F485415

General Info

Members Datasets Scaffolds Average Seq Length
909 338 875 232

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000006|Ga0265327_10000006428
Length 264
Sequence MNNLPHWRSHIPHINFDTLITLIFTFSHLVKMGLNKVVANADEAIKDIQSGATLMLGGFGLCGIPENCISALVRKGVKELTCISNNAGVDDFGIGLLLQQRQVKKMISSYVGENAEFERQLLSGELEVELIPQGTLATRCMAAGYGMPAVYVLAGVGTEVAEGKETRNFDGKEYLMEYAFNSDFAIVKAWKGDTQGNLIFKDTARNFNPMMAMAGKITIAEVEELVQPGELDPNFIHVPGIYVHRIFQGTQYEKRIEQRTTRKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
5 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738541284 Pedobacter sp. YR016 Isolate Unclassified
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
10 2738543023 Pedobacter sp. OK628 Isolate Unclassified
11 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
12 2739367651 Pedobacter sp. OK291 Isolate Unclassified
13 2739367656 Pedobacter sp. CF523 Isolate Unclassified
14 2739367663 Pedobacter sp. YR510 Isolate Unclassified
15 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
16 2818991437 Pedobacter terrae 518 Isolate Unclassified
17 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
18 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
19 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
20 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
21 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
22 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
23 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
24 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
25 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
26 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
27 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
28 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
29 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
30 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
31 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
32 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
33 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
34 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
35 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
36 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
37 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
77 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
78 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
213 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
214 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
228 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
243 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
244 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
245 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
259 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
326 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
327 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
328 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
329 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
330 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
331 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
334 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
335 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
336 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 0.11
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.18
Nodule 0
Rhizoplane 0.33
Rhizosphere 91.09
Stem 0
Stem Tuber 0
Unclassified 4.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1131605 2162886007 Bacteria 1250
2 SwRhRL2b_contig_1759593 2162886007 Bacteria 266684
3 SwRhRL2b_contig_3290449 2162886007 Bacteria 4315
4 JGI24740J21852_10042533 3300001979 Bacteria 1361
5 JGI24737J22298_10008536 3300001990 Bacteria 3426
6 JGI24737J22298_10014737 3300001990 Bacteria 2536
7 JGI24743J22301_10016381 3300001991 Bacteria 1382
8 JGI24735J21928_10000006 3300002067 Bacteria 339303
9 JGI24735J21928_10002913 3300002067 Bacteria 5887
10 JGI25162J39368_1001400 3300002737 Bacteria 13179
11 JGI25162J39368_1001919 3300002737 Bacteria 9518
12 JGI25164J39214_1003560 3300002772 Bacteria 1947
13 JGI25151J46595_10000014 3300003187 Bacteria 253098
14 JGI25153J46596_10000020 3300003215 Bacteria 252978
15 rootH1_10072982 3300003316 Bacteria 7424
16 rootH2_10001334 3300003320 Bacteria 238709
17 rootH2_10089325 3300003320 Bacteria 2361
18 rootH1_10002605 3300003323 Bacteria 51064
19 rootH1_10078843 3300003323 Bacteria 6972
20 rootH1_10116441 3300003323 Bacteria 7444
21 Ga0055536_1000226 3300003781 Bacteria 45469
22 Ga0055530_10005126 3300003791 Bacteria 6398
23 Ga0058863_11667303 3300004799 Bacteria 3334
24 Ga0065714_10002345 3300005288 Bacteria 23040
25 Ga0065714_10004805 3300005288 Bacteria 6056
26 Ga0065714_10006702 3300005288 Bacteria 4572
27 Ga0065714_10013197 3300005288 Bacteria 2037
28 Ga0065714_10017971 3300005288 Bacteria 1957
29 Ga0065714_10086246 3300005288 Bacteria 2110
30 Ga0065714_10098037 3300005288 Bacteria 1720
31 Ga0065704_10070133 3300005289 Bacteria 1266035
32 Ga0065704_10070382 3300005289 Bacteria 27921
33 Ga0065704_10075998 3300005289 Bacteria 5279
34 Ga0065704_10164090 3300005289 Bacteria 1332
35 Ga0065712_10315846 3300005290 Bacteria 836
36 Ga0065707_10123842 3300005295 Bacteria 2026
37 Ga0070658_10000026 3300005327 Bacteria 171716
38 Ga0070658_10073376 3300005327 Bacteria 2806
39 Ga0070658_10080404 3300005327 Bacteria 2677
40 Ga0070658_10117414 3300005327 Bacteria 2209
41 Ga0070658_10135069 3300005327 Bacteria 2057
42 Ga0070676_10001812 3300005328 Bacteria 10867
43 Ga0070676_10033047 3300005328 Bacteria 2967
44 Ga0070676_10120154 3300005328 Bacteria 1648
45 Ga0070676_10253158 3300005328 Bacteria 1176
46 Ga0070683_100006215 3300005329 Bacteria 10013
47 Ga0070683_100052046 3300005329 Bacteria 3793
48 Ga0070683_100065882 3300005329 Bacteria 3373
49 Ga0070683_100130540 3300005329 Bacteria 2378
50 Ga0070683_100431642 3300005329 Bacteria 1257
51 Ga0070683_100667198 3300005329 Bacteria 996
52 Ga0070690_100159027 3300005330 Bacteria 1547
53 Ga0070670_100030228 3300005331 Bacteria 4664
54 Ga0070670_100052426 3300005331 Bacteria 3504
55 Ga0070670_100169320 3300005331 Bacteria 1895
56 Ga0070670_100526797 3300005331 Bacteria 1053
57 Ga0068869_100053809 3300005334 Bacteria 2928
58 Ga0068869_100061630 3300005334 Bacteria 2752
59 Ga0068869_100069685 3300005334 Bacteria 2600
60 Ga0068869_100221189 3300005334 Bacteria 1501
61 Ga0070666_10016089 3300005335 Bacteria 4780
62 Ga0070666_10019554 3300005335 Bacteria 4373
63 Ga0070680_100009215 3300005336 Bacteria 7570
64 Ga0070680_100034278 3300005336 Bacteria 4093
65 Ga0070680_100108709 3300005336 Bacteria 2307
66 Ga0070680_100127421 3300005336 Bacteria 2127
67 Ga0070682_100000039 3300005337 Bacteria 144400
68 Ga0070682_100030177 3300005337 Bacteria 3270
69 Ga0070682_100063960 3300005337 Bacteria 2334
70 Ga0070682_100075268 3300005337 Unclassified 2171
71 Ga0070682_100552546 3300005337 Bacteria 901
72 Ga0068868_100012938 3300005338 Bacteria 6105
73 Ga0068868_100014676 3300005338 Bacteria 5777
74 Ga0068868_100027697 3300005338 Bacteria 4324
75 Ga0068868_100029787 3300005338 Bacteria 4182
76 Ga0068868_100087803 3300005338 Bacteria 2501
77 Ga0068868_100327270 3300005338 Bacteria 1307
78 Ga0070660_100000870 3300005339 Bacteria 20145
79 Ga0070660_100022188 3300005339 Bacteria 4691
80 Ga0070660_100063881 3300005339 Bacteria 2863
81 Ga0070660_100203178 3300005339 Bacteria 1607
82 Ga0070660_100441583 3300005339 Bacteria 1079
83 Ga0070689_100059757 3300005340 Bacteria 2962
84 Ga0070661_100001685 3300005344 Bacteria 15290
85 Ga0070661_100016838 3300005344 Bacteria 5174
86 Ga0070661_100122200 3300005344 Bacteria 1951
87 Ga0070692_10102076 3300005345 Bacteria 1574
88 Ga0070668_100029793 3300005347 Bacteria 4147
89 Ga0070669_100002558 3300005353 Bacteria 13155
90 Ga0070675_100079466 3300005354 Bacteria 2733
91 Ga0070675_100166793 3300005354 Bacteria 1897
92 Ga0070675_100325234 3300005354 Unclassified 1359
93 Ga0070671_100029341 3300005355 Bacteria 4535
94 Ga0070671_100041220 3300005355 Bacteria 3837
95 Ga0070671_100110248 3300005355 Bacteria 2311
96 Ga0070671_100365482 3300005355 Bacteria 1232
97 Ga0070671_100470114 3300005355 Bacteria 1080
98 Ga0070674_100462602 3300005356 Bacteria 1049
99 Ga0070673_100017680 3300005364 Bacteria 5077
100 Ga0070673_100286029 3300005364 Bacteria 1447
101 Ga0070688_100222962 3300005365 Bacteria 1329
102 Ga0070688_100280126 3300005365 Bacteria 1198
103 Ga0070688_100460512 3300005365 Bacteria 952
104 Ga0070659_100000578 3300005366 Bacteria 26773
105 Ga0070659_100001687 3300005366 Bacteria 15889
106 Ga0070659_100005037 3300005366 Bacteria 9470
107 Ga0070659_100029194 3300005366 Bacteria 4261
108 Ga0070659_100038013 3300005366 Bacteria 3753
109 Ga0070659_100110556 3300005366 Bacteria 2218
110 Ga0070659_100127506 3300005366 Bacteria 2065
111 Ga0070667_100057892 3300005367 Bacteria 3276
112 Ga0070667_100270548 3300005367 Bacteria 1523
113 Ga0070709_10027617 3300005434 Bacteria 3376
114 Ga0070714_100327873 3300005435 Unclassified 1433
115 Ga0070713_100332180 3300005436 Bacteria 1406
116 Ga0070663_100007287 3300005455 Bacteria 6724
117 Ga0070663_100056365 3300005455 Bacteria 2815
118 Ga0070663_100268909 3300005455 Bacteria 1354
119 Ga0070678_100119748 3300005456 Bacteria 2074
120 Ga0070662_100000093 3300005457 Bacteria 49418
121 Ga0070662_100010296 3300005457 Bacteria 6131
122 Ga0070662_100010443 3300005457 Bacteria 6092
123 Ga0070662_100100869 3300005457 Bacteria 2184
124 Ga0070662_100134101 3300005457 Bacteria 1913
125 Ga0070681_10015837 3300005458 Bacteria 7516
126 Ga0070681_10042095 3300005458 Bacteria 4578
127 Ga0070681_10110568 3300005458 Bacteria 2687
128 Ga0070681_10126709 3300005458 Bacteria 2486
129 Ga0070681_10184858 3300005458 Bacteria 2005
130 Ga0070681_10458353 3300005458 Bacteria 1187
131 Ga0068867_100000834 3300005459 Bacteria 20744
132 Ga0068867_100072490 3300005459 Bacteria 2578
133 Ga0070685_10053770 3300005466 Bacteria 2334
134 Ga0070679_100000053 3300005530 Bacteria 85011
135 Ga0070679_100010527 3300005530 Bacteria 8775
136 Ga0070679_100026213 3300005530 Bacteria 5722
137 Ga0070679_100037562 3300005530 Bacteria 4812
138 Ga0070679_100194770 3300005530 Bacteria 1994
139 Ga0070679_100679391 3300005530 Bacteria 972
140 Ga0070684_100001962 3300005535 Bacteria 15111
141 Ga0070684_100099797 3300005535 Bacteria 2592
142 Ga0070684_100173237 3300005535 Bacteria 1960
143 Ga0070684_100308382 3300005535 Bacteria 1453
144 Ga0070684_100450844 3300005535 Bacteria 1189
145 Ga0068853_100002136 3300005539 Bacteria 14716
146 Ga0068853_100019480 3300005539 Bacteria 5625
147 Ga0068853_100027230 3300005539 Bacteria 4802
148 Ga0068853_100038295 3300005539 Bacteria 4083
149 Ga0068853_100135257 3300005539 Bacteria 2209
150 Ga0068853_100206762 3300005539 Bacteria 1788
151 Ga0068853_100275387 3300005539 Unclassified 1550
152 Ga0068853_100339428 3300005539 Bacteria 1396
153 Ga0070672_100053325 3300005543 Bacteria 3161
154 Ga0070686_100014008 3300005544 Bacteria 4609
155 Ga0070686_100073946 3300005544 Bacteria 2239
156 Ga0070665_100000003 3300005548 Bacteria 811857
157 Ga0070665_100005268 3300005548 Bacteria 13366
158 Ga0070665_100610442 3300005548 Unclassified 1104
159 Ga0068855_100000727 3300005563 Bacteria 40453
160 Ga0068855_100001020 3300005563 Bacteria 34917
161 Ga0068855_100004855 3300005563 Bacteria 16414
162 Ga0068855_100006033 3300005563 Bacteria 14776
163 Ga0068855_100013351 3300005563 Bacteria 9907
164 Ga0068855_100015590 3300005563 Bacteria 9144
165 Ga0068855_100049734 3300005563 Bacteria 4943
166 Ga0068855_100053685 3300005563 Bacteria 4740
167 Ga0068855_100308903 3300005563 Bacteria 1750
168 Ga0068855_100348510 3300005563 Bacteria 1631
169 Ga0068855_100365276 3300005563 Bacteria 1588
170 Ga0068855_100520077 3300005563 Bacteria 1291
171 Ga0068855_100690316 3300005563 Bacteria 1093
172 Ga0070664_100005236 3300005564 Bacteria 10408
173 Ga0070664_100032121 3300005564 Bacteria 4391
174 Ga0070664_100042869 3300005564 Bacteria 3818
175 Ga0068857_100001716 3300005577 Bacteria 17629
176 Ga0068857_100014661 3300005577 Bacteria 6836
177 Ga0068857_100044542 3300005577 Bacteria 3936
178 Ga0068857_100046567 3300005577 Bacteria 3849
179 Ga0068857_100229944 3300005577 Bacteria 1696
180 Ga0068854_100040449 3300005578 Bacteria 3289
181 Ga0068854_100395655 3300005578 Bacteria 1142
182 Ga0068856_100001155 3300005614 Bacteria 27745
183 Ga0068856_100012101 3300005614 Bacteria 8355
184 Ga0068856_100045350 3300005614 Bacteria 4329
185 Ga0068856_100050481 3300005614 Bacteria 4101
186 Ga0068856_100093116 3300005614 Bacteria 2999
187 Ga0068856_100148395 3300005614 Bacteria 2353
188 Ga0068856_100186615 3300005614 Bacteria 2087
189 Ga0068856_100225387 3300005614 Bacteria 1890
190 Ga0068856_100938908 3300005614 Bacteria 884
191 Ga0068852_100005543 3300005616 Bacteria 9051
192 Ga0068852_100117022 3300005616 Bacteria 2433
193 Ga0068852_100214924 3300005616 Bacteria 1826
194 Ga0068852_100385361 3300005616 Bacteria 1376
195 Ga0068852_100600057 3300005616 Bacteria 1105
196 Ga0068859_100004525 3300005617 Bacteria 14180
197 Ga0068859_100005457 3300005617 Bacteria 12935
198 Ga0068859_100013275 3300005617 Bacteria 8264
199 Ga0068859_100022856 3300005617 Bacteria 6270
200 Ga0068859_100042002 3300005617 Bacteria 4592
201 Ga0068859_100090054 3300005617 Bacteria 3118
202 Ga0068864_100007308 3300005618 Bacteria 9087
203 Ga0068866_10135818 3300005718 Bacteria 1405
204 Ga0068866_10138092 3300005718 Bacteria 1396
205 Ga0068861_100033169 3300005719 Bacteria 3807
206 Ga0068851_10050635 3300005834 Bacteria 2109
207 Ga0068870_10115415 3300005840 Bacteria 1539
208 Ga0068863_100159874 3300005841 Bacteria 2158
209 Ga0068863_100189881 3300005841 Bacteria 1974
210 Ga0068863_100423301 3300005841 Bacteria 1305
211 Ga0068858_100044822 3300005842 Bacteria 4099
212 Ga0068858_100081025 3300005842 Bacteria 3017
213 Ga0068858_100087319 3300005842 Bacteria 2901
214 Ga0068858_101029335 3300005842 Bacteria 807
215 Ga0068860_100002154 3300005843 Bacteria 20736
216 Ga0068860_100022913 3300005843 Bacteria 6038
217 Ga0068860_100077181 3300005843 Bacteria 3167
218 Ga0068860_100086977 3300005843 Bacteria 2975
219 Ga0068860_100114836 3300005843 Bacteria 2574
220 Ga0068860_100396780 3300005843 Bacteria 1364
221 Ga0068862_100001370 3300005844 Bacteria 22653
222 Ga0068862_100067215 3300005844 Bacteria 3090
223 Ga0068862_100168512 3300005844 Bacteria 1959
224 Ga0068862_100293880 3300005844 Bacteria 1493
225 Ga0068862_100576719 3300005844 Bacteria 1077
226 Ga0068862_100656691 3300005844 Bacteria 1012
227 Ga0081539_10053522 3300005985 Bacteria 2259
228 Ga0070715_10009819 3300006163 Bacteria 3390
229 Ga0075366_10001635 3300006195 Bacteria 11237
230 Ga0075366_10105868 3300006195 Bacteria 1691
231 Ga0075366_10245551 3300006195 Bacteria 1092
232 Ga0097621_100002096 3300006237 Bacteria 13664
233 Ga0097621_100006750 3300006237 Bacteria 8150
234 Ga0097621_100098003 3300006237 Bacteria 2462
235 Ga0097621_100153206 3300006237 Unclassified 1977
236 Ga0097621_100157317 3300006237 Bacteria 1951
237 Ga0068871_100000196 3300006358 Bacteria 41550
238 Ga0068871_100002609 3300006358 Bacteria 12299
239 Ga0068871_100016800 3300006358 Bacteria 5524
240 Ga0068865_100000022 3300006881 Bacteria 102976
241 Ga0068865_100133962 3300006881 Bacteria 1859
242 Ga0068865_100430604 3300006881 Bacteria 1087
243 Ga0097620_100004525 3300006931 Bacteria 14180
244 Ga0097620_100005457 3300006931 Bacteria 12935
245 Ga0097620_100013274 3300006931 Bacteria 8264
246 Ga0097620_100022856 3300006931 Bacteria 6270
247 Ga0097620_100042001 3300006931 Bacteria 4592
248 Ga0097620_100090054 3300006931 Bacteria 3118
249 Ga0105240_10000011 3300009093 Bacteria 523646
250 Ga0105240_10000126 3300009093 Bacteria 157403
251 Ga0105240_10003724 3300009093 Bacteria 23554
252 Ga0105240_10006944 3300009093 Bacteria 16540
253 Ga0105240_10031376 3300009093 Bacteria 6892
254 Ga0105240_10058570 3300009093 Bacteria 4809
255 Ga0105240_10260825 3300009093 Bacteria 1999
256 Ga0105240_10281022 3300009093 Bacteria 1912
257 Ga0105240_10283953 3300009093 Bacteria 1900
258 Ga0105240_10393709 3300009093 Bacteria 1562
259 Ga0105240_10394176 3300009093 Bacteria 1561
260 Ga0105240_10396497 3300009093 Bacteria 1555
261 Ga0105240_10578221 3300009093 Bacteria 1239
262 Ga0111539_10086428 3300009094 Bacteria 3685
263 Ga0105245_10157763 3300009098 Bacteria 2150
264 Ga0105245_10161636 3300009098 Bacteria 2126
265 Ga0105245_10283948 3300009098 Bacteria 1619
266 Ga0105247_10022655 3300009101 Bacteria 3783
267 Ga0105243_10000025 3300009148 Bacteria 193732
268 Ga0105241_10000238 3300009174 Bacteria 41677
269 Ga0105241_10002650 3300009174 Bacteria 13403
270 Ga0105241_10033116 3300009174 Bacteria 3878
271 Ga0105241_10139578 3300009174 Bacteria 1972
272 Ga0105241_10169259 3300009174 Bacteria 1803
273 Ga0105241_10217437 3300009174 Bacteria 1604
274 Ga0105241_10388882 3300009174 Bacteria 1221
275 Ga0105241_10584519 3300009174 Bacteria 1007
276 Ga0105241_10996612 3300009174 Bacteria 783
277 Ga0105242_10035854 3300009176 Bacteria 3978
278 Ga0105242_10039472 3300009176 Bacteria 3800
279 Ga0105242_10087704 3300009176 Bacteria 2613
280 Ga0105242_10181646 3300009176 Bacteria 1856
281 Ga0105242_10341845 3300009176 Bacteria 1379
282 Ga0105237_10000233 3300009545 Bacteria 79346
283 Ga0105237_10001823 3300009545 Bacteria 27486
284 Ga0105237_10005111 3300009545 Bacteria 14884
285 Ga0105237_10018370 3300009545 Bacteria 7236
286 Ga0105237_10018921 3300009545 Bacteria 7119
287 Ga0105237_10088012 3300009545 Bacteria 3095
288 Ga0105237_10228280 3300009545 Bacteria 1862
289 Ga0105237_10597402 3300009545 Bacteria 1111
290 Ga0105237_10629128 3300009545 Bacteria 1080
291 Ga0105238_10008082 3300009551 Bacteria 10522
292 Ga0105238_10100505 3300009551 Bacteria 2875
293 Ga0105238_10410558 3300009551 Bacteria 1348
294 Ga0105249_10083416 3300009553 Bacteria 2975
295 Ga0105249_10108101 3300009553 Bacteria 2625
296 Ga0105249_10210986 3300009553 Bacteria 1906
297 Ga0105249_10276369 3300009553 Bacteria 1675
298 Ga0105239_10000005 3300010375 Bacteria 496066
299 Ga0105239_10000013 3300010375 Bacteria 327371
300 Ga0105239_10000122 3300010375 Bacteria 109167
301 Ga0105239_10002186 3300010375 Bacteria 25152
302 Ga0105239_10004534 3300010375 Bacteria 16549
303 Ga0105239_10004850 3300010375 Bacteria 15914
304 Ga0105239_10022560 3300010375 Bacteria 6941
305 Ga0105239_10073693 3300010375 Bacteria 3753
306 Ga0105239_10097656 3300010375 Bacteria 3246
307 Ga0105239_10242292 3300010375 Bacteria 2024
308 Ga0105246_10286234 3300011119 Bacteria 1324
309 Ga0105246_10967653 3300011119 Bacteria 768
310 Ga0157373_10000199 3300013100 Bacteria 49515
311 Ga0157373_10002419 3300013100 Bacteria 14191
312 Ga0157373_10002632 3300013100 Bacteria 13617
313 Ga0157373_10003027 3300013100 Bacteria 12673
314 Ga0157373_10008475 3300013100 Bacteria 7634
315 Ga0157373_10013487 3300013100 Bacteria 5994
316 Ga0157373_10016428 3300013100 Bacteria 5400
317 Ga0157373_10055300 3300013100 Bacteria 2819
318 Ga0157373_10062311 3300013100 Bacteria 2641
319 Ga0157373_10122817 3300013100 Bacteria 1825
320 Ga0157371_10000529 3300013102 Bacteria 45499
321 Ga0157371_10000620 3300013102 Bacteria 42287
322 Ga0157371_10000903 3300013102 Bacteria 33458
323 Ga0157371_10001268 3300013102 Bacteria 26605
324 Ga0157371_10002520 3300013102 Bacteria 17411
325 Ga0157371_10004074 3300013102 Bacteria 12917
326 Ga0157371_10007629 3300013102 Bacteria 8727
327 Ga0157371_10008584 3300013102 Bacteria 8121
328 Ga0157371_10009843 3300013102 Bacteria 7491
329 Ga0157371_10014830 3300013102 Bacteria 5867
330 Ga0157371_10018887 3300013102 Bacteria 5092
331 Ga0157371_10050537 3300013102 Bacteria 2954
332 Ga0157371_10074503 3300013102 Bacteria 2404
333 Ga0157371_10171419 3300013102 Bacteria 1551
334 Ga0157370_10000207 3300013104 Bacteria 74451
335 Ga0157370_10002038 3300013104 Bacteria 24827
336 Ga0157370_10002831 3300013104 Bacteria 20740
337 Ga0157370_10003741 3300013104 Bacteria 17784
338 Ga0157370_10007572 3300013104 Bacteria 11796
339 Ga0157370_10011824 3300013104 Bacteria 9107
340 Ga0157370_10013593 3300013104 Bacteria 8377
341 Ga0157370_10013720 3300013104 Bacteria 8330
342 Ga0157370_10022568 3300013104 Bacteria 6263
343 Ga0157370_10031796 3300013104 Bacteria 5159
344 Ga0157370_10487207 3300013104 Bacteria 1133
345 Ga0157369_10000039 3300013105 Bacteria 188947
346 Ga0157369_10000071 3300013105 Bacteria 140377
347 Ga0157369_10009198 3300013105 Bacteria 11303
348 Ga0157369_10035552 3300013105 Bacteria 5462
349 Ga0157369_10091713 3300013105 Bacteria 3243
350 Ga0157369_10105244 3300013105 Bacteria 3004
351 Ga0157374_10001622 3300013296 Bacteria 18852
352 Ga0157374_10003352 3300013296 Bacteria 13449
353 Ga0157374_10008373 3300013296 Bacteria 8831
354 Ga0157374_10015042 3300013296 Bacteria 6783
355 Ga0157374_10222909 3300013296 Bacteria 1851
356 Ga0157374_10334177 3300013296 Bacteria 1503
357 Ga0157374_10348151 3300013296 Bacteria 1472
358 Ga0157378_10003085 3300013297 Bacteria 14806
359 Ga0157378_10006215 3300013297 Bacteria 10456
360 Ga0157378_10072667 3300013297 Bacteria 3091
361 Ga0157378_10109877 3300013297 Bacteria 2526
362 Ga0157378_10168134 3300013297 Bacteria 2055
363 Ga0157378_10209543 3300013297 Bacteria 1847
364 Ga0157378_10531899 3300013297 Bacteria 1178
365 Ga0157378_10945081 3300013297 Bacteria 894
366 Ga0163162_10000024 3300013306 Bacteria 188515
367 Ga0163162_10000882 3300013306 Bacteria 27892
368 Ga0163162_10001708 3300013306 Bacteria 20592
369 Ga0163162_10003984 3300013306 Bacteria 14163
370 Ga0163162_10042161 3300013306 Bacteria 4566
371 Ga0163162_10063454 3300013306 Bacteria 3737
372 Ga0163162_10065752 3300013306 Bacteria 3674
373 Ga0163162_10067136 3300013306 Bacteria 3636
374 Ga0163162_10232405 3300013306 Bacteria 1974
375 Ga0157372_10000001 3300013307 Bacteria 791349
376 Ga0157372_10001038 3300013307 Bacteria 30369
377 Ga0157372_10001070 3300013307 Bacteria 29934
378 Ga0157372_10004146 3300013307 Bacteria 15520
379 Ga0157372_10004415 3300013307 Bacteria 14998
380 Ga0157372_10007653 3300013307 Bacteria 11486
381 Ga0157372_10018299 3300013307 Bacteria 7531
382 Ga0157372_10053155 3300013307 Bacteria 4513
383 Ga0157372_10065184 3300013307 Bacteria 4089
384 Ga0157372_10089720 3300013307 Bacteria 3493
385 Ga0157372_10100561 3300013307 Bacteria 3299
386 Ga0157372_10224886 3300013307 Bacteria 2176
387 Ga0157372_10723905 3300013307 Bacteria 1157
388 Ga0157375_10003648 3300013308 Bacteria 13356
389 Ga0157375_10016319 3300013308 Bacteria 6667
390 Ga0157375_10127509 3300013308 Bacteria 2661
391 Ga0157375_10253242 3300013308 Bacteria 1922
392 Ga0157375_10529722 3300013308 Bacteria 1341
393 Ga0157375_10649475 3300013308 Bacteria 1211
394 Ga0157375_11318909 3300013308 Bacteria 849
395 Ga0163163_10001556 3300014325 Bacteria 19351
396 Ga0163163_10012108 3300014325 Bacteria 7850
397 Ga0163163_10077719 3300014325 Bacteria 3314
398 Ga0163163_10524286 3300014325 Bacteria 1247
399 Ga0157380_10002192 3300014326 Bacteria 13126
400 Ga0157380_10235842 3300014326 Bacteria 1646
401 Ga0157380_10552350 3300014326 Bacteria 1130
402 Ga0182008_10000009 3300014497 Bacteria 331416
403 Ga0182008_10001007 3300014497 Bacteria 19580
404 Ga0182008_10009542 3300014497 Bacteria 5230
405 Ga0182008_10026303 3300014497 Bacteria 2951
406 Ga0182008_10026857 3300014497 Bacteria 2919
407 Ga0157377_10007003 3300014745 Bacteria 5417
408 Ga0157377_10302779 3300014745 Bacteria 1056
409 Ga0157379_10079067 3300014968 Bacteria 2945
410 Ga0157379_10460926 3300014968 Bacteria 1175
411 Ga0157376_10011991 3300014969 Bacteria 6412
412 Ga0157376_10015574 3300014969 Bacteria 5749
413 Ga0157376_10132960 3300014969 Bacteria 2223
414 Ga0157376_10241742 3300014969 Bacteria 1682
415 Ga0157376_10392818 3300014969 Bacteria 1339
416 Ga0182006_1000332 3300015261 Bacteria 40804
417 Ga0182006_1000356 3300015261 Bacteria 38331
418 Ga0182006_1001370 3300015261 Bacteria 14836
419 Ga0182006_1004469 3300015261 Bacteria 6885
420 Ga0182007_10000006 3300015262 Bacteria 427355
421 Ga0182007_10009267 3300015262 Bacteria 3983
422 Ga0182007_10017706 3300015262 Bacteria 2596
423 Ga0182007_10018127 3300015262 Bacteria 2557
424 Ga0183373_1001 3300015682 Bacteria 1410374
425 Ga0163161_10000309 3300017792 Bacteria 42593
426 Ga0163161_10000394 3300017792 Bacteria 36483
427 Ga0163161_10001188 3300017792 Bacteria 19557
428 Ga0163161_10001366 3300017792 Bacteria 18108
429 Ga0163161_10013505 3300017792 Bacteria 5686
430 Ga0163161_10093566 3300017792 Bacteria 2227
431 Ga0163161_10184672 3300017792 Bacteria 1600
432 Ga0213872_10009172 3300021361 Bacteria 4756
433 Ga0213872_10053446 3300021361 Bacteria 1832
434 Ga0207427_100106 3300025231 Bacteria 117041
435 Ga0209437_100077 3300025233 Bacteria 286656
436 Ga0209437_100226 3300025233 Bacteria 100303
437 Ga0207425_1000007 3300025245 Bacteria 777411
438 Ga0209026_1001905 3300025250 Bacteria 8463
439 Ga0209026_1012739 3300025250 Bacteria 1454
440 Ga0209129_1000006 3300025258 Bacteria 777761
441 Ga0209233_1000089 3300025261 Bacteria 316381
442 Ga0209233_1001139 3300025261 Bacteria 10845
443 Ga0209455_1002616 3300025272 Bacteria 6840
444 Ga0209676_1000090 3300025292 Bacteria 256336
445 Ga0209025_1000089 3300025294 Bacteria 254130
446 Ga0209758_1000016 3300025297 Bacteria 778557
447 Ga0209050_1000091 3300025298 Bacteria 253049
448 Ga0207697_10040271 3300025315 Bacteria 1919
449 Ga0207680_10564099 3300025903 Bacteria 813
450 Ga0207647_10000354 3300025904 Bacteria 37206
451 Ga0207647_10000473 3300025904 Bacteria 32482
452 Ga0207647_10035567 3300025904 Bacteria 3173
453 Ga0207647_10185355 3300025904 Bacteria 1207
454 Ga0207645_10000500 3300025907 Bacteria 32432
455 Ga0207645_10065394 3300025907 Bacteria 2324
456 Ga0207643_10022447 3300025908 Bacteria 3474
457 Ga0207643_10091934 3300025908 Bacteria 1770
458 Ga0207705_10000040 3300025909 Bacteria 185735
459 Ga0207705_10018591 3300025909 Bacteria 4967
460 Ga0207705_10030421 3300025909 Bacteria 3853
461 Ga0207705_10043320 3300025909 Bacteria 3233
462 Ga0207705_10265166 3300025909 Bacteria 1312
463 Ga0207705_10287661 3300025909 Bacteria 1259
464 Ga0207705_10736745 3300025909 Bacteria 766
465 Ga0207654_10000448 3300025911 Bacteria 23559
466 Ga0207654_10063509 3300025911 Bacteria 2167
467 Ga0207654_10084913 3300025911 Bacteria 1915
468 Ga0207654_10090860 3300025911 Bacteria 1861
469 Ga0207654_10132934 3300025911 Bacteria 1577
470 Ga0207654_10170802 3300025911 Bacteria 1412
471 Ga0207707_10037174 3300025912 Bacteria 4254
472 Ga0207695_10000010 3300025913 Bacteria 981919
473 Ga0207695_10000013 3300025913 Bacteria 821265
474 Ga0207695_10009521 3300025913 Bacteria 12012
475 Ga0207695_10012640 3300025913 Bacteria 10113
476 Ga0207695_10049264 3300025913 Bacteria 4443
477 Ga0207695_10100313 3300025913 Bacteria 2891
478 Ga0207695_10130012 3300025913 Bacteria 2476
479 Ga0207695_10179269 3300025913 Bacteria 2040
480 Ga0207695_10209543 3300025913 Bacteria 1860
481 Ga0207695_10232220 3300025913 Bacteria 1748
482 Ga0207695_10280140 3300025913 Bacteria 1561
483 Ga0207695_10312508 3300025913 Bacteria 1461
484 Ga0207671_10000728 3300025914 Bacteria 41791
485 Ga0207671_10001284 3300025914 Bacteria 29519
486 Ga0207671_10004426 3300025914 Bacteria 13457
487 Ga0207671_10005736 3300025914 Bacteria 11317
488 Ga0207671_10009466 3300025914 Bacteria 8141
489 Ga0207671_10015688 3300025914 Bacteria 5922
490 Ga0207671_10031607 3300025914 Bacteria 3944
491 Ga0207671_10149616 3300025914 Bacteria 1803
492 Ga0207660_10018889 3300025917 Bacteria 4603
493 Ga0207660_10137633 3300025917 Bacteria 1865
494 Ga0207660_10243584 3300025917 Bacteria 1417
495 Ga0207657_10002882 3300025919 Bacteria 18481
496 Ga0207657_10126977 3300025919 Bacteria 2094
497 Ga0207657_10205457 3300025919 Bacteria 1582
498 Ga0207657_10244398 3300025919 Bacteria 1432
499 Ga0207657_10533440 3300025919 Bacteria 918
500 Ga0207649_10002378 3300025920 Bacteria 10551
501 Ga0207649_10018665 3300025920 Bacteria 3950
502 Ga0207652_10000010 3300025921 Bacteria 247079
503 Ga0207652_10000844 3300025921 Bacteria 29188
504 Ga0207652_10015718 3300025921 Bacteria 6165
505 Ga0207652_10346613 3300025921 Bacteria 1341
506 Ga0207652_10605735 3300025921 Bacteria 982
507 Ga0207681_10019641 3300025923 Bacteria 4272
508 Ga0207681_10452488 3300025923 Bacteria 1045
509 Ga0207694_10008772 3300025924 Bacteria 7628
510 Ga0207650_10049197 3300025925 Bacteria 3112
511 Ga0207650_10064839 3300025925 Bacteria 2735
512 Ga0207650_10079521 3300025925 Bacteria 2483
513 Ga0207650_10157874 3300025925 Bacteria 1795
514 Ga0207650_10461484 3300025925 Bacteria 1058
515 Ga0207659_10107346 3300025926 Unclassified 2116
516 Ga0207659_10213382 3300025926 Bacteria 1548
517 Ga0207664_10360881 3300025929 Unclassified 1287
518 Ga0207644_10004161 3300025931 Bacteria 9381
519 Ga0207644_10103457 3300025931 Bacteria 2143
520 Ga0207644_10141493 3300025931 Bacteria 1853
521 Ga0207644_10683453 3300025931 Bacteria 855
522 Ga0207690_10001498 3300025932 Bacteria 14585
523 Ga0207690_10023076 3300025932 Bacteria 3880
524 Ga0207690_10101916 3300025932 Bacteria 2052
525 Ga0207690_10190744 3300025932 Bacteria 1550
526 Ga0207706_10000442 3300025933 Bacteria 44334
527 Ga0207706_10007192 3300025933 Bacteria 10293
528 Ga0207706_10019195 3300025933 Bacteria 6147
529 Ga0207706_10046944 3300025933 Bacteria 3823
530 Ga0207706_10342410 3300025933 Bacteria 1301
531 Ga0207686_10022554 3300025934 Bacteria 3627
532 Ga0207686_10055929 3300025934 Bacteria 2478
533 Ga0207686_10071244 3300025934 Bacteria 2236
534 Ga0207686_10381434 3300025934 Bacteria 1069
535 Ga0207709_10000003 3300025935 Bacteria 1050072
536 Ga0207670_10062668 3300025936 Bacteria 2542
537 Ga0207670_10112529 3300025936 Bacteria 1964
538 Ga0207669_10155222 3300025937 Bacteria 1609
539 Ga0207669_10281219 3300025937 Bacteria 1255
540 Ga0207704_10000011 3300025938 Bacteria 180140
541 Ga0207704_10084013 3300025938 Bacteria 2068
542 Ga0207704_10086891 3300025938 Bacteria 2041
543 Ga0207704_10201454 3300025938 Bacteria 1457
544 Ga0207691_10062524 3300025940 Bacteria 3378
545 Ga0207691_10224947 3300025940 Bacteria 1626
546 Ga0207691_10737289 3300025940 Bacteria 830
547 Ga0207689_10007865 3300025942 Bacteria 9315
548 Ga0207689_10023823 3300025942 Bacteria 5135
549 Ga0207689_10031604 3300025942 Bacteria 4405
550 Ga0207689_10101630 3300025942 Bacteria 2362
551 Ga0207689_10219548 3300025942 Bacteria 1571
552 Ga0207689_10447122 3300025942 Bacteria 1080
553 Ga0207661_10003428 3300025944 Bacteria 11003
554 Ga0207661_10012229 3300025944 Bacteria 6234
555 Ga0207661_10083125 3300025944 Bacteria 2649
556 Ga0207679_10002266 3300025945 Bacteria 11867
557 Ga0207679_10007295 3300025945 Bacteria 7006
558 Ga0207679_10060241 3300025945 Bacteria 2820
559 Ga0207667_10000020 3300025949 Bacteria 374770
560 Ga0207667_10001278 3300025949 Bacteria 31572
561 Ga0207667_10043117 3300025949 Bacteria 4789
562 Ga0207667_10289202 3300025949 Bacteria 1674
563 Ga0207667_10640882 3300025949 Bacteria 1069
564 Ga0207667_10835331 3300025949 Bacteria 916
565 Ga0207667_10916060 3300025949 Bacteria 868
566 Ga0207651_10003816 3300025960 Bacteria 7468
567 Ga0207651_10017197 3300025960 Bacteria 4264
568 Ga0207712_10012182 3300025961 Bacteria 5493
569 Ga0207712_10019417 3300025961 Bacteria 4438
570 Ga0207712_10024434 3300025961 Bacteria 4002
571 Ga0207668_10042758 3300025972 Bacteria 3071
572 Ga0207640_10062388 3300025981 Bacteria 2473
573 Ga0207640_10379996 3300025981 Bacteria 1144
574 Ga0207658_10041786 3300025986 Bacteria 3322
575 Ga0207658_10159321 3300025986 Bacteria 1848
576 Ga0207677_10006442 3300026023 Bacteria 6442
577 Ga0207677_10019837 3300026023 Bacteria 4069
578 Ga0207677_10057892 3300026023 Bacteria 2665
579 Ga0207677_10099842 3300026023 Bacteria 2133
580 Ga0207677_10624684 3300026023 Unclassified 948
581 Ga0207703_10113372 3300026035 Unclassified 2317
582 Ga0207703_10125105 3300026035 Bacteria 2212
583 Ga0207703_10285197 3300026035 Bacteria 1501
584 Ga0207703_10942308 3300026035 Bacteria 827
585 Ga0207639_10003710 3300026041 Bacteria 10275
586 Ga0207639_10013988 3300026041 Bacteria 5630
587 Ga0207639_10018026 3300026041 Bacteria 5009
588 Ga0207639_10091147 3300026041 Bacteria 2440
589 Ga0207639_10281357 3300026041 Bacteria 1463
590 Ga0207639_10310803 3300026041 Bacteria 1396
591 Ga0207639_10745085 3300026041 Unclassified 911
592 Ga0207678_10015406 3300026067 Bacteria 6724
593 Ga0207678_10052313 3300026067 Bacteria 3524
594 Ga0207678_10284339 3300026067 Bacteria 1420
595 Ga0207678_10337725 3300026067 Bacteria 1298
596 Ga0207702_10001532 3300026078 Bacteria 22854
597 Ga0207702_10005183 3300026078 Bacteria 11457
598 Ga0207702_10042134 3300026078 Bacteria 3829
599 Ga0207702_10051753 3300026078 Bacteria 3473
600 Ga0207702_10057981 3300026078 Bacteria 3294
601 Ga0207702_10208531 3300026078 Bacteria 1815
602 Ga0207702_10240259 3300026078 Bacteria 1697
603 Ga0207641_10121938 3300026088 Bacteria 2328
604 Ga0207641_10192789 3300026088 Bacteria 1874
605 Ga0207648_10001059 3300026089 Bacteria 30821
606 Ga0207648_10043714 3300026089 Bacteria 3933
607 Ga0207648_10088004 3300026089 Bacteria 2711
608 Ga0207648_10242851 3300026089 Bacteria 1604
609 Ga0207676_10007397 3300026095 Bacteria 7787
610 Ga0207676_10115397 3300026095 Bacteria 2255
611 Ga0207676_10160310 3300026095 Bacteria 1948
612 Ga0207676_10301240 3300026095 Bacteria 1464
613 Ga0207674_10003303 3300026116 Bacteria 19833
614 Ga0207674_10035923 3300026116 Bacteria 5169
615 Ga0207674_10036409 3300026116 Bacteria 5129
616 Ga0207674_10173016 3300026116 Bacteria 2112
617 Ga0207675_100109943 3300026118 Bacteria 2601
618 Ga0207675_100226444 3300026118 Bacteria 1803
619 Ga0207675_100446484 3300026118 Bacteria 1281
620 Ga0207683_10005152 3300026121 Bacteria 11224
621 Ga0207683_10022575 3300026121 Bacteria 5403
622 Ga0207698_10112732 3300026142 Bacteria 2283
623 Ga0207698_10164191 3300026142 Bacteria 1946
624 Ga0207698_10189610 3300026142 Bacteria 1830
625 Ga0207698_10218359 3300026142 Bacteria 1721
626 Ga0207698_10592970 3300026142 Bacteria 1092
627 Ga0207698_10806199 3300026142 Bacteria 941
628 Ga0207698_11013791 3300026142 Bacteria 841
629 Ga0268266_10000380 3300028379 Bacteria 67791
630 Ga0268266_10013332 3300028379 Bacteria 7083
631 Ga0268266_10244256 3300028379 Bacteria 1658
632 Ga0268265_10006391 3300028380 Bacteria 7987
633 Ga0268265_10141310 3300028380 Bacteria 2016
634 Ga0268265_10261745 3300028380 Bacteria 1538
635 Ga0268265_10506968 3300028380 Bacteria 1138
636 Ga0268264_10016735 3300028381 Bacteria 6002
637 Ga0268264_10028367 3300028381 Bacteria 4579
638 Ga0268264_10035430 3300028381 Bacteria 4109
639 Ga0268264_10062469 3300028381 Bacteria 3128
640 Ga0307517_10001632 3300028786 Bacteria 37097
641 Ga0307515_10000280 3300028794 Bacteria 125330
642 Ga0307515_10022378 3300028794 Bacteria 11140
643 Ga0307515_10036778 3300028794 Bacteria 7905
644 Ga0265338_10087151 3300028800 Bacteria 2595
645 Ga0316177_1086062 3300030731 Bacteria 14675
646 Ga0316176_1041743 3300030732 Bacteria 19091
647 Ga0316183_1132422 3300030742 Bacteria 30134
648 Ga0316181_1039957 3300030744 Bacteria 8183
649 Ga0265327_10000006 3300031251 Bacteria 693716
650 Ga0265327_10000046 3300031251 Bacteria 280722
651 Ga0265327_10000159 3300031251 Bacteria 145537
652 Ga0265327_10004250 3300031251 Bacteria 12841
653 Ga0265327_10004741 3300031251 Bacteria 11860
654 Ga0265327_10025635 3300031251 Bacteria 3433
655 Ga0265327_10059389 3300031251 Bacteria 1959
656 Ga0307509_10116904 3300031507 Bacteria 2655
657 Ga0265314_10058108 3300031711 Bacteria 2652
658 Ga0265314_10302299 3300031711 Bacteria 897
659 Ga0307516_10206095 3300031730 Bacteria 1683
660 Ga0307405_10000012 3300031731 Bacteria 233774
661 Ga0307405_10005916 3300031731 Bacteria 5964
662 Ga0307406_10502419 3300031901 Bacteria 983
663 Ga0307407_10000013 3300031903 Bacteria 165614
664 Ga0307412_10000084 3300031911 Bacteria 90908
665 Ga0307412_10027245 3300031911 Bacteria 3561
666 Ga0307412_10132054 3300031911 Bacteria 1815
667 Ga0307416_100000028 3300032002 Bacteria 165572
668 Ga0307416_100116527 3300032002 Bacteria 2369
669 Ga0307414_10004686 3300032004 Bacteria 7457
670 Ga0307414_10007511 3300032004 Bacteria 6126
671 Ga0307414_10032759 3300032004 Bacteria 3426
672 Ga0307414_10070261 3300032004 Bacteria 2521
673 Ga0307414_10149495 3300032004 Bacteria 1840
674 Ga0307414_10157053 3300032004 Bacteria 1802
675 Ga0307414_10247729 3300032004 Bacteria 1479
676 Ga0307414_10474955 3300032004 Bacteria 1102
677 Ga0307411_10002789 3300032005 Bacteria 7864
678 Ga0307411_10096172 3300032005 Bacteria 2081
679 Ga0307411_10235116 3300032005 Bacteria 1431
680 Ga0307507_10000052 3300033179 Bacteria 168303
681 Ga0307510_10008290 3300033180 Bacteria 12386
682 Ga0307510_10307297 3300033180 Bacteria 1046
683 Ga0373932_0169051 3300035112 Bacteria 761
684 Ga0373954_0036500 3300035118 Unclassified 2282
685 Ga0373946_0160540 3300035171 Bacteria 1055
686 Ga0373933_0168959 3300035724 Bacteria 1391
687 Ga0373947_0041140 3300035725 Bacteria 2755
688 Ga0373925_0059520 3300037068 Bacteria 2866
689 Ga0395899_0000002 3300037312 Bacteria 1324310
690 Ga0395899_0000025 3300037312 Bacteria 350927
691 Ga0395899_0000735 3300037312 Bacteria 32677
692 Ga0395899_0038695 3300037312 Bacteria 3571
693 Ga0395899_0097246 3300037312 Bacteria 2128
694 Ga0395899_0105011 3300037312 Bacteria 2035
695 Ga0395899_0115665 3300037312 Bacteria 1925
696 Ga0395899_0211472 3300037312 Bacteria 1347
697 Ga0395899_0306779 3300037312 Bacteria 1072
698 Ga0395900_0000014 3300037418 Bacteria 386513
699 Ga0395900_0000122 3300037418 Bacteria 133423
700 Ga0395900_0006326 3300037418 Bacteria 12346
701 Ga0395900_0007456 3300037418 Bacteria 11305
702 Ga0395900_0034926 3300037418 Bacteria 5179
703 Ga0395900_0041364 3300037418 Bacteria 4751
704 Ga0395900_0052327 3300037418 Bacteria 4204
705 Ga0395900_0096846 3300037418 Bacteria 3031
706 Ga0395900_0179961 3300037418 Bacteria 2149
707 Ga0395900_0367899 3300037418 Bacteria 1408
708 Ga0395900_0495558 3300037418 Bacteria 1172
709 Ga0395900_0756245 3300037418 Bacteria 902
710 Ga0395898_0024518 3300037466 Bacteria 6083
711 Ga0395898_0026930 3300037466 Bacteria 5776
712 Ga0395898_0047336 3300037466 Bacteria 4220
713 Ga0395898_0154386 3300037466 Bacteria 2196
714 Ga0395898_0189279 3300037466 Bacteria 1966
715 Ga0395898_0355309 3300037466 Unclassified 1397
716 Ga0395905_0000001 3300037471 Bacteria 2037079
717 Ga0395905_0000037 3300037471 Bacteria 261808
718 Ga0395905_0001611 3300037471 Bacteria 26826
719 Ga0395905_0007405 3300037471 Bacteria 10913
720 Ga0395905_0035016 3300037471 Bacteria 4714
721 Ga0395905_0185797 3300037471 Bacteria 1951
722 Ga0395905_0845263 3300037471 Bacteria 818
723 Ga0395901_0000219 3300038443 Bacteria 71884
724 Ga0395901_0001980 3300038443 Bacteria 21059
725 Ga0395901_0001995 3300038443 Bacteria 21004
726 Ga0395901_0017870 3300038443 Bacteria 7238
727 Ga0395901_0072520 3300038443 Bacteria 3590
728 Ga0395901_0093437 3300038443 Bacteria 3149
729 Ga0395901_0247713 3300038443 Bacteria 1857
730 Ga0395901_0776957 3300038443 Bacteria 949
731 Ga0395901_0800805 3300038443 Bacteria 931
732 Ga0436365_0832600 3300039437 Bacteria 990
733 Ga0436361_0351371 3300039447 Bacteria 6023
734 Ga0439439_0020409 3300041406 Bacteria 1648
735 Ga0451849_1408969 3300041505 Unclassified 883
736 Ga0439448_0026593 3300042005 Bacteria 1819
737 Ga0450899_007462 3300042135 Bacteria 1193
738 Ga0439434_0004196 3300042435 Bacteria 4209
739 Ga0451577_0000870 3300042876 Bacteria 44894
740 Ga0451577_0117869 3300042876 Bacteria 2378
741 Ga0466966_0022793 3300044684 Bacteria 4104
742 Ga0466961_0126273 3300044693 Bacteria 1605
743 Ga0453684_0000912 3300044712 Bacteria 98180
744 Ga0453684_0425614 3300044712 Bacteria 1482
745 Ga0453684_0484227 3300044712 Bacteria 1372
746 Ga0466970_0070816 3300044765 Bacteria 1875
747 Ga0466959_0138317 3300045049 Bacteria 1723
748 Ga0451576_0000002 3300045051 Bacteria 1670975
749 Ga0451576_0082587 3300045051 Bacteria 3342
750 Ga0466958_0053198 3300045836 Bacteria 2455
751 Ga0495627_009761 3300046453 Bacteria 3519
752 Ga0495592_0180762 3300046454 Bacteria 1437
753 Ga0495651_0305274 3300046462 Bacteria 1066
754 Ga0495653_0236487 3300046463 Bacteria 1220
755 Ga0495650_0000014 3300046471 Bacteria 581606
756 Ga0495650_0061702 3300046471 Bacteria 1500
757 Ga0495585_0000031 3300046492 Bacteria 143899
758 Ga0495585_0000806 3300046492 Bacteria 27323
759 Ga0495596_0050349 3300046500 Bacteria 1632
760 Ga0495607_0180713 3300046501 Bacteria 1058
761 Ga0495607_0216734 3300046501 Bacteria 939
762 Ga0495583_0056466 3300046506 Bacteria 1770
763 Ga0495583_0068490 3300046506 Bacteria 1565
764 Ga0495606_0000020 3300046507 Bacteria 274490
765 Ga0495606_0018977 3300046507 Bacteria 5138
766 Ga0495606_0056302 3300046507 Bacteria 2539
767 Ga0495606_0096864 3300046507 Bacteria 1804
768 Ga0495606_0171991 3300046507 Bacteria 1256
769 Ga0495606_0181188 3300046507 Bacteria 1214
770 Ga0495610_0000060 3300046512 Bacteria 131116
771 Ga0495610_0002356 3300046512 Bacteria 15967
772 Ga0495610_0017383 3300046512 Bacteria 4103
773 Ga0495616_0001192 3300046513 Bacteria 18322
774 Ga0495616_0022705 3300046513 Bacteria 3384
775 Ga0495616_0040499 3300046513 Bacteria 2380
776 Ga0495628_0067700 3300046516 Bacteria 2788
777 Ga0495630_0004081 3300046517 Bacteria 10226
778 Ga0495630_0621030 3300046517 Unclassified 828
779 Ga0495631_0234250 3300046518 Bacteria 783
780 Ga0495632_0071556 3300046519 Bacteria 1666
781 Ga0495637_0034584 3300046520 Bacteria 2212
782 Ga0495643_0000537 3300046522 Bacteria 47210
783 Ga0495643_0051822 3300046522 Bacteria 2206
784 Ga0495648_0008887 3300046524 Bacteria 7853
785 Ga0495648_0041931 3300046524 Bacteria 2885
786 Ga0495648_0186345 3300046524 Bacteria 1050
787 Ga0495652_0337405 3300046529 Bacteria 1084
788 Ga0495609_0017620 3300046538 Bacteria 3316
789 Ga0495609_0076475 3300046538 Bacteria 1467
790 Ga0495645_0339384 3300046543 Bacteria 971
791 Ga0495633_0000029 3300046558 Bacteria 200381
792 Ga0495633_0054924 3300046558 Bacteria 1873
793 Ga0495633_0109968 3300046558 Bacteria 1277
794 Ga0495667_0285591 3300046559 Bacteria 1047
795 Ga0495668_0000021 3300046616 Bacteria 381308
796 Ga0495668_0000212 3300046616 Bacteria 84542
797 Ga0495668_0000358 3300046616 Bacteria 60551
798 Ga0495611_0134899 3300046648 Bacteria 1152
799 Ga0495625_0000009 3300046660 Bacteria 404954
800 Ga0495625_0000601 3300046660 Bacteria 52410
801 Ga0495625_0000817 3300046660 Bacteria 42929
802 Ga0495625_0015260 3300046660 Bacteria 6092
803 Ga0495625_0021222 3300046660 Bacteria 5004
804 Ga0495625_0028393 3300046660 Bacteria 4196
805 Ga0495625_0051256 3300046660 Bacteria 2959
806 Ga0495635_0161484 3300046663 Bacteria 1525
807 Ga0495661_0004147 3300046665 Bacteria 10550
808 Ga0495657_0142414 3300046675 Bacteria 1494
809 Ga0495669_0054075 3300046684 Bacteria 1807
810 Ga0495671_0082545 3300046692 Bacteria 1575
811 Ga0495649_0000008 3300046694 Bacteria 483706
812 Ga0495589_0262428 3300046794 Bacteria 805
813 Ga0495600_0122978 3300046809 Bacteria 1688
814 Ga0495660_0011998 3300046810 Bacteria 5026
815 Ga0495660_0095489 3300046810 Bacteria 1538
816 Ga0495636_0000011 3300047318 Bacteria 87862
817 Ga0495680_0351649 3300047322 Unclassified 1026
818 Ga0495683_0008202 3300047323 Bacteria 5602
819 Ga0495687_001685 3300047443 Bacteria 19718
820 Ga0495673_0055614 3300047469 Bacteria 1716
821 Ga0495684_0202742 3300047471 Bacteria 1462
822 Ga0495686_0000194 3300047472 Bacteria 113904
823 Ga0495686_0007228 3300047472 Bacteria 8359
824 Ga0495686_0018337 3300047472 Bacteria 4699
825 Ga0495686_0043586 3300047472 Bacteria 2844
826 Ga0495686_0063558 3300047472 Bacteria 2287
827 Ga0495686_0097772 3300047472 Bacteria 1774
828 Ga0495686_0170675 3300047472 Bacteria 1265
829 Ga0495614_0015856 3300048089 Bacteria 3282
830 Ga0496108_0127860 3300048911 Bacteria 2183
831 Ga0496114_0866872 3300048917 Bacteria 783
832 Ga0496122_0001846 3300048925 Bacteria 32295
833 Ga0496123_0002062 3300048926 Bacteria 25924
834 Ga0495678_021374 3300049459 Bacteria 2851
835 Ga0501031_0171029 3300049568 Bacteria 1420
836 Ga0501032_0071838 3300049569 Bacteria 2306
837 Ga0501034_0000002 3300049571 Bacteria 565510
838 Ga0501034_0036212 3300049571 Bacteria 5000
839 Ga0501034_0056863 3300049571 Bacteria 3934
840 Ga0501036_0076268 3300049572 Bacteria 2836
841 Ga0501037_0086055 3300049573 Bacteria 2276
842 Ga0501037_0345190 3300049573 Bacteria 1028
843 Ga0501038_0234786 3300049574 Bacteria 1458
844 Ga0501039_0376768 3300049575 Bacteria 1115
845 Ga0501070_0100554 3300049586 Bacteria 2392
846 Ga0501070_0114810 3300049586 Bacteria 2225
847 Ga0501073_0022241 3300049589 Bacteria 4569
848 Ga0501074_0010463 3300049590 Bacteria 6734
849 Ga0501077_0304409 3300049593 Bacteria 1016
850 Ga0501223_000633 3300049663 Bacteria 8435
851 Ga0501079_0245505 3300049741 Bacteria 1399
852 Ga0501080_0389751 3300049742 Bacteria 1254
853 Ga0501083_0160860 3300049744 Bacteria 1469
854 Ga0501241_005415 3300049758 Bacteria 2380
855 Ga0501035_0085979 3300049822 Bacteria 2771
856 Ga0501035_0138397 3300049822 Bacteria 2118
857 Ga0501044_0225000 3300049823 Bacteria 1826
858 Ga0501045_0615129 3300049824 Bacteria 804
859 nmdc:mga0k408_171_c1 3300050493 Bacteria 34186
860 nmdc:mga0k408_55212_c1 3300050493 Bacteria 2303
861 nmdc:mga0k408_803_c1 3300050493 Bacteria 17292
862 nmdc:mga07m45_218114_c1 3300050496 Bacteria 1110
863 Ga0500646_0021302 3300053090 Bacteria 1726
864 Ga0500651_0011469 3300053093 Bacteria 5344
865 Ga0500650_0250633 3300053098 Bacteria 794
866 Ga0500608_000637 3300053122 Bacteria 12928
867 Ga0500618_000266 3300053125 Bacteria 40517
868 Ga0500642_0047893 3300053130 Bacteria 1875
869 Ga0500568_0001078 3300053139 Bacteria 18433
870 Ga0500616_0000850 3300053153 Bacteria 34025
871 Ga0500622_0000838 3300053156 Bacteria 26284
872 Ga0500624_000576 3300053157 Bacteria 10124
873 Ga0500627_0011955 3300053158 Bacteria 3231
874 Ga0500611_000002 3300053727 Bacteria 345991
875 Ga0501084_0595593 3300054114 Bacteria 934

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10533440 Ga0207657_105334402 212
2 3300038443 Ga0395901_0776957 Ga0395901_0776957_14_658 214
3 3300005614 Ga0068856_100093116 Ga0068856_1000931162 216
4 3300005290 Ga0065712_10315846 Ga0065712_103158461 218
5 3300025925 Ga0207650_10157874 Ga0207650_101578742 218
6 3300025940 Ga0207691_10737289 Ga0207691_107372892 218
7 3300032004 Ga0307414_10070261 Ga0307414_100702613 218
8 3300031251 Ga0265327_10004741 Ga0265327_100047411 219
9 3300005614 Ga0068856_100148395 Ga0068856_1001483952 220
10 3300038443 Ga0395901_0001980 Ga0395901_0001980_13938_14654 220
11 3300049742 Ga0501080_0389751 Ga0501080_0389751_46_744 221
12 3300032004 Ga0307414_10007511 Ga0307414_100075112 222
13 3300005355 Ga0070671_100365482 Ga0070671_1003654822 223
14 3300011119 Ga0105246_10967653 Ga0105246_109676531 223
15 3300025925 Ga0207650_10049197 Ga0207650_100491973 223
16 3300025931 Ga0207644_10103457 Ga0207644_101034573 223
17 3300005563 Ga0068855_100365276 Ga0068855_1003652762 225
18 3300025949 Ga0207667_10640882 Ga0207667_106408822 225
19 3300041406 Ga0439439_0020409 Ga0439439_0020409_528_1205 225
20 iso_pu_bacteria 2599185184 2599476843 225
21 iso_pu_bacteria 2852623160 2852623689 227
22 iso_pu_bacteria 2884933994 2884937406 227
23 iso_pu_bacteria 2919437846 2919438786 227
24 iso_pu_bacteria 2738541281 2738743662 228
25 iso_pu_bacteria 2738543032 2739352569 228
26 iso_pu_bacteria 2739367656 2739617764 228
27 iso_pu_bacteria 2928078545 2928078751 228
28 iso_pu_bacteria 2928147474 2928151571 228
29 iso_pu_bacteria 2932082852 2932084195 228
30 3300003316 rootH1_10072982 rootH1_100729824 229
31 3300005327 Ga0070658_10080404 Ga0070658_100804041 229
32 3300005458 Ga0070681_10042095 Ga0070681_100420954 229
33 3300005563 Ga0068855_100308903 Ga0068855_1003089032 229
34 3300005614 Ga0068856_100938908 Ga0068856_1009389082 229
35 3300009093 Ga0105240_10394176 Ga0105240_103941762 229
36 3300013104 Ga0157370_10013593 Ga0157370_100135938 229
37 3300025909 Ga0207705_10265166 Ga0207705_102651662 229
38 3300025912 Ga0207707_10037174 Ga0207707_100371743 229
39 3300025913 Ga0207695_10280140 Ga0207695_102801402 229
40 3300026078 Ga0207702_10208531 Ga0207702_102085313 229
41 3300046507 Ga0495606_0096864 Ga0495606_0096864_27_716 229
42 3300046520 Ga0495637_0034584 Ga0495637_0034584_1221_1910 229
43 3300046794 Ga0495589_0262428 Ga0495589_0262428_30_719 229
44 3300047472 Ga0495686_0097772 Ga0495686_0097772_962_1651 229
45 iso_pu_bacteria 2585427687 2586208605 229
46 iso_pu_bacteria 2738541273 2738699171 229
47 iso_pu_bacteria 2738541283 2738757174 229
48 iso_pu_bacteria 2738541284 2738762787 229
49 iso_pu_bacteria 2738541302 2738852991 229
50 iso_pu_bacteria 2738543014 2739254887 229
51 iso_pu_bacteria 2738543023 2739300464 229
52 iso_pu_bacteria 2739367651 2739586363 229
53 iso_pu_bacteria 2739367663 2739644867 229
54 iso_pu_bacteria 2775506987 2776614351 229
55 iso_pu_bacteria 2818991437 2819549131 229
56 iso_pu_bacteria 2842722452 2842725619 229
57 iso_pu_bacteria 2842903701 2842908387 229
58 iso_pu_bacteria 2842909656 2842914451 229
59 iso_pu_bacteria 2849281842 2849283023 229
60 iso_pu_bacteria 2852627209 2852630269 229
61 iso_pu_bacteria 2857627736 2857630645 229
62 iso_pu_bacteria 2902048731 2902048888 229
63 iso_pu_bacteria 2904445276 2904449207 229
64 iso_pu_bacteria 2919186247 2919190036 229
65 iso_pu_bacteria 2939664404 2939668317 229
66 iso_pu_bacteria 2945997725 2946001138 229
67 iso_pu_bacteria 2954016120 2954018038 229
68 iso_pu_bacteria 8055588893 8055589448 229
69 3300005327 Ga0070658_10117414 Ga0070658_101174143 230
70 3300005327 Ga0070658_10135069 Ga0070658_101350693 230
71 3300005337 Ga0070682_100075268 Ga0070682_1000752682 230
72 3300005339 Ga0070660_100000870 Ga0070660_10000087018 230
73 3300005339 Ga0070660_100022188 Ga0070660_1000221884 230
74 3300005339 Ga0070660_100441583 Ga0070660_1004415832 230
75 3300005345 Ga0070692_10102076 Ga0070692_101020762 230
76 3300005366 Ga0070659_100029194 Ga0070659_1000291944 230
77 3300005366 Ga0070659_100110556 Ga0070659_1001105563 230
78 3300005434 Ga0070709_10027617 Ga0070709_100276172 230
79 3300005435 Ga0070714_100327873 Ga0070714_1003278731 230
80 3300005458 Ga0070681_10184858 Ga0070681_101848583 230
81 3300005458 Ga0070681_10458353 Ga0070681_104583532 230
82 3300005530 Ga0070679_100000053 Ga0070679_100000053133 230
83 3300005530 Ga0070679_100026213 Ga0070679_1000262136 230
84 3300005539 Ga0068853_100275387 Ga0068853_1002753871 230
85 3300005563 Ga0068855_100006033 Ga0068855_1000060339 230
86 3300005563 Ga0068855_100348510 Ga0068855_1003485102 230
87 3300005578 Ga0068854_100395655 Ga0068854_1003956552 230
88 3300009093 Ga0105240_10031376 Ga0105240_100313767 230
89 3300009174 Ga0105241_10996612 Ga0105241_109966121 230
90 3300013100 Ga0157373_10013487 Ga0157373_100134874 230
91 3300013102 Ga0157371_10000903 Ga0157371_1000090340 230
92 3300013102 Ga0157371_10001268 Ga0157371_1000126829 230
93 3300013102 Ga0157371_10014830 Ga0157371_100148307 230
94 3300013102 Ga0157371_10074503 Ga0157371_100745032 230
95 3300013104 Ga0157370_10003741 Ga0157370_100037417 230
96 3300013105 Ga0157369_10035552 Ga0157369_100355523 230
97 3300013307 Ga0157372_10004415 Ga0157372_1000441514 230
98 3300013307 Ga0157372_10018299 Ga0157372_100182998 230
99 3300013307 Ga0157372_10089720 Ga0157372_100897202 230
100 3300025909 Ga0207705_10030421 Ga0207705_100304212 230
101 3300025909 Ga0207705_10043320 Ga0207705_100433204 230
102 3300025919 Ga0207657_10002882 Ga0207657_1000288215 230
103 3300025919 Ga0207657_10244398 Ga0207657_102443982 230
104 3300025921 Ga0207652_10000010 Ga0207652_10000010184 230
105 3300025921 Ga0207652_10346613 Ga0207652_103466132 230
106 3300025929 Ga0207664_10360881 Ga0207664_103608813 230
107 3300025932 Ga0207690_10190744 Ga0207690_101907442 230
108 3300025940 Ga0207691_10224947 Ga0207691_102249472 230
109 3300025949 Ga0207667_10289202 Ga0207667_102892023 230
110 3300026041 Ga0207639_10745085 Ga0207639_107450851 230
111 3300026142 Ga0207698_10112732 Ga0207698_101127321 230
112 3300031251 Ga0265327_10000046 Ga0265327_1000004686 230
113 3300037312 Ga0395899_0115665 Ga0395899_0115665_818_1510 230
114 3300037418 Ga0395900_0006326 Ga0395900_0006326_3349_4041 230
115 3300037418 Ga0395900_0034926 Ga0395900_0034926_3360_4052 230
116 3300037418 Ga0395900_0041364 Ga0395900_0041364_3786_4478 230
117 3300037466 Ga0395898_0026930 Ga0395898_0026930_3271_3963 230
118 3300037466 Ga0395898_0355309 Ga0395898_0355309_675_1367 230
119 3300038443 Ga0395901_0001995 Ga0395901_0001995_9316_10008 230
120 3300038443 Ga0395901_0017870 Ga0395901_0017870_2804_3496 230
121 3300053156 Ga0500622_0000838 Ga0500622_0000838_12412_13116 230
122 3300001990 JGI24737J22298_10014737 JGI24737J22298_100147373 231
123 3300001991 JGI24743J22301_10016381 JGI24743J22301_100163812 231
124 3300003323 rootH1_10116441 rootH1_101164413 231
125 3300005327 Ga0070658_10000026 Ga0070658_10000026122 231
126 3300005328 Ga0070676_10001812 Ga0070676_100018123 231
127 3300005329 Ga0070683_100006215 Ga0070683_1000062157 231
128 3300005337 Ga0070682_100030177 Ga0070682_1000301773 231
129 3300005337 Ga0070682_100063960 Ga0070682_1000639603 231
130 3300005338 Ga0068868_100027697 Ga0068868_1000276973 231
131 3300005339 Ga0070660_100063881 Ga0070660_1000638812 231
132 3300005344 Ga0070661_100001685 Ga0070661_1000016855 231
133 3300005355 Ga0070671_100041220 Ga0070671_1000412203 231
134 3300005364 Ga0070673_100286029 Ga0070673_1002860292 231
135 3300005366 Ga0070659_100001687 Ga0070659_10000168710 231
136 3300005366 Ga0070659_100038013 Ga0070659_1000380135 231
137 3300005457 Ga0070662_100000093 Ga0070662_10000009314 231
138 3300005459 Ga0068867_100000834 Ga0068867_1000008347 231
139 3300005459 Ga0068867_100072490 Ga0068867_1000724904 231
140 3300005535 Ga0070684_100001962 Ga0070684_10000196216 231
141 3300005539 Ga0068853_100002136 Ga0068853_10000213615 231
142 3300005539 Ga0068853_100027230 Ga0068853_1000272303 231
143 3300005563 Ga0068855_100000727 Ga0068855_10000072724 231
144 3300005563 Ga0068855_100004855 Ga0068855_10000485511 231
145 3300005563 Ga0068855_100015590 Ga0068855_1000155906 231
146 3300005563 Ga0068855_100520077 Ga0068855_1005200772 231
147 3300005564 Ga0070664_100005236 Ga0070664_1000052364 231
148 3300005577 Ga0068857_100001716 Ga0068857_1000017169 231
149 3300005614 Ga0068856_100012101 Ga0068856_1000121012 231
150 3300005614 Ga0068856_100050481 Ga0068856_1000504813 231
151 3300005614 Ga0068856_100225387 Ga0068856_1002253872 231
152 3300005616 Ga0068852_100005543 Ga0068852_1000055437 231
153 3300005842 Ga0068858_100044822 Ga0068858_1000448223 231
154 3300006237 Ga0097621_100002096 Ga0097621_1000020966 231
155 3300006358 Ga0068871_100000196 Ga0068871_10000019631 231
156 3300006881 Ga0068865_100000022 Ga0068865_10000002270 231
157 3300009093 Ga0105240_10003724 Ga0105240_100037243 231
158 3300009093 Ga0105240_10006944 Ga0105240_100069446 231
159 3300009093 Ga0105240_10260825 Ga0105240_102608252 231
160 3300009093 Ga0105240_10393709 Ga0105240_103937091 231
161 3300009093 Ga0105240_10396497 Ga0105240_103964972 231
162 3300009098 Ga0105245_10157763 Ga0105245_101577632 231
163 3300009098 Ga0105245_10161636 Ga0105245_101616362 231
164 3300009174 Ga0105241_10000238 Ga0105241_1000023814 231
165 3300009174 Ga0105241_10002650 Ga0105241_1000265015 231
166 3300009174 Ga0105241_10217437 Ga0105241_102174372 231
167 3300009176 Ga0105242_10035854 Ga0105242_100358542 231
168 3300009176 Ga0105242_10087704 Ga0105242_100877043 231
169 3300009545 Ga0105237_10000233 Ga0105237_1000023377 231
170 3300009545 Ga0105237_10001823 Ga0105237_1000182322 231
171 3300009545 Ga0105237_10088012 Ga0105237_100880123 231
172 3300009545 Ga0105237_10597402 Ga0105237_105974022 231
173 3300009551 Ga0105238_10008082 Ga0105238_100080824 231
174 3300009551 Ga0105238_10100505 Ga0105238_101005053 231
175 3300009553 Ga0105249_10083416 Ga0105249_100834164 231
176 3300009553 Ga0105249_10210986 Ga0105249_102109861 231
177 3300010375 Ga0105239_10000013 Ga0105239_10000013142 231
178 3300010375 Ga0105239_10073693 Ga0105239_100736935 231
179 3300010375 Ga0105239_10242292 Ga0105239_102422922 231
180 3300013102 Ga0157371_10018887 Ga0157371_100188873 231
181 3300013104 Ga0157370_10007572 Ga0157370_100075726 231
182 3300013296 Ga0157374_10001622 Ga0157374_1000162210 231
183 3300013296 Ga0157374_10003352 Ga0157374_100033527 231
184 3300013306 Ga0163162_10042161 Ga0163162_100421614 231
185 3300013307 Ga0157372_10065184 Ga0157372_100651844 231
186 3300013308 Ga0157375_10016319 Ga0157375_100163193 231
187 3300021361 Ga0213872_10009172 Ga0213872_100091725 231
188 3300025904 Ga0207647_10000354 Ga0207647_1000035423 231
189 3300025907 Ga0207645_10000500 Ga0207645_1000050015 231
190 3300025909 Ga0207705_10000040 Ga0207705_1000004015 231
191 3300025911 Ga0207654_10000448 Ga0207654_1000044823 231
192 3300025911 Ga0207654_10132934 Ga0207654_101329342 231
193 3300025913 Ga0207695_10012640 Ga0207695_100126403 231
194 3300025913 Ga0207695_10100313 Ga0207695_101003132 231
195 3300025913 Ga0207695_10179269 Ga0207695_101792692 231
196 3300025913 Ga0207695_10232220 Ga0207695_102322202 231
197 3300025913 Ga0207695_10312508 Ga0207695_103125082 231
198 3300025914 Ga0207671_10001284 Ga0207671_100012849 231
199 3300025914 Ga0207671_10004426 Ga0207671_1000442610 231
200 3300025914 Ga0207671_10015688 Ga0207671_100156883 231
201 3300025914 Ga0207671_10031607 Ga0207671_100316074 231
202 3300025919 Ga0207657_10126977 Ga0207657_101269772 231
203 3300025920 Ga0207649_10002378 Ga0207649_100023785 231
204 3300025924 Ga0207694_10008772 Ga0207694_100087729 231
205 3300025931 Ga0207644_10004161 Ga0207644_100041618 231
206 3300025932 Ga0207690_10023076 Ga0207690_100230763 231
207 3300025932 Ga0207690_10101916 Ga0207690_101019163 231
208 3300025933 Ga0207706_10000442 Ga0207706_1000044232 231
209 3300025934 Ga0207686_10022554 Ga0207686_100225543 231
210 3300025934 Ga0207686_10055929 Ga0207686_100559293 231
211 3300025938 Ga0207704_10000011 Ga0207704_1000001162 231
212 3300025944 Ga0207661_10003428 Ga0207661_100034286 231
213 3300025945 Ga0207679_10007295 Ga0207679_100072956 231
214 3300025949 Ga0207667_10000020 Ga0207667_10000020203 231
215 3300025960 Ga0207651_10003816 Ga0207651_100038162 231
216 3300025961 Ga0207712_10019417 Ga0207712_100194172 231
217 3300026023 Ga0207677_10006442 Ga0207677_100064423 231
218 3300026023 Ga0207677_10099842 Ga0207677_100998422 231
219 3300026035 Ga0207703_10285197 Ga0207703_102851972 231
220 3300026041 Ga0207639_10003710 Ga0207639_100037109 231
221 3300026041 Ga0207639_10018026 Ga0207639_100180265 231
222 3300026067 Ga0207678_10337725 Ga0207678_103377252 231
223 3300026078 Ga0207702_10005183 Ga0207702_1000518312 231
224 3300026078 Ga0207702_10051753 Ga0207702_100517533 231
225 3300026078 Ga0207702_10240259 Ga0207702_102402593 231
226 3300026089 Ga0207648_10001059 Ga0207648_1000105924 231
227 3300026089 Ga0207648_10043714 Ga0207648_100437144 231
228 3300026116 Ga0207674_10003303 Ga0207674_1000330317 231
229 3300026121 Ga0207683_10005152 Ga0207683_1000515213 231
230 3300026142 Ga0207698_11013791 Ga0207698_110137911 231
231 3300028786 Ga0307517_10001632 Ga0307517_1000163220 231
232 3300028794 Ga0307515_10022378 Ga0307515_100223783 231
233 3300030742 Ga0316183_1132422 Ga0316183_113242212 231
234 3300030744 Ga0316181_1039957 Ga0316181_10399574 231
235 3300031711 Ga0265314_10302299 Ga0265314_103022991 231
236 3300032002 Ga0307416_100116527 Ga0307416_1001165272 231
237 3300033179 Ga0307507_10000052 Ga0307507_1000005218 231
238 3300033180 Ga0307510_10307297 Ga0307510_103072971 231
239 3300037418 Ga0395900_0756245 Ga0395900_0756245_97_792 231
240 3300038443 Ga0395901_0247713 Ga0395901_0247713_26_721 231
241 3300039437 Ga0436365_0832600 Ga0436365_0832600_70_765 231
242 3300039447 Ga0436361_0351371 Ga0436361_0351371_2277_2972 231
243 3300042005 Ga0439448_0026593 Ga0439448_0026593_697_1392 231
244 3300044712 Ga0453684_0484227 Ga0453684_0484227_260_955 231
245 3300046492 Ga0495585_0000806 Ga0495585_0000806_19652_20347 231
246 3300046507 Ga0495606_0056302 Ga0495606_0056302_98_793 231
247 3300046517 Ga0495630_0621030 Ga0495630_0621030_113_811 231
248 3300046518 Ga0495631_0234250 Ga0495631_0234250_48_743 231
249 3300046519 Ga0495632_0071556 Ga0495632_0071556_486_1181 231
250 3300046524 Ga0495648_0008887 Ga0495648_0008887_6504_7199 231
251 3300046524 Ga0495648_0186345 Ga0495648_0186345_171_866 231
252 3300046616 Ga0495668_0000021 Ga0495668_0000021_118059_118754 231
253 3300046616 Ga0495668_0000358 Ga0495668_0000358_58474_59247 231
254 3300046660 Ga0495625_0000601 Ga0495625_0000601_8833_9528 231
255 3300046660 Ga0495625_0000817 Ga0495625_0000817_19050_19745 231
256 3300046665 Ga0495661_0004147 Ga0495661_0004147_5612_6313 231
257 3300047443 Ga0495687_001685 Ga0495687_001685_10817_11512 231
258 3300047472 Ga0495686_0043586 Ga0495686_0043586_981_1676 231
259 3300047472 Ga0495686_0170675 Ga0495686_0170675_492_1187 231
260 3300048089 Ga0495614_0015856 Ga0495614_0015856_767_1462 231
261 3300049568 Ga0501031_0171029 Ga0501031_0171029_618_1313 231
262 3300049569 Ga0501032_0071838 Ga0501032_0071838_68_763 231
263 3300049571 Ga0501034_0056863 Ga0501034_0056863_2978_3673 231
264 3300049572 Ga0501036_0076268 Ga0501036_0076268_2107_2802 231
265 3300049573 Ga0501037_0086055 Ga0501037_0086055_621_1316 231
266 3300049574 Ga0501038_0234786 Ga0501038_0234786_608_1303 231
267 3300049586 Ga0501070_0114810 Ga0501070_0114810_350_1045 231
268 3300049589 Ga0501073_0022241 Ga0501073_0022241_2635_3330 231
269 3300049590 Ga0501074_0010463 Ga0501074_0010463_3905_4600 231
270 3300049593 Ga0501077_0304409 Ga0501077_0304409_44_739 231
271 3300049741 Ga0501079_0245505 Ga0501079_0245505_340_1035 231
272 3300049744 Ga0501083_0160860 Ga0501083_0160860_278_973 231
273 3300049822 Ga0501035_0085979 Ga0501035_0085979_1835_2530 231
274 3300049824 Ga0501045_0615129 Ga0501045_0615129_83_778 231
275 3300053098 Ga0500650_0250633 Ga0500650_0250633_69_764 231
276 3300053122 Ga0500608_000637 Ga0500608_000637_3462_4157 231
277 3300053153 Ga0500616_0000850 Ga0500616_0000850_11494_12192 231
278 3300053158 Ga0500627_0011955 Ga0500627_0011955_547_1245 231
279 3300054114 Ga0501084_0595593 Ga0501084_0595593_171_866 231
280 2162886007 SwRhRL2b_contig_1759593 SwRhRL2b_0521.00008080 232
281 3300001979 JGI24740J21852_10042533 JGI24740J21852_100425332 232
282 3300001990 JGI24737J22298_10008536 JGI24737J22298_100085361 232
283 3300002067 JGI24735J21928_10000006 JGI24735J21928_1000000653 232
284 3300002067 JGI24735J21928_10002913 JGI24735J21928_100029137 232
285 3300002737 JGI25162J39368_1001400 JGI25162J39368_10014004 232
286 3300002737 JGI25162J39368_1001919 JGI25162J39368_10019192 232
287 3300002772 JGI25164J39214_1003560 JGI25164J39214_10035601 232
288 3300003320 rootH2_10001334 rootH2_1000133498 232
289 3300003320 rootH2_10089325 rootH2_100893252 232
290 3300003323 rootH1_10002605 rootH1_100026055 232
291 3300003323 rootH1_10078843 rootH1_100788435 232
292 3300004799 Ga0058863_11667303 Ga0058863_116673031 232
293 3300005288 Ga0065714_10006702 Ga0065714_100067023 232
294 3300005288 Ga0065714_10013197 Ga0065714_100131971 232
295 3300005288 Ga0065714_10098037 Ga0065714_100980372 232
296 3300005289 Ga0065704_10070133 Ga0065704_1007013322 232
297 3300005295 Ga0065707_10123842 Ga0065707_101238422 232
298 3300005327 Ga0070658_10073376 Ga0070658_100733763 232
299 3300005328 Ga0070676_10033047 Ga0070676_100330472 232
300 3300005328 Ga0070676_10120154 Ga0070676_101201541 232
301 3300005328 Ga0070676_10253158 Ga0070676_102531581 232
302 3300005329 Ga0070683_100052046 Ga0070683_1000520463 232
303 3300005329 Ga0070683_100065882 Ga0070683_1000658824 232
304 3300005329 Ga0070683_100130540 Ga0070683_1001305402 232
305 3300005329 Ga0070683_100431642 Ga0070683_1004316422 232
306 3300005329 Ga0070683_100667198 Ga0070683_1006671981 232
307 3300005330 Ga0070690_100159027 Ga0070690_1001590273 232
308 3300005331 Ga0070670_100030228 Ga0070670_1000302285 232
309 3300005331 Ga0070670_100052426 Ga0070670_1000524262 232
310 3300005331 Ga0070670_100169320 Ga0070670_1001693202 232
311 3300005331 Ga0070670_100526797 Ga0070670_1005267971 232
312 3300005334 Ga0068869_100053809 Ga0068869_1000538092 232
313 3300005334 Ga0068869_100061630 Ga0068869_1000616302 232
314 3300005334 Ga0068869_100069685 Ga0068869_1000696853 232
315 3300005334 Ga0068869_100221189 Ga0068869_1002211892 232
316 3300005335 Ga0070666_10016089 Ga0070666_100160893 232
317 3300005335 Ga0070666_10019554 Ga0070666_100195542 232
318 3300005336 Ga0070680_100009215 Ga0070680_1000092159 232
319 3300005336 Ga0070680_100034278 Ga0070680_1000342785 232
320 3300005336 Ga0070680_100108709 Ga0070680_1001087093 232
321 3300005336 Ga0070680_100127421 Ga0070680_1001274213 232
322 3300005337 Ga0070682_100000039 Ga0070682_10000003941 232
323 3300005337 Ga0070682_100552546 Ga0070682_1005525461 232
324 3300005338 Ga0068868_100012938 Ga0068868_1000129385 232
325 3300005338 Ga0068868_100014676 Ga0068868_1000146765 232
326 3300005338 Ga0068868_100029787 Ga0068868_1000297873 232
327 3300005338 Ga0068868_100087803 Ga0068868_1000878033 232
328 3300005338 Ga0068868_100327270 Ga0068868_1003272701 232
329 3300005339 Ga0070660_100203178 Ga0070660_1002031782 232
330 3300005340 Ga0070689_100059757 Ga0070689_1000597571 232
331 3300005344 Ga0070661_100016838 Ga0070661_1000168383 232
332 3300005344 Ga0070661_100122200 Ga0070661_1001222002 232
333 3300005347 Ga0070668_100029793 Ga0070668_1000297932 232
334 3300005353 Ga0070669_100002558 Ga0070669_1000025583 232
335 3300005354 Ga0070675_100079466 Ga0070675_1000794662 232
336 3300005354 Ga0070675_100166793 Ga0070675_1001667933 232
337 3300005354 Ga0070675_100325234 Ga0070675_1003252343 232
338 3300005355 Ga0070671_100029341 Ga0070671_1000293416 232
339 3300005355 Ga0070671_100110248 Ga0070671_1001102483 232
340 3300005355 Ga0070671_100470114 Ga0070671_1004701141 232
341 3300005356 Ga0070674_100462602 Ga0070674_1004626021 232
342 3300005364 Ga0070673_100017680 Ga0070673_1000176803 232
343 3300005365 Ga0070688_100222962 Ga0070688_1002229622 232
344 3300005365 Ga0070688_100280126 Ga0070688_1002801262 232
345 3300005365 Ga0070688_100460512 Ga0070688_1004605122 232
346 3300005366 Ga0070659_100005037 Ga0070659_1000050376 232
347 3300005367 Ga0070667_100057892 Ga0070667_1000578925 232
348 3300005367 Ga0070667_100270548 Ga0070667_1002705482 232
349 3300005436 Ga0070713_100332180 Ga0070713_1003321802 232
350 3300005455 Ga0070663_100007287 Ga0070663_1000072873 232
351 3300005455 Ga0070663_100056365 Ga0070663_1000563654 232
352 3300005455 Ga0070663_100268909 Ga0070663_1002689092 232
353 3300005456 Ga0070678_100119748 Ga0070678_1001197483 232
354 3300005457 Ga0070662_100010296 Ga0070662_1000102964 232
355 3300005457 Ga0070662_100010443 Ga0070662_1000104435 232
356 3300005457 Ga0070662_100100869 Ga0070662_1001008693 232
357 3300005457 Ga0070662_100134101 Ga0070662_1001341013 232
358 3300005458 Ga0070681_10015837 Ga0070681_100158374 232
359 3300005458 Ga0070681_10110568 Ga0070681_101105683 232
360 3300005458 Ga0070681_10126709 Ga0070681_101267092 232
361 3300005530 Ga0070679_100010527 Ga0070679_1000105276 232
362 3300005530 Ga0070679_100037562 Ga0070679_1000375624 232
363 3300005530 Ga0070679_100194770 Ga0070679_1001947703 232
364 3300005530 Ga0070679_100679391 Ga0070679_1006793911 232
365 3300005535 Ga0070684_100099797 Ga0070684_1000997973 232
366 3300005535 Ga0070684_100173237 Ga0070684_1001732372 232
367 3300005535 Ga0070684_100450844 Ga0070684_1004508442 232
368 3300005539 Ga0068853_100019480 Ga0068853_1000194807 232
369 3300005539 Ga0068853_100135257 Ga0068853_1001352572 232
370 3300005539 Ga0068853_100206762 Ga0068853_1002067621 232
371 3300005539 Ga0068853_100339428 Ga0068853_1003394282 232
372 3300005543 Ga0070672_100053325 Ga0070672_1000533252 232
373 3300005544 Ga0070686_100014008 Ga0070686_1000140087 232
374 3300005544 Ga0070686_100073946 Ga0070686_1000739463 232
375 3300005548 Ga0070665_100005268 Ga0070665_1000052688 232
376 3300005548 Ga0070665_100610442 Ga0070665_1006104422 232
377 3300005563 Ga0068855_100001020 Ga0068855_10000102011 232
378 3300005563 Ga0068855_100013351 Ga0068855_1000133512 232
379 3300005563 Ga0068855_100049734 Ga0068855_1000497341 232
380 3300005563 Ga0068855_100053685 Ga0068855_1000536855 232
381 3300005563 Ga0068855_100690316 Ga0068855_1006903161 232
382 3300005564 Ga0070664_100032121 Ga0070664_1000321215 232
383 3300005564 Ga0070664_100042869 Ga0070664_1000428693 232
384 3300005577 Ga0068857_100014661 Ga0068857_1000146615 232
385 3300005577 Ga0068857_100044542 Ga0068857_1000445424 232
386 3300005577 Ga0068857_100046567 Ga0068857_1000465676 232
387 3300005577 Ga0068857_100229944 Ga0068857_1002299442 232
388 3300005578 Ga0068854_100040449 Ga0068854_1000404494 232
389 3300005614 Ga0068856_100001155 Ga0068856_1000011558 232
390 3300005614 Ga0068856_100045350 Ga0068856_1000453504 232
391 3300005614 Ga0068856_100186615 Ga0068856_1001866153 232
392 3300005616 Ga0068852_100117022 Ga0068852_1001170223 232
393 3300005616 Ga0068852_100214924 Ga0068852_1002149243 232
394 3300005616 Ga0068852_100385361 Ga0068852_1003853611 232
395 3300005616 Ga0068852_100600057 Ga0068852_1006000571 232
396 3300005617 Ga0068859_100004525 Ga0068859_10000452511 232
397 3300005617 Ga0068859_100005457 Ga0068859_1000054578 232
398 3300005617 Ga0068859_100013275 Ga0068859_1000132757 232
399 3300005617 Ga0068859_100022856 Ga0068859_1000228564 232
400 3300005617 Ga0068859_100042002 Ga0068859_1000420021 232
401 3300005617 Ga0068859_100090054 Ga0068859_1000900544 232
402 3300005618 Ga0068864_100007308 Ga0068864_1000073089 232
403 3300005718 Ga0068866_10135818 Ga0068866_101358182 232
404 3300005718 Ga0068866_10138092 Ga0068866_101380922 232
405 3300005719 Ga0068861_100033169 Ga0068861_1000331693 232
406 3300005834 Ga0068851_10050635 Ga0068851_100506353 232
407 3300005840 Ga0068870_10115415 Ga0068870_101154152 232
408 3300005841 Ga0068863_100159874 Ga0068863_1001598741 232
409 3300005841 Ga0068863_100189881 Ga0068863_1001898812 232
410 3300005841 Ga0068863_100423301 Ga0068863_1004233013 232
411 3300005842 Ga0068858_100081025 Ga0068858_1000810254 232
412 3300005842 Ga0068858_100087319 Ga0068858_1000873193 232
413 3300005842 Ga0068858_101029335 Ga0068858_1010293351 232
414 3300005843 Ga0068860_100002154 Ga0068860_1000021548 232
415 3300005843 Ga0068860_100022913 Ga0068860_1000229134 232
416 3300005843 Ga0068860_100077181 Ga0068860_1000771813 232
417 3300005843 Ga0068860_100086977 Ga0068860_1000869773 232
418 3300005843 Ga0068860_100114836 Ga0068860_1001148362 232
419 3300005843 Ga0068860_100396780 Ga0068860_1003967802 232
420 3300005844 Ga0068862_100001370 Ga0068862_10000137015 232
421 3300005844 Ga0068862_100067215 Ga0068862_1000672153 232
422 3300005844 Ga0068862_100168512 Ga0068862_1001685122 232
423 3300005844 Ga0068862_100293880 Ga0068862_1002938803 232
424 3300005844 Ga0068862_100576719 Ga0068862_1005767192 232
425 3300005844 Ga0068862_100656691 Ga0068862_1006566912 232
426 3300005985 Ga0081539_10053522 Ga0081539_100535223 232
427 3300006163 Ga0070715_10009819 Ga0070715_100098194 232
428 3300006195 Ga0075366_10001635 Ga0075366_100016356 232
429 3300006195 Ga0075366_10105868 Ga0075366_101058682 232
430 3300006195 Ga0075366_10245551 Ga0075366_102455511 232
431 3300006237 Ga0097621_100006750 Ga0097621_1000067504 232
432 3300006237 Ga0097621_100098003 Ga0097621_1000980033 232
433 3300006237 Ga0097621_100153206 Ga0097621_1001532062 232
434 3300006358 Ga0068871_100002609 Ga0068871_1000026094 232
435 3300006358 Ga0068871_100016800 Ga0068871_1000168006 232
436 3300006881 Ga0068865_100133962 Ga0068865_1001339622 232
437 3300006881 Ga0068865_100430604 Ga0068865_1004306042 232
438 3300006931 Ga0097620_100004525 Ga0097620_10000452511 232
439 3300006931 Ga0097620_100005457 Ga0097620_1000054578 232
440 3300006931 Ga0097620_100013274 Ga0097620_1000132747 232
441 3300006931 Ga0097620_100022856 Ga0097620_1000228564 232
442 3300006931 Ga0097620_100042001 Ga0097620_1000420011 232
443 3300006931 Ga0097620_100090054 Ga0097620_1000900544 232
444 3300009093 Ga0105240_10000011 Ga0105240_1000001196 232
445 3300009093 Ga0105240_10000126 Ga0105240_1000012614 232
446 3300009093 Ga0105240_10058570 Ga0105240_100585705 232
447 3300009093 Ga0105240_10281022 Ga0105240_102810222 232
448 3300009093 Ga0105240_10283953 Ga0105240_102839533 232
449 3300009093 Ga0105240_10578221 Ga0105240_105782212 232
450 3300009094 Ga0111539_10086428 Ga0111539_100864282 232
451 3300009098 Ga0105245_10283948 Ga0105245_102839482 232
452 3300009101 Ga0105247_10022655 Ga0105247_100226554 232
453 3300009174 Ga0105241_10033116 Ga0105241_100331164 232
454 3300009174 Ga0105241_10139578 Ga0105241_101395781 232
455 3300009174 Ga0105241_10169259 Ga0105241_101692593 232
456 3300009174 Ga0105241_10388882 Ga0105241_103888822 232
457 3300009174 Ga0105241_10584519 Ga0105241_105845192 232
458 3300009176 Ga0105242_10039472 Ga0105242_100394724 232
459 3300009176 Ga0105242_10341845 Ga0105242_103418452 232
460 3300009545 Ga0105237_10005111 Ga0105237_1000511111 232
461 3300009545 Ga0105237_10018370 Ga0105237_100183705 232
462 3300009545 Ga0105237_10018921 Ga0105237_100189215 232
463 3300009545 Ga0105237_10228280 Ga0105237_102282803 232
464 3300009545 Ga0105237_10629128 Ga0105237_106291282 232
465 3300009551 Ga0105238_10410558 Ga0105238_104105582 232
466 3300009553 Ga0105249_10108101 Ga0105249_101081013 232
467 3300009553 Ga0105249_10276369 Ga0105249_102763692 232
468 3300010375 Ga0105239_10000005 Ga0105239_10000005381 232
469 3300010375 Ga0105239_10000122 Ga0105239_1000012265 232
470 3300010375 Ga0105239_10002186 Ga0105239_100021865 232
471 3300010375 Ga0105239_10004534 Ga0105239_1000453414 232
472 3300010375 Ga0105239_10004850 Ga0105239_1000485013 232
473 3300010375 Ga0105239_10022560 Ga0105239_100225606 232
474 3300010375 Ga0105239_10097656 Ga0105239_100976564 232
475 3300011119 Ga0105246_10286234 Ga0105246_102862342 232
476 3300013100 Ga0157373_10000199 Ga0157373_1000019925 232
477 3300013100 Ga0157373_10002632 Ga0157373_100026329 232
478 3300013100 Ga0157373_10003027 Ga0157373_100030273 232
479 3300013100 Ga0157373_10055300 Ga0157373_100553003 232
480 3300013100 Ga0157373_10122817 Ga0157373_101228171 232
481 3300013102 Ga0157371_10000529 Ga0157371_100005292 232
482 3300013102 Ga0157371_10002520 Ga0157371_1000252011 232
483 3300013102 Ga0157371_10007629 Ga0157371_100076294 232
484 3300013102 Ga0157371_10050537 Ga0157371_100505372 232
485 3300013102 Ga0157371_10171419 Ga0157371_101714193 232
486 3300013104 Ga0157370_10013720 Ga0157370_100137203 232
487 3300013104 Ga0157370_10031796 Ga0157370_100317965 232
488 3300013104 Ga0157370_10487207 Ga0157370_104872072 232
489 3300013105 Ga0157369_10000039 Ga0157369_1000003915 232
490 3300013105 Ga0157369_10009198 Ga0157369_100091984 232
491 3300013105 Ga0157369_10091713 Ga0157369_100917133 232
492 3300013105 Ga0157369_10105244 Ga0157369_101052443 232
493 3300013296 Ga0157374_10008373 Ga0157374_100083737 232
494 3300013296 Ga0157374_10222909 Ga0157374_102229093 232
495 3300013296 Ga0157374_10334177 Ga0157374_103341771 232
496 3300013297 Ga0157378_10003085 Ga0157378_1000308514 232
497 3300013297 Ga0157378_10006215 Ga0157378_100062159 232
498 3300013297 Ga0157378_10072667 Ga0157378_100726673 232
499 3300013297 Ga0157378_10109877 Ga0157378_101098773 232
500 3300013297 Ga0157378_10209543 Ga0157378_102095433 232
501 3300013297 Ga0157378_10531899 Ga0157378_105318992 232
502 3300013297 Ga0157378_10945081 Ga0157378_109450811 232
503 3300013306 Ga0163162_10000024 Ga0163162_10000024171 232
504 3300013306 Ga0163162_10000882 Ga0163162_100008825 232
505 3300013306 Ga0163162_10003984 Ga0163162_1000398413 232
506 3300013306 Ga0163162_10063454 Ga0163162_100634542 232
507 3300013306 Ga0163162_10065752 Ga0163162_100657524 232
508 3300013307 Ga0157372_10000001 Ga0157372_10000001347 232
509 3300013307 Ga0157372_10001038 Ga0157372_100010386 232
510 3300013307 Ga0157372_10001070 Ga0157372_1000107021 232
511 3300013307 Ga0157372_10004146 Ga0157372_100041465 232
512 3300013307 Ga0157372_10007653 Ga0157372_100076539 232
513 3300013307 Ga0157372_10053155 Ga0157372_100531554 232
514 3300013307 Ga0157372_10100561 Ga0157372_101005614 232
515 3300013307 Ga0157372_10224886 Ga0157372_102248861 232
516 3300013308 Ga0157375_10003648 Ga0157375_100036484 232
517 3300013308 Ga0157375_10127509 Ga0157375_101275093 232
518 3300013308 Ga0157375_10529722 Ga0157375_105297222 232
519 3300013308 Ga0157375_10649475 Ga0157375_106494752 232
520 3300013308 Ga0157375_11318909 Ga0157375_113189091 232
521 3300014325 Ga0163163_10001556 Ga0163163_100015566 232
522 3300014325 Ga0163163_10012108 Ga0163163_100121082 232
523 3300014325 Ga0163163_10524286 Ga0163163_105242862 232
524 3300014326 Ga0157380_10002192 Ga0157380_100021925 232
525 3300014326 Ga0157380_10235842 Ga0157380_102358423 232
526 3300014326 Ga0157380_10552350 Ga0157380_105523502 232
527 3300014745 Ga0157377_10007003 Ga0157377_100070037 232
528 3300014745 Ga0157377_10302779 Ga0157377_103027792 232
529 3300014968 Ga0157379_10460926 Ga0157379_104609262 232
530 3300014969 Ga0157376_10011991 Ga0157376_100119915 232
531 3300014969 Ga0157376_10015574 Ga0157376_100155747 232
532 3300014969 Ga0157376_10241742 Ga0157376_102417422 232
533 3300017792 Ga0163161_10001188 Ga0163161_1000118818 232
534 3300017792 Ga0163161_10013505 Ga0163161_100135057 232
535 3300017792 Ga0163161_10184672 Ga0163161_101846723 232
536 3300021361 Ga0213872_10053446 Ga0213872_100534462 232
537 3300025231 Ga0207427_100106 Ga0207427_10010635 232
538 3300025233 Ga0209437_100077 Ga0209437_100077155 232
539 3300025233 Ga0209437_100226 Ga0209437_10022634 232
540 3300025250 Ga0209026_1001905 Ga0209026_10019056 232
541 3300025250 Ga0209026_1012739 Ga0209026_10127392 232
542 3300025261 Ga0209233_1000089 Ga0209233_100008934 232
543 3300025261 Ga0209233_1001139 Ga0209233_100113912 232
544 3300025272 Ga0209455_1002616 Ga0209455_10026167 232
545 3300025315 Ga0207697_10040271 Ga0207697_100402712 232
546 3300025903 Ga0207680_10564099 Ga0207680_105640991 232
547 3300025904 Ga0207647_10000473 Ga0207647_1000047312 232
548 3300025904 Ga0207647_10035567 Ga0207647_100355672 232
549 3300025904 Ga0207647_10185355 Ga0207647_101853552 232
550 3300025907 Ga0207645_10065394 Ga0207645_100653942 232
551 3300025908 Ga0207643_10022447 Ga0207643_100224474 232
552 3300025908 Ga0207643_10091934 Ga0207643_100919341 232
553 3300025909 Ga0207705_10018591 Ga0207705_100185914 232
554 3300025909 Ga0207705_10287661 Ga0207705_102876612 232
555 3300025909 Ga0207705_10736745 Ga0207705_107367451 232
556 3300025911 Ga0207654_10063509 Ga0207654_100635093 232
557 3300025911 Ga0207654_10084913 Ga0207654_100849132 232
558 3300025911 Ga0207654_10090860 Ga0207654_100908602 232
559 3300025911 Ga0207654_10170802 Ga0207654_101708021 232
560 3300025913 Ga0207695_10000010 Ga0207695_10000010484 232
561 3300025913 Ga0207695_10000013 Ga0207695_10000013337 232
562 3300025913 Ga0207695_10009521 Ga0207695_100095212 232
563 3300025913 Ga0207695_10049264 Ga0207695_100492643 232
564 3300025913 Ga0207695_10130012 Ga0207695_101300123 232
565 3300025913 Ga0207695_10209543 Ga0207695_102095432 232
566 3300025914 Ga0207671_10000728 Ga0207671_1000072826 232
567 3300025914 Ga0207671_10005736 Ga0207671_100057364 232
568 3300025914 Ga0207671_10009466 Ga0207671_100094664 232
569 3300025914 Ga0207671_10149616 Ga0207671_101496163 232
570 3300025917 Ga0207660_10018889 Ga0207660_100188895 232
571 3300025917 Ga0207660_10137633 Ga0207660_101376332 232
572 3300025917 Ga0207660_10243584 Ga0207660_102435842 232
573 3300025919 Ga0207657_10205457 Ga0207657_102054572 232
574 3300025920 Ga0207649_10018665 Ga0207649_100186654 232
575 3300025921 Ga0207652_10000844 Ga0207652_1000084412 232
576 3300025921 Ga0207652_10015718 Ga0207652_100157183 232
577 3300025921 Ga0207652_10605735 Ga0207652_106057352 232
578 3300025923 Ga0207681_10019641 Ga0207681_100196415 232
579 3300025923 Ga0207681_10452488 Ga0207681_104524881 232
580 3300025925 Ga0207650_10064839 Ga0207650_100648393 232
581 3300025925 Ga0207650_10079521 Ga0207650_100795212 232
582 3300025925 Ga0207650_10461484 Ga0207650_104614841 232
583 3300025926 Ga0207659_10107346 Ga0207659_101073463 232
584 3300025926 Ga0207659_10213382 Ga0207659_102133822 232
585 3300025931 Ga0207644_10141493 Ga0207644_101414932 232
586 3300025931 Ga0207644_10683453 Ga0207644_106834531 232
587 3300025933 Ga0207706_10007192 Ga0207706_100071925 232
588 3300025933 Ga0207706_10019195 Ga0207706_100191957 232
589 3300025933 Ga0207706_10046944 Ga0207706_100469444 232
590 3300025933 Ga0207706_10342410 Ga0207706_103424103 232
591 3300025934 Ga0207686_10071244 Ga0207686_100712441 232
592 3300025934 Ga0207686_10381434 Ga0207686_103814342 232
593 3300025936 Ga0207670_10062668 Ga0207670_100626682 232
594 3300025936 Ga0207670_10112529 Ga0207670_101125292 232
595 3300025937 Ga0207669_10155222 Ga0207669_101552221 232
596 3300025937 Ga0207669_10281219 Ga0207669_102812192 232
597 3300025938 Ga0207704_10084013 Ga0207704_100840132 232
598 3300025938 Ga0207704_10086891 Ga0207704_100868912 232
599 3300025938 Ga0207704_10201454 Ga0207704_102014542 232
600 3300025940 Ga0207691_10062524 Ga0207691_100625244 232
601 3300025942 Ga0207689_10007865 Ga0207689_100078658 232
602 3300025942 Ga0207689_10023823 Ga0207689_100238232 232
603 3300025942 Ga0207689_10031604 Ga0207689_100316045 232
604 3300025942 Ga0207689_10101630 Ga0207689_101016302 232
605 3300025942 Ga0207689_10219548 Ga0207689_102195483 232
606 3300025942 Ga0207689_10447122 Ga0207689_104471222 232
607 3300025944 Ga0207661_10012229 Ga0207661_100122296 232
608 3300025944 Ga0207661_10083125 Ga0207661_100831254 232
609 3300025945 Ga0207679_10002266 Ga0207679_100022669 232
610 3300025945 Ga0207679_10060241 Ga0207679_100602413 232
611 3300025949 Ga0207667_10001278 Ga0207667_1000127829 232
612 3300025949 Ga0207667_10043117 Ga0207667_100431173 232
613 3300025949 Ga0207667_10835331 Ga0207667_108353311 232
614 3300025949 Ga0207667_10916060 Ga0207667_109160601 232
615 3300025960 Ga0207651_10017197 Ga0207651_100171975 232
616 3300025961 Ga0207712_10012182 Ga0207712_100121823 232
617 3300025961 Ga0207712_10024434 Ga0207712_100244344 232
618 3300025972 Ga0207668_10042758 Ga0207668_100427582 232
619 3300025981 Ga0207640_10062388 Ga0207640_100623883 232
620 3300025981 Ga0207640_10379996 Ga0207640_103799962 232
621 3300025986 Ga0207658_10041786 Ga0207658_100417864 232
622 3300025986 Ga0207658_10159321 Ga0207658_101593212 232
623 3300026023 Ga0207677_10019837 Ga0207677_100198373 232
624 3300026023 Ga0207677_10057892 Ga0207677_100578923 232
625 3300026023 Ga0207677_10624684 Ga0207677_106246842 232
626 3300026035 Ga0207703_10113372 Ga0207703_101133724 232
627 3300026035 Ga0207703_10125105 Ga0207703_101251051 232
628 3300026035 Ga0207703_10942308 Ga0207703_109423081 232
629 3300026041 Ga0207639_10013988 Ga0207639_100139882 232
630 3300026041 Ga0207639_10091147 Ga0207639_100911473 232
631 3300026041 Ga0207639_10281357 Ga0207639_102813572 232
632 3300026041 Ga0207639_10310803 Ga0207639_103108032 232
633 3300026067 Ga0207678_10015406 Ga0207678_100154063 232
634 3300026067 Ga0207678_10052313 Ga0207678_100523132 232
635 3300026067 Ga0207678_10284339 Ga0207678_102843393 232
636 3300026078 Ga0207702_10001532 Ga0207702_1000153220 232
637 3300026078 Ga0207702_10042134 Ga0207702_100421345 232
638 3300026078 Ga0207702_10057981 Ga0207702_100579814 232
639 3300026088 Ga0207641_10121938 Ga0207641_101219382 232
640 3300026088 Ga0207641_10192789 Ga0207641_101927892 232
641 3300026089 Ga0207648_10088004 Ga0207648_100880042 232
642 3300026089 Ga0207648_10242851 Ga0207648_102428512 232
643 3300026095 Ga0207676_10007397 Ga0207676_100073977 232
644 3300026095 Ga0207676_10115397 Ga0207676_101153972 232
645 3300026095 Ga0207676_10160310 Ga0207676_101603102 232
646 3300026095 Ga0207676_10301240 Ga0207676_103012402 232
647 3300026116 Ga0207674_10035923 Ga0207674_100359235 232
648 3300026116 Ga0207674_10036409 Ga0207674_100364095 232
649 3300026116 Ga0207674_10173016 Ga0207674_101730163 232
650 3300026118 Ga0207675_100109943 Ga0207675_1001099432 232
651 3300026118 Ga0207675_100226444 Ga0207675_1002264443 232
652 3300026118 Ga0207675_100446484 Ga0207675_1004464841 232
653 3300026121 Ga0207683_10022575 Ga0207683_100225755 232
654 3300026142 Ga0207698_10164191 Ga0207698_101641912 232
655 3300026142 Ga0207698_10189610 Ga0207698_101896103 232
656 3300026142 Ga0207698_10218359 Ga0207698_102183593 232
657 3300026142 Ga0207698_10592970 Ga0207698_105929702 232
658 3300028379 Ga0268266_10013332 Ga0268266_100133324 232
659 3300028379 Ga0268266_10244256 Ga0268266_102442562 232
660 3300028380 Ga0268265_10006391 Ga0268265_100063918 232
661 3300028380 Ga0268265_10141310 Ga0268265_101413103 232
662 3300028380 Ga0268265_10261745 Ga0268265_102617451 232
663 3300028380 Ga0268265_10506968 Ga0268265_105069682 232
664 3300028381 Ga0268264_10016735 Ga0268264_100167352 232
665 3300028381 Ga0268264_10028367 Ga0268264_100283674 232
666 3300028381 Ga0268264_10035430 Ga0268264_100354303 232
667 3300028381 Ga0268264_10062469 Ga0268264_100624691 232
668 3300028794 Ga0307515_10000280 Ga0307515_100002802 232
669 3300028800 Ga0265338_10087151 Ga0265338_100871514 232
670 3300031251 Ga0265327_10000006 Ga0265327_10000006428 232
671 3300031251 Ga0265327_10000159 Ga0265327_1000015990 232
672 3300031251 Ga0265327_10025635 Ga0265327_100256352 232
673 3300031251 Ga0265327_10059389 Ga0265327_100593892 232
674 3300031507 Ga0307509_10116904 Ga0307509_101169042 232
675 3300031711 Ga0265314_10058108 Ga0265314_100581083 232
676 3300031730 Ga0307516_10206095 Ga0307516_102060952 232
677 3300031731 Ga0307405_10005916 Ga0307405_100059166 232
678 3300031901 Ga0307406_10502419 Ga0307406_105024192 232
679 3300031911 Ga0307412_10027245 Ga0307412_100272453 232
680 3300031911 Ga0307412_10132054 Ga0307412_101320541 232
681 3300032004 Ga0307414_10474955 Ga0307414_104749552 232
682 3300032005 Ga0307411_10002789 Ga0307411_100027896 232
683 3300033180 Ga0307510_10008290 Ga0307510_100082908 232
684 3300035112 Ga0373932_0169051 Ga0373932_0169051_29_727 232
685 3300035118 Ga0373954_0036500 Ga0373954_0036500_972_1670 232
686 3300035171 Ga0373946_0160540 Ga0373946_0160540_242_940 232
687 3300035724 Ga0373933_0168959 Ga0373933_0168959_304_1002 232
688 3300035725 Ga0373947_0041140 Ga0373947_0041140_1772_2470 232
689 3300037068 Ga0373925_0059520 Ga0373925_0059520_819_1517 232
690 3300037312 Ga0395899_0000002 Ga0395899_0000002_919317_920015 232
691 3300037312 Ga0395899_0000735 Ga0395899_0000735_29269_29967 232
692 3300037312 Ga0395899_0038695 Ga0395899_0038695_1785_2486 232
693 3300037312 Ga0395899_0097246 Ga0395899_0097246_1224_1922 232
694 3300037312 Ga0395899_0105011 Ga0395899_0105011_1125_1823 232
695 3300037312 Ga0395899_0211472 Ga0395899_0211472_105_806 232
696 3300037312 Ga0395899_0306779 Ga0395899_0306779_165_866 232
697 3300037418 Ga0395900_0000014 Ga0395900_0000014_216997_217695 232
698 3300037418 Ga0395900_0000122 Ga0395900_0000122_4596_5294 232
699 3300037418 Ga0395900_0007456 Ga0395900_0007456_1022_1723 232
700 3300037418 Ga0395900_0052327 Ga0395900_0052327_1678_2415 232
701 3300037418 Ga0395900_0096846 Ga0395900_0096846_2216_2914 232
702 3300037418 Ga0395900_0367899 Ga0395900_0367899_55_753 232
703 3300037418 Ga0395900_0495558 Ga0395900_0495558_165_866 232
704 3300037466 Ga0395898_0024518 Ga0395898_0024518_1857_2555 232
705 3300037466 Ga0395898_0047336 Ga0395898_0047336_3358_4056 232
706 3300037466 Ga0395898_0154386 Ga0395898_0154386_1106_1843 232
707 3300037466 Ga0395898_0189279 Ga0395898_0189279_974_1675 232
708 3300037471 Ga0395905_0000001 Ga0395905_0000001_1464371_1465087 232
709 3300037471 Ga0395905_0000037 Ga0395905_0000037_216987_217685 232
710 3300037471 Ga0395905_0001611 Ga0395905_0001611_12355_13092 232
711 3300037471 Ga0395905_0007405 Ga0395905_0007405_513_1211 232
712 3300037471 Ga0395905_0035016 Ga0395905_0035016_3821_4522 232
713 3300037471 Ga0395905_0185797 Ga0395905_0185797_19_717 232
714 3300037471 Ga0395905_0845263 Ga0395905_0845263_71_769 232
715 3300038443 Ga0395901_0000219 Ga0395901_0000219_25601_26299 232
716 3300038443 Ga0395901_0072520 Ga0395901_0072520_1387_2124 232
717 3300038443 Ga0395901_0093437 Ga0395901_0093437_2298_2996 232
718 3300038443 Ga0395901_0800805 Ga0395901_0800805_103_804 232
719 3300041505 Ga0451849_1408969 Ga0451849_1408969_80_787 232
720 3300042135 Ga0450899_007462 Ga0450899_007462_402_1100 232
721 3300042435 Ga0439434_0004196 Ga0439434_0004196_1440_2138 232
722 3300042876 Ga0451577_0117869 Ga0451577_0117869_659_1372 232
723 3300044684 Ga0466966_0022793 Ga0466966_0022793_3207_3905 232
724 3300044693 Ga0466961_0126273 Ga0466961_0126273_178_876 232
725 3300044712 Ga0453684_0000912 Ga0453684_0000912_46664_47362 232
726 3300044712 Ga0453684_0425614 Ga0453684_0425614_616_1320 232
727 3300045049 Ga0466959_0138317 Ga0466959_0138317_842_1540 232
728 3300045051 Ga0451576_0000002 Ga0451576_0000002_228622_229320 232
729 3300045051 Ga0451576_0082587 Ga0451576_0082587_2090_2803 232
730 3300045836 Ga0466958_0053198 Ga0466958_0053198_524_1222 232
731 3300046454 Ga0495592_0180762 Ga0495592_0180762_436_1134 232
732 3300046462 Ga0495651_0305274 Ga0495651_0305274_300_998 232
733 3300046463 Ga0495653_0236487 Ga0495653_0236487_243_941 232
734 3300046471 Ga0495650_0000014 Ga0495650_0000014_562182_562880 232
735 3300046471 Ga0495650_0061702 Ga0495650_0061702_708_1406 232
736 3300046492 Ga0495585_0000031 Ga0495585_0000031_130401_131105 232
737 3300046500 Ga0495596_0050349 Ga0495596_0050349_798_1499 232
738 3300046501 Ga0495607_0180713 Ga0495607_0180713_195_893 232
739 3300046506 Ga0495583_0056466 Ga0495583_0056466_320_1018 232
740 3300046506 Ga0495583_0068490 Ga0495583_0068490_642_1346 232
741 3300046507 Ga0495606_0000020 Ga0495606_0000020_1746_2444 232
742 3300046507 Ga0495606_0018977 Ga0495606_0018977_1803_2501 232
743 3300046507 Ga0495606_0171991 Ga0495606_0171991_32_733 232
744 3300046512 Ga0495610_0017383 Ga0495610_0017383_2552_3250 232
745 3300046513 Ga0495616_0001192 Ga0495616_0001192_7802_8500 232
746 3300046513 Ga0495616_0022705 Ga0495616_0022705_614_1312 232
747 3300046516 Ga0495628_0067700 Ga0495628_0067700_1543_2241 232
748 3300046517 Ga0495630_0004081 Ga0495630_0004081_8947_9645 232
749 3300046522 Ga0495643_0000537 Ga0495643_0000537_7476_8174 232
750 3300046522 Ga0495643_0051822 Ga0495643_0051822_493_1191 232
751 3300046524 Ga0495648_0041931 Ga0495648_0041931_1787_2485 232
752 3300046529 Ga0495652_0337405 Ga0495652_0337405_213_911 232
753 3300046538 Ga0495609_0017620 Ga0495609_0017620_2423_3121 232
754 3300046543 Ga0495645_0339384 Ga0495645_0339384_130_828 232
755 3300046558 Ga0495633_0000029 Ga0495633_0000029_39131_39829 232
756 3300046558 Ga0495633_0109968 Ga0495633_0109968_60_758 232
757 3300046559 Ga0495667_0285591 Ga0495667_0285591_151_849 232
758 3300046616 Ga0495668_0000212 Ga0495668_0000212_83227_83925 232
759 3300046648 Ga0495611_0134899 Ga0495611_0134899_71_769 232
760 3300046660 Ga0495625_0000009 Ga0495625_0000009_65033_65731 232
761 3300046660 Ga0495625_0015260 Ga0495625_0015260_2332_3030 232
762 3300046660 Ga0495625_0021222 Ga0495625_0021222_3255_3959 232
763 3300046660 Ga0495625_0028393 Ga0495625_0028393_2240_2938 232
764 3300046663 Ga0495635_0161484 Ga0495635_0161484_141_839 232
765 3300046675 Ga0495657_0142414 Ga0495657_0142414_221_919 232
766 3300046684 Ga0495669_0054075 Ga0495669_0054075_478_1176 232
767 3300046692 Ga0495671_0082545 Ga0495671_0082545_550_1248 232
768 3300046694 Ga0495649_0000008 Ga0495649_0000008_182827_183525 232
769 3300046809 Ga0495600_0122978 Ga0495600_0122978_337_1035 232
770 3300046810 Ga0495660_0011998 Ga0495660_0011998_2415_3113 232
771 3300046810 Ga0495660_0095489 Ga0495660_0095489_128_826 232
772 3300047318 Ga0495636_0000011 Ga0495636_0000011_77416_78114 232
773 3300047322 Ga0495680_0351649 Ga0495680_0351649_306_1004 232
774 3300047323 Ga0495683_0008202 Ga0495683_0008202_3616_4317 232
775 3300047469 Ga0495673_0055614 Ga0495673_0055614_18_716 232
776 3300047471 Ga0495684_0202742 Ga0495684_0202742_53_751 232
777 3300047472 Ga0495686_0000194 Ga0495686_0000194_75680_76381 232
778 3300047472 Ga0495686_0007228 Ga0495686_0007228_49_747 232
779 3300047472 Ga0495686_0018337 Ga0495686_0018337_1316_2026 232
780 3300047472 Ga0495686_0063558 Ga0495686_0063558_850_1560 232
781 3300048911 Ga0496108_0127860 Ga0496108_0127860_569_1267 232
782 3300048917 Ga0496114_0866872 Ga0496114_0866872_46_744 232
783 3300049459 Ga0495678_021374 Ga0495678_021374_1817_2515 232
784 3300049571 Ga0501034_0000002 Ga0501034_0000002_448537_449244 232
785 3300049571 Ga0501034_0036212 Ga0501034_0036212_3961_4662 232
786 3300049573 Ga0501037_0345190 Ga0501037_0345190_113_814 232
787 3300049575 Ga0501039_0376768 Ga0501039_0376768_115_816 232
788 3300049586 Ga0501070_0100554 Ga0501070_0100554_1606_2307 232
789 3300049663 Ga0501223_000633 Ga0501223_000633_5848_6546 232
790 3300049822 Ga0501035_0138397 Ga0501035_0138397_1328_2029 232
791 3300049823 Ga0501044_0225000 Ga0501044_0225000_214_915 232
792 3300050493 nmdc:mga0k408_171_c1 nmdc:mga0k408_171_c1_783_1481 232
793 3300050493 nmdc:mga0k408_55212_c1 nmdc:mga0k408_55212_c1_401_1099 232
794 3300050493 nmdc:mga0k408_803_c1 nmdc:mga0k408_803_c1_6636_7358 232
795 3300050496 nmdc:mga07m45_218114_c1 nmdc:mga07m45_218114_c1_181_882 232
796 3300053090 Ga0500646_0021302 Ga0500646_0021302_849_1571 232
797 3300053125 Ga0500618_000266 Ga0500618_000266_8767_9465 232
798 3300053130 Ga0500642_0047893 Ga0500642_0047893_896_1594 232
799 3300053139 Ga0500568_0001078 Ga0500568_0001078_7887_8588 232
800 3300053157 Ga0500624_000576 Ga0500624_000576_8813_9511 232
801 3300053727 Ga0500611_000002 Ga0500611_000002_137037_137735 232
802 2162886007 SwRhRL2b_contig_1131605 SwRhRL2b_0890.00007430 233
803 2162886007 SwRhRL2b_contig_3290449 SwRhRL2b_0191.00000060 233
804 3300003187 JGI25151J46595_10000014 JGI25151J46595_1000001481 233
805 3300003215 JGI25153J46596_10000020 JGI25153J46596_1000002081 233
806 3300003781 Ga0055536_1000226 Ga0055536_100022614 233
807 3300003791 Ga0055530_10005126 Ga0055530_100051263 233
808 3300005288 Ga0065714_10002345 Ga0065714_100023458 233
809 3300005288 Ga0065714_10004805 Ga0065714_100048054 233
810 3300005288 Ga0065714_10017971 Ga0065714_100179711 233
811 3300005288 Ga0065714_10086246 Ga0065714_100862462 233
812 3300005289 Ga0065704_10070382 Ga0065704_1007038214 233
813 3300005289 Ga0065704_10075998 Ga0065704_100759983 233
814 3300005289 Ga0065704_10164090 Ga0065704_101640902 233
815 3300005366 Ga0070659_100000578 Ga0070659_10000057816 233
816 3300005366 Ga0070659_100127506 Ga0070659_1001275062 233
817 3300005466 Ga0070685_10053770 Ga0070685_100537703 233
818 3300005535 Ga0070684_100308382 Ga0070684_1003083822 233
819 3300005539 Ga0068853_100038295 Ga0068853_1000382953 233
820 3300005548 Ga0070665_100000003 Ga0070665_100000003193 233
821 3300006237 Ga0097621_100157317 Ga0097621_1001573173 233
822 3300009148 Ga0105243_10000025 Ga0105243_1000002589 233
823 3300009176 Ga0105242_10181646 Ga0105242_101816462 233
824 3300013100 Ga0157373_10002419 Ga0157373_100024198 233
825 3300013100 Ga0157373_10008475 Ga0157373_100084757 233
826 3300013100 Ga0157373_10016428 Ga0157373_100164284 233
827 3300013100 Ga0157373_10062311 Ga0157373_100623114 233
828 3300013102 Ga0157371_10000620 Ga0157371_1000062027 233
829 3300013102 Ga0157371_10004074 Ga0157371_100040744 233
830 3300013102 Ga0157371_10008584 Ga0157371_100085847 233
831 3300013102 Ga0157371_10009843 Ga0157371_100098433 233
832 3300013104 Ga0157370_10000207 Ga0157370_1000020718 233
833 3300013104 Ga0157370_10002038 Ga0157370_1000203818 233
834 3300013104 Ga0157370_10002831 Ga0157370_1000283113 233
835 3300013104 Ga0157370_10011824 Ga0157370_1001182410 233
836 3300013104 Ga0157370_10022568 Ga0157370_100225681 233
837 3300013105 Ga0157369_10000071 Ga0157369_1000007116 233
838 3300013296 Ga0157374_10015042 Ga0157374_100150426 233
839 3300013296 Ga0157374_10348151 Ga0157374_103481512 233
840 3300013297 Ga0157378_10168134 Ga0157378_101681342 233
841 3300013306 Ga0163162_10001708 Ga0163162_100017088 233
842 3300013306 Ga0163162_10067136 Ga0163162_100671364 233
843 3300013306 Ga0163162_10232405 Ga0163162_102324052 233
844 3300013307 Ga0157372_10723905 Ga0157372_107239052 233
845 3300013308 Ga0157375_10253242 Ga0157375_102532422 233
846 3300014325 Ga0163163_10077719 Ga0163163_100777192 233
847 3300014497 Ga0182008_10000009 Ga0182008_10000009171 233
848 3300014497 Ga0182008_10001007 Ga0182008_1000100721 233
849 3300014497 Ga0182008_10009542 Ga0182008_100095424 233
850 3300014497 Ga0182008_10026303 Ga0182008_100263032 233
851 3300014497 Ga0182008_10026857 Ga0182008_100268571 233
852 3300014968 Ga0157379_10079067 Ga0157379_100790672 233
853 3300014969 Ga0157376_10132960 Ga0157376_101329603 233
854 3300014969 Ga0157376_10392818 Ga0157376_103928182 233
855 3300015261 Ga0182006_1000332 Ga0182006_100033224 233
856 3300015261 Ga0182006_1000356 Ga0182006_10003563 233
857 3300015261 Ga0182006_1001370 Ga0182006_10013703 233
858 3300015261 Ga0182006_1004469 Ga0182006_10044692 233
859 3300015262 Ga0182007_10000006 Ga0182007_10000006303 233
860 3300015262 Ga0182007_10009267 Ga0182007_100092673 233
861 3300015262 Ga0182007_10017706 Ga0182007_100177062 233
862 3300015262 Ga0182007_10018127 Ga0182007_100181272 233
863 3300015682 Ga0183373_1001 Ga0183373_10011144 233
864 3300017792 Ga0163161_10000309 Ga0163161_1000030914 233
865 3300017792 Ga0163161_10000394 Ga0163161_1000039422 233
866 3300017792 Ga0163161_10001366 Ga0163161_100013666 233
867 3300017792 Ga0163161_10093566 Ga0163161_100935662 233
868 3300025245 Ga0207425_1000007 Ga0207425_100000794 233
869 3300025258 Ga0209129_1000006 Ga0209129_100000694 233
870 3300025292 Ga0209676_1000090 Ga0209676_100009026 233
871 3300025294 Ga0209025_1000089 Ga0209025_100008978 233
872 3300025297 Ga0209758_1000016 Ga0209758_100001694 233
873 3300025298 Ga0209050_1000091 Ga0209050_100009126 233
874 3300025932 Ga0207690_10001498 Ga0207690_1000149811 233
875 3300025935 Ga0207709_10000003 Ga0207709_10000003836 233
876 3300026142 Ga0207698_10806199 Ga0207698_108061991 233
877 3300028379 Ga0268266_10000380 Ga0268266_1000038014 233
878 3300028794 Ga0307515_10036778 Ga0307515_100367782 233
879 3300030731 Ga0316177_1086062 Ga0316177_10860623 233
880 3300030732 Ga0316176_1041743 Ga0316176_10417433 233
881 3300031251 Ga0265327_10004250 Ga0265327_100042507 233
882 3300031731 Ga0307405_10000012 Ga0307405_1000001210 233
883 3300031903 Ga0307407_10000013 Ga0307407_10000013131 233
884 3300031911 Ga0307412_10000084 Ga0307412_1000008415 233
885 3300032002 Ga0307416_100000028 Ga0307416_100000028131 233
886 3300032004 Ga0307414_10004686 Ga0307414_100046866 233
887 3300032004 Ga0307414_10032759 Ga0307414_100327593 233
888 3300032004 Ga0307414_10149495 Ga0307414_101494952 233
889 3300032004 Ga0307414_10157053 Ga0307414_101570532 233
890 3300032004 Ga0307414_10247729 Ga0307414_102477292 233
891 3300032005 Ga0307411_10096172 Ga0307411_100961722 233
892 3300032005 Ga0307411_10235116 Ga0307411_102351162 233
893 3300037312 Ga0395899_0000025 Ga0395899_0000025_28742_29458 233
894 3300037418 Ga0395900_0179961 Ga0395900_0179961_24_740 233
895 3300042876 Ga0451577_0000870 Ga0451577_0000870_8214_8918 233
896 3300044765 Ga0466970_0070816 Ga0466970_0070816_604_1308 233
897 3300046453 Ga0495627_009761 Ga0495627_009761_2663_3364 233
898 3300046501 Ga0495607_0216734 Ga0495607_0216734_228_929 233
899 3300046507 Ga0495606_0181188 Ga0495606_0181188_97_798 233
900 3300046512 Ga0495610_0000060 Ga0495610_0000060_10800_11501 233
901 3300046512 Ga0495610_0002356 Ga0495610_0002356_8059_8763 233
902 3300046513 Ga0495616_0040499 Ga0495616_0040499_556_1257 233
903 3300046538 Ga0495609_0076475 Ga0495609_0076475_236_937 233
904 3300046558 Ga0495633_0054924 Ga0495633_0054924_638_1342 233
905 3300046660 Ga0495625_0051256 Ga0495625_0051256_2034_2735 233
906 3300048925 Ga0496122_0001846 Ga0496122_0001846_17745_18446 233
907 3300048926 Ga0496123_0002062 Ga0496123_0002062_9768_10469 233
908 3300049758 Ga0501241_005415 Ga0501241_005415_1505_2206 233
909 3300053093 Ga0500651_0011469 Ga0500651_0011469_2003_2704 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

38

249

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ooy-assembly1.cif.gz_A succinyl-coa:3-ketoacid coa transferase from pig heart 0.9734 4 225
1ooz-assembly1.cif.gz_B deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9727 4 225
1ooz-assembly1.cif.gz_A deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9727 4 225
4kgb-assembly1.cif.gz_B structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.972 4 225
3dlx-assembly1.cif.gz_A crystal structure of human 3-oxoacid coa transferase 1 0.9716 4 225
ID Description Score Start End Superfamily
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9762 4 217 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9647 2 232 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9604 3 225 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9595 2 215 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9526 2 232 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A4V1QWY8-F1-model_v4 deleted 0.9915 26 102
AF-A0A448QWN8-F1-model_v4 deleted 0.9881 149 214
AF-A0A0B1R8W6-F1-model_v4 Succinyl-CoA:3-ketoacid-CoA transferase 0.9859 2 114 GO:0008410
AF-A7T8F7-F1-model_v4 Uncharacterized protein 0.9855 6 101 GO:0008410
AF-A0A455U9C0-F1-model_v4 CoA transferase subunit A 0.9854 1 114 GO:0008260
GO:0046950

Feature Viewer

pLDDT pTM Quality
91.6 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map