F485360
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 907 | 335 | 1814 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10223985|Ga0307406_102239852 |
| Length | 348 |
| Sequence | VKPKLTVGQLLERLRDPLELEQIGAAVGLDREVTSPEASSPGLVLSGYFNRFPFERIQVFGETEITYLNALDADVRARHLETFFSFAIPCVFVTKAQEPPEPFLALAAAAGIAVLRSRLKTAEFYRVIKPFLADVFAPQVTLHGSLADVFGVGLFFTGQSGIGKSECVLDLVERGHRLVADDLVIVQRRGNDVLIGRGHELQRHFMEIRGIGLVDIPAIFGIRAVRQQKRIEVVVQLEEWDQEAIVDRTGLDTESQTILGVELPKIRVPLNPGKNITVIAEVIAMNHLLRYSRGVSPAEAFNERLIAKMRGAAAAPPGGESVVLTSTSPNAYHTRAADVRRYLQEDDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 190 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 207 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 232 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 238 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 239 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 314 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.99 |
| Rhizosphere | 98.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307406_10223985 | 3300031901 | Bacteria | 1400 |
| 2 | Ga0065712_10003029 | 3300005290 | Bacteria | 3989 |
| 3 | Ga0065712_10138054 | 3300005290 | Bacteria | 1477 |
| 4 | Ga0065712_10149732 | 3300005290 | Unclassified | 1379 |
| 5 | Ga0070658_10009375 | 3300005327 | Bacteria | 7866 |
| 6 | Ga0070658_10014406 | 3300005327 | Bacteria | 6345 |
| 7 | Ga0070658_10094457 | 3300005327 | Unclassified | 2467 |
| 8 | Ga0070658_10196858 | 3300005327 | Bacteria | 1699 |
| 9 | Ga0070676_10008782 | 3300005328 | Bacteria | 5453 |
| 10 | Ga0070683_100003005 | 3300005329 | Bacteria | 13536 |
| 11 | Ga0070683_100006639 | 3300005329 | Bacteria | 9715 |
| 12 | Ga0070683_100018701 | 3300005329 | Bacteria | 6140 |
| 13 | Ga0070683_100030201 | 3300005329 | Bacteria | 4915 |
| 14 | Ga0070683_100048126 | 3300005329 | Bacteria | 3942 |
| 15 | Ga0070683_100060072 | 3300005329 | Bacteria | 3532 |
| 16 | Ga0070683_100086600 | 3300005329 | Bacteria | 2937 |
| 17 | Ga0070683_100220952 | 3300005329 | Bacteria | 1801 |
| 18 | Ga0070683_100254090 | 3300005329 | Bacteria | 1672 |
| 19 | Ga0070690_100011725 | 3300005330 | Bacteria | 5137 |
| 20 | Ga0070690_100032100 | 3300005330 | Unclassified | 3277 |
| 21 | Ga0070690_100049302 | 3300005330 | Bacteria | 2684 |
| 22 | Ga0070670_100013576 | 3300005331 | Bacteria | 6981 |
| 23 | Ga0070670_100041223 | 3300005331 | Bacteria | 3969 |
| 24 | Ga0070670_100133419 | 3300005331 | Bacteria | 2145 |
| 25 | Ga0070677_10079024 | 3300005333 | Bacteria | 1403 |
| 26 | Ga0070677_10088784 | 3300005333 | Bacteria | 1340 |
| 27 | Ga0068869_100024550 | 3300005334 | Bacteria | 4175 |
| 28 | Ga0068869_100056894 | 3300005334 | Bacteria | 2853 |
| 29 | Ga0068869_100228568 | 3300005334 | Unclassified | 1477 |
| 30 | Ga0070680_100001244 | 3300005336 | Bacteria | 18369 |
| 31 | Ga0070680_100002160 | 3300005336 | Bacteria | 14534 |
| 32 | Ga0070680_100002198 | 3300005336 | Bacteria | 14375 |
| 33 | Ga0070680_100002238 | 3300005336 | Bacteria | 14277 |
| 34 | Ga0070680_100067711 | 3300005336 | Bacteria | 2929 |
| 35 | Ga0070680_100091770 | 3300005336 | Bacteria | 2514 |
| 36 | Ga0070682_100005851 | 3300005337 | Bacteria | 6871 |
| 37 | Ga0068868_100016583 | 3300005338 | Bacteria | 5475 |
| 38 | Ga0070660_100003351 | 3300005339 | Bacteria | 11012 |
| 39 | Ga0070660_100148056 | 3300005339 | Bacteria | 1887 |
| 40 | Ga0070660_100177660 | 3300005339 | Unclassified | 1722 |
| 41 | Ga0070689_100007804 | 3300005340 | Bacteria | 7498 |
| 42 | Ga0070689_100043212 | 3300005340 | Bacteria | 3462 |
| 43 | Ga0070689_100116121 | 3300005340 | Bacteria | 2134 |
| 44 | Ga0070689_100149006 | 3300005340 | Bacteria | 1886 |
| 45 | Ga0070691_10012993 | 3300005341 | Bacteria | 3813 |
| 46 | Ga0070661_100003761 | 3300005344 | Bacteria | 10462 |
| 47 | Ga0070661_100004963 | 3300005344 | Bacteria | 9164 |
| 48 | Ga0070661_100010690 | 3300005344 | Bacteria | 6386 |
| 49 | Ga0070661_100016018 | 3300005344 | Bacteria | 5291 |
| 50 | Ga0070661_100053819 | 3300005344 | Bacteria | 2947 |
| 51 | Ga0070661_100218014 | 3300005344 | Unclassified | 1463 |
| 52 | Ga0070661_100289918 | 3300005344 | Unclassified | 1271 |
| 53 | Ga0070668_100002904 | 3300005347 | Bacteria | 12655 |
| 54 | Ga0070668_100023889 | 3300005347 | Bacteria | 4628 |
| 55 | Ga0070668_100032312 | 3300005347 | Bacteria | 3983 |
| 56 | Ga0070668_100051041 | 3300005347 | Bacteria | 3186 |
| 57 | Ga0070668_100082635 | 3300005347 | Unclassified | 2520 |
| 58 | Ga0070668_100133282 | 3300005347 | Bacteria | 1996 |
| 59 | Ga0070669_100019178 | 3300005353 | Bacteria | 4887 |
| 60 | Ga0070669_100039291 | 3300005353 | Bacteria | 3438 |
| 61 | Ga0070669_100063110 | 3300005353 | Unclassified | 2726 |
| 62 | Ga0070669_100109364 | 3300005353 | Bacteria | 2096 |
| 63 | Ga0070675_100001661 | 3300005354 | Bacteria | 16438 |
| 64 | Ga0070675_100002764 | 3300005354 | Bacteria | 13193 |
| 65 | Ga0070675_100009557 | 3300005354 | Bacteria | 7544 |
| 66 | Ga0070671_100037881 | 3300005355 | Bacteria | 4001 |
| 67 | Ga0070671_100090433 | 3300005355 | Unclassified | 2563 |
| 68 | Ga0070671_100184589 | 3300005355 | Bacteria | 1767 |
| 69 | Ga0070674_100020405 | 3300005356 | Bacteria | 4233 |
| 70 | Ga0070674_100105008 | 3300005356 | Unclassified | 2065 |
| 71 | Ga0070673_100010604 | 3300005364 | Bacteria | 6245 |
| 72 | Ga0070673_100069622 | 3300005364 | Bacteria | 2820 |
| 73 | Ga0070688_100035262 | 3300005365 | Bacteria | 3038 |
| 74 | Ga0070688_100061124 | 3300005365 | Unclassified | 2381 |
| 75 | Ga0070688_100072297 | 3300005365 | Bacteria | 2210 |
| 76 | Ga0070659_100001454 | 3300005366 | Bacteria | 17048 |
| 77 | Ga0070659_100006033 | 3300005366 | Bacteria | 8737 |
| 78 | Ga0070659_100023795 | 3300005366 | Bacteria | 4689 |
| 79 | Ga0070667_100014476 | 3300005367 | Bacteria | 6517 |
| 80 | Ga0070667_100098838 | 3300005367 | Unclassified | 2518 |
| 81 | Ga0070709_10023328 | 3300005434 | Bacteria | 3630 |
| 82 | Ga0070709_10036117 | 3300005434 | Bacteria | 3008 |
| 83 | Ga0070714_100000538 | 3300005435 | Bacteria | 27367 |
| 84 | Ga0070714_100026372 | 3300005435 | Bacteria | 4802 |
| 85 | Ga0070714_100031913 | 3300005435 | Bacteria | 4397 |
| 86 | Ga0070714_100078321 | 3300005435 | Bacteria | 2872 |
| 87 | Ga0070714_100167124 | 3300005435 | Bacteria | 1994 |
| 88 | Ga0070714_100255502 | 3300005435 | Bacteria | 1621 |
| 89 | Ga0070713_100000365 | 3300005436 | Bacteria | 29146 |
| 90 | Ga0070713_100030808 | 3300005436 | Bacteria | 4266 |
| 91 | Ga0070713_100052178 | 3300005436 | Bacteria | 3385 |
| 92 | Ga0070713_100147092 | 3300005436 | Bacteria | 2092 |
| 93 | Ga0070713_100167892 | 3300005436 | Bacteria | 1964 |
| 94 | Ga0070710_10090533 | 3300005437 | Unclassified | 1803 |
| 95 | Ga0070701_10063364 | 3300005438 | Bacteria | 1956 |
| 96 | Ga0070711_100072603 | 3300005439 | Bacteria | 2428 |
| 97 | Ga0070711_100153467 | 3300005439 | Bacteria | 1739 |
| 98 | Ga0070700_100040629 | 3300005441 | Bacteria | 2848 |
| 99 | Ga0070700_100044616 | 3300005441 | Bacteria | 2732 |
| 100 | Ga0070700_100100475 | 3300005441 | Bacteria | 1905 |
| 101 | Ga0070694_100040041 | 3300005444 | Bacteria | 3122 |
| 102 | Ga0070708_100000024 | 3300005445 | Bacteria | 104177 |
| 103 | Ga0070663_100008355 | 3300005455 | Bacteria | 6361 |
| 104 | Ga0070663_100021824 | 3300005455 | Bacteria | 4266 |
| 105 | Ga0070663_100038762 | 3300005455 | Bacteria | 3326 |
| 106 | Ga0070678_100059962 | 3300005456 | Bacteria | 2799 |
| 107 | Ga0070662_100004241 | 3300005457 | Bacteria | 9041 |
| 108 | Ga0070662_100033053 | 3300005457 | Unclassified | 3640 |
| 109 | Ga0070662_100033697 | 3300005457 | Bacteria | 3608 |
| 110 | Ga0070662_100209385 | 3300005457 | Bacteria | 1551 |
| 111 | Ga0070681_10000119 | 3300005458 | Bacteria | 59101 |
| 112 | Ga0070681_10001192 | 3300005458 | Bacteria | 22531 |
| 113 | Ga0070681_10011247 | 3300005458 | Bacteria | 8854 |
| 114 | Ga0070681_10011256 | 3300005458 | Bacteria | 8849 |
| 115 | Ga0070681_10012112 | 3300005458 | Bacteria | 8552 |
| 116 | Ga0070681_10012713 | 3300005458 | Bacteria | 8355 |
| 117 | Ga0070681_10166556 | 3300005458 | Bacteria | 2126 |
| 118 | Ga0070681_10277655 | 3300005458 | Bacteria | 1586 |
| 119 | Ga0068867_100187417 | 3300005459 | Unclassified | 1649 |
| 120 | Ga0070706_100033519 | 3300005467 | Bacteria | 4740 |
| 121 | Ga0070698_100010365 | 3300005471 | Bacteria | 9952 |
| 122 | Ga0070698_100026323 | 3300005471 | Bacteria | 6054 |
| 123 | Ga0070698_100197923 | 3300005471 | Bacteria | 1945 |
| 124 | Ga0070699_100034453 | 3300005518 | Bacteria | 4376 |
| 125 | Ga0070679_100000066 | 3300005530 | Bacteria | 78387 |
| 126 | Ga0070679_100001382 | 3300005530 | Bacteria | 21375 |
| 127 | Ga0070679_100003354 | 3300005530 | Bacteria | 14675 |
| 128 | Ga0070679_100003412 | 3300005530 | Bacteria | 14549 |
| 129 | Ga0070679_100027193 | 3300005530 | Bacteria | 5627 |
| 130 | Ga0070679_100046894 | 3300005530 | Bacteria | 4308 |
| 131 | Ga0070679_100084719 | 3300005530 | Bacteria | 3157 |
| 132 | Ga0070679_100115196 | 3300005530 | Bacteria | 2673 |
| 133 | Ga0070679_100176109 | 3300005530 | Bacteria | 2111 |
| 134 | Ga0070679_100226461 | 3300005530 | Bacteria | 1830 |
| 135 | Ga0070679_100262834 | 3300005530 | Bacteria | 1681 |
| 136 | Ga0070679_100271332 | 3300005530 | Bacteria | 1650 |
| 137 | Ga0070679_100280753 | 3300005530 | Bacteria | 1618 |
| 138 | Ga0070684_100005054 | 3300005535 | Bacteria | 10070 |
| 139 | Ga0070684_100005381 | 3300005535 | Bacteria | 9807 |
| 140 | Ga0070684_100009052 | 3300005535 | Bacteria | 7826 |
| 141 | Ga0070684_100022465 | 3300005535 | Bacteria | 5262 |
| 142 | Ga0070684_100024204 | 3300005535 | Bacteria | 5090 |
| 143 | Ga0070684_100075181 | 3300005535 | Unclassified | 2979 |
| 144 | Ga0070684_100076346 | 3300005535 | Bacteria | 2957 |
| 145 | Ga0070684_100077151 | 3300005535 | Bacteria | 2942 |
| 146 | Ga0070684_100118273 | 3300005535 | Bacteria | 2382 |
| 147 | Ga0070684_100294503 | 3300005535 | Bacteria | 1488 |
| 148 | Ga0068853_100048373 | 3300005539 | Bacteria | 3653 |
| 149 | Ga0068853_100055729 | 3300005539 | Bacteria | 3407 |
| 150 | Ga0068853_100074201 | 3300005539 | Bacteria | 2968 |
| 151 | Ga0068853_100098265 | 3300005539 | Unclassified | 2585 |
| 152 | Ga0070672_100004646 | 3300005543 | Bacteria | 8998 |
| 153 | Ga0070672_100052796 | 3300005543 | Bacteria | 3175 |
| 154 | Ga0070672_100071515 | 3300005543 | Bacteria | 2760 |
| 155 | Ga0070672_100080035 | 3300005543 | Unclassified | 2617 |
| 156 | Ga0070672_100490400 | 3300005543 | Bacteria | 1062 |
| 157 | Ga0070695_100001852 | 3300005545 | Bacteria | 11939 |
| 158 | Ga0070693_100005385 | 3300005547 | Bacteria | 6138 |
| 159 | Ga0070693_100006308 | 3300005547 | Bacteria | 5747 |
| 160 | Ga0070665_100024001 | 3300005548 | Bacteria | 6140 |
| 161 | Ga0070704_100101741 | 3300005549 | Unclassified | 2166 |
| 162 | Ga0070704_100192926 | 3300005549 | Bacteria | 1639 |
| 163 | Ga0068855_100026559 | 3300005563 | Bacteria | 6927 |
| 164 | Ga0068855_100029474 | 3300005563 | Bacteria | 6560 |
| 165 | Ga0068855_100044173 | 3300005563 | Bacteria | 5275 |
| 166 | Ga0068855_100206108 | 3300005563 | Bacteria | 2212 |
| 167 | Ga0070664_100010557 | 3300005564 | Bacteria | 7487 |
| 168 | Ga0070664_100013933 | 3300005564 | Bacteria | 6555 |
| 169 | Ga0070664_100015468 | 3300005564 | Bacteria | 6241 |
| 170 | Ga0070664_100018942 | 3300005564 | Bacteria | 5660 |
| 171 | Ga0070664_100024285 | 3300005564 | Bacteria | 5013 |
| 172 | Ga0070664_100028779 | 3300005564 | Bacteria | 4626 |
| 173 | Ga0070664_100043630 | 3300005564 | Bacteria | 3784 |
| 174 | Ga0070664_100091040 | 3300005564 | Bacteria | 2640 |
| 175 | Ga0070664_100102986 | 3300005564 | Bacteria | 2485 |
| 176 | Ga0070664_100214932 | 3300005564 | Bacteria | 1719 |
| 177 | Ga0070664_100282996 | 3300005564 | Bacteria | 1496 |
| 178 | Ga0070664_100523699 | 3300005564 | Bacteria | 1094 |
| 179 | Ga0068857_100007641 | 3300005577 | Bacteria | 9312 |
| 180 | Ga0068857_100014570 | 3300005577 | Bacteria | 6858 |
| 181 | Ga0068857_100014785 | 3300005577 | Bacteria | 6810 |
| 182 | Ga0068856_100002006 | 3300005614 | Bacteria | 21232 |
| 183 | Ga0068856_100014375 | 3300005614 | Bacteria | 7652 |
| 184 | Ga0068856_100018036 | 3300005614 | Bacteria | 6844 |
| 185 | Ga0070702_100000558 | 3300005615 | Bacteria | 13581 |
| 186 | Ga0068852_100026491 | 3300005616 | Bacteria | 4714 |
| 187 | Ga0068852_100035480 | 3300005616 | Bacteria | 4161 |
| 188 | Ga0068852_100037150 | 3300005616 | Bacteria | 4081 |
| 189 | Ga0068859_100005085 | 3300005617 | Bacteria | 13363 |
| 190 | Ga0068859_100023584 | 3300005617 | Bacteria | 6175 |
| 191 | Ga0068859_100060965 | 3300005617 | Bacteria | 3801 |
| 192 | Ga0068864_100008399 | 3300005618 | Bacteria | 8521 |
| 193 | Ga0068864_100455442 | 3300005618 | Bacteria | 1224 |
| 194 | Ga0068866_10149984 | 3300005718 | Bacteria | 1349 |
| 195 | Ga0068861_100018071 | 3300005719 | Bacteria | 5014 |
| 196 | Ga0068870_10002264 | 3300005840 | Bacteria | 7991 |
| 197 | Ga0068870_10052716 | 3300005840 | Bacteria | 2158 |
| 198 | Ga0068863_100007732 | 3300005841 | Bacteria | 10513 |
| 199 | Ga0068863_100083253 | 3300005841 | Bacteria | 3031 |
| 200 | Ga0068863_100306132 | 3300005841 | Unclassified | 1542 |
| 201 | Ga0068858_100027910 | 3300005842 | Bacteria | 5244 |
| 202 | Ga0068858_100453532 | 3300005842 | Bacteria | 1236 |
| 203 | Ga0068860_100008276 | 3300005843 | Bacteria | 10352 |
| 204 | Ga0068860_100077426 | 3300005843 | Unclassified | 3162 |
| 205 | Ga0068860_100151798 | 3300005843 | Bacteria | 2231 |
| 206 | Ga0068862_100000563 | 3300005844 | Bacteria | 38630 |
| 207 | Ga0068862_100016777 | 3300005844 | Bacteria | 6097 |
| 208 | Ga0068862_100044961 | 3300005844 | Unclassified | 3767 |
| 209 | Ga0068862_100068810 | 3300005844 | Bacteria | 3055 |
| 210 | Ga0081539_10062495 | 3300005985 | Bacteria | 2035 |
| 211 | Ga0070717_10005342 | 3300006028 | Bacteria | 9365 |
| 212 | Ga0070717_10271348 | 3300006028 | Unclassified | 1503 |
| 213 | Ga0097621_100095933 | 3300006237 | Unclassified | 2488 |
| 214 | Ga0068871_100004583 | 3300006358 | Bacteria | 9638 |
| 215 | Ga0068871_100328105 | 3300006358 | Unclassified | 1349 |
| 216 | Ga0075428_100092576 | 3300006844 | Bacteria | 3296 |
| 217 | Ga0075428_100392764 | 3300006844 | Unclassified | 1487 |
| 218 | Ga0075430_100002009 | 3300006846 | Bacteria | 16757 |
| 219 | Ga0075430_100019563 | 3300006846 | Bacteria | 5759 |
| 220 | Ga0075430_100241307 | 3300006846 | Bacteria | 1497 |
| 221 | Ga0075431_100005920 | 3300006847 | Bacteria | 12096 |
| 222 | Ga0075431_100041102 | 3300006847 | Bacteria | 4767 |
| 223 | Ga0075431_100065851 | 3300006847 | Bacteria | 3740 |
| 224 | Ga0075431_100212459 | 3300006847 | Bacteria | 1976 |
| 225 | Ga0075431_100350061 | 3300006847 | Bacteria | 1485 |
| 226 | Ga0075433_10002539 | 3300006852 | Bacteria | 13904 |
| 227 | Ga0075434_100010409 | 3300006871 | Bacteria | 8717 |
| 228 | Ga0075434_100055851 | 3300006871 | Bacteria | 3924 |
| 229 | Ga0075434_100059637 | 3300006871 | Bacteria | 3793 |
| 230 | Ga0075434_100094626 | 3300006871 | Bacteria | 2992 |
| 231 | Ga0075434_100118868 | 3300006871 | Unclassified | 2657 |
| 232 | Ga0075434_100195571 | 3300006871 | Unclassified | 2042 |
| 233 | Ga0075434_100208109 | 3300006871 | Bacteria | 1977 |
| 234 | Ga0075429_100025615 | 3300006880 | Bacteria | 5120 |
| 235 | Ga0075429_100031901 | 3300006880 | Bacteria | 4580 |
| 236 | Ga0075429_100044871 | 3300006880 | Bacteria | 3845 |
| 237 | Ga0075429_100237587 | 3300006880 | Bacteria | 1596 |
| 238 | Ga0068865_100019307 | 3300006881 | Bacteria | 4410 |
| 239 | Ga0068865_100026342 | 3300006881 | Bacteria | 3833 |
| 240 | Ga0075436_100027536 | 3300006914 | Bacteria | 3911 |
| 241 | Ga0075436_100072530 | 3300006914 | Bacteria | 2382 |
| 242 | Ga0097620_100005085 | 3300006931 | Bacteria | 13363 |
| 243 | Ga0097620_100023584 | 3300006931 | Bacteria | 6175 |
| 244 | Ga0097620_100060955 | 3300006931 | Bacteria | 3801 |
| 245 | Ga0075435_100171464 | 3300007076 | Bacteria | 1831 |
| 246 | Ga0105240_10032537 | 3300009093 | Bacteria | 6752 |
| 247 | Ga0105240_10066320 | 3300009093 | Bacteria | 4479 |
| 248 | Ga0105240_10094276 | 3300009093 | Bacteria | 3652 |
| 249 | Ga0105240_10433805 | 3300009093 | Bacteria | 1474 |
| 250 | Ga0111539_10016990 | 3300009094 | Bacteria | 9005 |
| 251 | Ga0111539_10118385 | 3300009094 | Bacteria | 3105 |
| 252 | Ga0111539_10574112 | 3300009094 | Unclassified | 1313 |
| 253 | Ga0105245_10004657 | 3300009098 | Bacteria | 12123 |
| 254 | Ga0105245_10230918 | 3300009098 | Bacteria | 1789 |
| 255 | Ga0114129_10016042 | 3300009147 | Bacteria | 10654 |
| 256 | Ga0114129_10018210 | 3300009147 | Bacteria | 10000 |
| 257 | Ga0114129_10041097 | 3300009147 | Bacteria | 6518 |
| 258 | Ga0114129_10382224 | 3300009147 | Bacteria | 1859 |
| 259 | Ga0105243_10059148 | 3300009148 | Bacteria | 3057 |
| 260 | Ga0105243_10166298 | 3300009148 | Bacteria | 1906 |
| 261 | Ga0105241_10059640 | 3300009174 | Bacteria | 2934 |
| 262 | Ga0105241_10189441 | 3300009174 | Unclassified | 1711 |
| 263 | Ga0105242_10066442 | 3300009176 | Bacteria | 2978 |
| 264 | Ga0105242_10068259 | 3300009176 | Unclassified | 2941 |
| 265 | Ga0105248_10003619 | 3300009177 | Bacteria | 17144 |
| 266 | Ga0105248_10027477 | 3300009177 | Bacteria | 6335 |
| 267 | Ga0105248_10102481 | 3300009177 | Unclassified | 3226 |
| 268 | Ga0105248_10111900 | 3300009177 | Bacteria | 3080 |
| 269 | Ga0105248_10112466 | 3300009177 | Bacteria | 3071 |
| 270 | Ga0105248_10433165 | 3300009177 | Bacteria | 1481 |
| 271 | Ga0105238_10004021 | 3300009551 | Bacteria | 14586 |
| 272 | Ga0105238_10029562 | 3300009551 | Bacteria | 5582 |
| 273 | Ga0105249_10000133 | 3300009553 | Bacteria | 98005 |
| 274 | Ga0105249_10000662 | 3300009553 | Bacteria | 31249 |
| 275 | Ga0105249_10005645 | 3300009553 | Bacteria | 10826 |
| 276 | Ga0099796_10018133 | 3300010159 | Bacteria | 2109 |
| 277 | Ga0105239_10020462 | 3300010375 | Bacteria | 7299 |
| 278 | Ga0105239_10116400 | 3300010375 | Unclassified | 2966 |
| 279 | Ga0105246_10003077 | 3300011119 | Bacteria | 10132 |
| 280 | Ga0157373_10010157 | 3300013100 | Bacteria | 6936 |
| 281 | Ga0157373_10021338 | 3300013100 | Bacteria | 4704 |
| 282 | Ga0157373_10028435 | 3300013100 | Bacteria | 4033 |
| 283 | Ga0157371_10009393 | 3300013102 | Bacteria | 7701 |
| 284 | Ga0157371_10025629 | 3300013102 | Bacteria | 4295 |
| 285 | Ga0157371_10033766 | 3300013102 | Bacteria | 3674 |
| 286 | Ga0157371_10203293 | 3300013102 | Bacteria | 1420 |
| 287 | Ga0157370_10006918 | 3300013104 | Bacteria | 12400 |
| 288 | Ga0157370_10008158 | 3300013104 | Bacteria | 11325 |
| 289 | Ga0157370_10026219 | 3300013104 | Bacteria | 5758 |
| 290 | Ga0157370_10038898 | 3300013104 | Bacteria | 4600 |
| 291 | Ga0157369_10015385 | 3300013105 | Bacteria | 8626 |
| 292 | Ga0157369_10016784 | 3300013105 | Bacteria | 8229 |
| 293 | Ga0157369_10034675 | 3300013105 | Bacteria | 5536 |
| 294 | Ga0157369_10055735 | 3300013105 | Bacteria | 4267 |
| 295 | Ga0157369_10084620 | 3300013105 | Unclassified | 3390 |
| 296 | Ga0157369_10127726 | 3300013105 | Bacteria | 2694 |
| 297 | Ga0157369_10146712 | 3300013105 | Bacteria | 2495 |
| 298 | Ga0157369_10183652 | 3300013105 | Bacteria | 2200 |
| 299 | Ga0157369_10543221 | 3300013105 | Bacteria | 1201 |
| 300 | Ga0157374_10073904 | 3300013296 | Bacteria | 3218 |
| 301 | Ga0157374_10199297 | 3300013296 | Bacteria | 1960 |
| 302 | Ga0157378_10214060 | 3300013297 | Bacteria | 1828 |
| 303 | Ga0157378_10237091 | 3300013297 | Bacteria | 1741 |
| 304 | Ga0163162_10021469 | 3300013306 | Bacteria | 6359 |
| 305 | Ga0163162_10189061 | 3300013306 | Unclassified | 2186 |
| 306 | Ga0163162_10265521 | 3300013306 | Unclassified | 1848 |
| 307 | Ga0157372_10003051 | 3300013307 | Bacteria | 18053 |
| 308 | Ga0157372_10012575 | 3300013307 | Bacteria | 9014 |
| 309 | Ga0157372_10025436 | 3300013307 | Bacteria | 6436 |
| 310 | Ga0157372_10033314 | 3300013307 | Bacteria | 5657 |
| 311 | Ga0157372_10040174 | 3300013307 | Bacteria | 5165 |
| 312 | Ga0157372_10042027 | 3300013307 | Bacteria | 5055 |
| 313 | Ga0157372_10077526 | 3300013307 | Bacteria | 3754 |
| 314 | Ga0157372_10093733 | 3300013307 | Bacteria | 3418 |
| 315 | Ga0157372_10109041 | 3300013307 | Bacteria | 3170 |
| 316 | Ga0157372_10149850 | 3300013307 | Bacteria | 2691 |
| 317 | Ga0157372_10323170 | 3300013307 | Bacteria | 1797 |
| 318 | Ga0157372_10476717 | 3300013307 | Bacteria | 1455 |
| 319 | Ga0157372_10555109 | 3300013307 | Unclassified | 1339 |
| 320 | Ga0157375_10006374 | 3300013308 | Bacteria | 10286 |
| 321 | Ga0157375_10036954 | 3300013308 | Bacteria | 4675 |
| 322 | Ga0157375_10051129 | 3300013308 | Bacteria | 4057 |
| 323 | Ga0157375_10070807 | 3300013308 | Bacteria | 3499 |
| 324 | Ga0157375_10084533 | 3300013308 | Bacteria | 3222 |
| 325 | Ga0157375_10225077 | 3300013308 | Unclassified | 2035 |
| 326 | Ga0157375_10416172 | 3300013308 | Bacteria | 1510 |
| 327 | Ga0163163_10022697 | 3300014325 | Bacteria | 5946 |
| 328 | Ga0157380_10001269 | 3300014326 | Bacteria | 16396 |
| 329 | Ga0157380_10047019 | 3300014326 | Bacteria | 3391 |
| 330 | Ga0157380_10104727 | 3300014326 | Bacteria | 2364 |
| 331 | Ga0182008_10001887 | 3300014497 | Bacteria | 13616 |
| 332 | Ga0157377_10003414 | 3300014745 | Bacteria | 7188 |
| 333 | Ga0157377_10009008 | 3300014745 | Bacteria | 4886 |
| 334 | Ga0157379_10009985 | 3300014968 | Bacteria | 8273 |
| 335 | Ga0157376_10012034 | 3300014969 | Bacteria | 6404 |
| 336 | Ga0157376_10119725 | 3300014969 | Bacteria | 2331 |
| 337 | Ga0157376_10399703 | 3300014969 | Unclassified | 1328 |
| 338 | Ga0163161_10005930 | 3300017792 | Bacteria | 8468 |
| 339 | Ga0206354_10083716 | 3300020081 | Bacteria | 2294 |
| 340 | Ga0213876_10001912 | 3300021384 | Bacteria | 12505 |
| 341 | Ga0213876_10026985 | 3300021384 | Bacteria | 3031 |
| 342 | Ga0207697_10033385 | 3300025315 | Bacteria | 2106 |
| 343 | Ga0207656_10013681 | 3300025321 | Bacteria | 3107 |
| 344 | Ga0207680_10064904 | 3300025903 | Bacteria | 2240 |
| 345 | Ga0207699_10009835 | 3300025906 | Bacteria | 4779 |
| 346 | Ga0207699_10047210 | 3300025906 | Bacteria | 2524 |
| 347 | Ga0207645_10005607 | 3300025907 | Bacteria | 9077 |
| 348 | Ga0207645_10006068 | 3300025907 | Bacteria | 8689 |
| 349 | Ga0207643_10041895 | 3300025908 | Bacteria | 2581 |
| 350 | Ga0207705_10015020 | 3300025909 | Bacteria | 5567 |
| 351 | Ga0207705_10069417 | 3300025909 | Bacteria | 2552 |
| 352 | Ga0207705_10093179 | 3300025909 | Bacteria | 2208 |
| 353 | Ga0207705_10167514 | 3300025909 | Bacteria | 1653 |
| 354 | Ga0207684_10101209 | 3300025910 | Bacteria | 2463 |
| 355 | Ga0207654_10048996 | 3300025911 | Bacteria | 2420 |
| 356 | Ga0207707_10001516 | 3300025912 | Bacteria | 21421 |
| 357 | Ga0207707_10003111 | 3300025912 | Bacteria | 14731 |
| 358 | Ga0207707_10003275 | 3300025912 | Bacteria | 14385 |
| 359 | Ga0207707_10004812 | 3300025912 | Bacteria | 11842 |
| 360 | Ga0207707_10032034 | 3300025912 | Bacteria | 4602 |
| 361 | Ga0207707_10159479 | 3300025912 | Unclassified | 1972 |
| 362 | Ga0207707_10183193 | 3300025912 | Bacteria | 1828 |
| 363 | Ga0207695_10008489 | 3300025913 | Bacteria | 12844 |
| 364 | Ga0207695_10036015 | 3300025913 | Bacteria | 5355 |
| 365 | Ga0207695_10054884 | 3300025913 | Bacteria | 4157 |
| 366 | Ga0207693_10004234 | 3300025915 | Bacteria | 12168 |
| 367 | Ga0207693_10010340 | 3300025915 | Bacteria | 7575 |
| 368 | Ga0207693_10318559 | 3300025915 | Bacteria | 1217 |
| 369 | Ga0207663_10039106 | 3300025916 | Bacteria | 2872 |
| 370 | Ga0207663_10131359 | 3300025916 | Bacteria | 1731 |
| 371 | Ga0207660_10000015 | 3300025917 | Bacteria | 79088 |
| 372 | Ga0207660_10003814 | 3300025917 | Bacteria | 9820 |
| 373 | Ga0207660_10007775 | 3300025917 | Bacteria | 6940 |
| 374 | Ga0207660_10028138 | 3300025917 | Bacteria | 3843 |
| 375 | Ga0207660_10045397 | 3300025917 | Bacteria | 3095 |
| 376 | Ga0207660_10090639 | 3300025917 | Bacteria | 2266 |
| 377 | Ga0207660_10104415 | 3300025917 | Bacteria | 2122 |
| 378 | Ga0207662_10001456 | 3300025918 | Bacteria | 11485 |
| 379 | Ga0207657_10003620 | 3300025919 | Bacteria | 16467 |
| 380 | Ga0207657_10019361 | 3300025919 | Bacteria | 6466 |
| 381 | Ga0207657_10120649 | 3300025919 | Bacteria | 2157 |
| 382 | Ga0207657_10162028 | 3300025919 | Bacteria | 1816 |
| 383 | Ga0207657_10206843 | 3300025919 | Bacteria | 1576 |
| 384 | Ga0207649_10001109 | 3300025920 | Bacteria | 16344 |
| 385 | Ga0207649_10004268 | 3300025920 | Bacteria | 7780 |
| 386 | Ga0207649_10020418 | 3300025920 | Bacteria | 3799 |
| 387 | Ga0207652_10002383 | 3300025921 | Bacteria | 15874 |
| 388 | Ga0207652_10019280 | 3300025921 | Bacteria | 5608 |
| 389 | Ga0207652_10034855 | 3300025921 | Bacteria | 4244 |
| 390 | Ga0207652_10036295 | 3300025921 | Bacteria | 4167 |
| 391 | Ga0207652_10040876 | 3300025921 | Bacteria | 3939 |
| 392 | Ga0207652_10050915 | 3300025921 | Unclassified | 3549 |
| 393 | Ga0207652_10055427 | 3300025921 | Bacteria | 3409 |
| 394 | Ga0207652_10065106 | 3300025921 | Bacteria | 3155 |
| 395 | Ga0207652_10128860 | 3300025921 | Bacteria | 2255 |
| 396 | Ga0207646_10173081 | 3300025922 | Unclassified | 1950 |
| 397 | Ga0207681_10008681 | 3300025923 | Bacteria | 6204 |
| 398 | Ga0207681_10069098 | 3300025923 | Unclassified | 2456 |
| 399 | Ga0207681_10187552 | 3300025923 | Bacteria | 1580 |
| 400 | Ga0207694_10000020 | 3300025924 | Bacteria | 310240 |
| 401 | Ga0207694_10020485 | 3300025924 | Bacteria | 5003 |
| 402 | Ga0207694_10121204 | 3300025924 | Bacteria | 2088 |
| 403 | Ga0207694_10286233 | 3300025924 | Bacteria | 1355 |
| 404 | Ga0207650_10005451 | 3300025925 | Bacteria | 8686 |
| 405 | Ga0207650_10018343 | 3300025925 | Bacteria | 4910 |
| 406 | Ga0207650_10038997 | 3300025925 | Bacteria | 3472 |
| 407 | Ga0207650_10262835 | 3300025925 | Bacteria | 1400 |
| 408 | Ga0207659_10019929 | 3300025926 | Bacteria | 4424 |
| 409 | Ga0207659_10020893 | 3300025926 | Bacteria | 4336 |
| 410 | Ga0207659_10053962 | 3300025926 | Bacteria | 2869 |
| 411 | Ga0207687_10002121 | 3300025927 | Bacteria | 13548 |
| 412 | Ga0207687_10019639 | 3300025927 | Bacteria | 4478 |
| 413 | Ga0207700_10000601 | 3300025928 | Bacteria | 21049 |
| 414 | Ga0207700_10011250 | 3300025928 | Bacteria | 5697 |
| 415 | Ga0207700_10314522 | 3300025928 | Bacteria | 1355 |
| 416 | Ga0207664_10041483 | 3300025929 | Bacteria | 3585 |
| 417 | Ga0207664_10055110 | 3300025929 | Bacteria | 3154 |
| 418 | Ga0207664_10060871 | 3300025929 | Bacteria | 3010 |
| 419 | Ga0207664_10080967 | 3300025929 | Bacteria | 2641 |
| 420 | Ga0207664_10150218 | 3300025929 | Bacteria | 1978 |
| 421 | Ga0207644_10037448 | 3300025931 | Bacteria | 3413 |
| 422 | Ga0207690_10009752 | 3300025932 | Bacteria | 5705 |
| 423 | Ga0207690_10009969 | 3300025932 | Bacteria | 5642 |
| 424 | Ga0207706_10000155 | 3300025933 | Bacteria | 75598 |
| 425 | Ga0207706_10021799 | 3300025933 | Bacteria | 5751 |
| 426 | Ga0207706_10082578 | 3300025933 | Bacteria | 2824 |
| 427 | Ga0207686_10051080 | 3300025934 | Bacteria | 2574 |
| 428 | Ga0207670_10094161 | 3300025936 | Bacteria | 2124 |
| 429 | Ga0207670_10237253 | 3300025936 | Bacteria | 1403 |
| 430 | Ga0207669_10081984 | 3300025937 | Unclassified | 2069 |
| 431 | Ga0207669_10148534 | 3300025937 | Bacteria | 1638 |
| 432 | Ga0207704_10015704 | 3300025938 | Bacteria | 3868 |
| 433 | Ga0207704_10039945 | 3300025938 | Bacteria | 2738 |
| 434 | Ga0207704_10242019 | 3300025938 | Bacteria | 1349 |
| 435 | Ga0207691_10001667 | 3300025940 | Bacteria | 21972 |
| 436 | Ga0207691_10002873 | 3300025940 | Bacteria | 16783 |
| 437 | Ga0207691_10051864 | 3300025940 | Bacteria | 3748 |
| 438 | Ga0207691_10076454 | 3300025940 | Bacteria | 3017 |
| 439 | Ga0207691_10083064 | 3300025940 | Bacteria | 2876 |
| 440 | Ga0207691_10153754 | 3300025940 | Unclassified | 2022 |
| 441 | Ga0207711_10062541 | 3300025941 | Bacteria | 3210 |
| 442 | Ga0207711_10122026 | 3300025941 | Unclassified | 2327 |
| 443 | Ga0207689_10002528 | 3300025942 | Bacteria | 16994 |
| 444 | Ga0207689_10026578 | 3300025942 | Bacteria | 4849 |
| 445 | Ga0207689_10052931 | 3300025942 | Unclassified | 3344 |
| 446 | Ga0207661_10001218 | 3300025944 | Bacteria | 17203 |
| 447 | Ga0207661_10001484 | 3300025944 | Bacteria | 15869 |
| 448 | Ga0207661_10004649 | 3300025944 | Bacteria | 9615 |
| 449 | Ga0207661_10029599 | 3300025944 | Bacteria | 4208 |
| 450 | Ga0207661_10030228 | 3300025944 | Bacteria | 4170 |
| 451 | Ga0207661_10036321 | 3300025944 | Bacteria | 3845 |
| 452 | Ga0207661_10036765 | 3300025944 | Bacteria | 3825 |
| 453 | Ga0207661_10056093 | 3300025944 | Bacteria | 3162 |
| 454 | Ga0207661_10056723 | 3300025944 | Bacteria | 3145 |
| 455 | Ga0207661_10092237 | 3300025944 | Bacteria | 2525 |
| 456 | Ga0207661_10198756 | 3300025944 | Unclassified | 1761 |
| 457 | Ga0207661_10239702 | 3300025944 | Bacteria | 1609 |
| 458 | Ga0207679_10001557 | 3300025945 | Bacteria | 14345 |
| 459 | Ga0207679_10002457 | 3300025945 | Bacteria | 11407 |
| 460 | Ga0207679_10004253 | 3300025945 | Bacteria | 8897 |
| 461 | Ga0207679_10005859 | 3300025945 | Bacteria | 7717 |
| 462 | Ga0207679_10010095 | 3300025945 | Bacteria | 6070 |
| 463 | Ga0207679_10032647 | 3300025945 | Bacteria | 3658 |
| 464 | Ga0207679_10342587 | 3300025945 | Bacteria | 1300 |
| 465 | Ga0207667_10031049 | 3300025949 | Bacteria | 5771 |
| 466 | Ga0207667_10035036 | 3300025949 | Bacteria | 5387 |
| 467 | Ga0207667_10040067 | 3300025949 | Bacteria | 4988 |
| 468 | Ga0207667_10049996 | 3300025949 | Bacteria | 4412 |
| 469 | Ga0207667_10082511 | 3300025949 | Unclassified | 3330 |
| 470 | Ga0207667_10085208 | 3300025949 | Bacteria | 3271 |
| 471 | Ga0207667_10176364 | 3300025949 | Bacteria | 2196 |
| 472 | Ga0207651_10036591 | 3300025960 | Unclassified | 3206 |
| 473 | Ga0207651_10047786 | 3300025960 | Unclassified | 2888 |
| 474 | Ga0207651_10298038 | 3300025960 | Bacteria | 1340 |
| 475 | Ga0207712_10000098 | 3300025961 | Bacteria | 99232 |
| 476 | Ga0207712_10006052 | 3300025961 | Bacteria | 7630 |
| 477 | Ga0207712_10006933 | 3300025961 | Bacteria | 7148 |
| 478 | Ga0207712_10054232 | 3300025961 | Bacteria | 2815 |
| 479 | Ga0207668_10004444 | 3300025972 | Bacteria | 8236 |
| 480 | Ga0207668_10022463 | 3300025972 | Bacteria | 4040 |
| 481 | Ga0207668_10115466 | 3300025972 | Unclassified | 2022 |
| 482 | Ga0207668_10308656 | 3300025972 | Bacteria | 1308 |
| 483 | Ga0207658_10034360 | 3300025986 | Bacteria | 3624 |
| 484 | Ga0207703_10111400 | 3300026035 | Bacteria | 2336 |
| 485 | Ga0207639_10014233 | 3300026041 | Bacteria | 5587 |
| 486 | Ga0207639_10017698 | 3300026041 | Bacteria | 5053 |
| 487 | Ga0207639_10051221 | 3300026041 | Unclassified | 3140 |
| 488 | Ga0207639_10087937 | 3300026041 | Bacteria | 2478 |
| 489 | Ga0207639_10152823 | 3300026041 | Bacteria | 1935 |
| 490 | Ga0207639_10197106 | 3300026041 | Bacteria | 1724 |
| 491 | Ga0207678_10065631 | 3300026067 | Bacteria | 3116 |
| 492 | Ga0207678_10067512 | 3300026067 | Unclassified | 3069 |
| 493 | Ga0207708_10049485 | 3300026075 | Bacteria | 3200 |
| 494 | Ga0207708_10054665 | 3300026075 | Bacteria | 3044 |
| 495 | Ga0207708_10135588 | 3300026075 | Bacteria | 1928 |
| 496 | Ga0207708_10215516 | 3300026075 | Unclassified | 1536 |
| 497 | Ga0207702_10004386 | 3300026078 | Bacteria | 12569 |
| 498 | Ga0207702_10123904 | 3300026078 | Bacteria | 2317 |
| 499 | Ga0207702_10246561 | 3300026078 | Unclassified | 1676 |
| 500 | Ga0207641_10006591 | 3300026088 | Bacteria | 9756 |
| 501 | Ga0207641_10116238 | 3300026088 | Unclassified | 2380 |
| 502 | Ga0207641_10122881 | 3300026088 | Bacteria | 2320 |
| 503 | Ga0207641_10169066 | 3300026088 | Unclassified | 1994 |
| 504 | Ga0207648_10016415 | 3300026089 | Bacteria | 6765 |
| 505 | Ga0207648_10022484 | 3300026089 | Bacteria | 5660 |
| 506 | Ga0207648_10122403 | 3300026089 | Bacteria | 2288 |
| 507 | Ga0207648_10334173 | 3300026089 | Bacteria | 1363 |
| 508 | Ga0207676_10002872 | 3300026095 | Bacteria | 12275 |
| 509 | Ga0207676_10141081 | 3300026095 | Bacteria | 2063 |
| 510 | Ga0207676_10320237 | 3300026095 | Bacteria | 1423 |
| 511 | Ga0207676_10423341 | 3300026095 | Bacteria | 1249 |
| 512 | Ga0207674_10000809 | 3300026116 | Bacteria | 40695 |
| 513 | Ga0207674_10001550 | 3300026116 | Bacteria | 29596 |
| 514 | Ga0207674_10001551 | 3300026116 | Bacteria | 29595 |
| 515 | Ga0207674_10015403 | 3300026116 | Bacteria | 8400 |
| 516 | Ga0207674_10017983 | 3300026116 | Bacteria | 7700 |
| 517 | Ga0207674_10026402 | 3300026116 | Bacteria | 6169 |
| 518 | Ga0207674_10109385 | 3300026116 | Bacteria | 2740 |
| 519 | Ga0207675_100001026 | 3300026118 | Bacteria | 27652 |
| 520 | Ga0207675_100163441 | 3300026118 | Unclassified | 2125 |
| 521 | Ga0207675_100174751 | 3300026118 | Viruses | 2055 |
| 522 | Ga0207675_100242322 | 3300026118 | Bacteria | 1743 |
| 523 | Ga0207683_10039859 | 3300026121 | Bacteria | 4098 |
| 524 | Ga0207683_10116397 | 3300026121 | Bacteria | 2396 |
| 525 | Ga0207683_10188451 | 3300026121 | Unclassified | 1872 |
| 526 | Ga0207698_10004902 | 3300026142 | Bacteria | 8208 |
| 527 | Ga0207698_10018642 | 3300026142 | Bacteria | 4736 |
| 528 | Ga0207698_10033827 | 3300026142 | Bacteria | 3719 |
| 529 | Ga0207698_10039732 | 3300026142 | Bacteria | 3488 |
| 530 | Ga0207698_10068467 | 3300026142 | Unclassified | 2803 |
| 531 | Ga0207698_10651159 | 3300026142 | Bacteria | 1044 |
| 532 | Ga0209966_1006371 | 3300027695 | Bacteria | 2046 |
| 533 | Ga0209998_10000274 | 3300027717 | Bacteria | 16290 |
| 534 | Ga0209974_10024251 | 3300027876 | Bacteria | 2007 |
| 535 | Ga0207428_10096596 | 3300027907 | Unclassified | 2288 |
| 536 | Ga0207428_10190486 | 3300027907 | Bacteria | 1546 |
| 537 | Ga0207428_10235367 | 3300027907 | Bacteria | 1369 |
| 538 | Ga0268266_10040493 | 3300028379 | Bacteria | 3971 |
| 539 | Ga0268266_10231605 | 3300028379 | Bacteria | 1702 |
| 540 | Ga0268265_10003561 | 3300028380 | Bacteria | 11130 |
| 541 | Ga0268265_10025393 | 3300028380 | Bacteria | 4204 |
| 542 | Ga0268265_10167716 | 3300028380 | Unclassified | 1873 |
| 543 | Ga0268264_10062479 | 3300028381 | Unclassified | 3127 |
| 544 | Ga0268264_10487534 | 3300028381 | Bacteria | 1200 |
| 545 | Ga0265337_1004238 | 3300028556 | Bacteria | 5997 |
| 546 | Ga0265337_1015539 | 3300028556 | Bacteria | 2489 |
| 547 | Ga0265337_1029943 | 3300028556 | Bacteria | 1625 |
| 548 | Ga0265326_10003616 | 3300028558 | Bacteria | 5052 |
| 549 | Ga0265319_1000161 | 3300028563 | Bacteria | 50866 |
| 550 | Ga0265334_10000919 | 3300028573 | Bacteria | 14702 |
| 551 | Ga0265334_10007271 | 3300028573 | Bacteria | 4750 |
| 552 | Ga0265318_10002008 | 3300028577 | Bacteria | 11278 |
| 553 | Ga0265322_10039859 | 3300028654 | Bacteria | 1337 |
| 554 | Ga0265336_10039431 | 3300028666 | Bacteria | 1448 |
| 555 | Ga0265338_10007668 | 3300028800 | Bacteria | 13304 |
| 556 | Ga0265338_10050207 | 3300028800 | Bacteria | 3773 |
| 557 | Ga0265338_10055085 | 3300028800 | Bacteria | 3540 |
| 558 | Ga0265330_10000006 | 3300031235 | Bacteria | 215296 |
| 559 | Ga0265332_10000057 | 3300031238 | Bacteria | 102893 |
| 560 | Ga0265332_10008139 | 3300031238 | Bacteria | 4715 |
| 561 | Ga0265325_10018846 | 3300031241 | Bacteria | 3824 |
| 562 | Ga0265329_10005906 | 3300031242 | Bacteria | 4907 |
| 563 | Ga0265340_10024591 | 3300031247 | Unclassified | 3058 |
| 564 | Ga0265331_10007368 | 3300031250 | Bacteria | 6374 |
| 565 | Ga0265316_10000023 | 3300031344 | Bacteria | 172893 |
| 566 | Ga0307408_100007627 | 3300031548 | Bacteria | 7156 |
| 567 | Ga0307408_100095341 | 3300031548 | Bacteria | 2255 |
| 568 | Ga0316575_10021565 | 3300031665 | Bacteria | 2480 |
| 569 | Ga0316579_10001523 | 3300031691 | Bacteria | 8436 |
| 570 | Ga0265314_10000019 | 3300031711 | Bacteria | 326248 |
| 571 | Ga0265342_10000010 | 3300031712 | Bacteria | 210877 |
| 572 | Ga0265342_10020882 | 3300031712 | Bacteria | 4190 |
| 573 | Ga0316576_10004250 | 3300031727 | Bacteria | 8558 |
| 574 | Ga0316576_10029267 | 3300031727 | Bacteria | 3892 |
| 575 | Ga0316578_10004047 | 3300031728 | Bacteria | 6850 |
| 576 | Ga0316578_10135330 | 3300031728 | Bacteria | 1483 |
| 577 | Ga0307405_10030236 | 3300031731 | Bacteria | 3174 |
| 578 | Ga0307405_10082186 | 3300031731 | Bacteria | 2108 |
| 579 | Ga0307405_10137179 | 3300031731 | Bacteria | 1700 |
| 580 | Ga0307405_10222094 | 3300031731 | Bacteria | 1387 |
| 581 | Ga0316577_10001255 | 3300031733 | Bacteria | 11834 |
| 582 | Ga0307413_10068731 | 3300031824 | Bacteria | 2220 |
| 583 | Ga0307413_10071638 | 3300031824 | Bacteria | 2185 |
| 584 | Ga0307413_10112627 | 3300031824 | Bacteria | 1824 |
| 585 | Ga0307410_10040121 | 3300031852 | Bacteria | 3079 |
| 586 | Ga0307410_10051378 | 3300031852 | Bacteria | 2778 |
| 587 | Ga0307410_10053205 | 3300031852 | Bacteria | 2739 |
| 588 | Ga0307406_10001667 | 3300031901 | Bacteria | 12207 |
| 589 | Ga0307406_10019878 | 3300031901 | Bacteria | 3946 |
| 590 | Ga0307406_10132277 | 3300031901 | Unclassified | 1753 |
| 591 | Ga0307406_10230829 | 3300031901 | Bacteria | 1382 |
| 592 | Ga0307407_10040280 | 3300031903 | Bacteria | 2604 |
| 593 | Ga0307407_10060474 | 3300031903 | Unclassified | 2211 |
| 594 | Ga0307412_10005921 | 3300031911 | Bacteria | 6892 |
| 595 | Ga0307412_10006175 | 3300031911 | Bacteria | 6753 |
| 596 | Ga0307412_10262565 | 3300031911 | Bacteria | 1347 |
| 597 | Ga0307409_100017363 | 3300031995 | Bacteria | 4793 |
| 598 | Ga0307409_100074067 | 3300031995 | Unclassified | 2719 |
| 599 | Ga0307409_100086010 | 3300031995 | Bacteria | 2558 |
| 600 | Ga0307416_100033976 | 3300032002 | Bacteria | 3874 |
| 601 | Ga0307416_100055905 | 3300032002 | Bacteria | 3181 |
| 602 | Ga0307416_100082932 | 3300032002 | Bacteria | 2718 |
| 603 | Ga0307416_100123655 | 3300032002 | Bacteria | 2313 |
| 604 | Ga0307416_100225804 | 3300032002 | Bacteria | 1801 |
| 605 | Ga0307416_100640336 | 3300032002 | Unclassified | 1147 |
| 606 | Ga0307414_10137754 | 3300032004 | Bacteria | 1906 |
| 607 | Ga0307411_10060531 | 3300032005 | Unclassified | 2515 |
| 608 | Ga0307411_10115990 | 3300032005 | Bacteria | 1927 |
| 609 | Ga0307415_100042972 | 3300032126 | Unclassified | 3012 |
| 610 | Ga0307415_100161989 | 3300032126 | Unclassified | 1735 |
| 611 | Ga0307415_100241510 | 3300032126 | Bacteria | 1461 |
| 612 | Ga0316583_10000021 | 3300032133 | Bacteria | 29938 |
| 613 | Ga0316580_10005912 | 3300032139 | Bacteria | 3591 |
| 614 | Ga0373926_0000731 | 3300035083 | Bacteria | 9111 |
| 615 | Ga0373934_0002803 | 3300035086 | Bacteria | 6387 |
| 616 | Ga0373934_0035797 | 3300035086 | Unclassified | 1954 |
| 617 | Ga0373939_0056675 | 3300035114 | Bacteria | 1234 |
| 618 | Ga0373953_0004240 | 3300035117 | Unclassified | 4552 |
| 619 | Ga0373956_0008121 | 3300035119 | Bacteria | 4247 |
| 620 | Ga0373957_0021116 | 3300035120 | Bacteria | 2308 |
| 621 | Ga0373943_0024931 | 3300035170 | Bacteria | 2792 |
| 622 | Ga0373943_0052615 | 3300035170 | Bacteria | 2008 |
| 623 | Ga0373955_0024317 | 3300035172 | Bacteria | 3097 |
| 624 | Ga0373955_0042205 | 3300035172 | Bacteria | 2448 |
| 625 | Ga0373955_0065489 | 3300035172 | Bacteria | 2017 |
| 626 | Ga0373955_0181796 | 3300035172 | Bacteria | 1248 |
| 627 | Ga0373955_0217716 | 3300035172 | Bacteria | 1140 |
| 628 | Ga0316574_0062057 | 3300035398 | Bacteria | 2348 |
| 629 | Ga0316574_0102126 | 3300035398 | Bacteria | 1836 |
| 630 | Ga0316574_0105154 | 3300035398 | Bacteria | 1808 |
| 631 | Ga0316574_0152560 | 3300035398 | Bacteria | 1488 |
| 632 | Ga0373931_0002236 | 3300035691 | Bacteria | 8557 |
| 633 | Ga0373935_0138346 | 3300035692 | Unclassified | 1643 |
| 634 | Ga0373927_0163695 | 3300035695 | Unclassified | 1458 |
| 635 | Ga0373933_0008609 | 3300035724 | Bacteria | 5565 |
| 636 | Ga0373947_0002620 | 3300035725 | Bacteria | 10799 |
| 637 | Ga0373947_0046564 | 3300035725 | Bacteria | 2597 |
| 638 | Ga0373937_0008385 | 3300036401 | Bacteria | 8979 |
| 639 | Ga0373937_0008633 | 3300036401 | Bacteria | 8852 |
| 640 | Ga0373937_0047280 | 3300036401 | Bacteria | 3937 |
| 641 | Ga0373937_0136061 | 3300036401 | Bacteria | 2297 |
| 642 | Ga0373937_0140843 | 3300036401 | Bacteria | 2256 |
| 643 | Ga0373937_0195111 | 3300036401 | Bacteria | 1903 |
| 644 | Ga0316582_0004354 | 3300036647 | Bacteria | 7133 |
| 645 | Ga0316582_0015735 | 3300036647 | Bacteria | 4336 |
| 646 | Ga0316584_0000036 | 3300036712 | Bacteria | 48276 |
| 647 | Ga0316584_0011426 | 3300036712 | Bacteria | 6238 |
| 648 | Ga0316584_0103924 | 3300036712 | Bacteria | 2126 |
| 649 | Ga0373925_0002987 | 3300037068 | Bacteria | 13332 |
| 650 | Ga0373925_0065811 | 3300037068 | Bacteria | 2731 |
| 651 | Ga0395899_0054189 | 3300037312 | Bacteria | 2968 |
| 652 | Ga0395900_0019850 | 3300037418 | Bacteria | 6851 |
| 653 | Ga0395905_0004652 | 3300037471 | Bacteria | 14191 |
| 654 | Ga0395905_0208661 | 3300037471 | Bacteria | 1831 |
| 655 | Ga0316581_0016270 | 3300037588 | Unclassified | 2134 |
| 656 | Ga0395901_0005373 | 3300038443 | Bacteria | 12953 |
| 657 | Ga0400486_30464 | 3300038742 | Unclassified | 1112 |
| 658 | Ga0400489_04212 | 3300039093 | Unclassified | 1590 |
| 659 | Ga0436365_0164142 | 3300039437 | Bacteria | 22278 |
| 660 | Ga0436365_0320936 | 3300039437 | Bacteria | 1236 |
| 661 | Ga0436365_0521568 | 3300039437 | Unclassified | 3623 |
| 662 | Ga0436365_0812650 | 3300039437 | Bacteria | 3046 |
| 663 | Ga0451787_068143 | 3300041441 | Unclassified | 1037 |
| 664 | Ga0451800_1055042 | 3300041459 | Bacteria | 1956 |
| 665 | Ga0439433_0024824 | 3300041999 | Unclassified | 1352 |
| 666 | Ga0439462_0042386 | 3300042015 | Bacteria | 1216 |
| 667 | Ga0439446_0029089 | 3300042156 | Bacteria | 1594 |
| 668 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 669 | Ga0451577_0003144 | 3300042876 | Bacteria | 18597 |
| 670 | Ga0451577_0012030 | 3300042876 | Bacteria | 8144 |
| 671 | Ga0451577_0092077 | 3300042876 | Bacteria | 2707 |
| 672 | Ga0451577_0228310 | 3300042876 | Bacteria | 1683 |
| 673 | Ga0466966_0011886 | 3300044684 | Bacteria | 5767 |
| 674 | Ga0466963_0142898 | 3300044694 | Bacteria | 1659 |
| 675 | Ga0453684_0000132 | 3300044712 | Bacteria | 331157 |
| 676 | Ga0453684_0001936 | 3300044712 | Bacteria | 53406 |
| 677 | Ga0453684_0028229 | 3300044712 | Bacteria | 8018 |
| 678 | Ga0453684_0068150 | 3300044712 | Bacteria | 4519 |
| 679 | Ga0453684_0074978 | 3300044712 | Bacteria | 4255 |
| 680 | Ga0466959_0055220 | 3300045049 | Unclassified | 2900 |
| 681 | Ga0451576_0008152 | 3300045051 | Bacteria | 12334 |
| 682 | Ga0451576_0019886 | 3300045051 | Bacteria | 7323 |
| 683 | Ga0451576_0020415 | 3300045051 | Bacteria | 7216 |
| 684 | Ga0451576_0055803 | 3300045051 | Bacteria | 4132 |
| 685 | Ga0451576_0279479 | 3300045051 | Bacteria | 1746 |
| 686 | Ga0466958_0138440 | 3300045836 | Bacteria | 1532 |
| 687 | Ga0466967_0138127 | 3300045976 | Bacteria | 2268 |
| 688 | Ga0495592_0024160 | 3300046454 | Bacteria | 4620 |
| 689 | Ga0495603_0002982 | 3300046455 | Bacteria | 10011 |
| 690 | Ga0495603_0027422 | 3300046455 | Bacteria | 3438 |
| 691 | Ga0495629_0066215 | 3300046459 | Bacteria | 2521 |
| 692 | Ga0495629_0095829 | 3300046459 | Bacteria | 2070 |
| 693 | Ga0495629_0125581 | 3300046459 | Bacteria | 1787 |
| 694 | Ga0495651_0012210 | 3300046462 | Bacteria | 6615 |
| 695 | Ga0495651_0043458 | 3300046462 | Bacteria | 3487 |
| 696 | Ga0495651_0113749 | 3300046462 | Bacteria | 1997 |
| 697 | Ga0495653_0019406 | 3300046463 | Bacteria | 5513 |
| 698 | Ga0495580_0005679 | 3300046472 | Bacteria | 10261 |
| 699 | Ga0495580_0028551 | 3300046472 | Bacteria | 4055 |
| 700 | Ga0495582_0005504 | 3300046473 | Bacteria | 7053 |
| 701 | Ga0495582_0009433 | 3300046473 | Bacteria | 5375 |
| 702 | Ga0495582_0021050 | 3300046473 | Bacteria | 3571 |
| 703 | Ga0495582_0023600 | 3300046473 | Bacteria | 3365 |
| 704 | Ga0495639_0000704 | 3300046475 | Bacteria | 15302 |
| 705 | Ga0495639_0022193 | 3300046475 | Unclassified | 2783 |
| 706 | Ga0495664_0018129 | 3300046477 | Bacteria | 4027 |
| 707 | Ga0495664_0071612 | 3300046477 | Unclassified | 2070 |
| 708 | Ga0495594_0004139 | 3300046499 | Bacteria | 7452 |
| 709 | Ga0495594_0007835 | 3300046499 | Bacteria | 5492 |
| 710 | Ga0495594_0008344 | 3300046499 | Bacteria | 5336 |
| 711 | Ga0495594_0034729 | 3300046499 | Bacteria | 2744 |
| 712 | Ga0495608_0013916 | 3300046511 | Bacteria | 5583 |
| 713 | Ga0495608_0029791 | 3300046511 | Unclassified | 3699 |
| 714 | Ga0495608_0042808 | 3300046511 | Bacteria | 3027 |
| 715 | Ga0495608_0093653 | 3300046511 | Bacteria | 1941 |
| 716 | Ga0495618_0002382 | 3300046514 | Bacteria | 12097 |
| 717 | Ga0495618_0019341 | 3300046514 | Bacteria | 4189 |
| 718 | Ga0495628_0005937 | 3300046516 | Bacteria | 10685 |
| 719 | Ga0495628_0070342 | 3300046516 | Bacteria | 2728 |
| 720 | Ga0495628_0072022 | 3300046516 | Bacteria | 2693 |
| 721 | Ga0495628_0097241 | 3300046516 | Bacteria | 2274 |
| 722 | Ga0495630_0014259 | 3300046517 | Bacteria | 5787 |
| 723 | Ga0495630_0059822 | 3300046517 | Bacteria | 2859 |
| 724 | Ga0495630_0065124 | 3300046517 | Bacteria | 2738 |
| 725 | Ga0495643_0000249 | 3300046522 | Bacteria | 79178 |
| 726 | Ga0495666_0021697 | 3300046526 | Bacteria | 3178 |
| 727 | Ga0495652_0053520 | 3300046529 | Bacteria | 3440 |
| 728 | Ga0495652_0058304 | 3300046529 | Bacteria | 3269 |
| 729 | Ga0495665_0001067 | 3300046531 | Bacteria | 14571 |
| 730 | Ga0495665_0009112 | 3300046531 | Bacteria | 5379 |
| 731 | Ga0495665_0011106 | 3300046531 | Bacteria | 4875 |
| 732 | Ga0495665_0142276 | 3300046531 | Bacteria | 1253 |
| 733 | Ga0495640_0017040 | 3300046533 | Bacteria | 5422 |
| 734 | Ga0495586_0002088 | 3300046535 | Bacteria | 10856 |
| 735 | Ga0495586_0007235 | 3300046535 | Bacteria | 5922 |
| 736 | Ga0495586_0013582 | 3300046535 | Bacteria | 4320 |
| 737 | Ga0495586_0099118 | 3300046535 | Bacteria | 1616 |
| 738 | Ga0495586_0150624 | 3300046535 | Unclassified | 1308 |
| 739 | Ga0495586_0175489 | 3300046535 | Unclassified | 1211 |
| 740 | Ga0495586_0198377 | 3300046535 | Bacteria | 1137 |
| 741 | Ga0495587_0000778 | 3300046536 | Bacteria | 21285 |
| 742 | Ga0495587_0007410 | 3300046536 | Bacteria | 7106 |
| 743 | Ga0495587_0010356 | 3300046536 | Bacteria | 5939 |
| 744 | Ga0495645_0000693 | 3300046543 | Bacteria | 23140 |
| 745 | Ga0495645_0015144 | 3300046543 | Bacteria | 5482 |
| 746 | Ga0495645_0040476 | 3300046543 | Bacteria | 3399 |
| 747 | Ga0495645_0055755 | 3300046543 | Bacteria | 2870 |
| 748 | Ga0495645_0067933 | 3300046543 | Bacteria | 2574 |
| 749 | Ga0495645_0122432 | 3300046543 | Bacteria | 1830 |
| 750 | Ga0495645_0312270 | 3300046543 | Bacteria | 1023 |
| 751 | Ga0495667_0006744 | 3300046559 | Bacteria | 7791 |
| 752 | Ga0495667_0069316 | 3300046559 | Bacteria | 2301 |
| 753 | Ga0495635_0004505 | 3300046663 | Bacteria | 9651 |
| 754 | Ga0495635_0011934 | 3300046663 | Bacteria | 6086 |
| 755 | Ga0495659_0000687 | 3300046664 | Bacteria | 12225 |
| 756 | Ga0495588_0001415 | 3300046674 | Bacteria | 10249 |
| 757 | Ga0495588_0098669 | 3300046674 | Bacteria | 1534 |
| 758 | Ga0495657_0015202 | 3300046675 | Bacteria | 5636 |
| 759 | Ga0495657_0129942 | 3300046675 | Bacteria | 1578 |
| 760 | Ga0495599_0004117 | 3300046678 | Bacteria | 8585 |
| 761 | Ga0495599_0007818 | 3300046678 | Bacteria | 6489 |
| 762 | Ga0495599_0010839 | 3300046678 | Bacteria | 5585 |
| 763 | Ga0495599_0013143 | 3300046678 | Bacteria | 5116 |
| 764 | Ga0495599_0032011 | 3300046678 | Bacteria | 3301 |
| 765 | Ga0495599_0105902 | 3300046678 | Bacteria | 1752 |
| 766 | Ga0495623_0002993 | 3300046679 | Bacteria | 11115 |
| 767 | Ga0495623_0013570 | 3300046679 | Bacteria | 5280 |
| 768 | Ga0495623_0069957 | 3300046679 | Bacteria | 2186 |
| 769 | Ga0495623_0085078 | 3300046679 | Bacteria | 1951 |
| 770 | Ga0495646_0035286 | 3300046680 | Bacteria | 3103 |
| 771 | Ga0495646_0051771 | 3300046680 | Unclassified | 2483 |
| 772 | Ga0495647_0018682 | 3300046681 | Bacteria | 2472 |
| 773 | Ga0495658_0001668 | 3300046683 | Bacteria | 11553 |
| 774 | Ga0495658_0003108 | 3300046683 | Bacteria | 8284 |
| 775 | Ga0495658_0043441 | 3300046683 | Bacteria | 2514 |
| 776 | Ga0495658_0085899 | 3300046683 | Bacteria | 1855 |
| 777 | Ga0495613_0004936 | 3300046689 | Bacteria | 10021 |
| 778 | Ga0495613_0005287 | 3300046689 | Bacteria | 9700 |
| 779 | Ga0495613_0111318 | 3300046689 | Bacteria | 1972 |
| 780 | Ga0495624_0053630 | 3300046690 | Bacteria | 2545 |
| 781 | Ga0495600_0003030 | 3300046809 | Bacteria | 9812 |
| 782 | Ga0495600_0019873 | 3300046809 | Bacteria | 4293 |
| 783 | Ga0495600_0022976 | 3300046809 | Bacteria | 4010 |
| 784 | Ga0495600_0127759 | 3300046809 | Unclassified | 1653 |
| 785 | Ga0495581_0000809 | 3300047315 | Bacteria | 16635 |
| 786 | Ga0495581_0019533 | 3300047315 | Bacteria | 3932 |
| 787 | Ga0495581_0062390 | 3300047315 | Bacteria | 2153 |
| 788 | Ga0495581_0277521 | 3300047315 | Bacteria | 980 |
| 789 | Ga0495604_0005420 | 3300047317 | Bacteria | 10117 |
| 790 | Ga0495604_0075934 | 3300047317 | Bacteria | 2529 |
| 791 | Ga0495604_0132104 | 3300047317 | Bacteria | 1793 |
| 792 | Ga0495674_0006248 | 3300047319 | Bacteria | 11431 |
| 793 | Ga0495674_0007711 | 3300047319 | Bacteria | 10282 |
| 794 | Ga0495674_0011877 | 3300047319 | Bacteria | 8209 |
| 795 | Ga0495674_0026894 | 3300047319 | Bacteria | 5262 |
| 796 | Ga0495674_0139436 | 3300047319 | Bacteria | 2039 |
| 797 | Ga0495672_0047261 | 3300047320 | Bacteria | 2561 |
| 798 | Ga0495680_0001042 | 3300047322 | Bacteria | 30684 |
| 799 | Ga0495680_0025992 | 3300047322 | Bacteria | 4835 |
| 800 | Ga0495680_0033497 | 3300047322 | Bacteria | 4158 |
| 801 | Ga0495675_0007997 | 3300047444 | Bacteria | 6541 |
| 802 | Ga0495675_0046723 | 3300047444 | Bacteria | 2756 |
| 803 | Ga0495675_0165219 | 3300047444 | Bacteria | 1361 |
| 804 | Ga0495684_0005933 | 3300047471 | Bacteria | 9491 |
| 805 | Ga0495684_0054724 | 3300047471 | Bacteria | 3043 |
| 806 | Ga0495684_0072477 | 3300047471 | Unclassified | 2617 |
| 807 | Ga0495684_0082616 | 3300047471 | Bacteria | 2437 |
| 808 | Ga0495684_0219635 | 3300047471 | Bacteria | 1394 |
| 809 | Ga0495593_0002738 | 3300047673 | Bacteria | 10610 |
| 810 | Ga0495602_0003786 | 3300048088 | Bacteria | 15729 |
| 811 | Ga0495602_0048921 | 3300048088 | Bacteria | 3793 |
| 812 | Ga0495602_0075894 | 3300048088 | Bacteria | 2851 |
| 813 | Ga0495602_0094817 | 3300048088 | Bacteria | 2465 |
| 814 | Ga0495614_0000708 | 3300048089 | Bacteria | 14038 |
| 815 | Ga0496104_0073425 | 3300048907 | Bacteria | 3255 |
| 816 | Ga0496109_0143407 | 3300048912 | Bacteria | 2234 |
| 817 | Ga0496109_0230039 | 3300048912 | Bacteria | 1744 |
| 818 | Ga0496109_0679926 | 3300048912 | Unclassified | 967 |
| 819 | Ga0496112_0021609 | 3300048915 | Bacteria | 6121 |
| 820 | Ga0496112_0333312 | 3300048915 | Bacteria | 1461 |
| 821 | Ga0496113_0040616 | 3300048916 | Bacteria | 3429 |
| 822 | Ga0501031_0133171 | 3300049568 | Bacteria | 1624 |
| 823 | Ga0501033_0005653 | 3300049570 | Bacteria | 9877 |
| 824 | Ga0501034_0003782 | 3300049571 | Bacteria | 17079 |
| 825 | Ga0501034_0071629 | 3300049571 | Bacteria | 3476 |
| 826 | Ga0501034_0523522 | 3300049571 | Bacteria | 1097 |
| 827 | Ga0501036_0117710 | 3300049572 | Bacteria | 2244 |
| 828 | Ga0501040_0190029 | 3300049576 | Bacteria | 1457 |
| 829 | Ga0501041_0022108 | 3300049577 | Bacteria | 3809 |
| 830 | Ga0501041_0074157 | 3300049577 | Bacteria | 2091 |
| 831 | Ga0501042_0079590 | 3300049578 | Bacteria | 2348 |
| 832 | Ga0501043_0042806 | 3300049579 | Bacteria | 3559 |
| 833 | Ga0501043_0064822 | 3300049579 | Unclassified | 2869 |
| 834 | Ga0501043_0144005 | 3300049579 | Bacteria | 1866 |
| 835 | Ga0501046_0086357 | 3300049580 | Bacteria | 2419 |
| 836 | Ga0501046_0111244 | 3300049580 | Bacteria | 2092 |
| 837 | Ga0501046_0171874 | 3300049580 | Bacteria | 1626 |
| 838 | Ga0501047_0002652 | 3300049581 | Bacteria | 17033 |
| 839 | Ga0501047_0007988 | 3300049581 | Bacteria | 9977 |
| 840 | Ga0501047_0072927 | 3300049581 | Bacteria | 3305 |
| 841 | Ga0501047_0119107 | 3300049581 | Bacteria | 2522 |
| 842 | Ga0501048_0025852 | 3300049582 | Bacteria | 4277 |
| 843 | Ga0501071_0040223 | 3300049587 | Bacteria | 3345 |
| 844 | Ga0501071_0264526 | 3300049587 | Bacteria | 1299 |
| 845 | Ga0501072_0066376 | 3300049588 | Bacteria | 2846 |
| 846 | Ga0501072_0068431 | 3300049588 | Bacteria | 2803 |
| 847 | Ga0501072_0203100 | 3300049588 | Bacteria | 1580 |
| 848 | Ga0501074_0044063 | 3300049590 | Bacteria | 3231 |
| 849 | Ga0501074_0076166 | 3300049590 | Bacteria | 2408 |
| 850 | Ga0501075_0076978 | 3300049591 | Bacteria | 2524 |
| 851 | Ga0501075_0225159 | 3300049591 | Bacteria | 1430 |
| 852 | Ga0501076_0076129 | 3300049592 | Bacteria | 2691 |
| 853 | Ga0501076_0161366 | 3300049592 | Bacteria | 1826 |
| 854 | Ga0501076_0412731 | 3300049592 | Bacteria | 1111 |
| 855 | Ga0501235_016965 | 3300049669 | Unclassified | 1610 |
| 856 | Ga0501259_005763 | 3300049688 | Unclassified | 1967 |
| 857 | Ga0501079_0072898 | 3300049741 | Bacteria | 2654 |
| 858 | Ga0501079_0075862 | 3300049741 | Bacteria | 2600 |
| 859 | Ga0501080_0032533 | 3300049742 | Bacteria | 4865 |
| 860 | Ga0501080_0046841 | 3300049742 | Bacteria | 4025 |
| 861 | Ga0501080_0114460 | 3300049742 | Unclassified | 2501 |
| 862 | Ga0501081_0008109 | 3300049743 | Bacteria | 6816 |
| 863 | Ga0501081_0017211 | 3300049743 | Bacteria | 4782 |
| 864 | Ga0501268_000435 | 3300049765 | Unclassified | 4502 |
| 865 | Ga0501268_020257 | 3300049765 | Bacteria | 1132 |
| 866 | Ga0501270_001697 | 3300049767 | Unclassified | 2157 |
| 867 | Ga0501035_0034312 | 3300049822 | Bacteria | 4611 |
| 868 | Ga0501044_0001375 | 3300049823 | Bacteria | 28520 |
| 869 | Ga0501044_0004890 | 3300049823 | Bacteria | 14973 |
| 870 | Ga0501044_0026721 | 3300049823 | Bacteria | 6109 |
| 871 | Ga0501044_0294074 | 3300049823 | Bacteria | 1555 |
| 872 | Ga0501045_0013793 | 3300049824 | Bacteria | 5714 |
| 873 | Ga0501045_0130981 | 3300049824 | Bacteria | 1864 |
| 874 | nmdc:mga05p37_25234_c1 | 3300050507 | Bacteria | 7227 |
| 875 | nmdc:mga09592_17168_c1 | 3300050508 | Bacteria | 5927 |
| 876 | nmdc:mga09592_20657_c1 | 3300050508 | Bacteria | 5418 |
| 877 | nmdc:mga09592_206955_c1 | 3300050508 | Bacteria | 1699 |
| 878 | nmdc:mga09592_67409_c1 | 3300050508 | Bacteria | 3035 |
| 879 | nmdc:mga09592_72272_c1 | 3300050508 | Unclassified | 2929 |
| 880 | nmdc:mga0qj67_196918_c1 | 3300050509 | Bacteria | 1637 |
| 881 | nmdc:mga0qj67_24652_c1 | 3300050509 | Bacteria | 4640 |
| 882 | nmdc:mga0qj67_3124_c1 | 3300050509 | Bacteria | 11922 |
| 883 | nmdc:mga0qj67_64380_c1 | 3300050509 | Unclassified | 2916 |
| 884 | nmdc:mga06r32_100161_c1 | 3300050510 | Bacteria | 2842 |
| 885 | nmdc:mga06r32_209184_c1 | 3300050510 | Bacteria | 1939 |
| 886 | nmdc:mga06r32_217302_c1 | 3300050510 | Bacteria | 1899 |
| 887 | nmdc:mga06r32_50553_c1 | 3300050510 | Bacteria | 3976 |
| 888 | nmdc:mga06r32_99343_c1 | 3300050510 | Unclassified | 2854 |
| 889 | nmdc:mga08y16_127858_c1 | 3300050511 | Bacteria | 2643 |
| 890 | nmdc:mga08y16_15652_c1 | 3300050511 | Bacteria | 7975 |
| 891 | nmdc:mga08y16_211857_c1 | 3300050511 | Unclassified | 2007 |
| 892 | nmdc:mga0n895_23636_c1 | 3300050512 | Bacteria | 5780 |
| 893 | nmdc:mga0n895_25229_c1 | 3300050512 | Bacteria | 5614 |
| 894 | nmdc:mga0n895_48397_c1 | 3300050512 | Bacteria | 4161 |
| 895 | nmdc:mga0n895_49920_c1 | 3300050512 | Bacteria | 4102 |
| 896 | nmdc:mga0rr50_357190_c1 | 3300050513 | Bacteria | 1229 |
| 897 | nmdc:mga0rr50_94518_c1 | 3300050513 | Bacteria | 2335 |
| 898 | nmdc:mga08x19_15238_c2 | 3300050514 | Bacteria | 3833 |
| 899 | nmdc:mga08x19_84009_c1 | 3300050514 | Bacteria | 2094 |
| 900 | nmdc:mga0a205_301813_c1 | 3300050515 | Unclassified | 1474 |
| 901 | nmdc:mga0a205_44896_c1 | 3300050515 | Bacteria | 3576 |
| 902 | Ga0495601_0053274 | 3300053077 | Bacteria | 2557 |
| 903 | Ga0495601_0166955 | 3300053077 | Bacteria | 1438 |
| 904 | Ga0495612_0006380 | 3300053078 | Unclassified | 4854 |
| 905 | Ga0495595_0020340 | 3300053084 | Bacteria | 2889 |
| 906 | Ga0495619_0082773 | 3300053085 | Bacteria | 2163 |
| 907 | Ga0501082_0142423 | 3300060353 | Bacteria | 2081 |
| 908 | Ga0307406_10223985 | |||
| 909 | Ga0065712_10003029 | |||
| 910 | Ga0065712_10138054 | |||
| 911 | Ga0065712_10149732 | |||
| 912 | Ga0070658_10009375 | |||
| 913 | Ga0070658_10014406 | |||
| 914 | Ga0070658_10094457 | |||
| 915 | Ga0070658_10196858 | |||
| 916 | Ga0070676_10008782 | |||
| 917 | Ga0070683_100003005 | |||
| 918 | Ga0070683_100006639 | |||
| 919 | Ga0070683_100018701 | |||
| 920 | Ga0070683_100030201 | |||
| 921 | Ga0070683_100048126 | |||
| 922 | Ga0070683_100060072 | |||
| 923 | Ga0070683_100086600 | |||
| 924 | Ga0070683_100220952 | |||
| 925 | Ga0070683_100254090 | |||
| 926 | Ga0070690_100011725 | |||
| 927 | Ga0070690_100032100 | |||
| 928 | Ga0070690_100049302 | |||
| 929 | Ga0070670_100013576 | |||
| 930 | Ga0070670_100041223 | |||
| 931 | Ga0070670_100133419 | |||
| 932 | Ga0070677_10079024 | |||
| 933 | Ga0070677_10088784 | |||
| 934 | Ga0068869_100024550 | |||
| 935 | Ga0068869_100056894 | |||
| 936 | Ga0068869_100228568 | |||
| 937 | Ga0070680_100001244 | |||
| 938 | Ga0070680_100002160 | |||
| 939 | Ga0070680_100002198 | |||
| 940 | Ga0070680_100002238 | |||
| 941 | Ga0070680_100067711 | |||
| 942 | Ga0070680_100091770 | |||
| 943 | Ga0070682_100005851 | |||
| 944 | Ga0068868_100016583 | |||
| 945 | Ga0070660_100003351 | |||
| 946 | Ga0070660_100148056 | |||
| 947 | Ga0070660_100177660 | |||
| 948 | Ga0070689_100007804 | |||
| 949 | Ga0070689_100043212 | |||
| 950 | Ga0070689_100116121 | |||
| 951 | Ga0070689_100149006 | |||
| 952 | Ga0070691_10012993 | |||
| 953 | Ga0070661_100003761 | |||
| 954 | Ga0070661_100004963 | |||
| 955 | Ga0070661_100010690 | |||
| 956 | Ga0070661_100016018 | |||
| 957 | Ga0070661_100053819 | |||
| 958 | Ga0070661_100218014 | |||
| 959 | Ga0070661_100289918 | |||
| 960 | Ga0070668_100002904 | |||
| 961 | Ga0070668_100023889 | |||
| 962 | Ga0070668_100032312 | |||
| 963 | Ga0070668_100051041 | |||
| 964 | Ga0070668_100082635 | |||
| 965 | Ga0070668_100133282 | |||
| 966 | Ga0070669_100019178 | |||
| 967 | Ga0070669_100039291 | |||
| 968 | Ga0070669_100063110 | |||
| 969 | Ga0070669_100109364 | |||
| 970 | Ga0070675_100001661 | |||
| 971 | Ga0070675_100002764 | |||
| 972 | Ga0070675_100009557 | |||
| 973 | Ga0070671_100037881 | |||
| 974 | Ga0070671_100090433 | |||
| 975 | Ga0070671_100184589 | |||
| 976 | Ga0070674_100020405 | |||
| 977 | Ga0070674_100105008 | |||
| 978 | Ga0070673_100010604 | |||
| 979 | Ga0070673_100069622 | |||
| 980 | Ga0070688_100035262 | |||
| 981 | Ga0070688_100061124 | |||
| 982 | Ga0070688_100072297 | |||
| 983 | Ga0070659_100001454 | |||
| 984 | Ga0070659_100006033 | |||
| 985 | Ga0070659_100023795 | |||
| 986 | Ga0070667_100014476 | |||
| 987 | Ga0070667_100098838 | |||
| 988 | Ga0070709_10023328 | |||
| 989 | Ga0070709_10036117 | |||
| 990 | Ga0070714_100000538 | |||
| 991 | Ga0070714_100026372 | |||
| 992 | Ga0070714_100031913 | |||
| 993 | Ga0070714_100078321 | |||
| 994 | Ga0070714_100167124 | |||
| 995 | Ga0070714_100255502 | |||
| 996 | Ga0070713_100000365 | |||
| 997 | Ga0070713_100030808 | |||
| 998 | Ga0070713_100052178 | |||
| 999 | Ga0070713_100147092 | |||
| 1000 | Ga0070713_100167892 | |||
| 1001 | Ga0070710_10090533 | |||
| 1002 | Ga0070701_10063364 | |||
| 1003 | Ga0070711_100072603 | |||
| 1004 | Ga0070711_100153467 | |||
| 1005 | Ga0070700_100040629 | |||
| 1006 | Ga0070700_100044616 | |||
| 1007 | Ga0070700_100100475 | |||
| 1008 | Ga0070694_100040041 | |||
| 1009 | Ga0070708_100000024 | |||
| 1010 | Ga0070663_100008355 | |||
| 1011 | Ga0070663_100021824 | |||
| 1012 | Ga0070663_100038762 | |||
| 1013 | Ga0070678_100059962 | |||
| 1014 | Ga0070662_100004241 | |||
| 1015 | Ga0070662_100033053 | |||
| 1016 | Ga0070662_100033697 | |||
| 1017 | Ga0070662_100209385 | |||
| 1018 | Ga0070681_10000119 | |||
| 1019 | Ga0070681_10001192 | |||
| 1020 | Ga0070681_10011247 | |||
| 1021 | Ga0070681_10011256 | |||
| 1022 | Ga0070681_10012112 | |||
| 1023 | Ga0070681_10012713 | |||
| 1024 | Ga0070681_10166556 | |||
| 1025 | Ga0070681_10277655 | |||
| 1026 | Ga0068867_100187417 | |||
| 1027 | Ga0070706_100033519 | |||
| 1028 | Ga0070698_100010365 | |||
| 1029 | Ga0070698_100026323 | |||
| 1030 | Ga0070698_100197923 | |||
| 1031 | Ga0070699_100034453 | |||
| 1032 | Ga0070679_100000066 | |||
| 1033 | Ga0070679_100001382 | |||
| 1034 | Ga0070679_100003354 | |||
| 1035 | Ga0070679_100003412 | |||
| 1036 | Ga0070679_100027193 | |||
| 1037 | Ga0070679_100046894 | |||
| 1038 | Ga0070679_100084719 | |||
| 1039 | Ga0070679_100115196 | |||
| 1040 | Ga0070679_100176109 | |||
| 1041 | Ga0070679_100226461 | |||
| 1042 | Ga0070679_100262834 | |||
| 1043 | Ga0070679_100271332 | |||
| 1044 | Ga0070679_100280753 | |||
| 1045 | Ga0070684_100005054 | |||
| 1046 | Ga0070684_100005381 | |||
| 1047 | Ga0070684_100009052 | |||
| 1048 | Ga0070684_100022465 | |||
| 1049 | Ga0070684_100024204 | |||
| 1050 | Ga0070684_100075181 | |||
| 1051 | Ga0070684_100076346 | |||
| 1052 | Ga0070684_100077151 | |||
| 1053 | Ga0070684_100118273 | |||
| 1054 | Ga0070684_100294503 | |||
| 1055 | Ga0068853_100048373 | |||
| 1056 | Ga0068853_100055729 | |||
| 1057 | Ga0068853_100074201 | |||
| 1058 | Ga0068853_100098265 | |||
| 1059 | Ga0070672_100004646 | |||
| 1060 | Ga0070672_100052796 | |||
| 1061 | Ga0070672_100071515 | |||
| 1062 | Ga0070672_100080035 | |||
| 1063 | Ga0070672_100490400 | |||
| 1064 | Ga0070695_100001852 | |||
| 1065 | Ga0070693_100005385 | |||
| 1066 | Ga0070693_100006308 | |||
| 1067 | Ga0070665_100024001 | |||
| 1068 | Ga0070704_100101741 | |||
| 1069 | Ga0070704_100192926 | |||
| 1070 | Ga0068855_100026559 | |||
| 1071 | Ga0068855_100029474 | |||
| 1072 | Ga0068855_100044173 | |||
| 1073 | Ga0068855_100206108 | |||
| 1074 | Ga0070664_100010557 | |||
| 1075 | Ga0070664_100013933 | |||
| 1076 | Ga0070664_100015468 | |||
| 1077 | Ga0070664_100018942 | |||
| 1078 | Ga0070664_100024285 | |||
| 1079 | Ga0070664_100028779 | |||
| 1080 | Ga0070664_100043630 | |||
| 1081 | Ga0070664_100091040 | |||
| 1082 | Ga0070664_100102986 | |||
| 1083 | Ga0070664_100214932 | |||
| 1084 | Ga0070664_100282996 | |||
| 1085 | Ga0070664_100523699 | |||
| 1086 | Ga0068857_100007641 | |||
| 1087 | Ga0068857_100014570 | |||
| 1088 | Ga0068857_100014785 | |||
| 1089 | Ga0068856_100002006 | |||
| 1090 | Ga0068856_100014375 | |||
| 1091 | Ga0068856_100018036 | |||
| 1092 | Ga0070702_100000558 | |||
| 1093 | Ga0068852_100026491 | |||
| 1094 | Ga0068852_100035480 | |||
| 1095 | Ga0068852_100037150 | |||
| 1096 | Ga0068859_100005085 | |||
| 1097 | Ga0068859_100023584 | |||
| 1098 | Ga0068859_100060965 | |||
| 1099 | Ga0068864_100008399 | |||
| 1100 | Ga0068864_100455442 | |||
| 1101 | Ga0068866_10149984 | |||
| 1102 | Ga0068861_100018071 | |||
| 1103 | Ga0068870_10002264 | |||
| 1104 | Ga0068870_10052716 | |||
| 1105 | Ga0068863_100007732 | |||
| 1106 | Ga0068863_100083253 | |||
| 1107 | Ga0068863_100306132 | |||
| 1108 | Ga0068858_100027910 | |||
| 1109 | Ga0068858_100453532 | |||
| 1110 | Ga0068860_100008276 | |||
| 1111 | Ga0068860_100077426 | |||
| 1112 | Ga0068860_100151798 | |||
| 1113 | Ga0068862_100000563 | |||
| 1114 | Ga0068862_100016777 | |||
| 1115 | Ga0068862_100044961 | |||
| 1116 | Ga0068862_100068810 | |||
| 1117 | Ga0081539_10062495 | |||
| 1118 | Ga0070717_10005342 | |||
| 1119 | Ga0070717_10271348 | |||
| 1120 | Ga0097621_100095933 | |||
| 1121 | Ga0068871_100004583 | |||
| 1122 | Ga0068871_100328105 | |||
| 1123 | Ga0075428_100092576 | |||
| 1124 | Ga0075428_100392764 | |||
| 1125 | Ga0075430_100002009 | |||
| 1126 | Ga0075430_100019563 | |||
| 1127 | Ga0075430_100241307 | |||
| 1128 | Ga0075431_100005920 | |||
| 1129 | Ga0075431_100041102 | |||
| 1130 | Ga0075431_100065851 | |||
| 1131 | Ga0075431_100212459 | |||
| 1132 | Ga0075431_100350061 | |||
| 1133 | Ga0075433_10002539 | |||
| 1134 | Ga0075434_100010409 | |||
| 1135 | Ga0075434_100055851 | |||
| 1136 | Ga0075434_100059637 | |||
| 1137 | Ga0075434_100094626 | |||
| 1138 | Ga0075434_100118868 | |||
| 1139 | Ga0075434_100195571 | |||
| 1140 | Ga0075434_100208109 | |||
| 1141 | Ga0075429_100025615 | |||
| 1142 | Ga0075429_100031901 | |||
| 1143 | Ga0075429_100044871 | |||
| 1144 | Ga0075429_100237587 | |||
| 1145 | Ga0068865_100019307 | |||
| 1146 | Ga0068865_100026342 | |||
| 1147 | Ga0075436_100027536 | |||
| 1148 | Ga0075436_100072530 | |||
| 1149 | Ga0097620_100005085 | |||
| 1150 | Ga0097620_100023584 | |||
| 1151 | Ga0097620_100060955 | |||
| 1152 | Ga0075435_100171464 | |||
| 1153 | Ga0105240_10032537 | |||
| 1154 | Ga0105240_10066320 | |||
| 1155 | Ga0105240_10094276 | |||
| 1156 | Ga0105240_10433805 | |||
| 1157 | Ga0111539_10016990 | |||
| 1158 | Ga0111539_10118385 | |||
| 1159 | Ga0111539_10574112 | |||
| 1160 | Ga0105245_10004657 | |||
| 1161 | Ga0105245_10230918 | |||
| 1162 | Ga0114129_10016042 | |||
| 1163 | Ga0114129_10018210 | |||
| 1164 | Ga0114129_10041097 | |||
| 1165 | Ga0114129_10382224 | |||
| 1166 | Ga0105243_10059148 | |||
| 1167 | Ga0105243_10166298 | |||
| 1168 | Ga0105241_10059640 | |||
| 1169 | Ga0105241_10189441 | |||
| 1170 | Ga0105242_10066442 | |||
| 1171 | Ga0105242_10068259 | |||
| 1172 | Ga0105248_10003619 | |||
| 1173 | Ga0105248_10027477 | |||
| 1174 | Ga0105248_10102481 | |||
| 1175 | Ga0105248_10111900 | |||
| 1176 | Ga0105248_10112466 | |||
| 1177 | Ga0105248_10433165 | |||
| 1178 | Ga0105238_10004021 | |||
| 1179 | Ga0105238_10029562 | |||
| 1180 | Ga0105249_10000133 | |||
| 1181 | Ga0105249_10000662 | |||
| 1182 | Ga0105249_10005645 | |||
| 1183 | Ga0099796_10018133 | |||
| 1184 | Ga0105239_10020462 | |||
| 1185 | Ga0105239_10116400 | |||
| 1186 | Ga0105246_10003077 | |||
| 1187 | Ga0157373_10010157 | |||
| 1188 | Ga0157373_10021338 | |||
| 1189 | Ga0157373_10028435 | |||
| 1190 | Ga0157371_10009393 | |||
| 1191 | Ga0157371_10025629 | |||
| 1192 | Ga0157371_10033766 | |||
| 1193 | Ga0157371_10203293 | |||
| 1194 | Ga0157370_10006918 | |||
| 1195 | Ga0157370_10008158 | |||
| 1196 | Ga0157370_10026219 | |||
| 1197 | Ga0157370_10038898 | |||
| 1198 | Ga0157369_10015385 | |||
| 1199 | Ga0157369_10016784 | |||
| 1200 | Ga0157369_10034675 | |||
| 1201 | Ga0157369_10055735 | |||
| 1202 | Ga0157369_10084620 | |||
| 1203 | Ga0157369_10127726 | |||
| 1204 | Ga0157369_10146712 | |||
| 1205 | Ga0157369_10183652 | |||
| 1206 | Ga0157369_10543221 | |||
| 1207 | Ga0157374_10073904 | |||
| 1208 | Ga0157374_10199297 | |||
| 1209 | Ga0157378_10214060 | |||
| 1210 | Ga0157378_10237091 | |||
| 1211 | Ga0163162_10021469 | |||
| 1212 | Ga0163162_10189061 | |||
| 1213 | Ga0163162_10265521 | |||
| 1214 | Ga0157372_10003051 | |||
| 1215 | Ga0157372_10012575 | |||
| 1216 | Ga0157372_10025436 | |||
| 1217 | Ga0157372_10033314 | |||
| 1218 | Ga0157372_10040174 | |||
| 1219 | Ga0157372_10042027 | |||
| 1220 | Ga0157372_10077526 | |||
| 1221 | Ga0157372_10093733 | |||
| 1222 | Ga0157372_10109041 | |||
| 1223 | Ga0157372_10149850 | |||
| 1224 | Ga0157372_10323170 | |||
| 1225 | Ga0157372_10476717 | |||
| 1226 | Ga0157372_10555109 | |||
| 1227 | Ga0157375_10006374 | |||
| 1228 | Ga0157375_10036954 | |||
| 1229 | Ga0157375_10051129 | |||
| 1230 | Ga0157375_10070807 | |||
| 1231 | Ga0157375_10084533 | |||
| 1232 | Ga0157375_10225077 | |||
| 1233 | Ga0157375_10416172 | |||
| 1234 | Ga0163163_10022697 | |||
| 1235 | Ga0157380_10001269 | |||
| 1236 | Ga0157380_10047019 | |||
| 1237 | Ga0157380_10104727 | |||
| 1238 | Ga0182008_10001887 | |||
| 1239 | Ga0157377_10003414 | |||
| 1240 | Ga0157377_10009008 | |||
| 1241 | Ga0157379_10009985 | |||
| 1242 | Ga0157376_10012034 | |||
| 1243 | Ga0157376_10119725 | |||
| 1244 | Ga0157376_10399703 | |||
| 1245 | Ga0163161_10005930 | |||
| 1246 | Ga0206354_10083716 | |||
| 1247 | Ga0213876_10001912 | |||
| 1248 | Ga0213876_10026985 | |||
| 1249 | Ga0207697_10033385 | |||
| 1250 | Ga0207656_10013681 | |||
| 1251 | Ga0207680_10064904 | |||
| 1252 | Ga0207699_10009835 | |||
| 1253 | Ga0207699_10047210 | |||
| 1254 | Ga0207645_10005607 | |||
| 1255 | Ga0207645_10006068 | |||
| 1256 | Ga0207643_10041895 | |||
| 1257 | Ga0207705_10015020 | |||
| 1258 | Ga0207705_10069417 | |||
| 1259 | Ga0207705_10093179 | |||
| 1260 | Ga0207705_10167514 | |||
| 1261 | Ga0207684_10101209 | |||
| 1262 | Ga0207654_10048996 | |||
| 1263 | Ga0207707_10001516 | |||
| 1264 | Ga0207707_10003111 | |||
| 1265 | Ga0207707_10003275 | |||
| 1266 | Ga0207707_10004812 | |||
| 1267 | Ga0207707_10032034 | |||
| 1268 | Ga0207707_10159479 | |||
| 1269 | Ga0207707_10183193 | |||
| 1270 | Ga0207695_10008489 | |||
| 1271 | Ga0207695_10036015 | |||
| 1272 | Ga0207695_10054884 | |||
| 1273 | Ga0207693_10004234 | |||
| 1274 | Ga0207693_10010340 | |||
| 1275 | Ga0207693_10318559 | |||
| 1276 | Ga0207663_10039106 | |||
| 1277 | Ga0207663_10131359 | |||
| 1278 | Ga0207660_10000015 | |||
| 1279 | Ga0207660_10003814 | |||
| 1280 | Ga0207660_10007775 | |||
| 1281 | Ga0207660_10028138 | |||
| 1282 | Ga0207660_10045397 | |||
| 1283 | Ga0207660_10090639 | |||
| 1284 | Ga0207660_10104415 | |||
| 1285 | Ga0207662_10001456 | |||
| 1286 | Ga0207657_10003620 | |||
| 1287 | Ga0207657_10019361 | |||
| 1288 | Ga0207657_10120649 | |||
| 1289 | Ga0207657_10162028 | |||
| 1290 | Ga0207657_10206843 | |||
| 1291 | Ga0207649_10001109 | |||
| 1292 | Ga0207649_10004268 | |||
| 1293 | Ga0207649_10020418 | |||
| 1294 | Ga0207652_10002383 | |||
| 1295 | Ga0207652_10019280 | |||
| 1296 | Ga0207652_10034855 | |||
| 1297 | Ga0207652_10036295 | |||
| 1298 | Ga0207652_10040876 | |||
| 1299 | Ga0207652_10050915 | |||
| 1300 | Ga0207652_10055427 | |||
| 1301 | Ga0207652_10065106 | |||
| 1302 | Ga0207652_10128860 | |||
| 1303 | Ga0207646_10173081 | |||
| 1304 | Ga0207681_10008681 | |||
| 1305 | Ga0207681_10069098 | |||
| 1306 | Ga0207681_10187552 | |||
| 1307 | Ga0207694_10000020 | |||
| 1308 | Ga0207694_10020485 | |||
| 1309 | Ga0207694_10121204 | |||
| 1310 | Ga0207694_10286233 | |||
| 1311 | Ga0207650_10005451 | |||
| 1312 | Ga0207650_10018343 | |||
| 1313 | Ga0207650_10038997 | |||
| 1314 | Ga0207650_10262835 | |||
| 1315 | Ga0207659_10019929 | |||
| 1316 | Ga0207659_10020893 | |||
| 1317 | Ga0207659_10053962 | |||
| 1318 | Ga0207687_10002121 | |||
| 1319 | Ga0207687_10019639 | |||
| 1320 | Ga0207700_10000601 | |||
| 1321 | Ga0207700_10011250 | |||
| 1322 | Ga0207700_10314522 | |||
| 1323 | Ga0207664_10041483 | |||
| 1324 | Ga0207664_10055110 | |||
| 1325 | Ga0207664_10060871 | |||
| 1326 | Ga0207664_10080967 | |||
| 1327 | Ga0207664_10150218 | |||
| 1328 | Ga0207644_10037448 | |||
| 1329 | Ga0207690_10009752 | |||
| 1330 | Ga0207690_10009969 | |||
| 1331 | Ga0207706_10000155 | |||
| 1332 | Ga0207706_10021799 | |||
| 1333 | Ga0207706_10082578 | |||
| 1334 | Ga0207686_10051080 | |||
| 1335 | Ga0207670_10094161 | |||
| 1336 | Ga0207670_10237253 | |||
| 1337 | Ga0207669_10081984 | |||
| 1338 | Ga0207669_10148534 | |||
| 1339 | Ga0207704_10015704 | |||
| 1340 | Ga0207704_10039945 | |||
| 1341 | Ga0207704_10242019 | |||
| 1342 | Ga0207691_10001667 | |||
| 1343 | Ga0207691_10002873 | |||
| 1344 | Ga0207691_10051864 | |||
| 1345 | Ga0207691_10076454 | |||
| 1346 | Ga0207691_10083064 | |||
| 1347 | Ga0207691_10153754 | |||
| 1348 | Ga0207711_10062541 | |||
| 1349 | Ga0207711_10122026 | |||
| 1350 | Ga0207689_10002528 | |||
| 1351 | Ga0207689_10026578 | |||
| 1352 | Ga0207689_10052931 | |||
| 1353 | Ga0207661_10001218 | |||
| 1354 | Ga0207661_10001484 | |||
| 1355 | Ga0207661_10004649 | |||
| 1356 | Ga0207661_10029599 | |||
| 1357 | Ga0207661_10030228 | |||
| 1358 | Ga0207661_10036321 | |||
| 1359 | Ga0207661_10036765 | |||
| 1360 | Ga0207661_10056093 | |||
| 1361 | Ga0207661_10056723 | |||
| 1362 | Ga0207661_10092237 | |||
| 1363 | Ga0207661_10198756 | |||
| 1364 | Ga0207661_10239702 | |||
| 1365 | Ga0207679_10001557 | |||
| 1366 | Ga0207679_10002457 | |||
| 1367 | Ga0207679_10004253 | |||
| 1368 | Ga0207679_10005859 | |||
| 1369 | Ga0207679_10010095 | |||
| 1370 | Ga0207679_10032647 | |||
| 1371 | Ga0207679_10342587 | |||
| 1372 | Ga0207667_10031049 | |||
| 1373 | Ga0207667_10035036 | |||
| 1374 | Ga0207667_10040067 | |||
| 1375 | Ga0207667_10049996 | |||
| 1376 | Ga0207667_10082511 | |||
| 1377 | Ga0207667_10085208 | |||
| 1378 | Ga0207667_10176364 | |||
| 1379 | Ga0207651_10036591 | |||
| 1380 | Ga0207651_10047786 | |||
| 1381 | Ga0207651_10298038 | |||
| 1382 | Ga0207712_10000098 | |||
| 1383 | Ga0207712_10006052 | |||
| 1384 | Ga0207712_10006933 | |||
| 1385 | Ga0207712_10054232 | |||
| 1386 | Ga0207668_10004444 | |||
| 1387 | Ga0207668_10022463 | |||
| 1388 | Ga0207668_10115466 | |||
| 1389 | Ga0207668_10308656 | |||
| 1390 | Ga0207658_10034360 | |||
| 1391 | Ga0207703_10111400 | |||
| 1392 | Ga0207639_10014233 | |||
| 1393 | Ga0207639_10017698 | |||
| 1394 | Ga0207639_10051221 | |||
| 1395 | Ga0207639_10087937 | |||
| 1396 | Ga0207639_10152823 | |||
| 1397 | Ga0207639_10197106 | |||
| 1398 | Ga0207678_10065631 | |||
| 1399 | Ga0207678_10067512 | |||
| 1400 | Ga0207708_10049485 | |||
| 1401 | Ga0207708_10054665 | |||
| 1402 | Ga0207708_10135588 | |||
| 1403 | Ga0207708_10215516 | |||
| 1404 | Ga0207702_10004386 | |||
| 1405 | Ga0207702_10123904 | |||
| 1406 | Ga0207702_10246561 | |||
| 1407 | Ga0207641_10006591 | |||
| 1408 | Ga0207641_10116238 | |||
| 1409 | Ga0207641_10122881 | |||
| 1410 | Ga0207641_10169066 | |||
| 1411 | Ga0207648_10016415 | |||
| 1412 | Ga0207648_10022484 | |||
| 1413 | Ga0207648_10122403 | |||
| 1414 | Ga0207648_10334173 | |||
| 1415 | Ga0207676_10002872 | |||
| 1416 | Ga0207676_10141081 | |||
| 1417 | Ga0207676_10320237 | |||
| 1418 | Ga0207676_10423341 | |||
| 1419 | Ga0207674_10000809 | |||
| 1420 | Ga0207674_10001550 | |||
| 1421 | Ga0207674_10001551 | |||
| 1422 | Ga0207674_10015403 | |||
| 1423 | Ga0207674_10017983 | |||
| 1424 | Ga0207674_10026402 | |||
| 1425 | Ga0207674_10109385 | |||
| 1426 | Ga0207675_100001026 | |||
| 1427 | Ga0207675_100163441 | |||
| 1428 | Ga0207675_100174751 | |||
| 1429 | Ga0207675_100242322 | |||
| 1430 | Ga0207683_10039859 | |||
| 1431 | Ga0207683_10116397 | |||
| 1432 | Ga0207683_10188451 | |||
| 1433 | Ga0207698_10004902 | |||
| 1434 | Ga0207698_10018642 | |||
| 1435 | Ga0207698_10033827 | |||
| 1436 | Ga0207698_10039732 | |||
| 1437 | Ga0207698_10068467 | |||
| 1438 | Ga0207698_10651159 | |||
| 1439 | Ga0209966_1006371 | |||
| 1440 | Ga0209998_10000274 | |||
| 1441 | Ga0209974_10024251 | |||
| 1442 | Ga0207428_10096596 | |||
| 1443 | Ga0207428_10190486 | |||
| 1444 | Ga0207428_10235367 | |||
| 1445 | Ga0268266_10040493 | |||
| 1446 | Ga0268266_10231605 | |||
| 1447 | Ga0268265_10003561 | |||
| 1448 | Ga0268265_10025393 | |||
| 1449 | Ga0268265_10167716 | |||
| 1450 | Ga0268264_10062479 | |||
| 1451 | Ga0268264_10487534 | |||
| 1452 | Ga0265337_1004238 | |||
| 1453 | Ga0265337_1015539 | |||
| 1454 | Ga0265337_1029943 | |||
| 1455 | Ga0265326_10003616 | |||
| 1456 | Ga0265319_1000161 | |||
| 1457 | Ga0265334_10000919 | |||
| 1458 | Ga0265334_10007271 | |||
| 1459 | Ga0265318_10002008 | |||
| 1460 | Ga0265322_10039859 | |||
| 1461 | Ga0265336_10039431 | |||
| 1462 | Ga0265338_10007668 | |||
| 1463 | Ga0265338_10050207 | |||
| 1464 | Ga0265338_10055085 | |||
| 1465 | Ga0265330_10000006 | |||
| 1466 | Ga0265332_10000057 | |||
| 1467 | Ga0265332_10008139 | |||
| 1468 | Ga0265325_10018846 | |||
| 1469 | Ga0265329_10005906 | |||
| 1470 | Ga0265340_10024591 | |||
| 1471 | Ga0265331_10007368 | |||
| 1472 | Ga0265316_10000023 | |||
| 1473 | Ga0307408_100007627 | |||
| 1474 | Ga0307408_100095341 | |||
| 1475 | Ga0316575_10021565 | |||
| 1476 | Ga0316579_10001523 | |||
| 1477 | Ga0265314_10000019 | |||
| 1478 | Ga0265342_10000010 | |||
| 1479 | Ga0265342_10020882 | |||
| 1480 | Ga0316576_10004250 | |||
| 1481 | Ga0316576_10029267 | |||
| 1482 | Ga0316578_10004047 | |||
| 1483 | Ga0316578_10135330 | |||
| 1484 | Ga0307405_10030236 | |||
| 1485 | Ga0307405_10082186 | |||
| 1486 | Ga0307405_10137179 | |||
| 1487 | Ga0307405_10222094 | |||
| 1488 | Ga0316577_10001255 | |||
| 1489 | Ga0307413_10068731 | |||
| 1490 | Ga0307413_10071638 | |||
| 1491 | Ga0307413_10112627 | |||
| 1492 | Ga0307410_10040121 | |||
| 1493 | Ga0307410_10051378 | |||
| 1494 | Ga0307410_10053205 | |||
| 1495 | Ga0307406_10001667 | |||
| 1496 | Ga0307406_10019878 | |||
| 1497 | Ga0307406_10132277 | |||
| 1498 | Ga0307406_10230829 | |||
| 1499 | Ga0307407_10040280 | |||
| 1500 | Ga0307407_10060474 | |||
| 1501 | Ga0307412_10005921 | |||
| 1502 | Ga0307412_10006175 | |||
| 1503 | Ga0307412_10262565 | |||
| 1504 | Ga0307409_100017363 | |||
| 1505 | Ga0307409_100074067 | |||
| 1506 | Ga0307409_100086010 | |||
| 1507 | Ga0307416_100033976 | |||
| 1508 | Ga0307416_100055905 | |||
| 1509 | Ga0307416_100082932 | |||
| 1510 | Ga0307416_100123655 | |||
| 1511 | Ga0307416_100225804 | |||
| 1512 | Ga0307416_100640336 | |||
| 1513 | Ga0307414_10137754 | |||
| 1514 | Ga0307411_10060531 | |||
| 1515 | Ga0307411_10115990 | |||
| 1516 | Ga0307415_100042972 | |||
| 1517 | Ga0307415_100161989 | |||
| 1518 | Ga0307415_100241510 | |||
| 1519 | Ga0316583_10000021 | |||
| 1520 | Ga0316580_10005912 | |||
| 1521 | Ga0373926_0000731 | |||
| 1522 | Ga0373934_0002803 | |||
| 1523 | Ga0373934_0035797 | |||
| 1524 | Ga0373939_0056675 | |||
| 1525 | Ga0373953_0004240 | |||
| 1526 | Ga0373956_0008121 | |||
| 1527 | Ga0373957_0021116 | |||
| 1528 | Ga0373943_0024931 | |||
| 1529 | Ga0373943_0052615 | |||
| 1530 | Ga0373955_0024317 | |||
| 1531 | Ga0373955_0042205 | |||
| 1532 | Ga0373955_0065489 | |||
| 1533 | Ga0373955_0181796 | |||
| 1534 | Ga0373955_0217716 | |||
| 1535 | Ga0316574_0062057 | |||
| 1536 | Ga0316574_0102126 | |||
| 1537 | Ga0316574_0105154 | |||
| 1538 | Ga0316574_0152560 | |||
| 1539 | Ga0373931_0002236 | |||
| 1540 | Ga0373935_0138346 | |||
| 1541 | Ga0373927_0163695 | |||
| 1542 | Ga0373933_0008609 | |||
| 1543 | Ga0373947_0002620 | |||
| 1544 | Ga0373947_0046564 | |||
| 1545 | Ga0373937_0008385 | |||
| 1546 | Ga0373937_0008633 | |||
| 1547 | Ga0373937_0047280 | |||
| 1548 | Ga0373937_0136061 | |||
| 1549 | Ga0373937_0140843 | |||
| 1550 | Ga0373937_0195111 | |||
| 1551 | Ga0316582_0004354 | |||
| 1552 | Ga0316582_0015735 | |||
| 1553 | Ga0316584_0000036 | |||
| 1554 | Ga0316584_0011426 | |||
| 1555 | Ga0316584_0103924 | |||
| 1556 | Ga0373925_0002987 | |||
| 1557 | Ga0373925_0065811 | |||
| 1558 | Ga0395899_0054189 | |||
| 1559 | Ga0395900_0019850 | |||
| 1560 | Ga0395905_0004652 | |||
| 1561 | Ga0395905_0208661 | |||
| 1562 | Ga0316581_0016270 | |||
| 1563 | Ga0395901_0005373 | |||
| 1564 | Ga0400486_30464 | |||
| 1565 | Ga0400489_04212 | |||
| 1566 | Ga0436365_0164142 | |||
| 1567 | Ga0436365_0320936 | |||
| 1568 | Ga0436365_0521568 | |||
| 1569 | Ga0436365_0812650 | |||
| 1570 | Ga0451787_068143 | |||
| 1571 | Ga0451800_1055042 | |||
| 1572 | Ga0439433_0024824 | |||
| 1573 | Ga0439462_0042386 | |||
| 1574 | Ga0439446_0029089 | |||
| 1575 | Ga0451577_0000001 | |||
| 1576 | Ga0451577_0003144 | |||
| 1577 | Ga0451577_0012030 | |||
| 1578 | Ga0451577_0092077 | |||
| 1579 | Ga0451577_0228310 | |||
| 1580 | Ga0466966_0011886 | |||
| 1581 | Ga0466963_0142898 | |||
| 1582 | Ga0453684_0000132 | |||
| 1583 | Ga0453684_0001936 | |||
| 1584 | Ga0453684_0028229 | |||
| 1585 | Ga0453684_0068150 | |||
| 1586 | Ga0453684_0074978 | |||
| 1587 | Ga0466959_0055220 | |||
| 1588 | Ga0451576_0008152 | |||
| 1589 | Ga0451576_0019886 | |||
| 1590 | Ga0451576_0020415 | |||
| 1591 | Ga0451576_0055803 | |||
| 1592 | Ga0451576_0279479 | |||
| 1593 | Ga0466958_0138440 | |||
| 1594 | Ga0466967_0138127 | |||
| 1595 | Ga0495592_0024160 | |||
| 1596 | Ga0495603_0002982 | |||
| 1597 | Ga0495603_0027422 | |||
| 1598 | Ga0495629_0066215 | |||
| 1599 | Ga0495629_0095829 | |||
| 1600 | Ga0495629_0125581 | |||
| 1601 | Ga0495651_0012210 | |||
| 1602 | Ga0495651_0043458 | |||
| 1603 | Ga0495651_0113749 | |||
| 1604 | Ga0495653_0019406 | |||
| 1605 | Ga0495580_0005679 | |||
| 1606 | Ga0495580_0028551 | |||
| 1607 | Ga0495582_0005504 | |||
| 1608 | Ga0495582_0009433 | |||
| 1609 | Ga0495582_0021050 | |||
| 1610 | Ga0495582_0023600 | |||
| 1611 | Ga0495639_0000704 | |||
| 1612 | Ga0495639_0022193 | |||
| 1613 | Ga0495664_0018129 | |||
| 1614 | Ga0495664_0071612 | |||
| 1615 | Ga0495594_0004139 | |||
| 1616 | Ga0495594_0007835 | |||
| 1617 | Ga0495594_0008344 | |||
| 1618 | Ga0495594_0034729 | |||
| 1619 | Ga0495608_0013916 | |||
| 1620 | Ga0495608_0029791 | |||
| 1621 | Ga0495608_0042808 | |||
| 1622 | Ga0495608_0093653 | |||
| 1623 | Ga0495618_0002382 | |||
| 1624 | Ga0495618_0019341 | |||
| 1625 | Ga0495628_0005937 | |||
| 1626 | Ga0495628_0070342 | |||
| 1627 | Ga0495628_0072022 | |||
| 1628 | Ga0495628_0097241 | |||
| 1629 | Ga0495630_0014259 | |||
| 1630 | Ga0495630_0059822 | |||
| 1631 | Ga0495630_0065124 | |||
| 1632 | Ga0495643_0000249 | |||
| 1633 | Ga0495666_0021697 | |||
| 1634 | Ga0495652_0053520 | |||
| 1635 | Ga0495652_0058304 | |||
| 1636 | Ga0495665_0001067 | |||
| 1637 | Ga0495665_0009112 | |||
| 1638 | Ga0495665_0011106 | |||
| 1639 | Ga0495665_0142276 | |||
| 1640 | Ga0495640_0017040 | |||
| 1641 | Ga0495586_0002088 | |||
| 1642 | Ga0495586_0007235 | |||
| 1643 | Ga0495586_0013582 | |||
| 1644 | Ga0495586_0099118 | |||
| 1645 | Ga0495586_0150624 | |||
| 1646 | Ga0495586_0175489 | |||
| 1647 | Ga0495586_0198377 | |||
| 1648 | Ga0495587_0000778 | |||
| 1649 | Ga0495587_0007410 | |||
| 1650 | Ga0495587_0010356 | |||
| 1651 | Ga0495645_0000693 | |||
| 1652 | Ga0495645_0015144 | |||
| 1653 | Ga0495645_0040476 | |||
| 1654 | Ga0495645_0055755 | |||
| 1655 | Ga0495645_0067933 | |||
| 1656 | Ga0495645_0122432 | |||
| 1657 | Ga0495645_0312270 | |||
| 1658 | Ga0495667_0006744 | |||
| 1659 | Ga0495667_0069316 | |||
| 1660 | Ga0495635_0004505 | |||
| 1661 | Ga0495635_0011934 | |||
| 1662 | Ga0495659_0000687 | |||
| 1663 | Ga0495588_0001415 | |||
| 1664 | Ga0495588_0098669 | |||
| 1665 | Ga0495657_0015202 | |||
| 1666 | Ga0495657_0129942 | |||
| 1667 | Ga0495599_0004117 | |||
| 1668 | Ga0495599_0007818 | |||
| 1669 | Ga0495599_0010839 | |||
| 1670 | Ga0495599_0013143 | |||
| 1671 | Ga0495599_0032011 | |||
| 1672 | Ga0495599_0105902 | |||
| 1673 | Ga0495623_0002993 | |||
| 1674 | Ga0495623_0013570 | |||
| 1675 | Ga0495623_0069957 | |||
| 1676 | Ga0495623_0085078 | |||
| 1677 | Ga0495646_0035286 | |||
| 1678 | Ga0495646_0051771 | |||
| 1679 | Ga0495647_0018682 | |||
| 1680 | Ga0495658_0001668 | |||
| 1681 | Ga0495658_0003108 | |||
| 1682 | Ga0495658_0043441 | |||
| 1683 | Ga0495658_0085899 | |||
| 1684 | Ga0495613_0004936 | |||
| 1685 | Ga0495613_0005287 | |||
| 1686 | Ga0495613_0111318 | |||
| 1687 | Ga0495624_0053630 | |||
| 1688 | Ga0495600_0003030 | |||
| 1689 | Ga0495600_0019873 | |||
| 1690 | Ga0495600_0022976 | |||
| 1691 | Ga0495600_0127759 | |||
| 1692 | Ga0495581_0000809 | |||
| 1693 | Ga0495581_0019533 | |||
| 1694 | Ga0495581_0062390 | |||
| 1695 | Ga0495581_0277521 | |||
| 1696 | Ga0495604_0005420 | |||
| 1697 | Ga0495604_0075934 | |||
| 1698 | Ga0495604_0132104 | |||
| 1699 | Ga0495674_0006248 | |||
| 1700 | Ga0495674_0007711 | |||
| 1701 | Ga0495674_0011877 | |||
| 1702 | Ga0495674_0026894 | |||
| 1703 | Ga0495674_0139436 | |||
| 1704 | Ga0495672_0047261 | |||
| 1705 | Ga0495680_0001042 | |||
| 1706 | Ga0495680_0025992 | |||
| 1707 | Ga0495680_0033497 | |||
| 1708 | Ga0495675_0007997 | |||
| 1709 | Ga0495675_0046723 | |||
| 1710 | Ga0495675_0165219 | |||
| 1711 | Ga0495684_0005933 | |||
| 1712 | Ga0495684_0054724 | |||
| 1713 | Ga0495684_0072477 | |||
| 1714 | Ga0495684_0082616 | |||
| 1715 | Ga0495684_0219635 | |||
| 1716 | Ga0495593_0002738 | |||
| 1717 | Ga0495602_0003786 | |||
| 1718 | Ga0495602_0048921 | |||
| 1719 | Ga0495602_0075894 | |||
| 1720 | Ga0495602_0094817 | |||
| 1721 | Ga0495614_0000708 | |||
| 1722 | Ga0496104_0073425 | |||
| 1723 | Ga0496109_0143407 | |||
| 1724 | Ga0496109_0230039 | |||
| 1725 | Ga0496109_0679926 | |||
| 1726 | Ga0496112_0021609 | |||
| 1727 | Ga0496112_0333312 | |||
| 1728 | Ga0496113_0040616 | |||
| 1729 | Ga0501031_0133171 | |||
| 1730 | Ga0501033_0005653 | |||
| 1731 | Ga0501034_0003782 | |||
| 1732 | Ga0501034_0071629 | |||
| 1733 | Ga0501034_0523522 | |||
| 1734 | Ga0501036_0117710 | |||
| 1735 | Ga0501040_0190029 | |||
| 1736 | Ga0501041_0022108 | |||
| 1737 | Ga0501041_0074157 | |||
| 1738 | Ga0501042_0079590 | |||
| 1739 | Ga0501043_0042806 | |||
| 1740 | Ga0501043_0064822 | |||
| 1741 | Ga0501043_0144005 | |||
| 1742 | Ga0501046_0086357 | |||
| 1743 | Ga0501046_0111244 | |||
| 1744 | Ga0501046_0171874 | |||
| 1745 | Ga0501047_0002652 | |||
| 1746 | Ga0501047_0007988 | |||
| 1747 | Ga0501047_0072927 | |||
| 1748 | Ga0501047_0119107 | |||
| 1749 | Ga0501048_0025852 | |||
| 1750 | Ga0501071_0040223 | |||
| 1751 | Ga0501071_0264526 | |||
| 1752 | Ga0501072_0066376 | |||
| 1753 | Ga0501072_0068431 | |||
| 1754 | Ga0501072_0203100 | |||
| 1755 | Ga0501074_0044063 | |||
| 1756 | Ga0501074_0076166 | |||
| 1757 | Ga0501075_0076978 | |||
| 1758 | Ga0501075_0225159 | |||
| 1759 | Ga0501076_0076129 | |||
| 1760 | Ga0501076_0161366 | |||
| 1761 | Ga0501076_0412731 | |||
| 1762 | Ga0501235_016965 | |||
| 1763 | Ga0501259_005763 | |||
| 1764 | Ga0501079_0072898 | |||
| 1765 | Ga0501079_0075862 | |||
| 1766 | Ga0501080_0032533 | |||
| 1767 | Ga0501080_0046841 | |||
| 1768 | Ga0501080_0114460 | |||
| 1769 | Ga0501081_0008109 | |||
| 1770 | Ga0501081_0017211 | |||
| 1771 | Ga0501268_000435 | |||
| 1772 | Ga0501268_020257 | |||
| 1773 | Ga0501270_001697 | |||
| 1774 | Ga0501035_0034312 | |||
| 1775 | Ga0501044_0001375 | |||
| 1776 | Ga0501044_0004890 | |||
| 1777 | Ga0501044_0026721 | |||
| 1778 | Ga0501044_0294074 | |||
| 1779 | Ga0501045_0013793 | |||
| 1780 | Ga0501045_0130981 | |||
| 1781 | nmdc:mga05p37_25234_c1 | |||
| 1782 | nmdc:mga09592_17168_c1 | |||
| 1783 | nmdc:mga09592_20657_c1 | |||
| 1784 | nmdc:mga09592_206955_c1 | |||
| 1785 | nmdc:mga09592_67409_c1 | |||
| 1786 | nmdc:mga09592_72272_c1 | |||
| 1787 | nmdc:mga0qj67_196918_c1 | |||
| 1788 | nmdc:mga0qj67_24652_c1 | |||
| 1789 | nmdc:mga0qj67_3124_c1 | |||
| 1790 | nmdc:mga0qj67_64380_c1 | |||
| 1791 | nmdc:mga06r32_100161_c1 | |||
| 1792 | nmdc:mga06r32_209184_c1 | |||
| 1793 | nmdc:mga06r32_217302_c1 | |||
| 1794 | nmdc:mga06r32_50553_c1 | |||
| 1795 | nmdc:mga06r32_99343_c1 | |||
| 1796 | nmdc:mga08y16_127858_c1 | |||
| 1797 | nmdc:mga08y16_15652_c1 | |||
| 1798 | nmdc:mga08y16_211857_c1 | |||
| 1799 | nmdc:mga0n895_23636_c1 | |||
| 1800 | nmdc:mga0n895_25229_c1 | |||
| 1801 | nmdc:mga0n895_48397_c1 | |||
| 1802 | nmdc:mga0n895_49920_c1 | |||
| 1803 | nmdc:mga0rr50_357190_c1 | |||
| 1804 | nmdc:mga0rr50_94518_c1 | |||
| 1805 | nmdc:mga08x19_15238_c2 | |||
| 1806 | nmdc:mga08x19_84009_c1 | |||
| 1807 | nmdc:mga0a205_301813_c1 | |||
| 1808 | nmdc:mga0a205_44896_c1 | |||
| 1809 | Ga0495601_0053274 | |||
| 1810 | Ga0495601_0166955 | |||
| 1811 | Ga0495612_0006380 | |||
| 1812 | Ga0495595_0020340 | |||
| 1813 | Ga0495619_0082773 | |||
| 1814 | Ga0501082_0142423 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kkl-assembly1.cif.gz_C | l.casei hprk/p in complex with b.subtilis hpr | 0.975 | 121 | 296 |
| 1kkl-assembly1.cif.gz_B-2 | l.casei hprk/p in complex with b.subtilis hpr | 0.9711 | 122 | 292 |
| 1kkm-assembly1.cif.gz_B | l.casei hprk/p in complex with b.subtilis p-ser-hpr | 0.9679 | 122 | 298 |
| 1kkl-assembly1.cif.gz_C | l.casei hprk/p in complex with b.subtilis hpr | 0.9637 | 121 | 296 |
| 1kkm-assembly1.cif.gz_B | l.casei hprk/p in complex with b.subtilis p-ser-hpr | 0.9626 | 122 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1knxD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9331 | 122 | 293 | 3.40.50.300 |
| 1ko7A01 | Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;HprK N-terminal domain-like | 0.9263 | 15 | 120 | 3.40.1390.20 |
| 3tqfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9257 | 124 | 274 | 3.40.50.300 |
| 1knxD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9228 | 122 | 293 | 3.40.50.300 |
| 3tqfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.902 | 124 | 274 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538SZT1-F1-model_v4 | HPr(Ser) kinase/phosphorylase N-terminal domain-containing protein | 0.9901 | 2 | 122 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-A0A317YKF1-F1-model_v4 | HPr kinase/phosphorylase | 0.9872 | 126 | 211 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-A0A371IZW4-F1-model_v4 | HPr(Ser) kinase/phosphatase | 0.9826 | 130 | 294 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-A0A3D3FJ41-F1-model_v4 | HPr kinase/phosphorylase | 0.9817 | 117 | 259 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-A0A3N5K3D0-F1-model_v4 | HPr(Ser) kinase/phosphatase | 0.9809 | 124 | 288 |
GO:0000155
GO:0005524 GO:0006109 |