300046491 | Ga0495584_0003708 | Ga0495584_0003708_1691_2044 | 117 |
| 736 | 3300046491 | Ga0495584_0011932 | Ga0495584_0011932_374_727 | 117 |
| 737 | 3300046492 | Ga0495585_0000756 | Ga0495585_0000756_1429_1782 | 117 |
| 738 | 3300046501 | Ga0495607_0000637 | Ga0495607_0000637_29113_29466 | 117 |
| 739 | 3300046501 | Ga0495607_0065857 | Ga0495607_0065857_702_1055 | 117 |
| 740 | 3300046507 | Ga0495606_0542355 | Ga0495606_0542355_99_452 | 117 |
| 741 | 3300046512 | Ga0495610_0038712 | Ga0495610_0038712_1545_1898 | 117 |
| 742 | 3300046513 | Ga0495616_0014077 | Ga0495616_0014077_2684_3037 | 117 |
| 743 | 3300046513 | Ga0495616_0099451 | Ga0495616_0099451_94_447 | 117 |
| 744 | 3300046513 | Ga0495616_0384892 | Ga0495616_0384892_163_525 | 117 |
| 745 | 3300046515 | Ga0495620_0106816 | Ga0495620_0106816_354_707 | 117 |
| 746 | 3300046517 | Ga0495630_0336434 | Ga0495630_0336434_50_406 | 117 |
| 747 | 3300046518 | Ga0495631_0394510 | Ga0495631_0394510_185_538 | 117 |
| 748 | 3300046519 | Ga0495632_0003848 | Ga0495632_0003848_3220_3573 | 117 |
| 749 | 3300046519 | Ga0495632_0018955 | Ga0495632_0018955_1158_1511 | 117 |
| 750 | 3300046520 | Ga0495637_0032976 | Ga0495637_0032976_1399_1752 | 117 |
| 751 | 3300046522 | Ga0495643_0006334 | Ga0495643_0006334_1028_1381 | 117 |
| 752 | 3300046522 | Ga0495643_0127363 | Ga0495643_0127363_248_601 | 117 |
| 753 | 3300046524 | Ga0495648_0018965 | Ga0495648_0018965_4432_4785 | 117 |
| 754 | 3300046524 | Ga0495648_0076588 | Ga0495648_0076588_678_1031 | 117 |
| 755 | 3300046528 | Ga0495642_0007901 | Ga0495642_0007901_1876_2229 | 117 |
| 756 | 3300046530 | Ga0495654_0091852 | Ga0495654_0091852_832_1185 | 117 |
| 757 | 3300046538 | Ga0495609_0005475 | Ga0495609_0005475_2795_3148 | 117 |
| 758 | 3300046539 | Ga0495621_0010202 | Ga0495621_0010202_2249_2602 | 117 |
| 759 | 3300046539 | Ga0495621_0158520 | Ga0495621_0158520_396_749 | 117 |
| 760 | 3300046542 | Ga0495597_0004785 | Ga0495597_0004785_6633_6986 | 117 |
| 761 | 3300046542 | Ga0495597_0077320 | Ga0495597_0077320_68_421 | 117 |
| 762 | 3300046557 | Ga0495622_0048833 | Ga0495622_0048833_1135_1488 | 117 |
| 763 | 3300046615 | Ga0495656_0614227 | Ga0495656_0614227_125_478 | 117 |
| 764 | 3300046648 | Ga0495611_0003183 | Ga0495611_0003183_5604_5957 | 117 |
| 765 | 3300046664 | Ga0495659_0013203 | Ga0495659_0013203_696_1049 | 117 |
| 766 | 3300046681 | Ga0495647_0080337 | Ga0495647_0080337_12_365 | 117 |
| 767 | 3300046683 | Ga0495658_0070648 | Ga0495658_0070648_972_1325 | 117 |
| 768 | 3300046683 | Ga0495658_0128881 | Ga0495658_0128881_735_1088 | 117 |
| 769 | 3300046691 | Ga0495670_0122488 | Ga0495670_0122488_869_1222 | 117 |
| 770 | 3300046694 | Ga0495649_0000086 | Ga0495649_0000086_4109_4462 | 117 |
| 771 | 3300046694 | Ga0495649_0090734 | Ga0495649_0090734_529_882 | 117 |
| 772 | 3300046794 | Ga0495589_0000636 | Ga0495589_0000636_18484_18837 | 117 |
| 773 | 3300046810 | Ga0495660_0103786 | Ga0495660_0103786_889_1242 | 117 |
| 774 | 3300046810 | Ga0495660_0193200 | Ga0495660_0193200_572_925 | 117 |
| 775 | 3300046810 | Ga0495660_0213571 | Ga0495660_0213571_256_609 | 117 |
| 776 | 3300047318 | Ga0495636_0001144 | Ga0495636_0001144_7828_8181 | 117 |
| 777 | 3300047319 | Ga0495674_0037120 | Ga0495674_0037120_2752_3105 | 117 |
| 778 | 3300047320 | Ga0495672_0001126 | Ga0495672_0001126_6558_6911 | 117 |
| 779 | 3300047443 | Ga0495687_001073 | Ga0495687_001073_23319_23672 | 117 |
| 780 | 3300047443 | Ga0495687_008149 | Ga0495687_008149_3685_4038 | 117 |
| 781 | 3300047447 | Ga0495685_003266 | Ga0495685_003266_223_576 | 117 |
| 782 | 3300047469 | Ga0495673_0004100 | Ga0495673_0004100_7477_7830 | 117 |
| 783 | 3300047470 | Ga0495681_0005449 | Ga0495681_0005449_1152_1505 | 117 |
| 784 | 3300047470 | Ga0495681_0111388 | Ga0495681_0111388_141_494 | 117 |
| 785 | 3300047472 | Ga0495686_0001282 | Ga0495686_0001282_26771_27124 | 117 |
| 786 | 3300047472 | Ga0495686_0004782 | Ga0495686_0004782_3825_4178 | 117 |
| 787 | 3300047472 | Ga0495686_0146610 | Ga0495686_0146610_11_364 | 117 |
| 788 | 3300048090 | Ga0495615_0307616 | Ga0495615_0307616_104_457 | 117 |
| 789 | 3300048091 | Ga0495626_0000490 | Ga0495626_0000490_37953_38306 | 117 |
| 790 | 3300048903 | Ga0496100_0599007 | Ga0496100_0599007_47_400 | 117 |
| 791 | 3300048904 | Ga0496101_0000946 | Ga0496101_0000946_7043_7399 | 117 |
| 792 | 3300048904 | Ga0496101_0474741 | Ga0496101_0474741_110_472 | 117 |
| 793 | 3300048905 | Ga0496102_0006848 | Ga0496102_0006848_2036_2392 | 117 |
| 794 | 3300048905 | Ga0496102_0014500 | Ga0496102_0014500_5681_6043 | 117 |
| 795 | 3300048905 | Ga0496102_1073406 | Ga0496102_1073406_94_447 | 117 |
| 796 | 3300048906 | Ga0496103_0156155 | Ga0496103_0156155_307_669 | 117 |
| 797 | 3300048906 | Ga0496103_0851553 | Ga0496103_0851553_31_387 | 117 |
| 798 | 3300048907 | Ga0496104_0030456 | Ga0496104_0030456_168_524 | 117 |
| 799 | 3300048907 | Ga0496104_0499328 | Ga0496104_0499328_500_853 | 117 |
| 800 | 3300048907 | Ga0496104_1826275 | Ga0496104_1826275_83_436 | 117 |
| 801 | 3300048908 | Ga0496105_0772589 | Ga0496105_0772589_184_540 | 117 |
| 802 | 3300048908 | Ga0496105_0780349 | Ga0496105_0780349_87_458 | 117 |
| 803 | 3300048908 | Ga0496105_1096254 | Ga0496105_1096254_22_375 | 117 |
| 804 | 3300048908 | Ga0496105_1119061 | Ga0496105_1119061_111_464 | 117 |
| 805 | 3300048909 | Ga0496106_0001831 | Ga0496106_0001831_15220_15576 | 117 |
| 806 | 3300048909 | Ga0496106_0012041 | Ga0496106_0012041_323_685 | 117 |
| 807 | 3300048910 | Ga0496107_0012964 | Ga0496107_0012964_445_801 | 117 |
| 808 | 3300048910 | Ga0496107_0133375 | Ga0496107_0133375_808_1170 | 117 |
| 809 | 3300048911 | Ga0496108_0035247 | Ga0496108_0035247_250_606 | 117 |
| 810 | 3300048911 | Ga0496108_0048381 | Ga0496108_0048381_2703_3059 | 117 |
| 811 | 3300048911 | Ga0496108_1135288 | Ga0496108_1135288_69_422 | 117 |
| 812 | 3300048912 | Ga0496109_0007810 | Ga0496109_0007810_4577_4933 | 117 |
| 813 | 3300048912 | Ga0496109_0035054 | Ga0496109_0035054_3410_3766 | 117 |
| 814 | 3300048912 | Ga0496109_0572379 | Ga0496109_0572379_660_1013 | 117 |
| 815 | 3300048912 | Ga0496109_0771267 | Ga0496109_0771267_75_437 | 117 |
| 816 | 3300048913 | Ga0496110_0000678 | Ga0496110_0000678_1057_1413 | 117 |
| 817 | 3300048913 | Ga0496110_0022804 | Ga0496110_0022804_1259_1615 | 117 |
| 818 | 3300048913 | Ga0496110_0938165 | Ga0496110_0938165_146_499 | 117 |
| 819 | 3300048914 | Ga0496111_0008384 | Ga0496111_0008384_4238_4594 | 117 |
| 820 | 3300048915 | Ga0496112_0515307 | Ga0496112_0515307_731_1096 | 117 |
| 821 | 3300048915 | Ga0496112_0636975 | Ga0496112_0636975_244_600 | 117 |
| 822 | 3300048915 | Ga0496112_1889146 | Ga0496112_1889146_25_384 | 117 |
| 823 | 3300048916 | Ga0496113_0140832 | Ga0496113_0140832_1483_1839 | 117 |
| 824 | 3300048916 | Ga0496113_0417678 | Ga0496113_0417678_195_551 | 117 |
| 825 | 3300048917 | Ga0496114_0264875 | Ga0496114_0264875_44_397 | 117 |
| 826 | 3300048917 | Ga0496114_0295237 | Ga0496114_0295237_774_1130 | 117 |
| 827 | 3300048917 | Ga0496114_0327111 | Ga0496114_0327111_24_377 | 117 |
| 828 | 3300048918 | Ga0496115_0076791 | Ga0496115_0076791_1111_1470 | 117 |
| 829 | 3300048918 | Ga0496115_0282032 | Ga0496115_0282032_222_578 | 117 |
| 830 | 3300048918 | Ga0496115_0420867 | Ga0496115_0420867_508_870 | 117 |
| 831 | 3300048921 | Ga0496118_0121214 | Ga0496118_0121214_906_1268 | 117 |
| 832 | 3300048927 | Ga0496124_0017518 | Ga0496124_0017518_1522_1875 | 117 |
| 833 | 3300049459 | Ga0495678_000437 | Ga0495678_000437_3287_3640 | 117 |
| 834 | 3300049460 | Ga0495682_0154673 | Ga0495682_0154673_418_771 | 117 |
| 835 | 3300049515 | Ga0501292_029095 | Ga0501292_029095_260_613 | 117 |
| 836 | 3300049517 | Ga0501294_028909 | Ga0501294_028909_163_516 | 117 |
| 837 | 3300049568 | Ga0501031_0029337 | Ga0501031_0029337_1994_2347 | 117 |
| 838 | 3300049568 | Ga0501031_0508335 | Ga0501031_0508335_227_580 | 117 |
| 839 | 3300049572 | Ga0501036_0085824 | Ga0501036_0085824_943_1296 | 117 |
| 840 | 3300049572 | Ga0501036_0154343 | Ga0501036_0154343_446_808 | 117 |
| 841 | 3300049575 | Ga0501039_0571487 | Ga0501039_0571487_154_507 | 117 |
| 842 | 3300049575 | Ga0501039_1550066 | Ga0501039_1550066_131_484 | 117 |
| 843 | 3300049577 | Ga0501041_0045372 | Ga0501041_0045372_183_542 | 117 |
| 844 | 3300049577 | Ga0501041_0253599 | Ga0501041_0253599_448_810 | 117 |
| 845 | 3300049578 | Ga0501042_0018382 | Ga0501042_0018382_4443_4802 | 117 |
| 846 | 3300049578 | Ga0501042_0042095 | Ga0501042_0042095_1594_1947 | 117 |
| 847 | 3300049578 | Ga0501042_0223767 | Ga0501042_0223767_735_1088 | 117 |
| 848 | 3300049580 | Ga0501046_0611471 | Ga0501046_0611471_216_617 | 117 |
| 849 | 3300049582 | Ga0501048_0311269 | Ga0501048_0311269_491_844 | 117 |
| 850 | 3300049582 | Ga0501048_0537350 | Ga0501048_0537350_104_457 | 117 |
| 851 | 3300049586 | Ga0501070_0752296 | Ga0501070_0752296_256_663 | 117 |
| 852 | 3300049587 | Ga0501071_0017977 | Ga0501071_0017977_2357_2716 | 117 |
| 853 | 3300049587 | Ga0501071_0328426 | Ga0501071_0328426_269_622 | 117 |
| 854 | 3300049588 | Ga0501072_0012333 | Ga0501072_0012333_1624_1983 | 117 |
| 855 | 3300049589 | Ga0501073_0608109 | Ga0501073_0608109_78_440 | 117 |
| 856 | 3300049590 | Ga0501074_0047129 | Ga0501074_0047129_1942_2301 | 117 |
| 857 | 3300049591 | Ga0501075_0253685 | Ga0501075_0253685_89_451 | 117 |
| 858 | 3300049591 | Ga0501075_0858496 | Ga0501075_0858496_73_426 | 117 |
| 859 | 3300049592 | Ga0501076_0978515 | Ga0501076_0978515_248_601 | 117 |
| 860 | 3300049593 | Ga0501077_0271443 | Ga0501077_0271443_31_438 | 117 |
| 861 | 3300049653 | Ga0501206_000997 | Ga0501206_000997_3068_3421 | 117 |
| 862 | 3300049662 | Ga0501222_008276 | Ga0501222_008276_264_617 | 117 |
| 863 | 3300049686 | Ga0501257_012817 | Ga0501257_012817_1298_1651 | 117 |
| 864 | 3300049690 | Ga0501261_052684 | Ga0501261_052684_213_566 | 117 |
| 865 | 3300049741 | Ga0501079_0002078 | Ga0501079_0002078_12473_12832 | 117 |
| 866 | 3300049743 | Ga0501081_0095927 | Ga0501081_0095927_808_1167 | 117 |
| 867 | 3300049743 | Ga0501081_0132526 | Ga0501081_0132526_14_376 | 117 |
| 868 | 3300049743 | Ga0501081_0756490 | Ga0501081_0756490_231_638 | 117 |
| 869 | 3300049744 | Ga0501083_0944779 | Ga0501083_0944779_35_397 | 117 |
| 870 | 3300049762 | Ga0501265_010796 | Ga0501265_010796_438_791 | 117 |
| 871 | 3300049822 | Ga0501035_0060070 | Ga0501035_0060070_1497_1850 | 117 |
| 872 | 3300049822 | Ga0501035_0391070 | Ga0501035_0391070_726_1085 | 117 |
| 873 | 3300049824 | Ga0501045_0026520 | Ga0501045_0026520_2852_3211 | 117 |
| 874 | 3300049824 | Ga0501045_0104928 | Ga0501045_0104928_1726_2079 | 117 |
| 875 | 3300049824 | Ga0501045_0153003 | Ga0501045_0153003_1098_1460 | 117 |
| 876 | 3300049824 | Ga0501045_1419392 | Ga0501045_1419392_123_476 | 117 |
| 877 | 3300050491 | nmdc:mga00v17_33166_c1 | nmdc:mga00v17_33166_c1_11_370 | 117 |
| 878 | 3300050492 | nmdc:mga0yw44_106134_c2 | nmdc:mga0yw44_106134_c2_663_1022 | 117 |
| 879 | 3300050493 | nmdc:mga0k408_444313_c1 | nmdc:mga0k408_444313_c1_394_747 | 117 |
| 880 | 3300050494 | nmdc:mga06z11_476289_c1 | nmdc:mga06z11_476289_c1_85_444 | 117 |
| 881 | 3300050496 | nmdc:mga07m45_14752_c1 | nmdc:mga07m45_14752_c1_957_1310 | 117 |
| 882 | 3300050507 | nmdc:mga05p37_571537_c1 | nmdc:mga05p37_571537_c1_169_531 | 117 |
| 883 | 3300050509 | nmdc:mga0qj67_399888_c1 | nmdc:mga0qj67_399888_c1_145_498 | 117 |
| 884 | 3300050510 | nmdc:mga06r32_135379_c1 | nmdc:mga06r32_135379_c1_1693_2055 | 117 |
| 885 | 3300050511 | nmdc:mga08y16_1215365_c1 | nmdc:mga08y16_1215365_c1_336_713 | 117 |
| 886 | 3300050511 | nmdc:mga08y16_128079_c1 | nmdc:mga08y16_128079_c1_113_490 | 117 |
| 887 | 3300050511 | nmdc:mga08y16_548632_c1 | nmdc:mga08y16_548632_c1_571_924 | 117 |
| 888 | 3300050511 | nmdc:mga08y16_648543_c1 | nmdc:mga08y16_648543_c1_61_414 | 117 |
| 889 | 3300050512 | nmdc:mga0n895_460071_c1 | nmdc:mga0n895_460071_c1_526_894 | 117 |
| 890 | 3300050513 | nmdc:mga0rr50_196583_c1 | nmdc:mga0rr50_196583_c1_1186_1539 | 117 |
| 891 | 3300050514 | nmdc:mga08x19_256803_c1 | nmdc:mga08x19_256803_c1_283_636 | 117 |
| 892 | 3300050514 | nmdc:mga08x19_62273_c1 | nmdc:mga08x19_62273_c1_699_1052 | 117 |
| 893 | 3300050515 | nmdc:mga0a205_44007_c1 | nmdc:mga0a205_44007_c1_2670_3029 | 117 |
| 894 | 3300053077 | Ga0495601_0505052 | Ga0495601_0505052_64_417 | 117 |
| 895 | 3300053083 | Ga0495655_0084467 | Ga0495655_0084467_210_563 | 117 |
| 896 | 3300053086 | Ga0500578_0043866 | Ga0500578_0043866_1775_2128 | 117 |
| 897 | 3300053092 | Ga0500583_0305445 | Ga0500583_0305445_88_447 | 117 |
| 898 | 3300053096 | Ga0500641_0398486 | Ga0500641_0398486_103_462 | 117 |
| 899 | 3300053139 | Ga0500568_0182939 | Ga0500568_0182939_210_563 | 117 |
| 900 | 3300053730 | Ga0500645_007433 | Ga0500645_007433_2789_3142 | 117 |
| 901 | 3300054114 | Ga0501084_0020668 | Ga0501084_0020668_4115_4474 | 117 |
| 902 | 3300054114 | Ga0501084_0206361 | Ga0501084_0206361_1089_1451 | 117 |
| 903 | 3300054114 | Ga0501084_0314841 | Ga0501084_0314841_897_1250 | 117 |
| 904 | 3300054114 | Ga0501084_0339597 | Ga0501084_0339597_874_1233 | 117 |
| 905 | 3300054114 | Ga0501084_1329676 | Ga0501084_1329676_41_442 | 117 |
| 906 | 3300059424 | Ga0590075_079124 | Ga0590075_079124_401_754 | 117 |
| 907 | 3300060353 | Ga0501082_0024896 | Ga0501082_0024896_1106_1465 | 117 |
| 908 | 3300060353 | Ga0501082_0219027 | Ga0501082_0219027_345_707 | 117 |
| 909 | 3300060353 | Ga0501082_1146821 | Ga0501082_1146821_108_461 | 117 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9565 | 1 | 117 |
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.951 | 1 | 117 |
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9432 | 1 | 117 |
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.8854 | 1 | 117 |
| 1xbw-assembly2.cif.gz_C | 1.9a crystal structure of the protein isdg from staphylococcus aureus aureus, structural genomics, mcsg | 0.7641 | 1 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAQ6_1_117_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9593 | 1 | 117 | 3.30.70.100 |
| af_P9WLA3_114_212_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8045 | 2 | 88 | 3.30.70.100 |
| 3mcsA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7556 | 2 | 92 | 3.30.70.100 |
| 2pgcA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7214 | 3 | 114 | 3.30.70.100 |
| 1xbwA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7196 | 1 | 117 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R2I8P8-F1-model_v4 | Uncharacterized protein YbaA (DUF1428 family) | 0.9884 | 1 | 117 |
|
| AF-A0A0Q6JVN0-F1-model_v4 | RNA signal recognition particle | 0.9853 | 2 | 117 |
|
| AF-A0A2T3X314-F1-model_v4 | deleted | 0.9841 | 1 | 117 |
|
| AF-A0A658NKC3-F1-model_v4 | DUF1428 domain-containing protein | 0.9822 | 9 | 90 |
|
| AF-A0A520Y529-F1-model_v4 | DUF1428 domain-containing protein | 0.9814 | 1 | 92 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar