F485415
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 909 | 338 | 875 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10000006|Ga0265327_10000006428 |
| Length | 264 |
| Sequence | MNNLPHWRSHIPHINFDTLITLIFTFSHLVKMGLNKVVANADEAIKDIQSGATLMLGGFGLCGIPENCISALVRKGVKELTCISNNAGVDDFGIGLLLQQRQVKKMISSYVGENAEFERQLLSGELEVELIPQGTLATRCMAAGYGMPAVYVLAGVGTEVAEGKETRNFDGKEYLMEYAFNSDFAIVKAWKGDTQGNLIFKDTARNFNPMMAMAGKITIAEVEELVQPGELDPNFIHVPGIYVHRIFQGTQYEKRIEQRTTRKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 5 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 6 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 7 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 8 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 9 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 10 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 11 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 12 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 13 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 14 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 15 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 16 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 17 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 18 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 19 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 20 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 21 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 22 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 23 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 24 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 25 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 26 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 27 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 28 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 29 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 30 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 31 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 32 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 33 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 34 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 35 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 36 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 37 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 38 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 39 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 40 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 41 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 42 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 43 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 44 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 45 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 46 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 49 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 52 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 213 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 214 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 215 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 216 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 228 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 229 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 243 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 244 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 245 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 246 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 326 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 327 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 329 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 331 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 332 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 334 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 335 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.15 |
| Metatranscriptomes | 0.11 |
| Isolates | 3.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.18 |
| Nodule | 0 |
| Rhizoplane | 0.33 |
| Rhizosphere | 91.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1131605 | 2162886007 | Bacteria | 1250 |
| 2 | SwRhRL2b_contig_1759593 | 2162886007 | Bacteria | 266684 |
| 3 | SwRhRL2b_contig_3290449 | 2162886007 | Bacteria | 4315 |
| 4 | JGI24740J21852_10042533 | 3300001979 | Bacteria | 1361 |
| 5 | JGI24737J22298_10008536 | 3300001990 | Bacteria | 3426 |
| 6 | JGI24737J22298_10014737 | 3300001990 | Bacteria | 2536 |
| 7 | JGI24743J22301_10016381 | 3300001991 | Bacteria | 1382 |
| 8 | JGI24735J21928_10000006 | 3300002067 | Bacteria | 339303 |
| 9 | JGI24735J21928_10002913 | 3300002067 | Bacteria | 5887 |
| 10 | JGI25162J39368_1001400 | 3300002737 | Bacteria | 13179 |
| 11 | JGI25162J39368_1001919 | 3300002737 | Bacteria | 9518 |
| 12 | JGI25164J39214_1003560 | 3300002772 | Bacteria | 1947 |
| 13 | JGI25151J46595_10000014 | 3300003187 | Bacteria | 253098 |
| 14 | JGI25153J46596_10000020 | 3300003215 | Bacteria | 252978 |
| 15 | rootH1_10072982 | 3300003316 | Bacteria | 7424 |
| 16 | rootH2_10001334 | 3300003320 | Bacteria | 238709 |
| 17 | rootH2_10089325 | 3300003320 | Bacteria | 2361 |
| 18 | rootH1_10002605 | 3300003323 | Bacteria | 51064 |
| 19 | rootH1_10078843 | 3300003323 | Bacteria | 6972 |
| 20 | rootH1_10116441 | 3300003323 | Bacteria | 7444 |
| 21 | Ga0055536_1000226 | 3300003781 | Bacteria | 45469 |
| 22 | Ga0055530_10005126 | 3300003791 | Bacteria | 6398 |
| 23 | Ga0058863_11667303 | 3300004799 | Bacteria | 3334 |
| 24 | Ga0065714_10002345 | 3300005288 | Bacteria | 23040 |
| 25 | Ga0065714_10004805 | 3300005288 | Bacteria | 6056 |
| 26 | Ga0065714_10006702 | 3300005288 | Bacteria | 4572 |
| 27 | Ga0065714_10013197 | 3300005288 | Bacteria | 2037 |
| 28 | Ga0065714_10017971 | 3300005288 | Bacteria | 1957 |
| 29 | Ga0065714_10086246 | 3300005288 | Bacteria | 2110 |
| 30 | Ga0065714_10098037 | 3300005288 | Bacteria | 1720 |
| 31 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 32 | Ga0065704_10070382 | 3300005289 | Bacteria | 27921 |
| 33 | Ga0065704_10075998 | 3300005289 | Bacteria | 5279 |
| 34 | Ga0065704_10164090 | 3300005289 | Bacteria | 1332 |
| 35 | Ga0065712_10315846 | 3300005290 | Bacteria | 836 |
| 36 | Ga0065707_10123842 | 3300005295 | Bacteria | 2026 |
| 37 | Ga0070658_10000026 | 3300005327 | Bacteria | 171716 |
| 38 | Ga0070658_10073376 | 3300005327 | Bacteria | 2806 |
| 39 | Ga0070658_10080404 | 3300005327 | Bacteria | 2677 |
| 40 | Ga0070658_10117414 | 3300005327 | Bacteria | 2209 |
| 41 | Ga0070658_10135069 | 3300005327 | Bacteria | 2057 |
| 42 | Ga0070676_10001812 | 3300005328 | Bacteria | 10867 |
| 43 | Ga0070676_10033047 | 3300005328 | Bacteria | 2967 |
| 44 | Ga0070676_10120154 | 3300005328 | Bacteria | 1648 |
| 45 | Ga0070676_10253158 | 3300005328 | Bacteria | 1176 |
| 46 | Ga0070683_100006215 | 3300005329 | Bacteria | 10013 |
| 47 | Ga0070683_100052046 | 3300005329 | Bacteria | 3793 |
| 48 | Ga0070683_100065882 | 3300005329 | Bacteria | 3373 |
| 49 | Ga0070683_100130540 | 3300005329 | Bacteria | 2378 |
| 50 | Ga0070683_100431642 | 3300005329 | Bacteria | 1257 |
| 51 | Ga0070683_100667198 | 3300005329 | Bacteria | 996 |
| 52 | Ga0070690_100159027 | 3300005330 | Bacteria | 1547 |
| 53 | Ga0070670_100030228 | 3300005331 | Bacteria | 4664 |
| 54 | Ga0070670_100052426 | 3300005331 | Bacteria | 3504 |
| 55 | Ga0070670_100169320 | 3300005331 | Bacteria | 1895 |
| 56 | Ga0070670_100526797 | 3300005331 | Bacteria | 1053 |
| 57 | Ga0068869_100053809 | 3300005334 | Bacteria | 2928 |
| 58 | Ga0068869_100061630 | 3300005334 | Bacteria | 2752 |
| 59 | Ga0068869_100069685 | 3300005334 | Bacteria | 2600 |
| 60 | Ga0068869_100221189 | 3300005334 | Bacteria | 1501 |
| 61 | Ga0070666_10016089 | 3300005335 | Bacteria | 4780 |
| 62 | Ga0070666_10019554 | 3300005335 | Bacteria | 4373 |
| 63 | Ga0070680_100009215 | 3300005336 | Bacteria | 7570 |
| 64 | Ga0070680_100034278 | 3300005336 | Bacteria | 4093 |
| 65 | Ga0070680_100108709 | 3300005336 | Bacteria | 2307 |
| 66 | Ga0070680_100127421 | 3300005336 | Bacteria | 2127 |
| 67 | Ga0070682_100000039 | 3300005337 | Bacteria | 144400 |
| 68 | Ga0070682_100030177 | 3300005337 | Bacteria | 3270 |
| 69 | Ga0070682_100063960 | 3300005337 | Bacteria | 2334 |
| 70 | Ga0070682_100075268 | 3300005337 | Unclassified | 2171 |
| 71 | Ga0070682_100552546 | 3300005337 | Bacteria | 901 |
| 72 | Ga0068868_100012938 | 3300005338 | Bacteria | 6105 |
| 73 | Ga0068868_100014676 | 3300005338 | Bacteria | 5777 |
| 74 | Ga0068868_100027697 | 3300005338 | Bacteria | 4324 |
| 75 | Ga0068868_100029787 | 3300005338 | Bacteria | 4182 |
| 76 | Ga0068868_100087803 | 3300005338 | Bacteria | 2501 |
| 77 | Ga0068868_100327270 | 3300005338 | Bacteria | 1307 |
| 78 | Ga0070660_100000870 | 3300005339 | Bacteria | 20145 |
| 79 | Ga0070660_100022188 | 3300005339 | Bacteria | 4691 |
| 80 | Ga0070660_100063881 | 3300005339 | Bacteria | 2863 |
| 81 | Ga0070660_100203178 | 3300005339 | Bacteria | 1607 |
| 82 | Ga0070660_100441583 | 3300005339 | Bacteria | 1079 |
| 83 | Ga0070689_100059757 | 3300005340 | Bacteria | 2962 |
| 84 | Ga0070661_100001685 | 3300005344 | Bacteria | 15290 |
| 85 | Ga0070661_100016838 | 3300005344 | Bacteria | 5174 |
| 86 | Ga0070661_100122200 | 3300005344 | Bacteria | 1951 |
| 87 | Ga0070692_10102076 | 3300005345 | Bacteria | 1574 |
| 88 | Ga0070668_100029793 | 3300005347 | Bacteria | 4147 |
| 89 | Ga0070669_100002558 | 3300005353 | Bacteria | 13155 |
| 90 | Ga0070675_100079466 | 3300005354 | Bacteria | 2733 |
| 91 | Ga0070675_100166793 | 3300005354 | Bacteria | 1897 |
| 92 | Ga0070675_100325234 | 3300005354 | Unclassified | 1359 |
| 93 | Ga0070671_100029341 | 3300005355 | Bacteria | 4535 |
| 94 | Ga0070671_100041220 | 3300005355 | Bacteria | 3837 |
| 95 | Ga0070671_100110248 | 3300005355 | Bacteria | 2311 |
| 96 | Ga0070671_100365482 | 3300005355 | Bacteria | 1232 |
| 97 | Ga0070671_100470114 | 3300005355 | Bacteria | 1080 |
| 98 | Ga0070674_100462602 | 3300005356 | Bacteria | 1049 |
| 99 | Ga0070673_100017680 | 3300005364 | Bacteria | 5077 |
| 100 | Ga0070673_100286029 | 3300005364 | Bacteria | 1447 |
| 101 | Ga0070688_100222962 | 3300005365 | Bacteria | 1329 |
| 102 | Ga0070688_100280126 | 3300005365 | Bacteria | 1198 |
| 103 | Ga0070688_100460512 | 3300005365 | Bacteria | 952 |
| 104 | Ga0070659_100000578 | 3300005366 | Bacteria | 26773 |
| 105 | Ga0070659_100001687 | 3300005366 | Bacteria | 15889 |
| 106 | Ga0070659_100005037 | 3300005366 | Bacteria | 9470 |
| 107 | Ga0070659_100029194 | 3300005366 | Bacteria | 4261 |
| 108 | Ga0070659_100038013 | 3300005366 | Bacteria | 3753 |
| 109 | Ga0070659_100110556 | 3300005366 | Bacteria | 2218 |
| 110 | Ga0070659_100127506 | 3300005366 | Bacteria | 2065 |
| 111 | Ga0070667_100057892 | 3300005367 | Bacteria | 3276 |
| 112 | Ga0070667_100270548 | 3300005367 | Bacteria | 1523 |
| 113 | Ga0070709_10027617 | 3300005434 | Bacteria | 3376 |
| 114 | Ga0070714_100327873 | 3300005435 | Unclassified | 1433 |
| 115 | Ga0070713_100332180 | 3300005436 | Bacteria | 1406 |
| 116 | Ga0070663_100007287 | 3300005455 | Bacteria | 6724 |
| 117 | Ga0070663_100056365 | 3300005455 | Bacteria | 2815 |
| 118 | Ga0070663_100268909 | 3300005455 | Bacteria | 1354 |
| 119 | Ga0070678_100119748 | 3300005456 | Bacteria | 2074 |
| 120 | Ga0070662_100000093 | 3300005457 | Bacteria | 49418 |
| 121 | Ga0070662_100010296 | 3300005457 | Bacteria | 6131 |
| 122 | Ga0070662_100010443 | 3300005457 | Bacteria | 6092 |
| 123 | Ga0070662_100100869 | 3300005457 | Bacteria | 2184 |
| 124 | Ga0070662_100134101 | 3300005457 | Bacteria | 1913 |
| 125 | Ga0070681_10015837 | 3300005458 | Bacteria | 7516 |
| 126 | Ga0070681_10042095 | 3300005458 | Bacteria | 4578 |
| 127 | Ga0070681_10110568 | 3300005458 | Bacteria | 2687 |
| 128 | Ga0070681_10126709 | 3300005458 | Bacteria | 2486 |
| 129 | Ga0070681_10184858 | 3300005458 | Bacteria | 2005 |
| 130 | Ga0070681_10458353 | 3300005458 | Bacteria | 1187 |
| 131 | Ga0068867_100000834 | 3300005459 | Bacteria | 20744 |
| 132 | Ga0068867_100072490 | 3300005459 | Bacteria | 2578 |
| 133 | Ga0070685_10053770 | 3300005466 | Bacteria | 2334 |
| 134 | Ga0070679_100000053 | 3300005530 | Bacteria | 85011 |
| 135 | Ga0070679_100010527 | 3300005530 | Bacteria | 8775 |
| 136 | Ga0070679_100026213 | 3300005530 | Bacteria | 5722 |
| 137 | Ga0070679_100037562 | 3300005530 | Bacteria | 4812 |
| 138 | Ga0070679_100194770 | 3300005530 | Bacteria | 1994 |
| 139 | Ga0070679_100679391 | 3300005530 | Bacteria | 972 |
| 140 | Ga0070684_100001962 | 3300005535 | Bacteria | 15111 |
| 141 | Ga0070684_100099797 | 3300005535 | Bacteria | 2592 |
| 142 | Ga0070684_100173237 | 3300005535 | Bacteria | 1960 |
| 143 | Ga0070684_100308382 | 3300005535 | Bacteria | 1453 |
| 144 | Ga0070684_100450844 | 3300005535 | Bacteria | 1189 |
| 145 | Ga0068853_100002136 | 3300005539 | Bacteria | 14716 |
| 146 | Ga0068853_100019480 | 3300005539 | Bacteria | 5625 |
| 147 | Ga0068853_100027230 | 3300005539 | Bacteria | 4802 |
| 148 | Ga0068853_100038295 | 3300005539 | Bacteria | 4083 |
| 149 | Ga0068853_100135257 | 3300005539 | Bacteria | 2209 |
| 150 | Ga0068853_100206762 | 3300005539 | Bacteria | 1788 |
| 151 | Ga0068853_100275387 | 3300005539 | Unclassified | 1550 |
| 152 | Ga0068853_100339428 | 3300005539 | Bacteria | 1396 |
| 153 | Ga0070672_100053325 | 3300005543 | Bacteria | 3161 |
| 154 | Ga0070686_100014008 | 3300005544 | Bacteria | 4609 |
| 155 | Ga0070686_100073946 | 3300005544 | Bacteria | 2239 |
| 156 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 157 | Ga0070665_100005268 | 3300005548 | Bacteria | 13366 |
| 158 | Ga0070665_100610442 | 3300005548 | Unclassified | 1104 |
| 159 | Ga0068855_100000727 | 3300005563 | Bacteria | 40453 |
| 160 | Ga0068855_100001020 | 3300005563 | Bacteria | 34917 |
| 161 | Ga0068855_100004855 | 3300005563 | Bacteria | 16414 |
| 162 | Ga0068855_100006033 | 3300005563 | Bacteria | 14776 |
| 163 | Ga0068855_100013351 | 3300005563 | Bacteria | 9907 |
| 164 | Ga0068855_100015590 | 3300005563 | Bacteria | 9144 |
| 165 | Ga0068855_100049734 | 3300005563 | Bacteria | 4943 |
| 166 | Ga0068855_100053685 | 3300005563 | Bacteria | 4740 |
| 167 | Ga0068855_100308903 | 3300005563 | Bacteria | 1750 |
| 168 | Ga0068855_100348510 | 3300005563 | Bacteria | 1631 |
| 169 | Ga0068855_100365276 | 3300005563 | Bacteria | 1588 |
| 170 | Ga0068855_100520077 | 3300005563 | Bacteria | 1291 |
| 171 | Ga0068855_100690316 | 3300005563 | Bacteria | 1093 |
| 172 | Ga0070664_100005236 | 3300005564 | Bacteria | 10408 |
| 173 | Ga0070664_100032121 | 3300005564 | Bacteria | 4391 |
| 174 | Ga0070664_100042869 | 3300005564 | Bacteria | 3818 |
| 175 | Ga0068857_100001716 | 3300005577 | Bacteria | 17629 |
| 176 | Ga0068857_100014661 | 3300005577 | Bacteria | 6836 |
| 177 | Ga0068857_100044542 | 3300005577 | Bacteria | 3936 |
| 178 | Ga0068857_100046567 | 3300005577 | Bacteria | 3849 |
| 179 | Ga0068857_100229944 | 3300005577 | Bacteria | 1696 |
| 180 | Ga0068854_100040449 | 3300005578 | Bacteria | 3289 |
| 181 | Ga0068854_100395655 | 3300005578 | Bacteria | 1142 |
| 182 | Ga0068856_100001155 | 3300005614 | Bacteria | 27745 |
| 183 | Ga0068856_100012101 | 3300005614 | Bacteria | 8355 |
| 184 | Ga0068856_100045350 | 3300005614 | Bacteria | 4329 |
| 185 | Ga0068856_100050481 | 3300005614 | Bacteria | 4101 |
| 186 | Ga0068856_100093116 | 3300005614 | Bacteria | 2999 |
| 187 | Ga0068856_100148395 | 3300005614 | Bacteria | 2353 |
| 188 | Ga0068856_100186615 | 3300005614 | Bacteria | 2087 |
| 189 | Ga0068856_100225387 | 3300005614 | Bacteria | 1890 |
| 190 | Ga0068856_100938908 | 3300005614 | Bacteria | 884 |
| 191 | Ga0068852_100005543 | 3300005616 | Bacteria | 9051 |
| 192 | Ga0068852_100117022 | 3300005616 | Bacteria | 2433 |
| 193 | Ga0068852_100214924 | 3300005616 | Bacteria | 1826 |
| 194 | Ga0068852_100385361 | 3300005616 | Bacteria | 1376 |
| 195 | Ga0068852_100600057 | 3300005616 | Bacteria | 1105 |
| 196 | Ga0068859_100004525 | 3300005617 | Bacteria | 14180 |
| 197 | Ga0068859_100005457 | 3300005617 | Bacteria | 12935 |
| 198 | Ga0068859_100013275 | 3300005617 | Bacteria | 8264 |
| 199 | Ga0068859_100022856 | 3300005617 | Bacteria | 6270 |
| 200 | Ga0068859_100042002 | 3300005617 | Bacteria | 4592 |
| 201 | Ga0068859_100090054 | 3300005617 | Bacteria | 3118 |
| 202 | Ga0068864_100007308 | 3300005618 | Bacteria | 9087 |
| 203 | Ga0068866_10135818 | 3300005718 | Bacteria | 1405 |
| 204 | Ga0068866_10138092 | 3300005718 | Bacteria | 1396 |
| 205 | Ga0068861_100033169 | 3300005719 | Bacteria | 3807 |
| 206 | Ga0068851_10050635 | 3300005834 | Bacteria | 2109 |
| 207 | Ga0068870_10115415 | 3300005840 | Bacteria | 1539 |
| 208 | Ga0068863_100159874 | 3300005841 | Bacteria | 2158 |
| 209 | Ga0068863_100189881 | 3300005841 | Bacteria | 1974 |
| 210 | Ga0068863_100423301 | 3300005841 | Bacteria | 1305 |
| 211 | Ga0068858_100044822 | 3300005842 | Bacteria | 4099 |
| 212 | Ga0068858_100081025 | 3300005842 | Bacteria | 3017 |
| 213 | Ga0068858_100087319 | 3300005842 | Bacteria | 2901 |
| 214 | Ga0068858_101029335 | 3300005842 | Bacteria | 807 |
| 215 | Ga0068860_100002154 | 3300005843 | Bacteria | 20736 |
| 216 | Ga0068860_100022913 | 3300005843 | Bacteria | 6038 |
| 217 | Ga0068860_100077181 | 3300005843 | Bacteria | 3167 |
| 218 | Ga0068860_100086977 | 3300005843 | Bacteria | 2975 |
| 219 | Ga0068860_100114836 | 3300005843 | Bacteria | 2574 |
| 220 | Ga0068860_100396780 | 3300005843 | Bacteria | 1364 |
| 221 | Ga0068862_100001370 | 3300005844 | Bacteria | 22653 |
| 222 | Ga0068862_100067215 | 3300005844 | Bacteria | 3090 |
| 223 | Ga0068862_100168512 | 3300005844 | Bacteria | 1959 |
| 224 | Ga0068862_100293880 | 3300005844 | Bacteria | 1493 |
| 225 | Ga0068862_100576719 | 3300005844 | Bacteria | 1077 |
| 226 | Ga0068862_100656691 | 3300005844 | Bacteria | 1012 |
| 227 | Ga0081539_10053522 | 3300005985 | Bacteria | 2259 |
| 228 | Ga0070715_10009819 | 3300006163 | Bacteria | 3390 |
| 229 | Ga0075366_10001635 | 3300006195 | Bacteria | 11237 |
| 230 | Ga0075366_10105868 | 3300006195 | Bacteria | 1691 |
| 231 | Ga0075366_10245551 | 3300006195 | Bacteria | 1092 |
| 232 | Ga0097621_100002096 | 3300006237 | Bacteria | 13664 |
| 233 | Ga0097621_100006750 | 3300006237 | Bacteria | 8150 |
| 234 | Ga0097621_100098003 | 3300006237 | Bacteria | 2462 |
| 235 | Ga0097621_100153206 | 3300006237 | Unclassified | 1977 |
| 236 | Ga0097621_100157317 | 3300006237 | Bacteria | 1951 |
| 237 | Ga0068871_100000196 | 3300006358 | Bacteria | 41550 |
| 238 | Ga0068871_100002609 | 3300006358 | Bacteria | 12299 |
| 239 | Ga0068871_100016800 | 3300006358 | Bacteria | 5524 |
| 240 | Ga0068865_100000022 | 3300006881 | Bacteria | 102976 |
| 241 | Ga0068865_100133962 | 3300006881 | Bacteria | 1859 |
| 242 | Ga0068865_100430604 | 3300006881 | Bacteria | 1087 |
| 243 | Ga0097620_100004525 | 3300006931 | Bacteria | 14180 |
| 244 | Ga0097620_100005457 | 3300006931 | Bacteria | 12935 |
| 245 | Ga0097620_100013274 | 3300006931 | Bacteria | 8264 |
| 246 | Ga0097620_100022856 | 3300006931 | Bacteria | 6270 |
| 247 | Ga0097620_100042001 | 3300006931 | Bacteria | 4592 |
| 248 | Ga0097620_100090054 | 3300006931 | Bacteria | 3118 |
| 249 | Ga0105240_10000011 | 3300009093 | Bacteria | 523646 |
| 250 | Ga0105240_10000126 | 3300009093 | Bacteria | 157403 |
| 251 | Ga0105240_10003724 | 3300009093 | Bacteria | 23554 |
| 252 | Ga0105240_10006944 | 3300009093 | Bacteria | 16540 |
| 253 | Ga0105240_10031376 | 3300009093 | Bacteria | 6892 |
| 254 | Ga0105240_10058570 | 3300009093 | Bacteria | 4809 |
| 255 | Ga0105240_10260825 | 3300009093 | Bacteria | 1999 |
| 256 | Ga0105240_10281022 | 3300009093 | Bacteria | 1912 |
| 257 | Ga0105240_10283953 | 3300009093 | Bacteria | 1900 |
| 258 | Ga0105240_10393709 | 3300009093 | Bacteria | 1562 |
| 259 | Ga0105240_10394176 | 3300009093 | Bacteria | 1561 |
| 260 | Ga0105240_10396497 | 3300009093 | Bacteria | 1555 |
| 261 | Ga0105240_10578221 | 3300009093 | Bacteria | 1239 |
| 262 | Ga0111539_10086428 | 3300009094 | Bacteria | 3685 |
| 263 | Ga0105245_10157763 | 3300009098 | Bacteria | 2150 |
| 264 | Ga0105245_10161636 | 3300009098 | Bacteria | 2126 |
| 265 | Ga0105245_10283948 | 3300009098 | Bacteria | 1619 |
| 266 | Ga0105247_10022655 | 3300009101 | Bacteria | 3783 |
| 267 | Ga0105243_10000025 | 3300009148 | Bacteria | 193732 |
| 268 | Ga0105241_10000238 | 3300009174 | Bacteria | 41677 |
| 269 | Ga0105241_10002650 | 3300009174 | Bacteria | 13403 |
| 270 | Ga0105241_10033116 | 3300009174 | Bacteria | 3878 |
| 271 | Ga0105241_10139578 | 3300009174 | Bacteria | 1972 |
| 272 | Ga0105241_10169259 | 3300009174 | Bacteria | 1803 |
| 273 | Ga0105241_10217437 | 3300009174 | Bacteria | 1604 |
| 274 | Ga0105241_10388882 | 3300009174 | Bacteria | 1221 |
| 275 | Ga0105241_10584519 | 3300009174 | Bacteria | 1007 |
| 276 | Ga0105241_10996612 | 3300009174 | Bacteria | 783 |
| 277 | Ga0105242_10035854 | 3300009176 | Bacteria | 3978 |
| 278 | Ga0105242_10039472 | 3300009176 | Bacteria | 3800 |
| 279 | Ga0105242_10087704 | 3300009176 | Bacteria | 2613 |
| 280 | Ga0105242_10181646 | 3300009176 | Bacteria | 1856 |
| 281 | Ga0105242_10341845 | 3300009176 | Bacteria | 1379 |
| 282 | Ga0105237_10000233 | 3300009545 | Bacteria | 79346 |
| 283 | Ga0105237_10001823 | 3300009545 | Bacteria | 27486 |
| 284 | Ga0105237_10005111 | 3300009545 | Bacteria | 14884 |
| 285 | Ga0105237_10018370 | 3300009545 | Bacteria | 7236 |
| 286 | Ga0105237_10018921 | 3300009545 | Bacteria | 7119 |
| 287 | Ga0105237_10088012 | 3300009545 | Bacteria | 3095 |
| 288 | Ga0105237_10228280 | 3300009545 | Bacteria | 1862 |
| 289 | Ga0105237_10597402 | 3300009545 | Bacteria | 1111 |
| 290 | Ga0105237_10629128 | 3300009545 | Bacteria | 1080 |
| 291 | Ga0105238_10008082 | 3300009551 | Bacteria | 10522 |
| 292 | Ga0105238_10100505 | 3300009551 | Bacteria | 2875 |
| 293 | Ga0105238_10410558 | 3300009551 | Bacteria | 1348 |
| 294 | Ga0105249_10083416 | 3300009553 | Bacteria | 2975 |
| 295 | Ga0105249_10108101 | 3300009553 | Bacteria | 2625 |
| 296 | Ga0105249_10210986 | 3300009553 | Bacteria | 1906 |
| 297 | Ga0105249_10276369 | 3300009553 | Bacteria | 1675 |
| 298 | Ga0105239_10000005 | 3300010375 | Bacteria | 496066 |
| 299 | Ga0105239_10000013 | 3300010375 | Bacteria | 327371 |
| 300 | Ga0105239_10000122 | 3300010375 | Bacteria | 109167 |
| 301 | Ga0105239_10002186 | 3300010375 | Bacteria | 25152 |
| 302 | Ga0105239_10004534 | 3300010375 | Bacteria | 16549 |
| 303 | Ga0105239_10004850 | 3300010375 | Bacteria | 15914 |
| 304 | Ga0105239_10022560 | 3300010375 | Bacteria | 6941 |
| 305 | Ga0105239_10073693 | 3300010375 | Bacteria | 3753 |
| 306 | Ga0105239_10097656 | 3300010375 | Bacteria | 3246 |
| 307 | Ga0105239_10242292 | 3300010375 | Bacteria | 2024 |
| 308 | Ga0105246_10286234 | 3300011119 | Bacteria | 1324 |
| 309 | Ga0105246_10967653 | 3300011119 | Bacteria | 768 |
| 310 | Ga0157373_10000199 | 3300013100 | Bacteria | 49515 |
| 311 | Ga0157373_10002419 | 3300013100 | Bacteria | 14191 |
| 312 | Ga0157373_10002632 | 3300013100 | Bacteria | 13617 |
| 313 | Ga0157373_10003027 | 3300013100 | Bacteria | 12673 |
| 314 | Ga0157373_10008475 | 3300013100 | Bacteria | 7634 |
| 315 | Ga0157373_10013487 | 3300013100 | Bacteria | 5994 |
| 316 | Ga0157373_10016428 | 3300013100 | Bacteria | 5400 |
| 317 | Ga0157373_10055300 | 3300013100 | Bacteria | 2819 |
| 318 | Ga0157373_10062311 | 3300013100 | Bacteria | 2641 |
| 319 | Ga0157373_10122817 | 3300013100 | Bacteria | 1825 |
| 320 | Ga0157371_10000529 | 3300013102 | Bacteria | 45499 |
| 321 | Ga0157371_10000620 | 3300013102 | Bacteria | 42287 |
| 322 | Ga0157371_10000903 | 3300013102 | Bacteria | 33458 |
| 323 | Ga0157371_10001268 | 3300013102 | Bacteria | 26605 |
| 324 | Ga0157371_10002520 | 3300013102 | Bacteria | 17411 |
| 325 | Ga0157371_10004074 | 3300013102 | Bacteria | 12917 |
| 326 | Ga0157371_10007629 | 3300013102 | Bacteria | 8727 |
| 327 | Ga0157371_10008584 | 3300013102 | Bacteria | 8121 |
| 328 | Ga0157371_10009843 | 3300013102 | Bacteria | 7491 |
| 329 | Ga0157371_10014830 | 3300013102 | Bacteria | 5867 |
| 330 | Ga0157371_10018887 | 3300013102 | Bacteria | 5092 |
| 331 | Ga0157371_10050537 | 3300013102 | Bacteria | 2954 |
| 332 | Ga0157371_10074503 | 3300013102 | Bacteria | 2404 |
| 333 | Ga0157371_10171419 | 3300013102 | Bacteria | 1551 |
| 334 | Ga0157370_10000207 | 3300013104 | Bacteria | 74451 |
| 335 | Ga0157370_10002038 | 3300013104 | Bacteria | 24827 |
| 336 | Ga0157370_10002831 | 3300013104 | Bacteria | 20740 |
| 337 | Ga0157370_10003741 | 3300013104 | Bacteria | 17784 |
| 338 | Ga0157370_10007572 | 3300013104 | Bacteria | 11796 |
| 339 | Ga0157370_10011824 | 3300013104 | Bacteria | 9107 |
| 340 | Ga0157370_10013593 | 3300013104 | Bacteria | 8377 |
| 341 | Ga0157370_10013720 | 3300013104 | Bacteria | 8330 |
| 342 | Ga0157370_10022568 | 3300013104 | Bacteria | 6263 |
| 343 | Ga0157370_10031796 | 3300013104 | Bacteria | 5159 |
| 344 | Ga0157370_10487207 | 3300013104 | Bacteria | 1133 |
| 345 | Ga0157369_10000039 | 3300013105 | Bacteria | 188947 |
| 346 | Ga0157369_10000071 | 3300013105 | Bacteria | 140377 |
| 347 | Ga0157369_10009198 | 3300013105 | Bacteria | 11303 |
| 348 | Ga0157369_10035552 | 3300013105 | Bacteria | 5462 |
| 349 | Ga0157369_10091713 | 3300013105 | Bacteria | 3243 |
| 350 | Ga0157369_10105244 | 3300013105 | Bacteria | 3004 |
| 351 | Ga0157374_10001622 | 3300013296 | Bacteria | 18852 |
| 352 | Ga0157374_10003352 | 3300013296 | Bacteria | 13449 |
| 353 | Ga0157374_10008373 | 3300013296 | Bacteria | 8831 |
| 354 | Ga0157374_10015042 | 3300013296 | Bacteria | 6783 |
| 355 | Ga0157374_10222909 | 3300013296 | Bacteria | 1851 |
| 356 | Ga0157374_10334177 | 3300013296 | Bacteria | 1503 |
| 357 | Ga0157374_10348151 | 3300013296 | Bacteria | 1472 |
| 358 | Ga0157378_10003085 | 3300013297 | Bacteria | 14806 |
| 359 | Ga0157378_10006215 | 3300013297 | Bacteria | 10456 |
| 360 | Ga0157378_10072667 | 3300013297 | Bacteria | 3091 |
| 361 | Ga0157378_10109877 | 3300013297 | Bacteria | 2526 |
| 362 | Ga0157378_10168134 | 3300013297 | Bacteria | 2055 |
| 363 | Ga0157378_10209543 | 3300013297 | Bacteria | 1847 |
| 364 | Ga0157378_10531899 | 3300013297 | Bacteria | 1178 |
| 365 | Ga0157378_10945081 | 3300013297 | Bacteria | 894 |
| 366 | Ga0163162_10000024 | 3300013306 | Bacteria | 188515 |
| 367 | Ga0163162_10000882 | 3300013306 | Bacteria | 27892 |
| 368 | Ga0163162_10001708 | 3300013306 | Bacteria | 20592 |
| 369 | Ga0163162_10003984 | 3300013306 | Bacteria | 14163 |
| 370 | Ga0163162_10042161 | 3300013306 | Bacteria | 4566 |
| 371 | Ga0163162_10063454 | 3300013306 | Bacteria | 3737 |
| 372 | Ga0163162_10065752 | 3300013306 | Bacteria | 3674 |
| 373 | Ga0163162_10067136 | 3300013306 | Bacteria | 3636 |
| 374 | Ga0163162_10232405 | 3300013306 | Bacteria | 1974 |
| 375 | Ga0157372_10000001 | 3300013307 | Bacteria | 791349 |
| 376 | Ga0157372_10001038 | 3300013307 | Bacteria | 30369 |
| 377 | Ga0157372_10001070 | 3300013307 | Bacteria | 29934 |
| 378 | Ga0157372_10004146 | 3300013307 | Bacteria | 15520 |
| 379 | Ga0157372_10004415 | 3300013307 | Bacteria | 14998 |
| 380 | Ga0157372_10007653 | 3300013307 | Bacteria | 11486 |
| 381 | Ga0157372_10018299 | 3300013307 | Bacteria | 7531 |
| 382 | Ga0157372_10053155 | 3300013307 | Bacteria | 4513 |
| 383 | Ga0157372_10065184 | 3300013307 | Bacteria | 4089 |
| 384 | Ga0157372_10089720 | 3300013307 | Bacteria | 3493 |
| 385 | Ga0157372_10100561 | 3300013307 | Bacteria | 3299 |
| 386 | Ga0157372_10224886 | 3300013307 | Bacteria | 2176 |
| 387 | Ga0157372_10723905 | 3300013307 | Bacteria | 1157 |
| 388 | Ga0157375_10003648 | 3300013308 | Bacteria | 13356 |
| 389 | Ga0157375_10016319 | 3300013308 | Bacteria | 6667 |
| 390 | Ga0157375_10127509 | 3300013308 | Bacteria | 2661 |
| 391 | Ga0157375_10253242 | 3300013308 | Bacteria | 1922 |
| 392 | Ga0157375_10529722 | 3300013308 | Bacteria | 1341 |
| 393 | Ga0157375_10649475 | 3300013308 | Bacteria | 1211 |
| 394 | Ga0157375_11318909 | 3300013308 | Bacteria | 849 |
| 395 | Ga0163163_10001556 | 3300014325 | Bacteria | 19351 |
| 396 | Ga0163163_10012108 | 3300014325 | Bacteria | 7850 |
| 397 | Ga0163163_10077719 | 3300014325 | Bacteria | 3314 |
| 398 | Ga0163163_10524286 | 3300014325 | Bacteria | 1247 |
| 399 | Ga0157380_10002192 | 3300014326 | Bacteria | 13126 |
| 400 | Ga0157380_10235842 | 3300014326 | Bacteria | 1646 |
| 401 | Ga0157380_10552350 | 3300014326 | Bacteria | 1130 |
| 402 | Ga0182008_10000009 | 3300014497 | Bacteria | 331416 |
| 403 | Ga0182008_10001007 | 3300014497 | Bacteria | 19580 |
| 404 | Ga0182008_10009542 | 3300014497 | Bacteria | 5230 |
| 405 | Ga0182008_10026303 | 3300014497 | Bacteria | 2951 |
| 406 | Ga0182008_10026857 | 3300014497 | Bacteria | 2919 |
| 407 | Ga0157377_10007003 | 3300014745 | Bacteria | 5417 |
| 408 | Ga0157377_10302779 | 3300014745 | Bacteria | 1056 |
| 409 | Ga0157379_10079067 | 3300014968 | Bacteria | 2945 |
| 410 | Ga0157379_10460926 | 3300014968 | Bacteria | 1175 |
| 411 | Ga0157376_10011991 | 3300014969 | Bacteria | 6412 |
| 412 | Ga0157376_10015574 | 3300014969 | Bacteria | 5749 |
| 413 | Ga0157376_10132960 | 3300014969 | Bacteria | 2223 |
| 414 | Ga0157376_10241742 | 3300014969 | Bacteria | 1682 |
| 415 | Ga0157376_10392818 | 3300014969 | Bacteria | 1339 |
| 416 | Ga0182006_1000332 | 3300015261 | Bacteria | 40804 |
| 417 | Ga0182006_1000356 | 3300015261 | Bacteria | 38331 |
| 418 | Ga0182006_1001370 | 3300015261 | Bacteria | 14836 |
| 419 | Ga0182006_1004469 | 3300015261 | Bacteria | 6885 |
| 420 | Ga0182007_10000006 | 3300015262 | Bacteria | 427355 |
| 421 | Ga0182007_10009267 | 3300015262 | Bacteria | 3983 |
| 422 | Ga0182007_10017706 | 3300015262 | Bacteria | 2596 |
| 423 | Ga0182007_10018127 | 3300015262 | Bacteria | 2557 |
| 424 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 425 | Ga0163161_10000309 | 3300017792 | Bacteria | 42593 |
| 426 | Ga0163161_10000394 | 3300017792 | Bacteria | 36483 |
| 427 | Ga0163161_10001188 | 3300017792 | Bacteria | 19557 |
| 428 | Ga0163161_10001366 | 3300017792 | Bacteria | 18108 |
| 429 | Ga0163161_10013505 | 3300017792 | Bacteria | 5686 |
| 430 | Ga0163161_10093566 | 3300017792 | Bacteria | 2227 |
| 431 | Ga0163161_10184672 | 3300017792 | Bacteria | 1600 |
| 432 | Ga0213872_10009172 | 3300021361 | Bacteria | 4756 |
| 433 | Ga0213872_10053446 | 3300021361 | Bacteria | 1832 |
| 434 | Ga0207427_100106 | 3300025231 | Bacteria | 117041 |
| 435 | Ga0209437_100077 | 3300025233 | Bacteria | 286656 |
| 436 | Ga0209437_100226 | 3300025233 | Bacteria | 100303 |
| 437 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 438 | Ga0209026_1001905 | 3300025250 | Bacteria | 8463 |
| 439 | Ga0209026_1012739 | 3300025250 | Bacteria | 1454 |
| 440 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 441 | Ga0209233_1000089 | 3300025261 | Bacteria | 316381 |
| 442 | Ga0209233_1001139 | 3300025261 | Bacteria | 10845 |
| 443 | Ga0209455_1002616 | 3300025272 | Bacteria | 6840 |
| 444 | Ga0209676_1000090 | 3300025292 | Bacteria | 256336 |
| 445 | Ga0209025_1000089 | 3300025294 | Bacteria | 254130 |
| 446 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 447 | Ga0209050_1000091 | 3300025298 | Bacteria | 253049 |
| 448 | Ga0207697_10040271 | 3300025315 | Bacteria | 1919 |
| 449 | Ga0207680_10564099 | 3300025903 | Bacteria | 813 |
| 450 | Ga0207647_10000354 | 3300025904 | Bacteria | 37206 |
| 451 | Ga0207647_10000473 | 3300025904 | Bacteria | 32482 |
| 452 | Ga0207647_10035567 | 3300025904 | Bacteria | 3173 |
| 453 | Ga0207647_10185355 | 3300025904 | Bacteria | 1207 |
| 454 | Ga0207645_10000500 | 3300025907 | Bacteria | 32432 |
| 455 | Ga0207645_10065394 | 3300025907 | Bacteria | 2324 |
| 456 | Ga0207643_10022447 | 3300025908 | Bacteria | 3474 |
| 457 | Ga0207643_10091934 | 3300025908 | Bacteria | 1770 |
| 458 | Ga0207705_10000040 | 3300025909 | Bacteria | 185735 |
| 459 | Ga0207705_10018591 | 3300025909 | Bacteria | 4967 |
| 460 | Ga0207705_10030421 | 3300025909 | Bacteria | 3853 |
| 461 | Ga0207705_10043320 | 3300025909 | Bacteria | 3233 |
| 462 | Ga0207705_10265166 | 3300025909 | Bacteria | 1312 |
| 463 | Ga0207705_10287661 | 3300025909 | Bacteria | 1259 |
| 464 | Ga0207705_10736745 | 3300025909 | Bacteria | 766 |
| 465 | Ga0207654_10000448 | 3300025911 | Bacteria | 23559 |
| 466 | Ga0207654_10063509 | 3300025911 | Bacteria | 2167 |
| 467 | Ga0207654_10084913 | 3300025911 | Bacteria | 1915 |
| 468 | Ga0207654_10090860 | 3300025911 | Bacteria | 1861 |
| 469 | Ga0207654_10132934 | 3300025911 | Bacteria | 1577 |
| 470 | Ga0207654_10170802 | 3300025911 | Bacteria | 1412 |
| 471 | Ga0207707_10037174 | 3300025912 | Bacteria | 4254 |
| 472 | Ga0207695_10000010 | 3300025913 | Bacteria | 981919 |
| 473 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 474 | Ga0207695_10009521 | 3300025913 | Bacteria | 12012 |
| 475 | Ga0207695_10012640 | 3300025913 | Bacteria | 10113 |
| 476 | Ga0207695_10049264 | 3300025913 | Bacteria | 4443 |
| 477 | Ga0207695_10100313 | 3300025913 | Bacteria | 2891 |
| 478 | Ga0207695_10130012 | 3300025913 | Bacteria | 2476 |
| 479 | Ga0207695_10179269 | 3300025913 | Bacteria | 2040 |
| 480 | Ga0207695_10209543 | 3300025913 | Bacteria | 1860 |
| 481 | Ga0207695_10232220 | 3300025913 | Bacteria | 1748 |
| 482 | Ga0207695_10280140 | 3300025913 | Bacteria | 1561 |
| 483 | Ga0207695_10312508 | 3300025913 | Bacteria | 1461 |
| 484 | Ga0207671_10000728 | 3300025914 | Bacteria | 41791 |
| 485 | Ga0207671_10001284 | 3300025914 | Bacteria | 29519 |
| 486 | Ga0207671_10004426 | 3300025914 | Bacteria | 13457 |
| 487 | Ga0207671_10005736 | 3300025914 | Bacteria | 11317 |
| 488 | Ga0207671_10009466 | 3300025914 | Bacteria | 8141 |
| 489 | Ga0207671_10015688 | 3300025914 | Bacteria | 5922 |
| 490 | Ga0207671_10031607 | 3300025914 | Bacteria | 3944 |
| 491 | Ga0207671_10149616 | 3300025914 | Bacteria | 1803 |
| 492 | Ga0207660_10018889 | 3300025917 | Bacteria | 4603 |
| 493 | Ga0207660_10137633 | 3300025917 | Bacteria | 1865 |
| 494 | Ga0207660_10243584 | 3300025917 | Bacteria | 1417 |
| 495 | Ga0207657_10002882 | 3300025919 | Bacteria | 18481 |
| 496 | Ga0207657_10126977 | 3300025919 | Bacteria | 2094 |
| 497 | Ga0207657_10205457 | 3300025919 | Bacteria | 1582 |
| 498 | Ga0207657_10244398 | 3300025919 | Bacteria | 1432 |
| 499 | Ga0207657_10533440 | 3300025919 | Bacteria | 918 |
| 500 | Ga0207649_10002378 | 3300025920 | Bacteria | 10551 |
| 501 | Ga0207649_10018665 | 3300025920 | Bacteria | 3950 |
| 502 | Ga0207652_10000010 | 3300025921 | Bacteria | 247079 |
| 503 | Ga0207652_10000844 | 3300025921 | Bacteria | 29188 |
| 504 | Ga0207652_10015718 | 3300025921 | Bacteria | 6165 |
| 505 | Ga0207652_10346613 | 3300025921 | Bacteria | 1341 |
| 506 | Ga0207652_10605735 | 3300025921 | Bacteria | 982 |
| 507 | Ga0207681_10019641 | 3300025923 | Bacteria | 4272 |
| 508 | Ga0207681_10452488 | 3300025923 | Bacteria | 1045 |
| 509 | Ga0207694_10008772 | 3300025924 | Bacteria | 7628 |
| 510 | Ga0207650_10049197 | 3300025925 | Bacteria | 3112 |
| 511 | Ga0207650_10064839 | 3300025925 | Bacteria | 2735 |
| 512 | Ga0207650_10079521 | 3300025925 | Bacteria | 2483 |
| 513 | Ga0207650_10157874 | 3300025925 | Bacteria | 1795 |
| 514 | Ga0207650_10461484 | 3300025925 | Bacteria | 1058 |
| 515 | Ga0207659_10107346 | 3300025926 | Unclassified | 2116 |
| 516 | Ga0207659_10213382 | 3300025926 | Bacteria | 1548 |
| 517 | Ga0207664_10360881 | 3300025929 | Unclassified | 1287 |
| 518 | Ga0207644_10004161 | 3300025931 | Bacteria | 9381 |
| 519 | Ga0207644_10103457 | 3300025931 | Bacteria | 2143 |
| 520 | Ga0207644_10141493 | 3300025931 | Bacteria | 1853 |
| 521 | Ga0207644_10683453 | 3300025931 | Bacteria | 855 |
| 522 | Ga0207690_10001498 | 3300025932 | Bacteria | 14585 |
| 523 | Ga0207690_10023076 | 3300025932 | Bacteria | 3880 |
| 524 | Ga0207690_10101916 | 3300025932 | Bacteria | 2052 |
| 525 | Ga0207690_10190744 | 3300025932 | Bacteria | 1550 |
| 526 | Ga0207706_10000442 | 3300025933 | Bacteria | 44334 |
| 527 | Ga0207706_10007192 | 3300025933 | Bacteria | 10293 |
| 528 | Ga0207706_10019195 | 3300025933 | Bacteria | 6147 |
| 529 | Ga0207706_10046944 | 3300025933 | Bacteria | 3823 |
| 530 | Ga0207706_10342410 | 3300025933 | Bacteria | 1301 |
| 531 | Ga0207686_10022554 | 3300025934 | Bacteria | 3627 |
| 532 | Ga0207686_10055929 | 3300025934 | Bacteria | 2478 |
| 533 | Ga0207686_10071244 | 3300025934 | Bacteria | 2236 |
| 534 | Ga0207686_10381434 | 3300025934 | Bacteria | 1069 |
| 535 | Ga0207709_10000003 | 3300025935 | Bacteria | 1050072 |
| 536 | Ga0207670_10062668 | 3300025936 | Bacteria | 2542 |
| 537 | Ga0207670_10112529 | 3300025936 | Bacteria | 1964 |
| 538 | Ga0207669_10155222 | 3300025937 | Bacteria | 1609 |
| 539 | Ga0207669_10281219 | 3300025937 | Bacteria | 1255 |
| 540 | Ga0207704_10000011 | 3300025938 | Bacteria | 180140 |
| 541 | Ga0207704_10084013 | 3300025938 | Bacteria | 2068 |
| 542 | Ga0207704_10086891 | 3300025938 | Bacteria | 2041 |
| 543 | Ga0207704_10201454 | 3300025938 | Bacteria | 1457 |
| 544 | Ga0207691_10062524 | 3300025940 | Bacteria | 3378 |
| 545 | Ga0207691_10224947 | 3300025940 | Bacteria | 1626 |
| 546 | Ga0207691_10737289 | 3300025940 | Bacteria | 830 |
| 547 | Ga0207689_10007865 | 3300025942 | Bacteria | 9315 |
| 548 | Ga0207689_10023823 | 3300025942 | Bacteria | 5135 |
| 549 | Ga0207689_10031604 | 3300025942 | Bacteria | 4405 |
| 550 | Ga0207689_10101630 | 3300025942 | Bacteria | 2362 |
| 551 | Ga0207689_10219548 | 3300025942 | Bacteria | 1571 |
| 552 | Ga0207689_10447122 | 3300025942 | Bacteria | 1080 |
| 553 | Ga0207661_10003428 | 3300025944 | Bacteria | 11003 |
| 554 | Ga0207661_10012229 | 3300025944 | Bacteria | 6234 |
| 555 | Ga0207661_10083125 | 3300025944 | Bacteria | 2649 |
| 556 | Ga0207679_10002266 | 3300025945 | Bacteria | 11867 |
| 557 | Ga0207679_10007295 | 3300025945 | Bacteria | 7006 |
| 558 | Ga0207679_10060241 | 3300025945 | Bacteria | 2820 |
| 559 | Ga0207667_10000020 | 3300025949 | Bacteria | 374770 |
| 560 | Ga0207667_10001278 | 3300025949 | Bacteria | 31572 |
| 561 | Ga0207667_10043117 | 3300025949 | Bacteria | 4789 |
| 562 | Ga0207667_10289202 | 3300025949 | Bacteria | 1674 |
| 563 | Ga0207667_10640882 | 3300025949 | Bacteria | 1069 |
| 564 | Ga0207667_10835331 | 3300025949 | Bacteria | 916 |
| 565 | Ga0207667_10916060 | 3300025949 | Bacteria | 868 |
| 566 | Ga0207651_10003816 | 3300025960 | Bacteria | 7468 |
| 567 | Ga0207651_10017197 | 3300025960 | Bacteria | 4264 |
| 568 | Ga0207712_10012182 | 3300025961 | Bacteria | 5493 |
| 569 | Ga0207712_10019417 | 3300025961 | Bacteria | 4438 |
| 570 | Ga0207712_10024434 | 3300025961 | Bacteria | 4002 |
| 571 | Ga0207668_10042758 | 3300025972 | Bacteria | 3071 |
| 572 | Ga0207640_10062388 | 3300025981 | Bacteria | 2473 |
| 573 | Ga0207640_10379996 | 3300025981 | Bacteria | 1144 |
| 574 | Ga0207658_10041786 | 3300025986 | Bacteria | 3322 |
| 575 | Ga0207658_10159321 | 3300025986 | Bacteria | 1848 |
| 576 | Ga0207677_10006442 | 3300026023 | Bacteria | 6442 |
| 577 | Ga0207677_10019837 | 3300026023 | Bacteria | 4069 |
| 578 | Ga0207677_10057892 | 3300026023 | Bacteria | 2665 |
| 579 | Ga0207677_10099842 | 3300026023 | Bacteria | 2133 |
| 580 | Ga0207677_10624684 | 3300026023 | Unclassified | 948 |
| 581 | Ga0207703_10113372 | 3300026035 | Unclassified | 2317 |
| 582 | Ga0207703_10125105 | 3300026035 | Bacteria | 2212 |
| 583 | Ga0207703_10285197 | 3300026035 | Bacteria | 1501 |
| 584 | Ga0207703_10942308 | 3300026035 | Bacteria | 827 |
| 585 | Ga0207639_10003710 | 3300026041 | Bacteria | 10275 |
| 586 | Ga0207639_10013988 | 3300026041 | Bacteria | 5630 |
| 587 | Ga0207639_10018026 | 3300026041 | Bacteria | 5009 |
| 588 | Ga0207639_10091147 | 3300026041 | Bacteria | 2440 |
| 589 | Ga0207639_10281357 | 3300026041 | Bacteria | 1463 |
| 590 | Ga0207639_10310803 | 3300026041 | Bacteria | 1396 |
| 591 | Ga0207639_10745085 | 3300026041 | Unclassified | 911 |
| 592 | Ga0207678_10015406 | 3300026067 | Bacteria | 6724 |
| 593 | Ga0207678_10052313 | 3300026067 | Bacteria | 3524 |
| 594 | Ga0207678_10284339 | 3300026067 | Bacteria | 1420 |
| 595 | Ga0207678_10337725 | 3300026067 | Bacteria | 1298 |
| 596 | Ga0207702_10001532 | 3300026078 | Bacteria | 22854 |
| 597 | Ga0207702_10005183 | 3300026078 | Bacteria | 11457 |
| 598 | Ga0207702_10042134 | 3300026078 | Bacteria | 3829 |
| 599 | Ga0207702_10051753 | 3300026078 | Bacteria | 3473 |
| 600 | Ga0207702_10057981 | 3300026078 | Bacteria | 3294 |
| 601 | Ga0207702_10208531 | 3300026078 | Bacteria | 1815 |
| 602 | Ga0207702_10240259 | 3300026078 | Bacteria | 1697 |
| 603 | Ga0207641_10121938 | 3300026088 | Bacteria | 2328 |
| 604 | Ga0207641_10192789 | 3300026088 | Bacteria | 1874 |
| 605 | Ga0207648_10001059 | 3300026089 | Bacteria | 30821 |
| 606 | Ga0207648_10043714 | 3300026089 | Bacteria | 3933 |
| 607 | Ga0207648_10088004 | 3300026089 | Bacteria | 2711 |
| 608 | Ga0207648_10242851 | 3300026089 | Bacteria | 1604 |
| 609 | Ga0207676_10007397 | 3300026095 | Bacteria | 7787 |
| 610 | Ga0207676_10115397 | 3300026095 | Bacteria | 2255 |
| 611 | Ga0207676_10160310 | 3300026095 | Bacteria | 1948 |
| 612 | Ga0207676_10301240 | 3300026095 | Bacteria | 1464 |
| 613 | Ga0207674_10003303 | 3300026116 | Bacteria | 19833 |
| 614 | Ga0207674_10035923 | 3300026116 | Bacteria | 5169 |
| 615 | Ga0207674_10036409 | 3300026116 | Bacteria | 5129 |
| 616 | Ga0207674_10173016 | 3300026116 | Bacteria | 2112 |
| 617 | Ga0207675_100109943 | 3300026118 | Bacteria | 2601 |
| 618 | Ga0207675_100226444 | 3300026118 | Bacteria | 1803 |
| 619 | Ga0207675_100446484 | 3300026118 | Bacteria | 1281 |
| 620 | Ga0207683_10005152 | 3300026121 | Bacteria | 11224 |
| 621 | Ga0207683_10022575 | 3300026121 | Bacteria | 5403 |
| 622 | Ga0207698_10112732 | 3300026142 | Bacteria | 2283 |
| 623 | Ga0207698_10164191 | 3300026142 | Bacteria | 1946 |
| 624 | Ga0207698_10189610 | 3300026142 | Bacteria | 1830 |
| 625 | Ga0207698_10218359 | 3300026142 | Bacteria | 1721 |
| 626 | Ga0207698_10592970 | 3300026142 | Bacteria | 1092 |
| 627 | Ga0207698_10806199 | 3300026142 | Bacteria | 941 |
| 628 | Ga0207698_11013791 | 3300026142 | Bacteria | 841 |
| 629 | Ga0268266_10000380 | 3300028379 | Bacteria | 67791 |
| 630 | Ga0268266_10013332 | 3300028379 | Bacteria | 7083 |
| 631 | Ga0268266_10244256 | 3300028379 | Bacteria | 1658 |
| 632 | Ga0268265_10006391 | 3300028380 | Bacteria | 7987 |
| 633 | Ga0268265_10141310 | 3300028380 | Bacteria | 2016 |
| 634 | Ga0268265_10261745 | 3300028380 | Bacteria | 1538 |
| 635 | Ga0268265_10506968 | 3300028380 | Bacteria | 1138 |
| 636 | Ga0268264_10016735 | 3300028381 | Bacteria | 6002 |
| 637 | Ga0268264_10028367 | 3300028381 | Bacteria | 4579 |
| 638 | Ga0268264_10035430 | 3300028381 | Bacteria | 4109 |
| 639 | Ga0268264_10062469 | 3300028381 | Bacteria | 3128 |
| 640 | Ga0307517_10001632 | 3300028786 | Bacteria | 37097 |
| 641 | Ga0307515_10000280 | 3300028794 | Bacteria | 125330 |
| 642 | Ga0307515_10022378 | 3300028794 | Bacteria | 11140 |
| 643 | Ga0307515_10036778 | 3300028794 | Bacteria | 7905 |
| 644 | Ga0265338_10087151 | 3300028800 | Bacteria | 2595 |
| 645 | Ga0316177_1086062 | 3300030731 | Bacteria | 14675 |
| 646 | Ga0316176_1041743 | 3300030732 | Bacteria | 19091 |
| 647 | Ga0316183_1132422 | 3300030742 | Bacteria | 30134 |
| 648 | Ga0316181_1039957 | 3300030744 | Bacteria | 8183 |
| 649 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 650 | Ga0265327_10000046 | 3300031251 | Bacteria | 280722 |
| 651 | Ga0265327_10000159 | 3300031251 | Bacteria | 145537 |
| 652 | Ga0265327_10004250 | 3300031251 | Bacteria | 12841 |
| 653 | Ga0265327_10004741 | 3300031251 | Bacteria | 11860 |
| 654 | Ga0265327_10025635 | 3300031251 | Bacteria | 3433 |
| 655 | Ga0265327_10059389 | 3300031251 | Bacteria | 1959 |
| 656 | Ga0307509_10116904 | 3300031507 | Bacteria | 2655 |
| 657 | Ga0265314_10058108 | 3300031711 | Bacteria | 2652 |
| 658 | Ga0265314_10302299 | 3300031711 | Bacteria | 897 |
| 659 | Ga0307516_10206095 | 3300031730 | Bacteria | 1683 |
| 660 | Ga0307405_10000012 | 3300031731 | Bacteria | 233774 |
| 661 | Ga0307405_10005916 | 3300031731 | Bacteria | 5964 |
| 662 | Ga0307406_10502419 | 3300031901 | Bacteria | 983 |
| 663 | Ga0307407_10000013 | 3300031903 | Bacteria | 165614 |
| 664 | Ga0307412_10000084 | 3300031911 | Bacteria | 90908 |
| 665 | Ga0307412_10027245 | 3300031911 | Bacteria | 3561 |
| 666 | Ga0307412_10132054 | 3300031911 | Bacteria | 1815 |
| 667 | Ga0307416_100000028 | 3300032002 | Bacteria | 165572 |
| 668 | Ga0307416_100116527 | 3300032002 | Bacteria | 2369 |
| 669 | Ga0307414_10004686 | 3300032004 | Bacteria | 7457 |
| 670 | Ga0307414_10007511 | 3300032004 | Bacteria | 6126 |
| 671 | Ga0307414_10032759 | 3300032004 | Bacteria | 3426 |
| 672 | Ga0307414_10070261 | 3300032004 | Bacteria | 2521 |
| 673 | Ga0307414_10149495 | 3300032004 | Bacteria | 1840 |
| 674 | Ga0307414_10157053 | 3300032004 | Bacteria | 1802 |
| 675 | Ga0307414_10247729 | 3300032004 | Bacteria | 1479 |
| 676 | Ga0307414_10474955 | 3300032004 | Bacteria | 1102 |
| 677 | Ga0307411_10002789 | 3300032005 | Bacteria | 7864 |
| 678 | Ga0307411_10096172 | 3300032005 | Bacteria | 2081 |
| 679 | Ga0307411_10235116 | 3300032005 | Bacteria | 1431 |
| 680 | Ga0307507_10000052 | 3300033179 | Bacteria | 168303 |
| 681 | Ga0307510_10008290 | 3300033180 | Bacteria | 12386 |
| 682 | Ga0307510_10307297 | 3300033180 | Bacteria | 1046 |
| 683 | Ga0373932_0169051 | 3300035112 | Bacteria | 761 |
| 684 | Ga0373954_0036500 | 3300035118 | Unclassified | 2282 |
| 685 | Ga0373946_0160540 | 3300035171 | Bacteria | 1055 |
| 686 | Ga0373933_0168959 | 3300035724 | Bacteria | 1391 |
| 687 | Ga0373947_0041140 | 3300035725 | Bacteria | 2755 |
| 688 | Ga0373925_0059520 | 3300037068 | Bacteria | 2866 |
| 689 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 690 | Ga0395899_0000025 | 3300037312 | Bacteria | 350927 |
| 691 | Ga0395899_0000735 | 3300037312 | Bacteria | 32677 |
| 692 | Ga0395899_0038695 | 3300037312 | Bacteria | 3571 |
| 693 | Ga0395899_0097246 | 3300037312 | Bacteria | 2128 |
| 694 | Ga0395899_0105011 | 3300037312 | Bacteria | 2035 |
| 695 | Ga0395899_0115665 | 3300037312 | Bacteria | 1925 |
| 696 | Ga0395899_0211472 | 3300037312 | Bacteria | 1347 |
| 697 | Ga0395899_0306779 | 3300037312 | Bacteria | 1072 |
| 698 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 699 | Ga0395900_0000122 | 3300037418 | Bacteria | 133423 |
| 700 | Ga0395900_0006326 | 3300037418 | Bacteria | 12346 |
| 701 | Ga0395900_0007456 | 3300037418 | Bacteria | 11305 |
| 702 | Ga0395900_0034926 | 3300037418 | Bacteria | 5179 |
| 703 | Ga0395900_0041364 | 3300037418 | Bacteria | 4751 |
| 704 | Ga0395900_0052327 | 3300037418 | Bacteria | 4204 |
| 705 | Ga0395900_0096846 | 3300037418 | Bacteria | 3031 |
| 706 | Ga0395900_0179961 | 3300037418 | Bacteria | 2149 |
| 707 | Ga0395900_0367899 | 3300037418 | Bacteria | 1408 |
| 708 | Ga0395900_0495558 | 3300037418 | Bacteria | 1172 |
| 709 | Ga0395900_0756245 | 3300037418 | Bacteria | 902 |
| 710 | Ga0395898_0024518 | 3300037466 | Bacteria | 6083 |
| 711 | Ga0395898_0026930 | 3300037466 | Bacteria | 5776 |
| 712 | Ga0395898_0047336 | 3300037466 | Bacteria | 4220 |
| 713 | Ga0395898_0154386 | 3300037466 | Bacteria | 2196 |
| 714 | Ga0395898_0189279 | 3300037466 | Bacteria | 1966 |
| 715 | Ga0395898_0355309 | 3300037466 | Unclassified | 1397 |
| 716 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 717 | Ga0395905_0000037 | 3300037471 | Bacteria | 261808 |
| 718 | Ga0395905_0001611 | 3300037471 | Bacteria | 26826 |
| 719 | Ga0395905_0007405 | 3300037471 | Bacteria | 10913 |
| 720 | Ga0395905_0035016 | 3300037471 | Bacteria | 4714 |
| 721 | Ga0395905_0185797 | 3300037471 | Bacteria | 1951 |
| 722 | Ga0395905_0845263 | 3300037471 | Bacteria | 818 |
| 723 | Ga0395901_0000219 | 3300038443 | Bacteria | 71884 |
| 724 | Ga0395901_0001980 | 3300038443 | Bacteria | 21059 |
| 725 | Ga0395901_0001995 | 3300038443 | Bacteria | 21004 |
| 726 | Ga0395901_0017870 | 3300038443 | Bacteria | 7238 |
| 727 | Ga0395901_0072520 | 3300038443 | Bacteria | 3590 |
| 728 | Ga0395901_0093437 | 3300038443 | Bacteria | 3149 |
| 729 | Ga0395901_0247713 | 3300038443 | Bacteria | 1857 |
| 730 | Ga0395901_0776957 | 3300038443 | Bacteria | 949 |
| 731 | Ga0395901_0800805 | 3300038443 | Bacteria | 931 |
| 732 | Ga0436365_0832600 | 3300039437 | Bacteria | 990 |
| 733 | Ga0436361_0351371 | 3300039447 | Bacteria | 6023 |
| 734 | Ga0439439_0020409 | 3300041406 | Bacteria | 1648 |
| 735 | Ga0451849_1408969 | 3300041505 | Unclassified | 883 |
| 736 | Ga0439448_0026593 | 3300042005 | Bacteria | 1819 |
| 737 | Ga0450899_007462 | 3300042135 | Bacteria | 1193 |
| 738 | Ga0439434_0004196 | 3300042435 | Bacteria | 4209 |
| 739 | Ga0451577_0000870 | 3300042876 | Bacteria | 44894 |
| 740 | Ga0451577_0117869 | 3300042876 | Bacteria | 2378 |
| 741 | Ga0466966_0022793 | 3300044684 | Bacteria | 4104 |
| 742 | Ga0466961_0126273 | 3300044693 | Bacteria | 1605 |
| 743 | Ga0453684_0000912 | 3300044712 | Bacteria | 98180 |
| 744 | Ga0453684_0425614 | 3300044712 | Bacteria | 1482 |
| 745 | Ga0453684_0484227 | 3300044712 | Bacteria | 1372 |
| 746 | Ga0466970_0070816 | 3300044765 | Bacteria | 1875 |
| 747 | Ga0466959_0138317 | 3300045049 | Bacteria | 1723 |
| 748 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 749 | Ga0451576_0082587 | 3300045051 | Bacteria | 3342 |
| 750 | Ga0466958_0053198 | 3300045836 | Bacteria | 2455 |
| 751 | Ga0495627_009761 | 3300046453 | Bacteria | 3519 |
| 752 | Ga0495592_0180762 | 3300046454 | Bacteria | 1437 |
| 753 | Ga0495651_0305274 | 3300046462 | Bacteria | 1066 |
| 754 | Ga0495653_0236487 | 3300046463 | Bacteria | 1220 |
| 755 | Ga0495650_0000014 | 3300046471 | Bacteria | 581606 |
| 756 | Ga0495650_0061702 | 3300046471 | Bacteria | 1500 |
| 757 | Ga0495585_0000031 | 3300046492 | Bacteria | 143899 |
| 758 | Ga0495585_0000806 | 3300046492 | Bacteria | 27323 |
| 759 | Ga0495596_0050349 | 3300046500 | Bacteria | 1632 |
| 760 | Ga0495607_0180713 | 3300046501 | Bacteria | 1058 |
| 761 | Ga0495607_0216734 | 3300046501 | Bacteria | 939 |
| 762 | Ga0495583_0056466 | 3300046506 | Bacteria | 1770 |
| 763 | Ga0495583_0068490 | 3300046506 | Bacteria | 1565 |
| 764 | Ga0495606_0000020 | 3300046507 | Bacteria | 274490 |
| 765 | Ga0495606_0018977 | 3300046507 | Bacteria | 5138 |
| 766 | Ga0495606_0056302 | 3300046507 | Bacteria | 2539 |
| 767 | Ga0495606_0096864 | 3300046507 | Bacteria | 1804 |
| 768 | Ga0495606_0171991 | 3300046507 | Bacteria | 1256 |
| 769 | Ga0495606_0181188 | 3300046507 | Bacteria | 1214 |
| 770 | Ga0495610_0000060 | 3300046512 | Bacteria | 131116 |
| 771 | Ga0495610_0002356 | 3300046512 | Bacteria | 15967 |
| 772 | Ga0495610_0017383 | 3300046512 | Bacteria | 4103 |
| 773 | Ga0495616_0001192 | 3300046513 | Bacteria | 18322 |
| 774 | Ga0495616_0022705 | 3300046513 | Bacteria | 3384 |
| 775 | Ga0495616_0040499 | 3300046513 | Bacteria | 2380 |
| 776 | Ga0495628_0067700 | 3300046516 | Bacteria | 2788 |
| 777 | Ga0495630_0004081 | 3300046517 | Bacteria | 10226 |
| 778 | Ga0495630_0621030 | 3300046517 | Unclassified | 828 |
| 779 | Ga0495631_0234250 | 3300046518 | Bacteria | 783 |
| 780 | Ga0495632_0071556 | 3300046519 | Bacteria | 1666 |
| 781 | Ga0495637_0034584 | 3300046520 | Bacteria | 2212 |
| 782 | Ga0495643_0000537 | 3300046522 | Bacteria | 47210 |
| 783 | Ga0495643_0051822 | 3300046522 | Bacteria | 2206 |
| 784 | Ga0495648_0008887 | 3300046524 | Bacteria | 7853 |
| 785 | Ga0495648_0041931 | 3300046524 | Bacteria | 2885 |
| 786 | Ga0495648_0186345 | 3300046524 | Bacteria | 1050 |
| 787 | Ga0495652_0337405 | 3300046529 | Bacteria | 1084 |
| 788 | Ga0495609_0017620 | 3300046538 | Bacteria | 3316 |
| 789 | Ga0495609_0076475 | 3300046538 | Bacteria | 1467 |
| 790 | Ga0495645_0339384 | 3300046543 | Bacteria | 971 |
| 791 | Ga0495633_0000029 | 3300046558 | Bacteria | 200381 |
| 792 | Ga0495633_0054924 | 3300046558 | Bacteria | 1873 |
| 793 | Ga0495633_0109968 | 3300046558 | Bacteria | 1277 |
| 794 | Ga0495667_0285591 | 3300046559 | Bacteria | 1047 |
| 795 | Ga0495668_0000021 | 3300046616 | Bacteria | 381308 |
| 796 | Ga0495668_0000212 | 3300046616 | Bacteria | 84542 |
| 797 | Ga0495668_0000358 | 3300046616 | Bacteria | 60551 |
| 798 | Ga0495611_0134899 | 3300046648 | Bacteria | 1152 |
| 799 | Ga0495625_0000009 | 3300046660 | Bacteria | 404954 |
| 800 | Ga0495625_0000601 | 3300046660 | Bacteria | 52410 |
| 801 | Ga0495625_0000817 | 3300046660 | Bacteria | 42929 |
| 802 | Ga0495625_0015260 | 3300046660 | Bacteria | 6092 |
| 803 | Ga0495625_0021222 | 3300046660 | Bacteria | 5004 |
| 804 | Ga0495625_0028393 | 3300046660 | Bacteria | 4196 |
| 805 | Ga0495625_0051256 | 3300046660 | Bacteria | 2959 |
| 806 | Ga0495635_0161484 | 3300046663 | Bacteria | 1525 |
| 807 | Ga0495661_0004147 | 3300046665 | Bacteria | 10550 |
| 808 | Ga0495657_0142414 | 3300046675 | Bacteria | 1494 |
| 809 | Ga0495669_0054075 | 3300046684 | Bacteria | 1807 |
| 810 | Ga0495671_0082545 | 3300046692 | Bacteria | 1575 |
| 811 | Ga0495649_0000008 | 3300046694 | Bacteria | 483706 |
| 812 | Ga0495589_0262428 | 3300046794 | Bacteria | 805 |
| 813 | Ga0495600_0122978 | 3300046809 | Bacteria | 1688 |
| 814 | Ga0495660_0011998 | 3300046810 | Bacteria | 5026 |
| 815 | Ga0495660_0095489 | 3300046810 | Bacteria | 1538 |
| 816 | Ga0495636_0000011 | 3300047318 | Bacteria | 87862 |
| 817 | Ga0495680_0351649 | 3300047322 | Unclassified | 1026 |
| 818 | Ga0495683_0008202 | 3300047323 | Bacteria | 5602 |
| 819 | Ga0495687_001685 | 3300047443 | Bacteria | 19718 |
| 820 | Ga0495673_0055614 | 3300047469 | Bacteria | 1716 |
| 821 | Ga0495684_0202742 | 3300047471 | Bacteria | 1462 |
| 822 | Ga0495686_0000194 | 3300047472 | Bacteria | 113904 |
| 823 | Ga0495686_0007228 | 3300047472 | Bacteria | 8359 |
| 824 | Ga0495686_0018337 | 3300047472 | Bacteria | 4699 |
| 825 | Ga0495686_0043586 | 3300047472 | Bacteria | 2844 |
| 826 | Ga0495686_0063558 | 3300047472 | Bacteria | 2287 |
| 827 | Ga0495686_0097772 | 3300047472 | Bacteria | 1774 |
| 828 | Ga0495686_0170675 | 3300047472 | Bacteria | 1265 |
| 829 | Ga0495614_0015856 | 3300048089 | Bacteria | 3282 |
| 830 | Ga0496108_0127860 | 3300048911 | Bacteria | 2183 |
| 831 | Ga0496114_0866872 | 3300048917 | Bacteria | 783 |
| 832 | Ga0496122_0001846 | 3300048925 | Bacteria | 32295 |
| 833 | Ga0496123_0002062 | 3300048926 | Bacteria | 25924 |
| 834 | Ga0495678_021374 | 3300049459 | Bacteria | 2851 |
| 835 | Ga0501031_0171029 | 3300049568 | Bacteria | 1420 |
| 836 | Ga0501032_0071838 | 3300049569 | Bacteria | 2306 |
| 837 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 838 | Ga0501034_0036212 | 3300049571 | Bacteria | 5000 |
| 839 | Ga0501034_0056863 | 3300049571 | Bacteria | 3934 |
| 840 | Ga0501036_0076268 | 3300049572 | Bacteria | 2836 |
| 841 | Ga0501037_0086055 | 3300049573 | Bacteria | 2276 |
| 842 | Ga0501037_0345190 | 3300049573 | Bacteria | 1028 |
| 843 | Ga0501038_0234786 | 3300049574 | Bacteria | 1458 |
| 844 | Ga0501039_0376768 | 3300049575 | Bacteria | 1115 |
| 845 | Ga0501070_0100554 | 3300049586 | Bacteria | 2392 |
| 846 | Ga0501070_0114810 | 3300049586 | Bacteria | 2225 |
| 847 | Ga0501073_0022241 | 3300049589 | Bacteria | 4569 |
| 848 | Ga0501074_0010463 | 3300049590 | Bacteria | 6734 |
| 849 | Ga0501077_0304409 | 3300049593 | Bacteria | 1016 |
| 850 | Ga0501223_000633 | 3300049663 | Bacteria | 8435 |
| 851 | Ga0501079_0245505 | 3300049741 | Bacteria | 1399 |
| 852 | Ga0501080_0389751 | 3300049742 | Bacteria | 1254 |
| 853 | Ga0501083_0160860 | 3300049744 | Bacteria | 1469 |
| 854 | Ga0501241_005415 | 3300049758 | Bacteria | 2380 |
| 855 | Ga0501035_0085979 | 3300049822 | Bacteria | 2771 |
| 856 | Ga0501035_0138397 | 3300049822 | Bacteria | 2118 |
| 857 | Ga0501044_0225000 | 3300049823 | Bacteria | 1826 |
| 858 | Ga0501045_0615129 | 3300049824 | Bacteria | 804 |
| 859 | nmdc:mga0k408_171_c1 | 3300050493 | Bacteria | 34186 |
| 860 | nmdc:mga0k408_55212_c1 | 3300050493 | Bacteria | 2303 |
| 861 | nmdc:mga0k408_803_c1 | 3300050493 | Bacteria | 17292 |
| 862 | nmdc:mga07m45_218114_c1 | 3300050496 | Bacteria | 1110 |
| 863 | Ga0500646_0021302 | 3300053090 | Bacteria | 1726 |
| 864 | Ga0500651_0011469 | 3300053093 | Bacteria | 5344 |
| 865 | Ga0500650_0250633 | 3300053098 | Bacteria | 794 |
| 866 | Ga0500608_000637 | 3300053122 | Bacteria | 12928 |
| 867 | Ga0500618_000266 | 3300053125 | Bacteria | 40517 |
| 868 | Ga0500642_0047893 | 3300053130 | Bacteria | 1875 |
| 869 | Ga0500568_0001078 | 3300053139 | Bacteria | 18433 |
| 870 | Ga0500616_0000850 | 3300053153 | Bacteria | 34025 |
| 871 | Ga0500622_0000838 | 3300053156 | Bacteria | 26284 |
| 872 | Ga0500624_000576 | 3300053157 | Bacteria | 10124 |
| 873 | Ga0500627_0011955 | 3300053158 | Bacteria | 3231 |
| 874 | Ga0500611_000002 | 3300053727 | Bacteria | 345991 |
| 875 | Ga0501084_0595593 | 3300054114 | Bacteria | 934 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025919 | Ga0207657_10533440 | Ga0207657_105334402 | 212 |
| 2 | 3300038443 | Ga0395901_0776957 | Ga0395901_0776957_14_658 | 214 |
| 3 | 3300005614 | Ga0068856_100093116 | Ga0068856_1000931162 | 216 |
| 4 | 3300005290 | Ga0065712_10315846 | Ga0065712_103158461 | 218 |
| 5 | 3300025925 | Ga0207650_10157874 | Ga0207650_101578742 | 218 |
| 6 | 3300025940 | Ga0207691_10737289 | Ga0207691_107372892 | 218 |
| 7 | 3300032004 | Ga0307414_10070261 | Ga0307414_100702613 | 218 |
| 8 | 3300031251 | Ga0265327_10004741 | Ga0265327_100047411 | 219 |
| 9 | 3300005614 | Ga0068856_100148395 | Ga0068856_1001483952 | 220 |
| 10 | 3300038443 | Ga0395901_0001980 | Ga0395901_0001980_13938_14654 | 220 |
| 11 | 3300049742 | Ga0501080_0389751 | Ga0501080_0389751_46_744 | 221 |
| 12 | 3300032004 | Ga0307414_10007511 | Ga0307414_100075112 | 222 |
| 13 | 3300005355 | Ga0070671_100365482 | Ga0070671_1003654822 | 223 |
| 14 | 3300011119 | Ga0105246_10967653 | Ga0105246_109676531 | 223 |
| 15 | 3300025925 | Ga0207650_10049197 | Ga0207650_100491973 | 223 |
| 16 | 3300025931 | Ga0207644_10103457 | Ga0207644_101034573 | 223 |
| 17 | 3300005563 | Ga0068855_100365276 | Ga0068855_1003652762 | 225 |
| 18 | 3300025949 | Ga0207667_10640882 | Ga0207667_106408822 | 225 |
| 19 | 3300041406 | Ga0439439_0020409 | Ga0439439_0020409_528_1205 | 225 |
| 20 | iso_pu_bacteria | 2599185184 | 2599476843 | 225 |
| 21 | iso_pu_bacteria | 2852623160 | 2852623689 | 227 |
| 22 | iso_pu_bacteria | 2884933994 | 2884937406 | 227 |
| 23 | iso_pu_bacteria | 2919437846 | 2919438786 | 227 |
| 24 | iso_pu_bacteria | 2738541281 | 2738743662 | 228 |
| 25 | iso_pu_bacteria | 2738543032 | 2739352569 | 228 |
| 26 | iso_pu_bacteria | 2739367656 | 2739617764 | 228 |
| 27 | iso_pu_bacteria | 2928078545 | 2928078751 | 228 |
| 28 | iso_pu_bacteria | 2928147474 | 2928151571 | 228 |
| 29 | iso_pu_bacteria | 2932082852 | 2932084195 | 228 |
| 30 | 3300003316 | rootH1_10072982 | rootH1_100729824 | 229 |
| 31 | 3300005327 | Ga0070658_10080404 | Ga0070658_100804041 | 229 |
| 32 | 3300005458 | Ga0070681_10042095 | Ga0070681_100420954 | 229 |
| 33 | 3300005563 | Ga0068855_100308903 | Ga0068855_1003089032 | 229 |
| 34 | 3300005614 | Ga0068856_100938908 | Ga0068856_1009389082 | 229 |
| 35 | 3300009093 | Ga0105240_10394176 | Ga0105240_103941762 | 229 |
| 36 | 3300013104 | Ga0157370_10013593 | Ga0157370_100135938 | 229 |
| 37 | 3300025909 | Ga0207705_10265166 | Ga0207705_102651662 | 229 |
| 38 | 3300025912 | Ga0207707_10037174 | Ga0207707_100371743 | 229 |
| 39 | 3300025913 | Ga0207695_10280140 | Ga0207695_102801402 | 229 |
| 40 | 3300026078 | Ga0207702_10208531 | Ga0207702_102085313 | 229 |
| 41 | 3300046507 | Ga0495606_0096864 | Ga0495606_0096864_27_716 | 229 |
| 42 | 3300046520 | Ga0495637_0034584 | Ga0495637_0034584_1221_1910 | 229 |
| 43 | 3300046794 | Ga0495589_0262428 | Ga0495589_0262428_30_719 | 229 |
| 44 | 3300047472 | Ga0495686_0097772 | Ga0495686_0097772_962_1651 | 229 |
| 45 | iso_pu_bacteria | 2585427687 | 2586208605 | 229 |
| 46 | iso_pu_bacteria | 2738541273 | 2738699171 | 229 |
| 47 | iso_pu_bacteria | 2738541283 | 2738757174 | 229 |
| 48 | iso_pu_bacteria | 2738541284 | 2738762787 | 229 |
| 49 | iso_pu_bacteria | 2738541302 | 2738852991 | 229 |
| 50 | iso_pu_bacteria | 2738543014 | 2739254887 | 229 |
| 51 | iso_pu_bacteria | 2738543023 | 2739300464 | 229 |
| 52 | iso_pu_bacteria | 2739367651 | 2739586363 | 229 |
| 53 | iso_pu_bacteria | 2739367663 | 2739644867 | 229 |
| 54 | iso_pu_bacteria | 2775506987 | 2776614351 | 229 |
| 55 | iso_pu_bacteria | 2818991437 | 2819549131 | 229 |
| 56 | iso_pu_bacteria | 2842722452 | 2842725619 | 229 |
| 57 | iso_pu_bacteria | 2842903701 | 2842908387 | 229 |
| 58 | iso_pu_bacteria | 2842909656 | 2842914451 | 229 |
| 59 | iso_pu_bacteria | 2849281842 | 2849283023 | 229 |
| 60 | iso_pu_bacteria | 2852627209 | 2852630269 | 229 |
| 61 | iso_pu_bacteria | 2857627736 | 2857630645 | 229 |
| 62 | iso_pu_bacteria | 2902048731 | 2902048888 | 229 |
| 63 | iso_pu_bacteria | 2904445276 | 2904449207 | 229 |
| 64 | iso_pu_bacteria | 2919186247 | 2919190036 | 229 |
| 65 | iso_pu_bacteria | 2939664404 | 2939668317 | 229 |
| 66 | iso_pu_bacteria | 2945997725 | 2946001138 | 229 |
| 67 | iso_pu_bacteria | 2954016120 | 2954018038 | 229 |
| 68 | iso_pu_bacteria | 8055588893 | 8055589448 | 229 |
| 69 | 3300005327 | Ga0070658_10117414 | Ga0070658_101174143 | 230 |
| 70 | 3300005327 | Ga0070658_10135069 | Ga0070658_101350693 | 230 |
| 71 | 3300005337 | Ga0070682_100075268 | Ga0070682_1000752682 | 230 |
| 72 | 3300005339 | Ga0070660_100000870 | Ga0070660_10000087018 | 230 |
| 73 | 3300005339 | Ga0070660_100022188 | Ga0070660_1000221884 | 230 |
| 74 | 3300005339 | Ga0070660_100441583 | Ga0070660_1004415832 | 230 |
| 75 | 3300005345 | Ga0070692_10102076 | Ga0070692_101020762 | 230 |
| 76 | 3300005366 | Ga0070659_100029194 | Ga0070659_1000291944 | 230 |
| 77 | 3300005366 | Ga0070659_100110556 | Ga0070659_1001105563 | 230 |
| 78 | 3300005434 | Ga0070709_10027617 | Ga0070709_100276172 | 230 |
| 79 | 3300005435 | Ga0070714_100327873 | Ga0070714_1003278731 | 230 |
| 80 | 3300005458 | Ga0070681_10184858 | Ga0070681_101848583 | 230 |
| 81 | 3300005458 | Ga0070681_10458353 | Ga0070681_104583532 | 230 |
| 82 | 3300005530 | Ga0070679_100000053 | Ga0070679_100000053133 | 230 |
| 83 | 3300005530 | Ga0070679_100026213 | Ga0070679_1000262136 | 230 |
| 84 | 3300005539 | Ga0068853_100275387 | Ga0068853_1002753871 | 230 |
| 85 | 3300005563 | Ga0068855_100006033 | Ga0068855_1000060339 | 230 |
| 86 | 3300005563 | Ga0068855_100348510 | Ga0068855_1003485102 | 230 |
| 87 | 3300005578 | Ga0068854_100395655 | Ga0068854_1003956552 | 230 |
| 88 | 3300009093 | Ga0105240_10031376 | Ga0105240_100313767 | 230 |
| 89 | 3300009174 | Ga0105241_10996612 | Ga0105241_109966121 | 230 |
| 90 | 3300013100 | Ga0157373_10013487 | Ga0157373_100134874 | 230 |
| 91 | 3300013102 | Ga0157371_10000903 | Ga0157371_1000090340 | 230 |
| 92 | 3300013102 | Ga0157371_10001268 | Ga0157371_1000126829 | 230 |
| 93 | 3300013102 | Ga0157371_10014830 | Ga0157371_100148307 | 230 |
| 94 | 3300013102 | Ga0157371_10074503 | Ga0157371_100745032 | 230 |
| 95 | 3300013104 | Ga0157370_10003741 | Ga0157370_100037417 | 230 |
| 96 | 3300013105 | Ga0157369_10035552 | Ga0157369_100355523 | 230 |
| 97 | 3300013307 | Ga0157372_10004415 | Ga0157372_1000441514 | 230 |
| 98 | 3300013307 | Ga0157372_10018299 | Ga0157372_100182998 | 230 |
| 99 | 3300013307 | Ga0157372_10089720 | Ga0157372_100897202 | 230 |
| 100 | 3300025909 | Ga0207705_10030421 | Ga0207705_100304212 | 230 |
| 101 | 3300025909 | Ga0207705_10043320 | Ga0207705_100433204 | 230 |
| 102 | 3300025919 | Ga0207657_10002882 | Ga0207657_1000288215 | 230 |
| 103 | 3300025919 | Ga0207657_10244398 | Ga0207657_102443982 | 230 |
| 104 | 3300025921 | Ga0207652_10000010 | Ga0207652_10000010184 | 230 |
| 105 | 3300025921 | Ga0207652_10346613 | Ga0207652_103466132 | 230 |
| 106 | 3300025929 | Ga0207664_10360881 | Ga0207664_103608813 | 230 |
| 107 | 3300025932 | Ga0207690_10190744 | Ga0207690_101907442 | 230 |
| 108 | 3300025940 | Ga0207691_10224947 | Ga0207691_102249472 | 230 |
| 109 | 3300025949 | Ga0207667_10289202 | Ga0207667_102892023 | 230 |
| 110 | 3300026041 | Ga0207639_10745085 | Ga0207639_107450851 | 230 |
| 111 | 3300026142 | Ga0207698_10112732 | Ga0207698_101127321 | 230 |
| 112 | 3300031251 | Ga0265327_10000046 | Ga0265327_1000004686 | 230 |
| 113 | 3300037312 | Ga0395899_0115665 | Ga0395899_0115665_818_1510 | 230 |
| 114 | 3300037418 | Ga0395900_0006326 | Ga0395900_0006326_3349_4041 | 230 |
| 115 | 3300037418 | Ga0395900_0034926 | Ga0395900_0034926_3360_4052 | 230 |
| 116 | 3300037418 | Ga0395900_0041364 | Ga0395900_0041364_3786_4478 | 230 |
| 117 | 3300037466 | Ga0395898_0026930 | Ga0395898_0026930_3271_3963 | 230 |
| 118 | 3300037466 | Ga0395898_0355309 | Ga0395898_0355309_675_1367 | 230 |
| 119 | 3300038443 | Ga0395901_0001995 | Ga0395901_0001995_9316_10008 | 230 |
| 120 | 3300038443 | Ga0395901_0017870 | Ga0395901_0017870_2804_3496 | 230 |
| 121 | 3300053156 | Ga0500622_0000838 | Ga0500622_0000838_12412_13116 | 230 |
| 122 | 3300001990 | JGI24737J22298_10014737 | JGI24737J22298_100147373 | 231 |
| 123 | 3300001991 | JGI24743J22301_10016381 | JGI24743J22301_100163812 | 231 |
| 124 | 3300003323 | rootH1_10116441 | rootH1_101164413 | 231 |
| 125 | 3300005327 | Ga0070658_10000026 | Ga0070658_10000026122 | 231 |
| 126 | 3300005328 | Ga0070676_10001812 | Ga0070676_100018123 | 231 |
| 127 | 3300005329 | Ga0070683_100006215 | Ga0070683_1000062157 | 231 |
| 128 | 3300005337 | Ga0070682_100030177 | Ga0070682_1000301773 | 231 |
| 129 | 3300005337 | Ga0070682_100063960 | Ga0070682_1000639603 | 231 |
| 130 | 3300005338 | Ga0068868_100027697 | Ga0068868_1000276973 | 231 |
| 131 | 3300005339 | Ga0070660_100063881 | Ga0070660_1000638812 | 231 |
| 132 | 3300005344 | Ga0070661_100001685 | Ga0070661_1000016855 | 231 |
| 133 | 3300005355 | Ga0070671_100041220 | Ga0070671_1000412203 | 231 |
| 134 | 3300005364 | Ga0070673_100286029 | Ga0070673_1002860292 | 231 |
| 135 | 3300005366 | Ga0070659_100001687 | Ga0070659_10000168710 | 231 |
| 136 | 3300005366 | Ga0070659_100038013 | Ga0070659_1000380135 | 231 |
| 137 | 3300005457 | Ga0070662_100000093 | Ga0070662_10000009314 | 231 |
| 138 | 3300005459 | Ga0068867_100000834 | Ga0068867_1000008347 | 231 |
| 139 | 3300005459 | Ga0068867_100072490 | Ga0068867_1000724904 | 231 |
| 140 | 3300005535 | Ga0070684_100001962 | Ga0070684_10000196216 | 231 |
| 141 | 3300005539 | Ga0068853_100002136 | Ga0068853_10000213615 | 231 |
| 142 | 3300005539 | Ga0068853_100027230 | Ga0068853_1000272303 | 231 |
| 143 | 3300005563 | Ga0068855_100000727 | Ga0068855_10000072724 | 231 |
| 144 | 3300005563 | Ga0068855_100004855 | Ga0068855_10000485511 | 231 |
| 145 | 3300005563 | Ga0068855_100015590 | Ga0068855_1000155906 | 231 |
| 146 | 3300005563 | Ga0068855_100520077 | Ga0068855_1005200772 | 231 |
| 147 | 3300005564 | Ga0070664_100005236 | Ga0070664_1000052364 | 231 |
| 148 | 3300005577 | Ga0068857_100001716 | Ga0068857_1000017169 | 231 |
| 149 | 3300005614 | Ga0068856_100012101 | Ga0068856_1000121012 | 231 |
| 150 | 3300005614 | Ga0068856_100050481 | Ga0068856_1000504813 | 231 |
| 151 | 3300005614 | Ga0068856_100225387 | Ga0068856_1002253872 | 231 |
| 152 | 3300005616 | Ga0068852_100005543 | Ga0068852_1000055437 | 231 |
| 153 | 3300005842 | Ga0068858_100044822 | Ga0068858_1000448223 | 231 |
| 154 | 3300006237 | Ga0097621_100002096 | Ga0097621_1000020966 | 231 |
| 155 | 3300006358 | Ga0068871_100000196 | Ga0068871_10000019631 | 231 |
| 156 | 3300006881 | Ga0068865_100000022 | Ga0068865_10000002270 | 231 |
| 157 | 3300009093 | Ga0105240_10003724 | Ga0105240_100037243 | 231 |
| 158 | 3300009093 | Ga0105240_10006944 | Ga0105240_100069446 | 231 |
| 159 | 3300009093 | Ga0105240_10260825 | Ga0105240_102608252 | 231 |
| 160 | 3300009093 | Ga0105240_10393709 | Ga0105240_103937091 | 231 |
| 161 | 3300009093 | Ga0105240_10396497 | Ga0105240_103964972 | 231 |
| 162 | 3300009098 | Ga0105245_10157763 | Ga0105245_101577632 | 231 |
| 163 | 3300009098 | Ga0105245_10161636 | Ga0105245_101616362 | 231 |
| 164 | 3300009174 | Ga0105241_10000238 | Ga0105241_1000023814 | 231 |
| 165 | 3300009174 | Ga0105241_10002650 | Ga0105241_1000265015 | 231 |
| 166 | 3300009174 | Ga0105241_10217437 | Ga0105241_102174372 | 231 |
| 167 | 3300009176 | Ga0105242_10035854 | Ga0105242_100358542 | 231 |
| 168 | 3300009176 | Ga0105242_10087704 | Ga0105242_100877043 | 231 |
| 169 | 3300009545 | Ga0105237_10000233 | Ga0105237_1000023377 | 231 |
| 170 | 3300009545 | Ga0105237_10001823 | Ga0105237_1000182322 | 231 |
| 171 | 3300009545 | Ga0105237_10088012 | Ga0105237_100880123 | 231 |
| 172 | 3300009545 | Ga0105237_10597402 | Ga0105237_105974022 | 231 |
| 173 | 3300009551 | Ga0105238_10008082 | Ga0105238_100080824 | 231 |
| 174 | 3300009551 | Ga0105238_10100505 | Ga0105238_101005053 | 231 |
| 175 | 3300009553 | Ga0105249_10083416 | Ga0105249_100834164 | 231 |
| 176 | 3300009553 | Ga0105249_10210986 | Ga0105249_102109861 | 231 |
| 177 | 3300010375 | Ga0105239_10000013 | Ga0105239_10000013142 | 231 |
| 178 | 3300010375 | Ga0105239_10073693 | Ga0105239_100736935 | 231 |
| 179 | 3300010375 | Ga0105239_10242292 | Ga0105239_102422922 | 231 |
| 180 | 3300013102 | Ga0157371_10018887 | Ga0157371_100188873 | 231 |
| 181 | 3300013104 | Ga0157370_10007572 | Ga0157370_100075726 | 231 |
| 182 | 3300013296 | Ga0157374_10001622 | Ga0157374_1000162210 | 231 |
| 183 | 3300013296 | Ga0157374_10003352 | Ga0157374_100033527 | 231 |
| 184 | 3300013306 | Ga0163162_10042161 | Ga0163162_100421614 | 231 |
| 185 | 3300013307 | Ga0157372_10065184 | Ga0157372_100651844 | 231 |
| 186 | 3300013308 | Ga0157375_10016319 | Ga0157375_100163193 | 231 |
| 187 | 3300021361 | Ga0213872_10009172 | Ga0213872_100091725 | 231 |
| 188 | 3300025904 | Ga0207647_10000354 | Ga0207647_1000035423 | 231 |
| 189 | 3300025907 | Ga0207645_10000500 | Ga0207645_1000050015 | 231 |
| 190 | 3300025909 | Ga0207705_10000040 | Ga0207705_1000004015 | 231 |
| 191 | 3300025911 | Ga0207654_10000448 | Ga0207654_1000044823 | 231 |
| 192 | 3300025911 | Ga0207654_10132934 | Ga0207654_101329342 | 231 |
| 193 | 3300025913 | Ga0207695_10012640 | Ga0207695_100126403 | 231 |
| 194 | 3300025913 | Ga0207695_10100313 | Ga0207695_101003132 | 231 |
| 195 | 3300025913 | Ga0207695_10179269 | Ga0207695_101792692 | 231 |
| 196 | 3300025913 | Ga0207695_10232220 | Ga0207695_102322202 | 231 |
| 197 | 3300025913 | Ga0207695_10312508 | Ga0207695_103125082 | 231 |
| 198 | 3300025914 | Ga0207671_10001284 | Ga0207671_100012849 | 231 |
| 199 | 3300025914 | Ga0207671_10004426 | Ga0207671_1000442610 | 231 |
| 200 | 3300025914 | Ga0207671_10015688 | Ga0207671_100156883 | 231 |
| 201 | 3300025914 | Ga0207671_10031607 | Ga0207671_100316074 | 231 |
| 202 | 3300025919 | Ga0207657_10126977 | Ga0207657_101269772 | 231 |
| 203 | 3300025920 | Ga0207649_10002378 | Ga0207649_100023785 | 231 |
| 204 | 3300025924 | Ga0207694_10008772 | Ga0207694_100087729 | 231 |
| 205 | 3300025931 | Ga0207644_10004161 | Ga0207644_100041618 | 231 |
| 206 | 3300025932 | Ga0207690_10023076 | Ga0207690_100230763 | 231 |
| 207 | 3300025932 | Ga0207690_10101916 | Ga0207690_101019163 | 231 |
| 208 | 3300025933 | Ga0207706_10000442 | Ga0207706_1000044232 | 231 |
| 209 | 3300025934 | Ga0207686_10022554 | Ga0207686_100225543 | 231 |
| 210 | 3300025934 | Ga0207686_10055929 | Ga0207686_100559293 | 231 |
| 211 | 3300025938 | Ga0207704_10000011 | Ga0207704_1000001162 | 231 |
| 212 | 3300025944 | Ga0207661_10003428 | Ga0207661_100034286 | 231 |
| 213 | 3300025945 | Ga0207679_10007295 | Ga0207679_100072956 | 231 |
| 214 | 3300025949 | Ga0207667_10000020 | Ga0207667_10000020203 | 231 |
| 215 | 3300025960 | Ga0207651_10003816 | Ga0207651_100038162 | 231 |
| 216 | 3300025961 | Ga0207712_10019417 | Ga0207712_100194172 | 231 |
| 217 | 3300026023 | Ga0207677_10006442 | Ga0207677_100064423 | 231 |
| 218 | 3300026023 | Ga0207677_10099842 | Ga0207677_100998422 | 231 |
| 219 | 3300026035 | Ga0207703_10285197 | Ga0207703_102851972 | 231 |
| 220 | 3300026041 | Ga0207639_10003710 | Ga0207639_100037109 | 231 |
| 221 | 3300026041 | Ga0207639_10018026 | Ga0207639_100180265 | 231 |
| 222 | 3300026067 | Ga0207678_10337725 | Ga0207678_103377252 | 231 |
| 223 | 3300026078 | Ga0207702_10005183 | Ga0207702_1000518312 | 231 |
| 224 | 3300026078 | Ga0207702_10051753 | Ga0207702_100517533 | 231 |
| 225 | 3300026078 | Ga0207702_10240259 | Ga0207702_102402593 | 231 |
| 226 | 3300026089 | Ga0207648_10001059 | Ga0207648_1000105924 | 231 |
| 227 | 3300026089 | Ga0207648_10043714 | Ga0207648_100437144 | 231 |
| 228 | 3300026116 | Ga0207674_10003303 | Ga0207674_1000330317 | 231 |
| 229 | 3300026121 | Ga0207683_10005152 | Ga0207683_1000515213 | 231 |
| 230 | 3300026142 | Ga0207698_11013791 | Ga0207698_110137911 | 231 |
| 231 | 3300028786 | Ga0307517_10001632 | Ga0307517_1000163220 | 231 |
| 232 | 3300028794 | Ga0307515_10022378 | Ga0307515_100223783 | 231 |
| 233 | 3300030742 | Ga0316183_1132422 | Ga0316183_113242212 | 231 |
| 234 | 3300030744 | Ga0316181_1039957 | Ga0316181_10399574 | 231 |
| 235 | 3300031711 | Ga0265314_10302299 | Ga0265314_103022991 | 231 |
| 236 | 3300032002 | Ga0307416_100116527 | Ga0307416_1001165272 | 231 |
| 237 | 3300033179 | Ga0307507_10000052 | Ga0307507_1000005218 | 231 |
| 238 | 3300033180 | Ga0307510_10307297 | Ga0307510_103072971 | 231 |
| 239 | 3300037418 | Ga0395900_0756245 | Ga0395900_0756245_97_792 | 231 |
| 240 | 3300038443 | Ga0395901_0247713 | Ga0395901_0247713_26_721 | 231 |
| 241 | 3300039437 | Ga0436365_0832600 | Ga0436365_0832600_70_765 | 231 |
| 242 | 3300039447 | Ga0436361_0351371 | Ga0436361_0351371_2277_2972 | 231 |
| 243 | 3300042005 | Ga0439448_0026593 | Ga0439448_0026593_697_1392 | 231 |
| 244 | 3300044712 | Ga0453684_0484227 | Ga0453684_0484227_260_955 | 231 |
| 245 | 3300046492 | Ga0495585_0000806 | Ga0495585_0000806_19652_20347 | 231 |
| 246 | 3300046507 | Ga0495606_0056302 | Ga0495606_0056302_98_793 | 231 |
| 247 | 3300046517 | Ga0495630_0621030 | Ga0495630_0621030_113_811 | 231 |
| 248 | 3300046518 | Ga0495631_0234250 | Ga0495631_0234250_48_743 | 231 |
| 249 | 3300046519 | Ga0495632_0071556 | Ga0495632_0071556_486_1181 | 231 |
| 250 | 3300046524 | Ga0495648_0008887 | Ga0495648_0008887_6504_7199 | 231 |
| 251 | 3300046524 | Ga0495648_0186345 | Ga0495648_0186345_171_866 | 231 |
| 252 | 3300046616 | Ga0495668_0000021 | Ga0495668_0000021_118059_118754 | 231 |
| 253 | 3300046616 | Ga0495668_0000358 | Ga0495668_0000358_58474_59247 | 231 |
| 254 | 3300046660 | Ga0495625_0000601 | Ga0495625_0000601_8833_9528 | 231 |
| 255 | 3300046660 | Ga0495625_0000817 | Ga0495625_0000817_19050_19745 | 231 |
| 256 | 3300046665 | Ga0495661_0004147 | Ga0495661_0004147_5612_6313 | 231 |
| 257 | 3300047443 | Ga0495687_001685 | Ga0495687_001685_10817_11512 | 231 |
| 258 | 3300047472 | Ga0495686_0043586 | Ga0495686_0043586_981_1676 | 231 |
| 259 | 3300047472 | Ga0495686_0170675 | Ga0495686_0170675_492_1187 | 231 |
| 260 | 3300048089 | Ga0495614_0015856 | Ga0495614_0015856_767_1462 | 231 |
| 261 | 3300049568 | Ga0501031_0171029 | Ga0501031_0171029_618_1313 | 231 |
| 262 | 3300049569 | Ga0501032_0071838 | Ga0501032_0071838_68_763 | 231 |
| 263 | 3300049571 | Ga0501034_0056863 | Ga0501034_0056863_2978_3673 | 231 |
| 264 | 3300049572 | Ga0501036_0076268 | Ga0501036_0076268_2107_2802 | 231 |
| 265 | 3300049573 | Ga0501037_0086055 | Ga0501037_0086055_621_1316 | 231 |
| 266 | 3300049574 | Ga0501038_0234786 | Ga0501038_0234786_608_1303 | 231 |
| 267 | 3300049586 | Ga0501070_0114810 | Ga0501070_0114810_350_1045 | 231 |
| 268 | 3300049589 | Ga0501073_0022241 | Ga0501073_0022241_2635_3330 | 231 |
| 269 | 3300049590 | Ga0501074_0010463 | Ga0501074_0010463_3905_4600 | 231 |
| 270 | 3300049593 | Ga0501077_0304409 | Ga0501077_0304409_44_739 | 231 |
| 271 | 3300049741 | Ga0501079_0245505 | Ga0501079_0245505_340_1035 | 231 |
| 272 | 3300049744 | Ga0501083_0160860 | Ga0501083_0160860_278_973 | 231 |
| 273 | 3300049822 | Ga0501035_0085979 | Ga0501035_0085979_1835_2530 | 231 |
| 274 | 3300049824 | Ga0501045_0615129 | Ga0501045_0615129_83_778 | 231 |
| 275 | 3300053098 | Ga0500650_0250633 | Ga0500650_0250633_69_764 | 231 |
| 276 | 3300053122 | Ga0500608_000637 | Ga0500608_000637_3462_4157 | 231 |
| 277 | 3300053153 | Ga0500616_0000850 | Ga0500616_0000850_11494_12192 | 231 |
| 278 | 3300053158 | Ga0500627_0011955 | Ga0500627_0011955_547_1245 | 231 |
| 279 | 3300054114 | Ga0501084_0595593 | Ga0501084_0595593_171_866 | 231 |
| 280 | 2162886007 | SwRhRL2b_contig_1759593 | SwRhRL2b_0521.00008080 | 232 |
| 281 | 3300001979 | JGI24740J21852_10042533 | JGI24740J21852_100425332 | 232 |
| 282 | 3300001990 | JGI24737J22298_10008536 | JGI24737J22298_100085361 | 232 |
| 283 | 3300002067 | JGI24735J21928_10000006 | JGI24735J21928_1000000653 | 232 |
| 284 | 3300002067 | JGI24735J21928_10002913 | JGI24735J21928_100029137 | 232 |
| 285 | 3300002737 | JGI25162J39368_1001400 | JGI25162J39368_10014004 | 232 |
| 286 | 3300002737 | JGI25162J39368_1001919 | JGI25162J39368_10019192 | 232 |
| 287 | 3300002772 | JGI25164J39214_1003560 | JGI25164J39214_10035601 | 232 |
| 288 | 3300003320 | rootH2_10001334 | rootH2_1000133498 | 232 |
| 289 | 3300003320 | rootH2_10089325 | rootH2_100893252 | 232 |
| 290 | 3300003323 | rootH1_10002605 | rootH1_100026055 | 232 |
| 291 | 3300003323 | rootH1_10078843 | rootH1_100788435 | 232 |
| 292 | 3300004799 | Ga0058863_11667303 | Ga0058863_116673031 | 232 |
| 293 | 3300005288 | Ga0065714_10006702 | Ga0065714_100067023 | 232 |
| 294 | 3300005288 | Ga0065714_10013197 | Ga0065714_100131971 | 232 |
| 295 | 3300005288 | Ga0065714_10098037 | Ga0065714_100980372 | 232 |
| 296 | 3300005289 | Ga0065704_10070133 | Ga0065704_1007013322 | 232 |
| 297 | 3300005295 | Ga0065707_10123842 | Ga0065707_101238422 | 232 |
| 298 | 3300005327 | Ga0070658_10073376 | Ga0070658_100733763 | 232 |
| 299 | 3300005328 | Ga0070676_10033047 | Ga0070676_100330472 | 232 |
| 300 | 3300005328 | Ga0070676_10120154 | Ga0070676_101201541 | 232 |
| 301 | 3300005328 | Ga0070676_10253158 | Ga0070676_102531581 | 232 |
| 302 | 3300005329 | Ga0070683_100052046 | Ga0070683_1000520463 | 232 |
| 303 | 3300005329 | Ga0070683_100065882 | Ga0070683_1000658824 | 232 |
| 304 | 3300005329 | Ga0070683_100130540 | Ga0070683_1001305402 | 232 |
| 305 | 3300005329 | Ga0070683_100431642 | Ga0070683_1004316422 | 232 |
| 306 | 3300005329 | Ga0070683_100667198 | Ga0070683_1006671981 | 232 |
| 307 | 3300005330 | Ga0070690_100159027 | Ga0070690_1001590273 | 232 |
| 308 | 3300005331 | Ga0070670_100030228 | Ga0070670_1000302285 | 232 |
| 309 | 3300005331 | Ga0070670_100052426 | Ga0070670_1000524262 | 232 |
| 310 | 3300005331 | Ga0070670_100169320 | Ga0070670_1001693202 | 232 |
| 311 | 3300005331 | Ga0070670_100526797 | Ga0070670_1005267971 | 232 |
| 312 | 3300005334 | Ga0068869_100053809 | Ga0068869_1000538092 | 232 |
| 313 | 3300005334 | Ga0068869_100061630 | Ga0068869_1000616302 | 232 |
| 314 | 3300005334 | Ga0068869_100069685 | Ga0068869_1000696853 | 232 |
| 315 | 3300005334 | Ga0068869_100221189 | Ga0068869_1002211892 | 232 |
| 316 | 3300005335 | Ga0070666_10016089 | Ga0070666_100160893 | 232 |
| 317 | 3300005335 | Ga0070666_10019554 | Ga0070666_100195542 | 232 |
| 318 | 3300005336 | Ga0070680_100009215 | Ga0070680_1000092159 | 232 |
| 319 | 3300005336 | Ga0070680_100034278 | Ga0070680_1000342785 | 232 |
| 320 | 3300005336 | Ga0070680_100108709 | Ga0070680_1001087093 | 232 |
| 321 | 3300005336 | Ga0070680_100127421 | Ga0070680_1001274213 | 232 |
| 322 | 3300005337 | Ga0070682_100000039 | Ga0070682_10000003941 | 232 |
| 323 | 3300005337 | Ga0070682_100552546 | Ga0070682_1005525461 | 232 |
| 324 | 3300005338 | Ga0068868_100012938 | Ga0068868_1000129385 | 232 |
| 325 | 3300005338 | Ga0068868_100014676 | Ga0068868_1000146765 | 232 |
| 326 | 3300005338 | Ga0068868_100029787 | Ga0068868_1000297873 | 232 |
| 327 | 3300005338 | Ga0068868_100087803 | Ga0068868_1000878033 | 232 |
| 328 | 3300005338 | Ga0068868_100327270 | Ga0068868_1003272701 | 232 |
| 329 | 3300005339 | Ga0070660_100203178 | Ga0070660_1002031782 | 232 |
| 330 | 3300005340 | Ga0070689_100059757 | Ga0070689_1000597571 | 232 |
| 331 | 3300005344 | Ga0070661_100016838 | Ga0070661_1000168383 | 232 |
| 332 | 3300005344 | Ga0070661_100122200 | Ga0070661_1001222002 | 232 |
| 333 | 3300005347 | Ga0070668_100029793 | Ga0070668_1000297932 | 232 |
| 334 | 3300005353 | Ga0070669_100002558 | Ga0070669_1000025583 | 232 |
| 335 | 3300005354 | Ga0070675_100079466 | Ga0070675_1000794662 | 232 |
| 336 | 3300005354 | Ga0070675_100166793 | Ga0070675_1001667933 | 232 |
| 337 | 3300005354 | Ga0070675_100325234 | Ga0070675_1003252343 | 232 |
| 338 | 3300005355 | Ga0070671_100029341 | Ga0070671_1000293416 | 232 |
| 339 | 3300005355 | Ga0070671_100110248 | Ga0070671_1001102483 | 232 |
| 340 | 3300005355 | Ga0070671_100470114 | Ga0070671_1004701141 | 232 |
| 341 | 3300005356 | Ga0070674_100462602 | Ga0070674_1004626021 | 232 |
| 342 | 3300005364 | Ga0070673_100017680 | Ga0070673_1000176803 | 232 |
| 343 | 3300005365 | Ga0070688_100222962 | Ga0070688_1002229622 | 232 |
| 344 | 3300005365 | Ga0070688_100280126 | Ga0070688_1002801262 | 232 |
| 345 | 3300005365 | Ga0070688_100460512 | Ga0070688_1004605122 | 232 |
| 346 | 3300005366 | Ga0070659_100005037 | Ga0070659_1000050376 | 232 |
| 347 | 3300005367 | Ga0070667_100057892 | Ga0070667_1000578925 | 232 |
| 348 | 3300005367 | Ga0070667_100270548 | Ga0070667_1002705482 | 232 |
| 349 | 3300005436 | Ga0070713_100332180 | Ga0070713_1003321802 | 232 |
| 350 | 3300005455 | Ga0070663_100007287 | Ga0070663_1000072873 | 232 |
| 351 | 3300005455 | Ga0070663_100056365 | Ga0070663_1000563654 | 232 |
| 352 | 3300005455 | Ga0070663_100268909 | Ga0070663_1002689092 | 232 |
| 353 | 3300005456 | Ga0070678_100119748 | Ga0070678_1001197483 | 232 |
| 354 | 3300005457 | Ga0070662_100010296 | Ga0070662_1000102964 | 232 |
| 355 | 3300005457 | Ga0070662_100010443 | Ga0070662_1000104435 | 232 |
| 356 | 3300005457 | Ga0070662_100100869 | Ga0070662_1001008693 | 232 |
| 357 | 3300005457 | Ga0070662_100134101 | Ga0070662_1001341013 | 232 |
| 358 | 3300005458 | Ga0070681_10015837 | Ga0070681_100158374 | 232 |
| 359 | 3300005458 | Ga0070681_10110568 | Ga0070681_101105683 | 232 |
| 360 | 3300005458 | Ga0070681_10126709 | Ga0070681_101267092 | 232 |
| 361 | 3300005530 | Ga0070679_100010527 | Ga0070679_1000105276 | 232 |
| 362 | 3300005530 | Ga0070679_100037562 | Ga0070679_1000375624 | 232 |
| 363 | 3300005530 | Ga0070679_100194770 | Ga0070679_1001947703 | 232 |
| 364 | 3300005530 | Ga0070679_100679391 | Ga0070679_1006793911 | 232 |
| 365 | 3300005535 | Ga0070684_100099797 | Ga0070684_1000997973 | 232 |
| 366 | 3300005535 | Ga0070684_100173237 | Ga0070684_1001732372 | 232 |
| 367 | 3300005535 | Ga0070684_100450844 | Ga0070684_1004508442 | 232 |
| 368 | 3300005539 | Ga0068853_100019480 | Ga0068853_1000194807 | 232 |
| 369 | 3300005539 | Ga0068853_100135257 | Ga0068853_1001352572 | 232 |
| 370 | 3300005539 | Ga0068853_100206762 | Ga0068853_1002067621 | 232 |
| 371 | 3300005539 | Ga0068853_100339428 | Ga0068853_1003394282 | 232 |
| 372 | 3300005543 | Ga0070672_100053325 | Ga0070672_1000533252 | 232 |
| 373 | 3300005544 | Ga0070686_100014008 | Ga0070686_1000140087 | 232 |
| 374 | 3300005544 | Ga0070686_100073946 | Ga0070686_1000739463 | 232 |
| 375 | 3300005548 | Ga0070665_100005268 | Ga0070665_1000052688 | 232 |
| 376 | 3300005548 | Ga0070665_100610442 | Ga0070665_1006104422 | 232 |
| 377 | 3300005563 | Ga0068855_100001020 | Ga0068855_10000102011 | 232 |
| 378 | 3300005563 | Ga0068855_100013351 | Ga0068855_1000133512 | 232 |
| 379 | 3300005563 | Ga0068855_100049734 | Ga0068855_1000497341 | 232 |
| 380 | 3300005563 | Ga0068855_100053685 | Ga0068855_1000536855 | 232 |
| 381 | 3300005563 | Ga0068855_100690316 | Ga0068855_1006903161 | 232 |
| 382 | 3300005564 | Ga0070664_100032121 | Ga0070664_1000321215 | 232 |
| 383 | 3300005564 | Ga0070664_100042869 | Ga0070664_1000428693 | 232 |
| 384 | 3300005577 | Ga0068857_100014661 | Ga0068857_1000146615 | 232 |
| 385 | 3300005577 | Ga0068857_100044542 | Ga0068857_1000445424 | 232 |
| 386 | 3300005577 | Ga0068857_100046567 | Ga0068857_1000465676 | 232 |
| 387 | 3300005577 | Ga0068857_100229944 | Ga0068857_1002299442 | 232 |
| 388 | 3300005578 | Ga0068854_100040449 | Ga0068854_1000404494 | 232 |
| 389 | 3300005614 | Ga0068856_100001155 | Ga0068856_1000011558 | 232 |
| 390 | 3300005614 | Ga0068856_100045350 | Ga0068856_1000453504 | 232 |
| 391 | 3300005614 | Ga0068856_100186615 | Ga0068856_1001866153 | 232 |
| 392 | 3300005616 | Ga0068852_100117022 | Ga0068852_1001170223 | 232 |
| 393 | 3300005616 | Ga0068852_100214924 | Ga0068852_1002149243 | 232 |
| 394 | 3300005616 | Ga0068852_100385361 | Ga0068852_1003853611 | 232 |
| 395 | 3300005616 | Ga0068852_100600057 | Ga0068852_1006000571 | 232 |
| 396 | 3300005617 | Ga0068859_100004525 | Ga0068859_10000452511 | 232 |
| 397 | 3300005617 | Ga0068859_100005457 | Ga0068859_1000054578 | 232 |
| 398 | 3300005617 | Ga0068859_100013275 | Ga0068859_1000132757 | 232 |
| 399 | 3300005617 | Ga0068859_100022856 | Ga0068859_1000228564 | 232 |
| 400 | 3300005617 | Ga0068859_100042002 | Ga0068859_1000420021 | 232 |
| 401 | 3300005617 | Ga0068859_100090054 | Ga0068859_1000900544 | 232 |
| 402 | 3300005618 | Ga0068864_100007308 | Ga0068864_1000073089 | 232 |
| 403 | 3300005718 | Ga0068866_10135818 | Ga0068866_101358182 | 232 |
| 404 | 3300005718 | Ga0068866_10138092 | Ga0068866_101380922 | 232 |
| 405 | 3300005719 | Ga0068861_100033169 | Ga0068861_1000331693 | 232 |
| 406 | 3300005834 | Ga0068851_10050635 | Ga0068851_100506353 | 232 |
| 407 | 3300005840 | Ga0068870_10115415 | Ga0068870_101154152 | 232 |
| 408 | 3300005841 | Ga0068863_100159874 | Ga0068863_1001598741 | 232 |
| 409 | 3300005841 | Ga0068863_100189881 | Ga0068863_1001898812 | 232 |
| 410 | 3300005841 | Ga0068863_100423301 | Ga0068863_1004233013 | 232 |
| 411 | 3300005842 | Ga0068858_100081025 | Ga0068858_1000810254 | 232 |
| 412 | 3300005842 | Ga0068858_100087319 | Ga0068858_1000873193 | 232 |
| 413 | 3300005842 | Ga0068858_101029335 | Ga0068858_1010293351 | 232 |
| 414 | 3300005843 | Ga0068860_100002154 | Ga0068860_1000021548 | 232 |
| 415 | 3300005843 | Ga0068860_100022913 | Ga0068860_1000229134 | 232 |
| 416 | 3300005843 | Ga0068860_100077181 | Ga0068860_1000771813 | 232 |
| 417 | 3300005843 | Ga0068860_100086977 | Ga0068860_1000869773 | 232 |
| 418 | 3300005843 | Ga0068860_100114836 | Ga0068860_1001148362 | 232 |
| 419 | 3300005843 | Ga0068860_100396780 | Ga0068860_1003967802 | 232 |
| 420 | 3300005844 | Ga0068862_100001370 | Ga0068862_10000137015 | 232 |
| 421 | 3300005844 | Ga0068862_100067215 | Ga0068862_1000672153 | 232 |
| 422 | 3300005844 | Ga0068862_100168512 | Ga0068862_1001685122 | 232 |
| 423 | 3300005844 | Ga0068862_100293880 | Ga0068862_1002938803 | 232 |
| 424 | 3300005844 | Ga0068862_100576719 | Ga0068862_1005767192 | 232 |
| 425 | 3300005844 | Ga0068862_100656691 | Ga0068862_1006566912 | 232 |
| 426 | 3300005985 | Ga0081539_10053522 | Ga0081539_100535223 | 232 |
| 427 | 3300006163 | Ga0070715_10009819 | Ga0070715_100098194 | 232 |
| 428 | 3300006195 | Ga0075366_10001635 | Ga0075366_100016356 | 232 |
| 429 | 3300006195 | Ga0075366_10105868 | Ga0075366_101058682 | 232 |
| 430 | 3300006195 | Ga0075366_10245551 | Ga0075366_102455511 | 232 |
| 431 | 3300006237 | Ga0097621_100006750 | Ga0097621_1000067504 | 232 |
| 432 | 3300006237 | Ga0097621_100098003 | Ga0097621_1000980033 | 232 |
| 433 | 3300006237 | Ga0097621_100153206 | Ga0097621_1001532062 | 232 |
| 434 | 3300006358 | Ga0068871_100002609 | Ga0068871_1000026094 | 232 |
| 435 | 3300006358 | Ga0068871_100016800 | Ga0068871_1000168006 | 232 |
| 436 | 3300006881 | Ga0068865_100133962 | Ga0068865_1001339622 | 232 |
| 437 | 3300006881 | Ga0068865_100430604 | Ga0068865_1004306042 | 232 |
| 438 | 3300006931 | Ga0097620_100004525 | Ga0097620_10000452511 | 232 |
| 439 | 3300006931 | Ga0097620_100005457 | Ga0097620_1000054578 | 232 |
| 440 | 3300006931 | Ga0097620_100013274 | Ga0097620_1000132747 | 232 |
| 441 | 3300006931 | Ga0097620_100022856 | Ga0097620_1000228564 | 232 |
| 442 | 3300006931 | Ga0097620_100042001 | Ga0097620_1000420011 | 232 |
| 443 | 3300006931 | Ga0097620_100090054 | Ga0097620_1000900544 | 232 |
| 444 | 3300009093 | Ga0105240_10000011 | Ga0105240_1000001196 | 232 |
| 445 | 3300009093 | Ga0105240_10000126 | Ga0105240_1000012614 | 232 |
| 446 | 3300009093 | Ga0105240_10058570 | Ga0105240_100585705 | 232 |
| 447 | 3300009093 | Ga0105240_10281022 | Ga0105240_102810222 | 232 |
| 448 | 3300009093 | Ga0105240_10283953 | Ga0105240_102839533 | 232 |
| 449 | 3300009093 | Ga0105240_10578221 | Ga0105240_105782212 | 232 |
| 450 | 3300009094 | Ga0111539_10086428 | Ga0111539_100864282 | 232 |
| 451 | 3300009098 | Ga0105245_10283948 | Ga0105245_102839482 | 232 |
| 452 | 3300009101 | Ga0105247_10022655 | Ga0105247_100226554 | 232 |
| 453 | 3300009174 | Ga0105241_10033116 | Ga0105241_100331164 | 232 |
| 454 | 3300009174 | Ga0105241_10139578 | Ga0105241_101395781 | 232 |
| 455 | 3300009174 | Ga0105241_10169259 | Ga0105241_101692593 | 232 |
| 456 | 3300009174 | Ga0105241_10388882 | Ga0105241_103888822 | 232 |
| 457 | 3300009174 | Ga0105241_10584519 | Ga0105241_105845192 | 232 |
| 458 | 3300009176 | Ga0105242_10039472 | Ga0105242_100394724 | 232 |
| 459 | 3300009176 | Ga0105242_10341845 | Ga0105242_103418452 | 232 |
| 460 | 3300009545 | Ga0105237_10005111 | Ga0105237_1000511111 | 232 |
| 461 | 3300009545 | Ga0105237_10018370 | Ga0105237_100183705 | 232 |
| 462 | 3300009545 | Ga0105237_10018921 | Ga0105237_100189215 | 232 |
| 463 | 3300009545 | Ga0105237_10228280 | Ga0105237_102282803 | 232 |
| 464 | 3300009545 | Ga0105237_10629128 | Ga0105237_106291282 | 232 |
| 465 | 3300009551 | Ga0105238_10410558 | Ga0105238_104105582 | 232 |
| 466 | 3300009553 | Ga0105249_10108101 | Ga0105249_101081013 | 232 |
| 467 | 3300009553 | Ga0105249_10276369 | Ga0105249_102763692 | 232 |
| 468 | 3300010375 | Ga0105239_10000005 | Ga0105239_10000005381 | 232 |
| 469 | 3300010375 | Ga0105239_10000122 | Ga0105239_1000012265 | 232 |
| 470 | 3300010375 | Ga0105239_10002186 | Ga0105239_100021865 | 232 |
| 471 | 3300010375 | Ga0105239_10004534 | Ga0105239_1000453414 | 232 |
| 472 | 3300010375 | Ga0105239_10004850 | Ga0105239_1000485013 | 232 |
| 473 | 3300010375 | Ga0105239_10022560 | Ga0105239_100225606 | 232 |
| 474 | 3300010375 | Ga0105239_10097656 | Ga0105239_100976564 | 232 |
| 475 | 3300011119 | Ga0105246_10286234 | Ga0105246_102862342 | 232 |
| 476 | 3300013100 | Ga0157373_10000199 | Ga0157373_1000019925 | 232 |
| 477 | 3300013100 | Ga0157373_10002632 | Ga0157373_100026329 | 232 |
| 478 | 3300013100 | Ga0157373_10003027 | Ga0157373_100030273 | 232 |
| 479 | 3300013100 | Ga0157373_10055300 | Ga0157373_100553003 | 232 |
| 480 | 3300013100 | Ga0157373_10122817 | Ga0157373_101228171 | 232 |
| 481 | 3300013102 | Ga0157371_10000529 | Ga0157371_100005292 | 232 |
| 482 | 3300013102 | Ga0157371_10002520 | Ga0157371_1000252011 | 232 |
| 483 | 3300013102 | Ga0157371_10007629 | Ga0157371_100076294 | 232 |
| 484 | 3300013102 | Ga0157371_10050537 | Ga0157371_100505372 | 232 |
| 485 | 3300013102 | Ga0157371_10171419 | Ga0157371_101714193 | 232 |
| 486 | 3300013104 | Ga0157370_10013720 | Ga0157370_100137203 | 232 |
| 487 | 3300013104 | Ga0157370_10031796 | Ga0157370_100317965 | 232 |
| 488 | 3300013104 | Ga0157370_10487207 | Ga0157370_104872072 | 232 |
| 489 | 3300013105 | Ga0157369_10000039 | Ga0157369_1000003915 | 232 |
| 490 | 3300013105 | Ga0157369_10009198 | Ga0157369_100091984 | 232 |
| 491 | 3300013105 | Ga0157369_10091713 | Ga0157369_100917133 | 232 |
| 492 | 3300013105 | Ga0157369_10105244 | Ga0157369_101052443 | 232 |
| 493 | 3300013296 | Ga0157374_10008373 | Ga0157374_100083737 | 232 |
| 494 | 3300013296 | Ga0157374_10222909 | Ga0157374_102229093 | 232 |
| 495 | 3300013296 | Ga0157374_10334177 | Ga0157374_103341771 | 232 |
| 496 | 3300013297 | Ga0157378_10003085 | Ga0157378_1000308514 | 232 |
| 497 | 3300013297 | Ga0157378_10006215 | Ga0157378_100062159 | 232 |
| 498 | 3300013297 | Ga0157378_10072667 | Ga0157378_100726673 | 232 |
| 499 | 3300013297 | Ga0157378_10109877 | Ga0157378_101098773 | 232 |
| 500 | 3300013297 | Ga0157378_10209543 | Ga0157378_102095433 | 232 |
| 501 | 3300013297 | Ga0157378_10531899 | Ga0157378_105318992 | 232 |
| 502 | 3300013297 | Ga0157378_10945081 | Ga0157378_109450811 | 232 |
| 503 | 3300013306 | Ga0163162_10000024 | Ga0163162_10000024171 | 232 |
| 504 | 3300013306 | Ga0163162_10000882 | Ga0163162_100008825 | 232 |
| 505 | 3300013306 | Ga0163162_10003984 | Ga0163162_1000398413 | 232 |
| 506 | 3300013306 | Ga0163162_10063454 | Ga0163162_100634542 | 232 |
| 507 | 3300013306 | Ga0163162_10065752 | Ga0163162_100657524 | 232 |
| 508 | 3300013307 | Ga0157372_10000001 | Ga0157372_10000001347 | 232 |
| 509 | 3300013307 | Ga0157372_10001038 | Ga0157372_100010386 | 232 |
| 510 | 3300013307 | Ga0157372_10001070 | Ga0157372_1000107021 | 232 |
| 511 | 3300013307 | Ga0157372_10004146 | Ga0157372_100041465 | 232 |
| 512 | 3300013307 | Ga0157372_10007653 | Ga0157372_100076539 | 232 |
| 513 | 3300013307 | Ga0157372_10053155 | Ga0157372_100531554 | 232 |
| 514 | 3300013307 | Ga0157372_10100561 | Ga0157372_101005614 | 232 |
| 515 | 3300013307 | Ga0157372_10224886 | Ga0157372_102248861 | 232 |
| 516 | 3300013308 | Ga0157375_10003648 | Ga0157375_100036484 | 232 |
| 517 | 3300013308 | Ga0157375_10127509 | Ga0157375_101275093 | 232 |
| 518 | 3300013308 | Ga0157375_10529722 | Ga0157375_105297222 | 232 |
| 519 | 3300013308 | Ga0157375_10649475 | Ga0157375_106494752 | 232 |
| 520 | 3300013308 | Ga0157375_11318909 | Ga0157375_113189091 | 232 |
| 521 | 3300014325 | Ga0163163_10001556 | Ga0163163_100015566 | 232 |
| 522 | 3300014325 | Ga0163163_10012108 | Ga0163163_100121082 | 232 |
| 523 | 3300014325 | Ga0163163_10524286 | Ga0163163_105242862 | 232 |
| 524 | 3300014326 | Ga0157380_10002192 | Ga0157380_100021925 | 232 |
| 525 | 3300014326 | Ga0157380_10235842 | Ga0157380_102358423 | 232 |
| 526 | 3300014326 | Ga0157380_10552350 | Ga0157380_105523502 | 232 |
| 527 | 3300014745 | Ga0157377_10007003 | Ga0157377_100070037 | 232 |
| 528 | 3300014745 | Ga0157377_10302779 | Ga0157377_103027792 | 232 |
| 529 | 3300014968 | Ga0157379_10460926 | Ga0157379_104609262 | 232 |
| 530 | 3300014969 | Ga0157376_10011991 | Ga0157376_100119915 | 232 |
| 531 | 3300014969 | Ga0157376_10015574 | Ga0157376_100155747 | 232 |
| 532 | 3300014969 | Ga0157376_10241742 | Ga0157376_102417422 | 232 |
| 533 | 3300017792 | Ga0163161_10001188 | Ga0163161_1000118818 | 232 |
| 534 | 3300017792 | Ga0163161_10013505 | Ga0163161_100135057 | 232 |
| 535 | 3300017792 | Ga0163161_10184672 | Ga0163161_101846723 | 232 |
| 536 | 3300021361 | Ga0213872_10053446 | Ga0213872_100534462 | 232 |
| 537 | 3300025231 | Ga0207427_100106 | Ga0207427_10010635 | 232 |
| 538 | 3300025233 | Ga0209437_100077 | Ga0209437_100077155 | 232 |
| 539 | 3300025233 | Ga0209437_100226 | Ga0209437_10022634 | 232 |
| 540 | 3300025250 | Ga0209026_1001905 | Ga0209026_10019056 | 232 |
| 541 | 3300025250 | Ga0209026_1012739 | Ga0209026_10127392 | 232 |
| 542 | 3300025261 | Ga0209233_1000089 | Ga0209233_100008934 | 232 |
| 543 | 3300025261 | Ga0209233_1001139 | Ga0209233_100113912 | 232 |
| 544 | 3300025272 | Ga0209455_1002616 | Ga0209455_10026167 | 232 |
| 545 | 3300025315 | Ga0207697_10040271 | Ga0207697_100402712 | 232 |
| 546 | 3300025903 | Ga0207680_10564099 | Ga0207680_105640991 | 232 |
| 547 | 3300025904 | Ga0207647_10000473 | Ga0207647_1000047312 | 232 |
| 548 | 3300025904 | Ga0207647_10035567 | Ga0207647_100355672 | 232 |
| 549 | 3300025904 | Ga0207647_10185355 | Ga0207647_101853552 | 232 |
| 550 | 3300025907 | Ga0207645_10065394 | Ga0207645_100653942 | 232 |
| 551 | 3300025908 | Ga0207643_10022447 | Ga0207643_100224474 | 232 |
| 552 | 3300025908 | Ga0207643_10091934 | Ga0207643_100919341 | 232 |
| 553 | 3300025909 | Ga0207705_10018591 | Ga0207705_100185914 | 232 |
| 554 | 3300025909 | Ga0207705_10287661 | Ga0207705_102876612 | 232 |
| 555 | 3300025909 | Ga0207705_10736745 | Ga0207705_107367451 | 232 |
| 556 | 3300025911 | Ga0207654_10063509 | Ga0207654_100635093 | 232 |
| 557 | 3300025911 | Ga0207654_10084913 | Ga0207654_100849132 | 232 |
| 558 | 3300025911 | Ga0207654_10090860 | Ga0207654_100908602 | 232 |
| 559 | 3300025911 | Ga0207654_10170802 | Ga0207654_101708021 | 232 |
| 560 | 3300025913 | Ga0207695_10000010 | Ga0207695_10000010484 | 232 |
| 561 | 3300025913 | Ga0207695_10000013 | Ga0207695_10000013337 | 232 |
| 562 | 3300025913 | Ga0207695_10009521 | Ga0207695_100095212 | 232 |
| 563 | 3300025913 | Ga0207695_10049264 | Ga0207695_100492643 | 232 |
| 564 | 3300025913 | Ga0207695_10130012 | Ga0207695_101300123 | 232 |
| 565 | 3300025913 | Ga0207695_10209543 | Ga0207695_102095432 | 232 |
| 566 | 3300025914 | Ga0207671_10000728 | Ga0207671_1000072826 | 232 |
| 567 | 3300025914 | Ga0207671_10005736 | Ga0207671_100057364 | 232 |
| 568 | 3300025914 | Ga0207671_10009466 | Ga0207671_100094664 | 232 |
| 569 | 3300025914 | Ga0207671_10149616 | Ga0207671_101496163 | 232 |
| 570 | 3300025917 | Ga0207660_10018889 | Ga0207660_100188895 | 232 |
| 571 | 3300025917 | Ga0207660_10137633 | Ga0207660_101376332 | 232 |
| 572 | 3300025917 | Ga0207660_10243584 | Ga0207660_102435842 | 232 |
| 573 | 3300025919 | Ga0207657_10205457 | Ga0207657_102054572 | 232 |
| 574 | 3300025920 | Ga0207649_10018665 | Ga0207649_100186654 | 232 |
| 575 | 3300025921 | Ga0207652_10000844 | Ga0207652_1000084412 | 232 |
| 576 | 3300025921 | Ga0207652_10015718 | Ga0207652_100157183 | 232 |
| 577 | 3300025921 | Ga0207652_10605735 | Ga0207652_106057352 | 232 |
| 578 | 3300025923 | Ga0207681_10019641 | Ga0207681_100196415 | 232 |
| 579 | 3300025923 | Ga0207681_10452488 | Ga0207681_104524881 | 232 |
| 580 | 3300025925 | Ga0207650_10064839 | Ga0207650_100648393 | 232 |
| 581 | 3300025925 | Ga0207650_10079521 | Ga0207650_100795212 | 232 |
| 582 | 3300025925 | Ga0207650_10461484 | Ga0207650_104614841 | 232 |
| 583 | 3300025926 | Ga0207659_10107346 | Ga0207659_101073463 | 232 |
| 584 | 3300025926 | Ga0207659_10213382 | Ga0207659_102133822 | 232 |
| 585 | 3300025931 | Ga0207644_10141493 | Ga0207644_101414932 | 232 |
| 586 | 3300025931 | Ga0207644_10683453 | Ga0207644_106834531 | 232 |
| 587 | 3300025933 | Ga0207706_10007192 | Ga0207706_100071925 | 232 |
| 588 | 3300025933 | Ga0207706_10019195 | Ga0207706_100191957 | 232 |
| 589 | 3300025933 | Ga0207706_10046944 | Ga0207706_100469444 | 232 |
| 590 | 3300025933 | Ga0207706_10342410 | Ga0207706_103424103 | 232 |
| 591 | 3300025934 | Ga0207686_10071244 | Ga0207686_100712441 | 232 |
| 592 | 3300025934 | Ga0207686_10381434 | Ga0207686_103814342 | 232 |
| 593 | 3300025936 | Ga0207670_10062668 | Ga0207670_100626682 | 232 |
| 594 | 3300025936 | Ga0207670_10112529 | Ga0207670_101125292 | 232 |
| 595 | 3300025937 | Ga0207669_10155222 | Ga0207669_101552221 | 232 |
| 596 | 3300025937 | Ga0207669_10281219 | Ga0207669_102812192 | 232 |
| 597 | 3300025938 | Ga0207704_10084013 | Ga0207704_100840132 | 232 |
| 598 | 3300025938 | Ga0207704_10086891 | Ga0207704_100868912 | 232 |
| 599 | 3300025938 | Ga0207704_10201454 | Ga0207704_102014542 | 232 |
| 600 | 3300025940 | Ga0207691_10062524 | Ga0207691_100625244 | 232 |
| 601 | 3300025942 | Ga0207689_10007865 | Ga0207689_100078658 | 232 |
| 602 | 3300025942 | Ga0207689_10023823 | Ga0207689_100238232 | 232 |
| 603 | 3300025942 | Ga0207689_10031604 | Ga0207689_100316045 | 232 |
| 604 | 3300025942 | Ga0207689_10101630 | Ga0207689_101016302 | 232 |
| 605 | 3300025942 | Ga0207689_10219548 | Ga0207689_102195483 | 232 |
| 606 | 3300025942 | Ga0207689_10447122 | Ga0207689_104471222 | 232 |
| 607 | 3300025944 | Ga0207661_10012229 | Ga0207661_100122296 | 232 |
| 608 | 3300025944 | Ga0207661_10083125 | Ga0207661_100831254 | 232 |
| 609 | 3300025945 | Ga0207679_10002266 | Ga0207679_100022669 | 232 |
| 610 | 3300025945 | Ga0207679_10060241 | Ga0207679_100602413 | 232 |
| 611 | 3300025949 | Ga0207667_10001278 | Ga0207667_1000127829 | 232 |
| 612 | 3300025949 | Ga0207667_10043117 | Ga0207667_100431173 | 232 |
| 613 | 3300025949 | Ga0207667_10835331 | Ga0207667_108353311 | 232 |
| 614 | 3300025949 | Ga0207667_10916060 | Ga0207667_109160601 | 232 |
| 615 | 3300025960 | Ga0207651_10017197 | Ga0207651_100171975 | 232 |
| 616 | 3300025961 | Ga0207712_10012182 | Ga0207712_100121823 | 232 |
| 617 | 3300025961 | Ga0207712_10024434 | Ga0207712_100244344 | 232 |
| 618 | 3300025972 | Ga0207668_10042758 | Ga0207668_100427582 | 232 |
| 619 | 3300025981 | Ga0207640_10062388 | Ga0207640_100623883 | 232 |
| 620 | 3300025981 | Ga0207640_10379996 | Ga0207640_103799962 | 232 |
| 621 | 3300025986 | Ga0207658_10041786 | Ga0207658_100417864 | 232 |
| 622 | 3300025986 | Ga0207658_10159321 | Ga0207658_101593212 | 232 |
| 623 | 3300026023 | Ga0207677_10019837 | Ga0207677_100198373 | 232 |
| 624 | 3300026023 | Ga0207677_10057892 | Ga0207677_100578923 | 232 |
| 625 | 3300026023 | Ga0207677_10624684 | Ga0207677_106246842 | 232 |
| 626 | 3300026035 | Ga0207703_10113372 | Ga0207703_101133724 | 232 |
| 627 | 3300026035 | Ga0207703_10125105 | Ga0207703_101251051 | 232 |
| 628 | 3300026035 | Ga0207703_10942308 | Ga0207703_109423081 | 232 |
| 629 | 3300026041 | Ga0207639_10013988 | Ga0207639_100139882 | 232 |
| 630 | 3300026041 | Ga0207639_10091147 | Ga0207639_100911473 | 232 |
| 631 | 3300026041 | Ga0207639_10281357 | Ga0207639_102813572 | 232 |
| 632 | 3300026041 | Ga0207639_10310803 | Ga0207639_103108032 | 232 |
| 633 | 3300026067 | Ga0207678_10015406 | Ga0207678_100154063 | 232 |
| 634 | 3300026067 | Ga0207678_10052313 | Ga0207678_100523132 | 232 |
| 635 | 3300026067 | Ga0207678_10284339 | Ga0207678_102843393 | 232 |
| 636 | 3300026078 | Ga0207702_10001532 | Ga0207702_1000153220 | 232 |
| 637 | 3300026078 | Ga0207702_10042134 | Ga0207702_100421345 | 232 |
| 638 | 3300026078 | Ga0207702_10057981 | Ga0207702_100579814 | 232 |
| 639 | 3300026088 | Ga0207641_10121938 | Ga0207641_101219382 | 232 |
| 640 | 3300026088 | Ga0207641_10192789 | Ga0207641_101927892 | 232 |
| 641 | 3300026089 | Ga0207648_10088004 | Ga0207648_100880042 | 232 |
| 642 | 3300026089 | Ga0207648_10242851 | Ga0207648_102428512 | 232 |
| 643 | 3300026095 | Ga0207676_10007397 | Ga0207676_100073977 | 232 |
| 644 | 3300026095 | Ga0207676_10115397 | Ga0207676_101153972 | 232 |
| 645 | 3300026095 | Ga0207676_10160310 | Ga0207676_101603102 | 232 |
| 646 | 3300026095 | Ga0207676_10301240 | Ga0207676_103012402 | 232 |
| 647 | 3300026116 | Ga0207674_10035923 | Ga0207674_100359235 | 232 |
| 648 | 3300026116 | Ga0207674_10036409 | Ga0207674_100364095 | 232 |
| 649 | 3300026116 | Ga0207674_10173016 | Ga0207674_101730163 | 232 |
| 650 | 3300026118 | Ga0207675_100109943 | Ga0207675_1001099432 | 232 |
| 651 | 3300026118 | Ga0207675_100226444 | Ga0207675_1002264443 | 232 |
| 652 | 3300026118 | Ga0207675_100446484 | Ga0207675_1004464841 | 232 |
| 653 | 3300026121 | Ga0207683_10022575 | Ga0207683_100225755 | 232 |
| 654 | 3300026142 | Ga0207698_10164191 | Ga0207698_101641912 | 232 |
| 655 | 3300026142 | Ga0207698_10189610 | Ga0207698_101896103 | 232 |
| 656 | 3300026142 | Ga0207698_10218359 | Ga0207698_102183593 | 232 |
| 657 | 3300026142 | Ga0207698_10592970 | Ga0207698_105929702 | 232 |
| 658 | 3300028379 | Ga0268266_10013332 | Ga0268266_100133324 | 232 |
| 659 | 3300028379 | Ga0268266_10244256 | Ga0268266_102442562 | 232 |
| 660 | 3300028380 | Ga0268265_10006391 | Ga0268265_100063918 | 232 |
| 661 | 3300028380 | Ga0268265_10141310 | Ga0268265_101413103 | 232 |
| 662 | 3300028380 | Ga0268265_10261745 | Ga0268265_102617451 | 232 |
| 663 | 3300028380 | Ga0268265_10506968 | Ga0268265_105069682 | 232 |
| 664 | 3300028381 | Ga0268264_10016735 | Ga0268264_100167352 | 232 |
| 665 | 3300028381 | Ga0268264_10028367 | Ga0268264_100283674 | 232 |
| 666 | 3300028381 | Ga0268264_10035430 | Ga0268264_100354303 | 232 |
| 667 | 3300028381 | Ga0268264_10062469 | Ga0268264_100624691 | 232 |
| 668 | 3300028794 | Ga0307515_10000280 | Ga0307515_100002802 | 232 |
| 669 | 3300028800 | Ga0265338_10087151 | Ga0265338_100871514 | 232 |
| 670 | 3300031251 | Ga0265327_10000006 | Ga0265327_10000006428 | 232 |
| 671 | 3300031251 | Ga0265327_10000159 | Ga0265327_1000015990 | 232 |
| 672 | 3300031251 | Ga0265327_10025635 | Ga0265327_100256352 | 232 |
| 673 | 3300031251 | Ga0265327_10059389 | Ga0265327_100593892 | 232 |
| 674 | 3300031507 | Ga0307509_10116904 | Ga0307509_101169042 | 232 |
| 675 | 3300031711 | Ga0265314_10058108 | Ga0265314_100581083 | 232 |
| 676 | 3300031730 | Ga0307516_10206095 | Ga0307516_102060952 | 232 |
| 677 | 3300031731 | Ga0307405_10005916 | Ga0307405_100059166 | 232 |
| 678 | 3300031901 | Ga0307406_10502419 | Ga0307406_105024192 | 232 |
| 679 | 3300031911 | Ga0307412_10027245 | Ga0307412_100272453 | 232 |
| 680 | 3300031911 | Ga0307412_10132054 | Ga0307412_101320541 | 232 |
| 681 | 3300032004 | Ga0307414_10474955 | Ga0307414_104749552 | 232 |
| 682 | 3300032005 | Ga0307411_10002789 | Ga0307411_100027896 | 232 |
| 683 | 3300033180 | Ga0307510_10008290 | Ga0307510_100082908 | 232 |
| 684 | 3300035112 | Ga0373932_0169051 | Ga0373932_0169051_29_727 | 232 |
| 685 | 3300035118 | Ga0373954_0036500 | Ga0373954_0036500_972_1670 | 232 |
| 686 | 3300035171 | Ga0373946_0160540 | Ga0373946_0160540_242_940 | 232 |
| 687 | 3300035724 | Ga0373933_0168959 | Ga0373933_0168959_304_1002 | 232 |
| 688 | 3300035725 | Ga0373947_0041140 | Ga0373947_0041140_1772_2470 | 232 |
| 689 | 3300037068 | Ga0373925_0059520 | Ga0373925_0059520_819_1517 | 232 |
| 690 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_919317_920015 | 232 |
| 691 | 3300037312 | Ga0395899_0000735 | Ga0395899_0000735_29269_29967 | 232 |
| 692 | 3300037312 | Ga0395899_0038695 | Ga0395899_0038695_1785_2486 | 232 |
| 693 | 3300037312 | Ga0395899_0097246 | Ga0395899_0097246_1224_1922 | 232 |
| 694 | 3300037312 | Ga0395899_0105011 | Ga0395899_0105011_1125_1823 | 232 |
| 695 | 3300037312 | Ga0395899_0211472 | Ga0395899_0211472_105_806 | 232 |
| 696 | 3300037312 | Ga0395899_0306779 | Ga0395899_0306779_165_866 | 232 |
| 697 | 3300037418 | Ga0395900_0000014 | Ga0395900_0000014_216997_217695 | 232 |
| 698 | 3300037418 | Ga0395900_0000122 | Ga0395900_0000122_4596_5294 | 232 |
| 699 | 3300037418 | Ga0395900_0007456 | Ga0395900_0007456_1022_1723 | 232 |
| 700 | 3300037418 | Ga0395900_0052327 | Ga0395900_0052327_1678_2415 | 232 |
| 701 | 3300037418 | Ga0395900_0096846 | Ga0395900_0096846_2216_2914 | 232 |
| 702 | 3300037418 | Ga0395900_0367899 | Ga0395900_0367899_55_753 | 232 |
| 703 | 3300037418 | Ga0395900_0495558 | Ga0395900_0495558_165_866 | 232 |
| 704 | 3300037466 | Ga0395898_0024518 | Ga0395898_0024518_1857_2555 | 232 |
| 705 | 3300037466 | Ga0395898_0047336 | Ga0395898_0047336_3358_4056 | 232 |
| 706 | 3300037466 | Ga0395898_0154386 | Ga0395898_0154386_1106_1843 | 232 |
| 707 | 3300037466 | Ga0395898_0189279 | Ga0395898_0189279_974_1675 | 232 |
| 708 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_1464371_1465087 | 232 |
| 709 | 3300037471 | Ga0395905_0000037 | Ga0395905_0000037_216987_217685 | 232 |
| 710 | 3300037471 | Ga0395905_0001611 | Ga0395905_0001611_12355_13092 | 232 |
| 711 | 3300037471 | Ga0395905_0007405 | Ga0395905_0007405_513_1211 | 232 |
| 712 | 3300037471 | Ga0395905_0035016 | Ga0395905_0035016_3821_4522 | 232 |
| 713 | 3300037471 | Ga0395905_0185797 | Ga0395905_0185797_19_717 | 232 |
| 714 | 3300037471 | Ga0395905_0845263 | Ga0395905_0845263_71_769 | 232 |
| 715 | 3300038443 | Ga0395901_0000219 | Ga0395901_0000219_25601_26299 | 232 |
| 716 | 3300038443 | Ga0395901_0072520 | Ga0395901_0072520_1387_2124 | 232 |
| 717 | 3300038443 | Ga0395901_0093437 | Ga0395901_0093437_2298_2996 | 232 |
| 718 | 3300038443 | Ga0395901_0800805 | Ga0395901_0800805_103_804 | 232 |
| 719 | 3300041505 | Ga0451849_1408969 | Ga0451849_1408969_80_787 | 232 |
| 720 | 3300042135 | Ga0450899_007462 | Ga0450899_007462_402_1100 | 232 |
| 721 | 3300042435 | Ga0439434_0004196 | Ga0439434_0004196_1440_2138 | 232 |
| 722 | 3300042876 | Ga0451577_0117869 | Ga0451577_0117869_659_1372 | 232 |
| 723 | 3300044684 | Ga0466966_0022793 | Ga0466966_0022793_3207_3905 | 232 |
| 724 | 3300044693 | Ga0466961_0126273 | Ga0466961_0126273_178_876 | 232 |
| 725 | 3300044712 | Ga0453684_0000912 | Ga0453684_0000912_46664_47362 | 232 |
| 726 | 3300044712 | Ga0453684_0425614 | Ga0453684_0425614_616_1320 | 232 |
| 727 | 3300045049 | Ga0466959_0138317 | Ga0466959_0138317_842_1540 | 232 |
| 728 | 3300045051 | Ga0451576_0000002 | Ga0451576_0000002_228622_229320 | 232 |
| 729 | 3300045051 | Ga0451576_0082587 | Ga0451576_0082587_2090_2803 | 232 |
| 730 | 3300045836 | Ga0466958_0053198 | Ga0466958_0053198_524_1222 | 232 |
| 731 | 3300046454 | Ga0495592_0180762 | Ga0495592_0180762_436_1134 | 232 |
| 732 | 3300046462 | Ga0495651_0305274 | Ga0495651_0305274_300_998 | 232 |
| 733 | 3300046463 | Ga0495653_0236487 | Ga0495653_0236487_243_941 | 232 |
| 734 | 3300046471 | Ga0495650_0000014 | Ga0495650_0000014_562182_562880 | 232 |
| 735 | 3300046471 | Ga0495650_0061702 | Ga0495650_0061702_708_1406 | 232 |
| 736 | 3300046492 | Ga0495585_0000031 | Ga0495585_0000031_130401_131105 | 232 |
| 737 | 3300046500 | Ga0495596_0050349 | Ga0495596_0050349_798_1499 | 232 |
| 738 | 3300046501 | Ga0495607_0180713 | Ga0495607_0180713_195_893 | 232 |
| 739 | 3300046506 | Ga0495583_0056466 | Ga0495583_0056466_320_1018 | 232 |
| 740 | 3300046506 | Ga0495583_0068490 | Ga0495583_0068490_642_1346 | 232 |
| 741 | 3300046507 | Ga0495606_0000020 | Ga0495606_0000020_1746_2444 | 232 |
| 742 | 3300046507 | Ga0495606_0018977 | Ga0495606_0018977_1803_2501 | 232 |
| 743 | 3300046507 | Ga0495606_0171991 | Ga0495606_0171991_32_733 | 232 |
| 744 | 3300046512 | Ga0495610_0017383 | Ga0495610_0017383_2552_3250 | 232 |
| 745 | 3300046513 | Ga0495616_0001192 | Ga0495616_0001192_7802_8500 | 232 |
| 746 | 3300046513 | Ga0495616_0022705 | Ga0495616_0022705_614_1312 | 232 |
| 747 | 3300046516 | Ga0495628_0067700 | Ga0495628_0067700_1543_2241 | 232 |
| 748 | 3300046517 | Ga0495630_0004081 | Ga0495630_0004081_8947_9645 | 232 |
| 749 | 3300046522 | Ga0495643_0000537 | Ga0495643_0000537_7476_8174 | 232 |
| 750 | 3300046522 | Ga0495643_0051822 | Ga0495643_0051822_493_1191 | 232 |
| 751 | 3300046524 | Ga0495648_0041931 | Ga0495648_0041931_1787_2485 | 232 |
| 752 | 3300046529 | Ga0495652_0337405 | Ga0495652_0337405_213_911 | 232 |
| 753 | 3300046538 | Ga0495609_0017620 | Ga0495609_0017620_2423_3121 | 232 |
| 754 | 3300046543 | Ga0495645_0339384 | Ga0495645_0339384_130_828 | 232 |
| 755 | 3300046558 | Ga0495633_0000029 | Ga0495633_0000029_39131_39829 | 232 |
| 756 | 3300046558 | Ga0495633_0109968 | Ga0495633_0109968_60_758 | 232 |
| 757 | 3300046559 | Ga0495667_0285591 | Ga0495667_0285591_151_849 | 232 |
| 758 | 3300046616 | Ga0495668_0000212 | Ga0495668_0000212_83227_83925 | 232 |
| 759 | 3300046648 | Ga0495611_0134899 | Ga0495611_0134899_71_769 | 232 |
| 760 | 3300046660 | Ga0495625_0000009 | Ga0495625_0000009_65033_65731 | 232 |
| 761 | 3300046660 | Ga0495625_0015260 | Ga0495625_0015260_2332_3030 | 232 |
| 762 | 3300046660 | Ga0495625_0021222 | Ga0495625_0021222_3255_3959 | 232 |
| 763 | 3300046660 | Ga0495625_0028393 | Ga0495625_0028393_2240_2938 | 232 |
| 764 | 3300046663 | Ga0495635_0161484 | Ga0495635_0161484_141_839 | 232 |
| 765 | 3300046675 | Ga0495657_0142414 | Ga0495657_0142414_221_919 | 232 |
| 766 | 3300046684 | Ga0495669_0054075 | Ga0495669_0054075_478_1176 | 232 |
| 767 | 3300046692 | Ga0495671_0082545 | Ga0495671_0082545_550_1248 | 232 |
| 768 | 3300046694 | Ga0495649_0000008 | Ga0495649_0000008_182827_183525 | 232 |
| 769 | 3300046809 | Ga0495600_0122978 | Ga0495600_0122978_337_1035 | 232 |
| 770 | 3300046810 | Ga0495660_0011998 | Ga0495660_0011998_2415_3113 | 232 |
| 771 | 3300046810 | Ga0495660_0095489 | Ga0495660_0095489_128_826 | 232 |
| 772 | 3300047318 | Ga0495636_0000011 | Ga0495636_0000011_77416_78114 | 232 |
| 773 | 3300047322 | Ga0495680_0351649 | Ga0495680_0351649_306_1004 | 232 |
| 774 | 3300047323 | Ga0495683_0008202 | Ga0495683_0008202_3616_4317 | 232 |
| 775 | 3300047469 | Ga0495673_0055614 | Ga0495673_0055614_18_716 | 232 |
| 776 | 3300047471 | Ga0495684_0202742 | Ga0495684_0202742_53_751 | 232 |
| 777 | 3300047472 | Ga0495686_0000194 | Ga0495686_0000194_75680_76381 | 232 |
| 778 | 3300047472 | Ga0495686_0007228 | Ga0495686_0007228_49_747 | 232 |
| 779 | 3300047472 | Ga0495686_0018337 | Ga0495686_0018337_1316_2026 | 232 |
| 780 | 3300047472 | Ga0495686_0063558 | Ga0495686_0063558_850_1560 | 232 |
| 781 | 3300048911 | Ga0496108_0127860 | Ga0496108_0127860_569_1267 | 232 |
| 782 | 3300048917 | Ga0496114_0866872 | Ga0496114_0866872_46_744 | 232 |
| 783 | 3300049459 | Ga0495678_021374 | Ga0495678_021374_1817_2515 | 232 |
| 784 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_448537_449244 | 232 |
| 785 | 3300049571 | Ga0501034_0036212 | Ga0501034_0036212_3961_4662 | 232 |
| 786 | 3300049573 | Ga0501037_0345190 | Ga0501037_0345190_113_814 | 232 |
| 787 | 3300049575 | Ga0501039_0376768 | Ga0501039_0376768_115_816 | 232 |
| 788 | 3300049586 | Ga0501070_0100554 | Ga0501070_0100554_1606_2307 | 232 |
| 789 | 3300049663 | Ga0501223_000633 | Ga0501223_000633_5848_6546 | 232 |
| 790 | 3300049822 | Ga0501035_0138397 | Ga0501035_0138397_1328_2029 | 232 |
| 791 | 3300049823 | Ga0501044_0225000 | Ga0501044_0225000_214_915 | 232 |
| 792 | 3300050493 | nmdc:mga0k408_171_c1 | nmdc:mga0k408_171_c1_783_1481 | 232 |
| 793 | 3300050493 | nmdc:mga0k408_55212_c1 | nmdc:mga0k408_55212_c1_401_1099 | 232 |
| 794 | 3300050493 | nmdc:mga0k408_803_c1 | nmdc:mga0k408_803_c1_6636_7358 | 232 |
| 795 | 3300050496 | nmdc:mga07m45_218114_c1 | nmdc:mga07m45_218114_c1_181_882 | 232 |
| 796 | 3300053090 | Ga0500646_0021302 | Ga0500646_0021302_849_1571 | 232 |
| 797 | 3300053125 | Ga0500618_000266 | Ga0500618_000266_8767_9465 | 232 |
| 798 | 3300053130 | Ga0500642_0047893 | Ga0500642_0047893_896_1594 | 232 |
| 799 | 3300053139 | Ga0500568_0001078 | Ga0500568_0001078_7887_8588 | 232 |
| 800 | 3300053157 | Ga0500624_000576 | Ga0500624_000576_8813_9511 | 232 |
| 801 | 3300053727 | Ga0500611_000002 | Ga0500611_000002_137037_137735 | 232 |
| 802 | 2162886007 | SwRhRL2b_contig_1131605 | SwRhRL2b_0890.00007430 | 233 |
| 803 | 2162886007 | SwRhRL2b_contig_3290449 | SwRhRL2b_0191.00000060 | 233 |
| 804 | 3300003187 | JGI25151J46595_10000014 | JGI25151J46595_1000001481 | 233 |
| 805 | 3300003215 | JGI25153J46596_10000020 | JGI25153J46596_1000002081 | 233 |
| 806 | 3300003781 | Ga0055536_1000226 | Ga0055536_100022614 | 233 |
| 807 | 3300003791 | Ga0055530_10005126 | Ga0055530_100051263 | 233 |
| 808 | 3300005288 | Ga0065714_10002345 | Ga0065714_100023458 | 233 |
| 809 | 3300005288 | Ga0065714_10004805 | Ga0065714_100048054 | 233 |
| 810 | 3300005288 | Ga0065714_10017971 | Ga0065714_100179711 | 233 |
| 811 | 3300005288 | Ga0065714_10086246 | Ga0065714_100862462 | 233 |
| 812 | 3300005289 | Ga0065704_10070382 | Ga0065704_1007038214 | 233 |
| 813 | 3300005289 | Ga0065704_10075998 | Ga0065704_100759983 | 233 |
| 814 | 3300005289 | Ga0065704_10164090 | Ga0065704_101640902 | 233 |
| 815 | 3300005366 | Ga0070659_100000578 | Ga0070659_10000057816 | 233 |
| 816 | 3300005366 | Ga0070659_100127506 | Ga0070659_1001275062 | 233 |
| 817 | 3300005466 | Ga0070685_10053770 | Ga0070685_100537703 | 233 |
| 818 | 3300005535 | Ga0070684_100308382 | Ga0070684_1003083822 | 233 |
| 819 | 3300005539 | Ga0068853_100038295 | Ga0068853_1000382953 | 233 |
| 820 | 3300005548 | Ga0070665_100000003 | Ga0070665_100000003193 | 233 |
| 821 | 3300006237 | Ga0097621_100157317 | Ga0097621_1001573173 | 233 |
| 822 | 3300009148 | Ga0105243_10000025 | Ga0105243_1000002589 | 233 |
| 823 | 3300009176 | Ga0105242_10181646 | Ga0105242_101816462 | 233 |
| 824 | 3300013100 | Ga0157373_10002419 | Ga0157373_100024198 | 233 |
| 825 | 3300013100 | Ga0157373_10008475 | Ga0157373_100084757 | 233 |
| 826 | 3300013100 | Ga0157373_10016428 | Ga0157373_100164284 | 233 |
| 827 | 3300013100 | Ga0157373_10062311 | Ga0157373_100623114 | 233 |
| 828 | 3300013102 | Ga0157371_10000620 | Ga0157371_1000062027 | 233 |
| 829 | 3300013102 | Ga0157371_10004074 | Ga0157371_100040744 | 233 |
| 830 | 3300013102 | Ga0157371_10008584 | Ga0157371_100085847 | 233 |
| 831 | 3300013102 | Ga0157371_10009843 | Ga0157371_100098433 | 233 |
| 832 | 3300013104 | Ga0157370_10000207 | Ga0157370_1000020718 | 233 |
| 833 | 3300013104 | Ga0157370_10002038 | Ga0157370_1000203818 | 233 |
| 834 | 3300013104 | Ga0157370_10002831 | Ga0157370_1000283113 | 233 |
| 835 | 3300013104 | Ga0157370_10011824 | Ga0157370_1001182410 | 233 |
| 836 | 3300013104 | Ga0157370_10022568 | Ga0157370_100225681 | 233 |
| 837 | 3300013105 | Ga0157369_10000071 | Ga0157369_1000007116 | 233 |
| 838 | 3300013296 | Ga0157374_10015042 | Ga0157374_100150426 | 233 |
| 839 | 3300013296 | Ga0157374_10348151 | Ga0157374_103481512 | 233 |
| 840 | 3300013297 | Ga0157378_10168134 | Ga0157378_101681342 | 233 |
| 841 | 3300013306 | Ga0163162_10001708 | Ga0163162_100017088 | 233 |
| 842 | 3300013306 | Ga0163162_10067136 | Ga0163162_100671364 | 233 |
| 843 | 3300013306 | Ga0163162_10232405 | Ga0163162_102324052 | 233 |
| 844 | 3300013307 | Ga0157372_10723905 | Ga0157372_107239052 | 233 |
| 845 | 3300013308 | Ga0157375_10253242 | Ga0157375_102532422 | 233 |
| 846 | 3300014325 | Ga0163163_10077719 | Ga0163163_100777192 | 233 |
| 847 | 3300014497 | Ga0182008_10000009 | Ga0182008_10000009171 | 233 |
| 848 | 3300014497 | Ga0182008_10001007 | Ga0182008_1000100721 | 233 |
| 849 | 3300014497 | Ga0182008_10009542 | Ga0182008_100095424 | 233 |
| 850 | 3300014497 | Ga0182008_10026303 | Ga0182008_100263032 | 233 |
| 851 | 3300014497 | Ga0182008_10026857 | Ga0182008_100268571 | 233 |
| 852 | 3300014968 | Ga0157379_10079067 | Ga0157379_100790672 | 233 |
| 853 | 3300014969 | Ga0157376_10132960 | Ga0157376_101329603 | 233 |
| 854 | 3300014969 | Ga0157376_10392818 | Ga0157376_103928182 | 233 |
| 855 | 3300015261 | Ga0182006_1000332 | Ga0182006_100033224 | 233 |
| 856 | 3300015261 | Ga0182006_1000356 | Ga0182006_10003563 | 233 |
| 857 | 3300015261 | Ga0182006_1001370 | Ga0182006_10013703 | 233 |
| 858 | 3300015261 | Ga0182006_1004469 | Ga0182006_10044692 | 233 |
| 859 | 3300015262 | Ga0182007_10000006 | Ga0182007_10000006303 | 233 |
| 860 | 3300015262 | Ga0182007_10009267 | Ga0182007_100092673 | 233 |
| 861 | 3300015262 | Ga0182007_10017706 | Ga0182007_100177062 | 233 |
| 862 | 3300015262 | Ga0182007_10018127 | Ga0182007_100181272 | 233 |
| 863 | 3300015682 | Ga0183373_1001 | Ga0183373_10011144 | 233 |
| 864 | 3300017792 | Ga0163161_10000309 | Ga0163161_1000030914 | 233 |
| 865 | 3300017792 | Ga0163161_10000394 | Ga0163161_1000039422 | 233 |
| 866 | 3300017792 | Ga0163161_10001366 | Ga0163161_100013666 | 233 |
| 867 | 3300017792 | Ga0163161_10093566 | Ga0163161_100935662 | 233 |
| 868 | 3300025245 | Ga0207425_1000007 | Ga0207425_100000794 | 233 |
| 869 | 3300025258 | Ga0209129_1000006 | Ga0209129_100000694 | 233 |
| 870 | 3300025292 | Ga0209676_1000090 | Ga0209676_100009026 | 233 |
| 871 | 3300025294 | Ga0209025_1000089 | Ga0209025_100008978 | 233 |
| 872 | 3300025297 | Ga0209758_1000016 | Ga0209758_100001694 | 233 |
| 873 | 3300025298 | Ga0209050_1000091 | Ga0209050_100009126 | 233 |
| 874 | 3300025932 | Ga0207690_10001498 | Ga0207690_1000149811 | 233 |
| 875 | 3300025935 | Ga0207709_10000003 | Ga0207709_10000003836 | 233 |
| 876 | 3300026142 | Ga0207698_10806199 | Ga0207698_108061991 | 233 |
| 877 | 3300028379 | Ga0268266_10000380 | Ga0268266_1000038014 | 233 |
| 878 | 3300028794 | Ga0307515_10036778 | Ga0307515_100367782 | 233 |
| 879 | 3300030731 | Ga0316177_1086062 | Ga0316177_10860623 | 233 |
| 880 | 3300030732 | Ga0316176_1041743 | Ga0316176_10417433 | 233 |
| 881 | 3300031251 | Ga0265327_10004250 | Ga0265327_100042507 | 233 |
| 882 | 3300031731 | Ga0307405_10000012 | Ga0307405_1000001210 | 233 |
| 883 | 3300031903 | Ga0307407_10000013 | Ga0307407_10000013131 | 233 |
| 884 | 3300031911 | Ga0307412_10000084 | Ga0307412_1000008415 | 233 |
| 885 | 3300032002 | Ga0307416_100000028 | Ga0307416_100000028131 | 233 |
| 886 | 3300032004 | Ga0307414_10004686 | Ga0307414_100046866 | 233 |
| 887 | 3300032004 | Ga0307414_10032759 | Ga0307414_100327593 | 233 |
| 888 | 3300032004 | Ga0307414_10149495 | Ga0307414_101494952 | 233 |
| 889 | 3300032004 | Ga0307414_10157053 | Ga0307414_101570532 | 233 |
| 890 | 3300032004 | Ga0307414_10247729 | Ga0307414_102477292 | 233 |
| 891 | 3300032005 | Ga0307411_10096172 | Ga0307411_100961722 | 233 |
| 892 | 3300032005 | Ga0307411_10235116 | Ga0307411_102351162 | 233 |
| 893 | 3300037312 | Ga0395899_0000025 | Ga0395899_0000025_28742_29458 | 233 |
| 894 | 3300037418 | Ga0395900_0179961 | Ga0395900_0179961_24_740 | 233 |
| 895 | 3300042876 | Ga0451577_0000870 | Ga0451577_0000870_8214_8918 | 233 |
| 896 | 3300044765 | Ga0466970_0070816 | Ga0466970_0070816_604_1308 | 233 |
| 897 | 3300046453 | Ga0495627_009761 | Ga0495627_009761_2663_3364 | 233 |
| 898 | 3300046501 | Ga0495607_0216734 | Ga0495607_0216734_228_929 | 233 |
| 899 | 3300046507 | Ga0495606_0181188 | Ga0495606_0181188_97_798 | 233 |
| 900 | 3300046512 | Ga0495610_0000060 | Ga0495610_0000060_10800_11501 | 233 |
| 901 | 3300046512 | Ga0495610_0002356 | Ga0495610_0002356_8059_8763 | 233 |
| 902 | 3300046513 | Ga0495616_0040499 | Ga0495616_0040499_556_1257 | 233 |
| 903 | 3300046538 | Ga0495609_0076475 | Ga0495609_0076475_236_937 | 233 |
| 904 | 3300046558 | Ga0495633_0054924 | Ga0495633_0054924_638_1342 | 233 |
| 905 | 3300046660 | Ga0495625_0051256 | Ga0495625_0051256_2034_2735 | 233 |
| 906 | 3300048925 | Ga0496122_0001846 | Ga0496122_0001846_17745_18446 | 233 |
| 907 | 3300048926 | Ga0496123_0002062 | Ga0496123_0002062_9768_10469 | 233 |
| 908 | 3300049758 | Ga0501241_005415 | Ga0501241_005415_1505_2206 | 233 |
| 909 | 3300053093 | Ga0500651_0011469 | Ga0500651_0011469_2003_2704 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ooy-assembly1.cif.gz_A | succinyl-coa:3-ketoacid coa transferase from pig heart | 0.9734 | 4 | 225 |
| 1ooz-assembly1.cif.gz_B | deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart | 0.9727 | 4 | 225 |
| 1ooz-assembly1.cif.gz_A | deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart | 0.9727 | 4 | 225 |
| 4kgb-assembly1.cif.gz_B | structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster | 0.972 | 4 | 225 |
| 3dlx-assembly1.cif.gz_A | crystal structure of human 3-oxoacid coa transferase 1 | 0.9716 | 4 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2nrbB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9762 | 4 | 217 | 3.40.1080.10 |
| af_Q4E2P8_5_264_3.40.1080.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9647 | 2 | 232 | 3.40.1080.10 |
| af_A4I5L9_2_259_3.40.1080.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9604 | 3 | 225 | 3.40.1080.10 |
| 5dbnA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9595 | 2 | 215 | 3.40.1080.10 |
| af_Q4E2P8_5_264_3.40.1080.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9526 | 2 | 232 | 3.40.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1QWY8-F1-model_v4 | deleted | 0.9915 | 26 | 102 |
|
| AF-A0A448QWN8-F1-model_v4 | deleted | 0.9881 | 149 | 214 |
|
| AF-A0A0B1R8W6-F1-model_v4 | Succinyl-CoA:3-ketoacid-CoA transferase | 0.9859 | 2 | 114 |
GO:0008410
|
| AF-A7T8F7-F1-model_v4 | Uncharacterized protein | 0.9855 | 6 | 101 |
GO:0008410
|
| AF-A0A455U9C0-F1-model_v4 | CoA transferase subunit A | 0.9854 | 1 | 114 |
GO:0008260
GO:0046950 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar