F485360

General Info

Members Datasets Scaffolds Average Seq Length
907 335 1814 323

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10223985|Ga0307406_102239852
Length 348
Sequence VKPKLTVGQLLERLRDPLELEQIGAAVGLDREVTSPEASSPGLVLSGYFNRFPFERIQVFGETEITYLNALDADVRARHLETFFSFAIPCVFVTKAQEPPEPFLALAAAAGIAVLRSRLKTAEFYRVIKPFLADVFAPQVTLHGSLADVFGVGLFFTGQSGIGKSECVLDLVERGHRLVADDLVIVQRRGNDVLIGRGHELQRHFMEIRGIGLVDIPAIFGIRAVRQQKRIEVVVQLEEWDQEAIVDRTGLDTESQTILGVELPKIRVPLNPGKNITVIAEVIAMNHLLRYSRGVSPAEAFNERLIAKMRGAAAAPPGGESVVLTSTSPNAYHTRAADVRRYLQEDDE

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
174 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
175 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
190 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
207 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
232 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
235 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
313 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
318 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.99
Rhizosphere 98.13
Stem 0
Stem Tuber 0
Unclassified 11.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10223985 3300031901 Bacteria 1400
2 Ga0065712_10003029 3300005290 Bacteria 3989
3 Ga0065712_10138054 3300005290 Bacteria 1477
4 Ga0065712_10149732 3300005290 Unclassified 1379
5 Ga0070658_10009375 3300005327 Bacteria 7866
6 Ga0070658_10014406 3300005327 Bacteria 6345
7 Ga0070658_10094457 3300005327 Unclassified 2467
8 Ga0070658_10196858 3300005327 Bacteria 1699
9 Ga0070676_10008782 3300005328 Bacteria 5453
10 Ga0070683_100003005 3300005329 Bacteria 13536
11 Ga0070683_100006639 3300005329 Bacteria 9715
12 Ga0070683_100018701 3300005329 Bacteria 6140
13 Ga0070683_100030201 3300005329 Bacteria 4915
14 Ga0070683_100048126 3300005329 Bacteria 3942
15 Ga0070683_100060072 3300005329 Bacteria 3532
16 Ga0070683_100086600 3300005329 Bacteria 2937
17 Ga0070683_100220952 3300005329 Bacteria 1801
18 Ga0070683_100254090 3300005329 Bacteria 1672
19 Ga0070690_100011725 3300005330 Bacteria 5137
20 Ga0070690_100032100 3300005330 Unclassified 3277
21 Ga0070690_100049302 3300005330 Bacteria 2684
22 Ga0070670_100013576 3300005331 Bacteria 6981
23 Ga0070670_100041223 3300005331 Bacteria 3969
24 Ga0070670_100133419 3300005331 Bacteria 2145
25 Ga0070677_10079024 3300005333 Bacteria 1403
26 Ga0070677_10088784 3300005333 Bacteria 1340
27 Ga0068869_100024550 3300005334 Bacteria 4175
28 Ga0068869_100056894 3300005334 Bacteria 2853
29 Ga0068869_100228568 3300005334 Unclassified 1477
30 Ga0070680_100001244 3300005336 Bacteria 18369
31 Ga0070680_100002160 3300005336 Bacteria 14534
32 Ga0070680_100002198 3300005336 Bacteria 14375
33 Ga0070680_100002238 3300005336 Bacteria 14277
34 Ga0070680_100067711 3300005336 Bacteria 2929
35 Ga0070680_100091770 3300005336 Bacteria 2514
36 Ga0070682_100005851 3300005337 Bacteria 6871
37 Ga0068868_100016583 3300005338 Bacteria 5475
38 Ga0070660_100003351 3300005339 Bacteria 11012
39 Ga0070660_100148056 3300005339 Bacteria 1887
40 Ga0070660_100177660 3300005339 Unclassified 1722
41 Ga0070689_100007804 3300005340 Bacteria 7498
42 Ga0070689_100043212 3300005340 Bacteria 3462
43 Ga0070689_100116121 3300005340 Bacteria 2134
44 Ga0070689_100149006 3300005340 Bacteria 1886
45 Ga0070691_10012993 3300005341 Bacteria 3813
46 Ga0070661_100003761 3300005344 Bacteria 10462
47 Ga0070661_100004963 3300005344 Bacteria 9164
48 Ga0070661_100010690 3300005344 Bacteria 6386
49 Ga0070661_100016018 3300005344 Bacteria 5291
50 Ga0070661_100053819 3300005344 Bacteria 2947
51 Ga0070661_100218014 3300005344 Unclassified 1463
52 Ga0070661_100289918 3300005344 Unclassified 1271
53 Ga0070668_100002904 3300005347 Bacteria 12655
54 Ga0070668_100023889 3300005347 Bacteria 4628
55 Ga0070668_100032312 3300005347 Bacteria 3983
56 Ga0070668_100051041 3300005347 Bacteria 3186
57 Ga0070668_100082635 3300005347 Unclassified 2520
58 Ga0070668_100133282 3300005347 Bacteria 1996
59 Ga0070669_100019178 3300005353 Bacteria 4887
60 Ga0070669_100039291 3300005353 Bacteria 3438
61 Ga0070669_100063110 3300005353 Unclassified 2726
62 Ga0070669_100109364 3300005353 Bacteria 2096
63 Ga0070675_100001661 3300005354 Bacteria 16438
64 Ga0070675_100002764 3300005354 Bacteria 13193
65 Ga0070675_100009557 3300005354 Bacteria 7544
66 Ga0070671_100037881 3300005355 Bacteria 4001
67 Ga0070671_100090433 3300005355 Unclassified 2563
68 Ga0070671_100184589 3300005355 Bacteria 1767
69 Ga0070674_100020405 3300005356 Bacteria 4233
70 Ga0070674_100105008 3300005356 Unclassified 2065
71 Ga0070673_100010604 3300005364 Bacteria 6245
72 Ga0070673_100069622 3300005364 Bacteria 2820
73 Ga0070688_100035262 3300005365 Bacteria 3038
74 Ga0070688_100061124 3300005365 Unclassified 2381
75 Ga0070688_100072297 3300005365 Bacteria 2210
76 Ga0070659_100001454 3300005366 Bacteria 17048
77 Ga0070659_100006033 3300005366 Bacteria 8737
78 Ga0070659_100023795 3300005366 Bacteria 4689
79 Ga0070667_100014476 3300005367 Bacteria 6517
80 Ga0070667_100098838 3300005367 Unclassified 2518
81 Ga0070709_10023328 3300005434 Bacteria 3630
82 Ga0070709_10036117 3300005434 Bacteria 3008
83 Ga0070714_100000538 3300005435 Bacteria 27367
84 Ga0070714_100026372 3300005435 Bacteria 4802
85 Ga0070714_100031913 3300005435 Bacteria 4397
86 Ga0070714_100078321 3300005435 Bacteria 2872
87 Ga0070714_100167124 3300005435 Bacteria 1994
88 Ga0070714_100255502 3300005435 Bacteria 1621
89 Ga0070713_100000365 3300005436 Bacteria 29146
90 Ga0070713_100030808 3300005436 Bacteria 4266
91 Ga0070713_100052178 3300005436 Bacteria 3385
92 Ga0070713_100147092 3300005436 Bacteria 2092
93 Ga0070713_100167892 3300005436 Bacteria 1964
94 Ga0070710_10090533 3300005437 Unclassified 1803
95 Ga0070701_10063364 3300005438 Bacteria 1956
96 Ga0070711_100072603 3300005439 Bacteria 2428
97 Ga0070711_100153467 3300005439 Bacteria 1739
98 Ga0070700_100040629 3300005441 Bacteria 2848
99 Ga0070700_100044616 3300005441 Bacteria 2732
100 Ga0070700_100100475 3300005441 Bacteria 1905
101 Ga0070694_100040041 3300005444 Bacteria 3122
102 Ga0070708_100000024 3300005445 Bacteria 104177
103 Ga0070663_100008355 3300005455 Bacteria 6361
104 Ga0070663_100021824 3300005455 Bacteria 4266
105 Ga0070663_100038762 3300005455 Bacteria 3326
106 Ga0070678_100059962 3300005456 Bacteria 2799
107 Ga0070662_100004241 3300005457 Bacteria 9041
108 Ga0070662_100033053 3300005457 Unclassified 3640
109 Ga0070662_100033697 3300005457 Bacteria 3608
110 Ga0070662_100209385 3300005457 Bacteria 1551
111 Ga0070681_10000119 3300005458 Bacteria 59101
112 Ga0070681_10001192 3300005458 Bacteria 22531
113 Ga0070681_10011247 3300005458 Bacteria 8854
114 Ga0070681_10011256 3300005458 Bacteria 8849
115 Ga0070681_10012112 3300005458 Bacteria 8552
116 Ga0070681_10012713 3300005458 Bacteria 8355
117 Ga0070681_10166556 3300005458 Bacteria 2126
118 Ga0070681_10277655 3300005458 Bacteria 1586
119 Ga0068867_100187417 3300005459 Unclassified 1649
120 Ga0070706_100033519 3300005467 Bacteria 4740
121 Ga0070698_100010365 3300005471 Bacteria 9952
122 Ga0070698_100026323 3300005471 Bacteria 6054
123 Ga0070698_100197923 3300005471 Bacteria 1945
124 Ga0070699_100034453 3300005518 Bacteria 4376
125 Ga0070679_100000066 3300005530 Bacteria 78387
126 Ga0070679_100001382 3300005530 Bacteria 21375
127 Ga0070679_100003354 3300005530 Bacteria 14675
128 Ga0070679_100003412 3300005530 Bacteria 14549
129 Ga0070679_100027193 3300005530 Bacteria 5627
130 Ga0070679_100046894 3300005530 Bacteria 4308
131 Ga0070679_100084719 3300005530 Bacteria 3157
132 Ga0070679_100115196 3300005530 Bacteria 2673
133 Ga0070679_100176109 3300005530 Bacteria 2111
134 Ga0070679_100226461 3300005530 Bacteria 1830
135 Ga0070679_100262834 3300005530 Bacteria 1681
136 Ga0070679_100271332 3300005530 Bacteria 1650
137 Ga0070679_100280753 3300005530 Bacteria 1618
138 Ga0070684_100005054 3300005535 Bacteria 10070
139 Ga0070684_100005381 3300005535 Bacteria 9807
140 Ga0070684_100009052 3300005535 Bacteria 7826
141 Ga0070684_100022465 3300005535 Bacteria 5262
142 Ga0070684_100024204 3300005535 Bacteria 5090
143 Ga0070684_100075181 3300005535 Unclassified 2979
144 Ga0070684_100076346 3300005535 Bacteria 2957
145 Ga0070684_100077151 3300005535 Bacteria 2942
146 Ga0070684_100118273 3300005535 Bacteria 2382
147 Ga0070684_100294503 3300005535 Bacteria 1488
148 Ga0068853_100048373 3300005539 Bacteria 3653
149 Ga0068853_100055729 3300005539 Bacteria 3407
150 Ga0068853_100074201 3300005539 Bacteria 2968
151 Ga0068853_100098265 3300005539 Unclassified 2585
152 Ga0070672_100004646 3300005543 Bacteria 8998
153 Ga0070672_100052796 3300005543 Bacteria 3175
154 Ga0070672_100071515 3300005543 Bacteria 2760
155 Ga0070672_100080035 3300005543 Unclassified 2617
156 Ga0070672_100490400 3300005543 Bacteria 1062
157 Ga0070695_100001852 3300005545 Bacteria 11939
158 Ga0070693_100005385 3300005547 Bacteria 6138
159 Ga0070693_100006308 3300005547 Bacteria 5747
160 Ga0070665_100024001 3300005548 Bacteria 6140
161 Ga0070704_100101741 3300005549 Unclassified 2166
162 Ga0070704_100192926 3300005549 Bacteria 1639
163 Ga0068855_100026559 3300005563 Bacteria 6927
164 Ga0068855_100029474 3300005563 Bacteria 6560
165 Ga0068855_100044173 3300005563 Bacteria 5275
166 Ga0068855_100206108 3300005563 Bacteria 2212
167 Ga0070664_100010557 3300005564 Bacteria 7487
168 Ga0070664_100013933 3300005564 Bacteria 6555
169 Ga0070664_100015468 3300005564 Bacteria 6241
170 Ga0070664_100018942 3300005564 Bacteria 5660
171 Ga0070664_100024285 3300005564 Bacteria 5013
172 Ga0070664_100028779 3300005564 Bacteria 4626
173 Ga0070664_100043630 3300005564 Bacteria 3784
174 Ga0070664_100091040 3300005564 Bacteria 2640
175 Ga0070664_100102986 3300005564 Bacteria 2485
176 Ga0070664_100214932 3300005564 Bacteria 1719
177 Ga0070664_100282996 3300005564 Bacteria 1496
178 Ga0070664_100523699 3300005564 Bacteria 1094
179 Ga0068857_100007641 3300005577 Bacteria 9312
180 Ga0068857_100014570 3300005577 Bacteria 6858
181 Ga0068857_100014785 3300005577 Bacteria 6810
182 Ga0068856_100002006 3300005614 Bacteria 21232
183 Ga0068856_100014375 3300005614 Bacteria 7652
184 Ga0068856_100018036 3300005614 Bacteria 6844
185 Ga0070702_100000558 3300005615 Bacteria 13581
186 Ga0068852_100026491 3300005616 Bacteria 4714
187 Ga0068852_100035480 3300005616 Bacteria 4161
188 Ga0068852_100037150 3300005616 Bacteria 4081
189 Ga0068859_100005085 3300005617 Bacteria 13363
190 Ga0068859_100023584 3300005617 Bacteria 6175
191 Ga0068859_100060965 3300005617 Bacteria 3801
192 Ga0068864_100008399 3300005618 Bacteria 8521
193 Ga0068864_100455442 3300005618 Bacteria 1224
194 Ga0068866_10149984 3300005718 Bacteria 1349
195 Ga0068861_100018071 3300005719 Bacteria 5014
196 Ga0068870_10002264 3300005840 Bacteria 7991
197 Ga0068870_10052716 3300005840 Bacteria 2158
198 Ga0068863_100007732 3300005841 Bacteria 10513
199 Ga0068863_100083253 3300005841 Bacteria 3031
200 Ga0068863_100306132 3300005841 Unclassified 1542
201 Ga0068858_100027910 3300005842 Bacteria 5244
202 Ga0068858_100453532 3300005842 Bacteria 1236
203 Ga0068860_100008276 3300005843 Bacteria 10352
204 Ga0068860_100077426 3300005843 Unclassified 3162
205 Ga0068860_100151798 3300005843 Bacteria 2231
206 Ga0068862_100000563 3300005844 Bacteria 38630
207 Ga0068862_100016777 3300005844 Bacteria 6097
208 Ga0068862_100044961 3300005844 Unclassified 3767
209 Ga0068862_100068810 3300005844 Bacteria 3055
210 Ga0081539_10062495 3300005985 Bacteria 2035
211 Ga0070717_10005342 3300006028 Bacteria 9365
212 Ga0070717_10271348 3300006028 Unclassified 1503
213 Ga0097621_100095933 3300006237 Unclassified 2488
214 Ga0068871_100004583 3300006358 Bacteria 9638
215 Ga0068871_100328105 3300006358 Unclassified 1349
216 Ga0075428_100092576 3300006844 Bacteria 3296
217 Ga0075428_100392764 3300006844 Unclassified 1487
218 Ga0075430_100002009 3300006846 Bacteria 16757
219 Ga0075430_100019563 3300006846 Bacteria 5759
220 Ga0075430_100241307 3300006846 Bacteria 1497
221 Ga0075431_100005920 3300006847 Bacteria 12096
222 Ga0075431_100041102 3300006847 Bacteria 4767
223 Ga0075431_100065851 3300006847 Bacteria 3740
224 Ga0075431_100212459 3300006847 Bacteria 1976
225 Ga0075431_100350061 3300006847 Bacteria 1485
226 Ga0075433_10002539 3300006852 Bacteria 13904
227 Ga0075434_100010409 3300006871 Bacteria 8717
228 Ga0075434_100055851 3300006871 Bacteria 3924
229 Ga0075434_100059637 3300006871 Bacteria 3793
230 Ga0075434_100094626 3300006871 Bacteria 2992
231 Ga0075434_100118868 3300006871 Unclassified 2657
232 Ga0075434_100195571 3300006871 Unclassified 2042
233 Ga0075434_100208109 3300006871 Bacteria 1977
234 Ga0075429_100025615 3300006880 Bacteria 5120
235 Ga0075429_100031901 3300006880 Bacteria 4580
236 Ga0075429_100044871 3300006880 Bacteria 3845
237 Ga0075429_100237587 3300006880 Bacteria 1596
238 Ga0068865_100019307 3300006881 Bacteria 4410
239 Ga0068865_100026342 3300006881 Bacteria 3833
240 Ga0075436_100027536 3300006914 Bacteria 3911
241 Ga0075436_100072530 3300006914 Bacteria 2382
242 Ga0097620_100005085 3300006931 Bacteria 13363
243 Ga0097620_100023584 3300006931 Bacteria 6175
244 Ga0097620_100060955 3300006931 Bacteria 3801
245 Ga0075435_100171464 3300007076 Bacteria 1831
246 Ga0105240_10032537 3300009093 Bacteria 6752
247 Ga0105240_10066320 3300009093 Bacteria 4479
248 Ga0105240_10094276 3300009093 Bacteria 3652
249 Ga0105240_10433805 3300009093 Bacteria 1474
250 Ga0111539_10016990 3300009094 Bacteria 9005
251 Ga0111539_10118385 3300009094 Bacteria 3105
252 Ga0111539_10574112 3300009094 Unclassified 1313
253 Ga0105245_10004657 3300009098 Bacteria 12123
254 Ga0105245_10230918 3300009098 Bacteria 1789
255 Ga0114129_10016042 3300009147 Bacteria 10654
256 Ga0114129_10018210 3300009147 Bacteria 10000
257 Ga0114129_10041097 3300009147 Bacteria 6518
258 Ga0114129_10382224 3300009147 Bacteria 1859
259 Ga0105243_10059148 3300009148 Bacteria 3057
260 Ga0105243_10166298 3300009148 Bacteria 1906
261 Ga0105241_10059640 3300009174 Bacteria 2934
262 Ga0105241_10189441 3300009174 Unclassified 1711
263 Ga0105242_10066442 3300009176 Bacteria 2978
264 Ga0105242_10068259 3300009176 Unclassified 2941
265 Ga0105248_10003619 3300009177 Bacteria 17144
266 Ga0105248_10027477 3300009177 Bacteria 6335
267 Ga0105248_10102481 3300009177 Unclassified 3226
268 Ga0105248_10111900 3300009177 Bacteria 3080
269 Ga0105248_10112466 3300009177 Bacteria 3071
270 Ga0105248_10433165 3300009177 Bacteria 1481
271 Ga0105238_10004021 3300009551 Bacteria 14586
272 Ga0105238_10029562 3300009551 Bacteria 5582
273 Ga0105249_10000133 3300009553 Bacteria 98005
274 Ga0105249_10000662 3300009553 Bacteria 31249
275 Ga0105249_10005645 3300009553 Bacteria 10826
276 Ga0099796_10018133 3300010159 Bacteria 2109
277 Ga0105239_10020462 3300010375 Bacteria 7299
278 Ga0105239_10116400 3300010375 Unclassified 2966
279 Ga0105246_10003077 3300011119 Bacteria 10132
280 Ga0157373_10010157 3300013100 Bacteria 6936
281 Ga0157373_10021338 3300013100 Bacteria 4704
282 Ga0157373_10028435 3300013100 Bacteria 4033
283 Ga0157371_10009393 3300013102 Bacteria 7701
284 Ga0157371_10025629 3300013102 Bacteria 4295
285 Ga0157371_10033766 3300013102 Bacteria 3674
286 Ga0157371_10203293 3300013102 Bacteria 1420
287 Ga0157370_10006918 3300013104 Bacteria 12400
288 Ga0157370_10008158 3300013104 Bacteria 11325
289 Ga0157370_10026219 3300013104 Bacteria 5758
290 Ga0157370_10038898 3300013104 Bacteria 4600
291 Ga0157369_10015385 3300013105 Bacteria 8626
292 Ga0157369_10016784 3300013105 Bacteria 8229
293 Ga0157369_10034675 3300013105 Bacteria 5536
294 Ga0157369_10055735 3300013105 Bacteria 4267
295 Ga0157369_10084620 3300013105 Unclassified 3390
296 Ga0157369_10127726 3300013105 Bacteria 2694
297 Ga0157369_10146712 3300013105 Bacteria 2495
298 Ga0157369_10183652 3300013105 Bacteria 2200
299 Ga0157369_10543221 3300013105 Bacteria 1201
300 Ga0157374_10073904 3300013296 Bacteria 3218
301 Ga0157374_10199297 3300013296 Bacteria 1960
302 Ga0157378_10214060 3300013297 Bacteria 1828
303 Ga0157378_10237091 3300013297 Bacteria 1741
304 Ga0163162_10021469 3300013306 Bacteria 6359
305 Ga0163162_10189061 3300013306 Unclassified 2186
306 Ga0163162_10265521 3300013306 Unclassified 1848
307 Ga0157372_10003051 3300013307 Bacteria 18053
308 Ga0157372_10012575 3300013307 Bacteria 9014
309 Ga0157372_10025436 3300013307 Bacteria 6436
310 Ga0157372_10033314 3300013307 Bacteria 5657
311 Ga0157372_10040174 3300013307 Bacteria 5165
312 Ga0157372_10042027 3300013307 Bacteria 5055
313 Ga0157372_10077526 3300013307 Bacteria 3754
314 Ga0157372_10093733 3300013307 Bacteria 3418
315 Ga0157372_10109041 3300013307 Bacteria 3170
316 Ga0157372_10149850 3300013307 Bacteria 2691
317 Ga0157372_10323170 3300013307 Bacteria 1797
318 Ga0157372_10476717 3300013307 Bacteria 1455
319 Ga0157372_10555109 3300013307 Unclassified 1339
320 Ga0157375_10006374 3300013308 Bacteria 10286
321 Ga0157375_10036954 3300013308 Bacteria 4675
322 Ga0157375_10051129 3300013308 Bacteria 4057
323 Ga0157375_10070807 3300013308 Bacteria 3499
324 Ga0157375_10084533 3300013308 Bacteria 3222
325 Ga0157375_10225077 3300013308 Unclassified 2035
326 Ga0157375_10416172 3300013308 Bacteria 1510
327 Ga0163163_10022697 3300014325 Bacteria 5946
328 Ga0157380_10001269 3300014326 Bacteria 16396
329 Ga0157380_10047019 3300014326 Bacteria 3391
330 Ga0157380_10104727 3300014326 Bacteria 2364
331 Ga0182008_10001887 3300014497 Bacteria 13616
332 Ga0157377_10003414 3300014745 Bacteria 7188
333 Ga0157377_10009008 3300014745 Bacteria 4886
334 Ga0157379_10009985 3300014968 Bacteria 8273
335 Ga0157376_10012034 3300014969 Bacteria 6404
336 Ga0157376_10119725 3300014969 Bacteria 2331
337 Ga0157376_10399703 3300014969 Unclassified 1328
338 Ga0163161_10005930 3300017792 Bacteria 8468
339 Ga0206354_10083716 3300020081 Bacteria 2294
340 Ga0213876_10001912 3300021384 Bacteria 12505
341 Ga0213876_10026985 3300021384 Bacteria 3031
342 Ga0207697_10033385 3300025315 Bacteria 2106
343 Ga0207656_10013681 3300025321 Bacteria 3107
344 Ga0207680_10064904 3300025903 Bacteria 2240
345 Ga0207699_10009835 3300025906 Bacteria 4779
346 Ga0207699_10047210 3300025906 Bacteria 2524
347 Ga0207645_10005607 3300025907 Bacteria 9077
348 Ga0207645_10006068 3300025907 Bacteria 8689
349 Ga0207643_10041895 3300025908 Bacteria 2581
350 Ga0207705_10015020 3300025909 Bacteria 5567
351 Ga0207705_10069417 3300025909 Bacteria 2552
352 Ga0207705_10093179 3300025909 Bacteria 2208
353 Ga0207705_10167514 3300025909 Bacteria 1653
354 Ga0207684_10101209 3300025910 Bacteria 2463
355 Ga0207654_10048996 3300025911 Bacteria 2420
356 Ga0207707_10001516 3300025912 Bacteria 21421
357 Ga0207707_10003111 3300025912 Bacteria 14731
358 Ga0207707_10003275 3300025912 Bacteria 14385
359 Ga0207707_10004812 3300025912 Bacteria 11842
360 Ga0207707_10032034 3300025912 Bacteria 4602
361 Ga0207707_10159479 3300025912 Unclassified 1972
362 Ga0207707_10183193 3300025912 Bacteria 1828
363 Ga0207695_10008489 3300025913 Bacteria 12844
364 Ga0207695_10036015 3300025913 Bacteria 5355
365 Ga0207695_10054884 3300025913 Bacteria 4157
366 Ga0207693_10004234 3300025915 Bacteria 12168
367 Ga0207693_10010340 3300025915 Bacteria 7575
368 Ga0207693_10318559 3300025915 Bacteria 1217
369 Ga0207663_10039106 3300025916 Bacteria 2872
370 Ga0207663_10131359 3300025916 Bacteria 1731
371 Ga0207660_10000015 3300025917 Bacteria 79088
372 Ga0207660_10003814 3300025917 Bacteria 9820
373 Ga0207660_10007775 3300025917 Bacteria 6940
374 Ga0207660_10028138 3300025917 Bacteria 3843
375 Ga0207660_10045397 3300025917 Bacteria 3095
376 Ga0207660_10090639 3300025917 Bacteria 2266
377 Ga0207660_10104415 3300025917 Bacteria 2122
378 Ga0207662_10001456 3300025918 Bacteria 11485
379 Ga0207657_10003620 3300025919 Bacteria 16467
380 Ga0207657_10019361 3300025919 Bacteria 6466
381 Ga0207657_10120649 3300025919 Bacteria 2157
382 Ga0207657_10162028 3300025919 Bacteria 1816
383 Ga0207657_10206843 3300025919 Bacteria 1576
384 Ga0207649_10001109 3300025920 Bacteria 16344
385 Ga0207649_10004268 3300025920 Bacteria 7780
386 Ga0207649_10020418 3300025920 Bacteria 3799
387 Ga0207652_10002383 3300025921 Bacteria 15874
388 Ga0207652_10019280 3300025921 Bacteria 5608
389 Ga0207652_10034855 3300025921 Bacteria 4244
390 Ga0207652_10036295 3300025921 Bacteria 4167
391 Ga0207652_10040876 3300025921 Bacteria 3939
392 Ga0207652_10050915 3300025921 Unclassified 3549
393 Ga0207652_10055427 3300025921 Bacteria 3409
394 Ga0207652_10065106 3300025921 Bacteria 3155
395 Ga0207652_10128860 3300025921 Bacteria 2255
396 Ga0207646_10173081 3300025922 Unclassified 1950
397 Ga0207681_10008681 3300025923 Bacteria 6204
398 Ga0207681_10069098 3300025923 Unclassified 2456
399 Ga0207681_10187552 3300025923 Bacteria 1580
400 Ga0207694_10000020 3300025924 Bacteria 310240
401 Ga0207694_10020485 3300025924 Bacteria 5003
402 Ga0207694_10121204 3300025924 Bacteria 2088
403 Ga0207694_10286233 3300025924 Bacteria 1355
404 Ga0207650_10005451 3300025925 Bacteria 8686
405 Ga0207650_10018343 3300025925 Bacteria 4910
406 Ga0207650_10038997 3300025925 Bacteria 3472
407 Ga0207650_10262835 3300025925 Bacteria 1400
408 Ga0207659_10019929 3300025926 Bacteria 4424
409 Ga0207659_10020893 3300025926 Bacteria 4336
410 Ga0207659_10053962 3300025926 Bacteria 2869
411 Ga0207687_10002121 3300025927 Bacteria 13548
412 Ga0207687_10019639 3300025927 Bacteria 4478
413 Ga0207700_10000601 3300025928 Bacteria 21049
414 Ga0207700_10011250 3300025928 Bacteria 5697
415 Ga0207700_10314522 3300025928 Bacteria 1355
416 Ga0207664_10041483 3300025929 Bacteria 3585
417 Ga0207664_10055110 3300025929 Bacteria 3154
418 Ga0207664_10060871 3300025929 Bacteria 3010
419 Ga0207664_10080967 3300025929 Bacteria 2641
420 Ga0207664_10150218 3300025929 Bacteria 1978
421 Ga0207644_10037448 3300025931 Bacteria 3413
422 Ga0207690_10009752 3300025932 Bacteria 5705
423 Ga0207690_10009969 3300025932 Bacteria 5642
424 Ga0207706_10000155 3300025933 Bacteria 75598
425 Ga0207706_10021799 3300025933 Bacteria 5751
426 Ga0207706_10082578 3300025933 Bacteria 2824
427 Ga0207686_10051080 3300025934 Bacteria 2574
428 Ga0207670_10094161 3300025936 Bacteria 2124
429 Ga0207670_10237253 3300025936 Bacteria 1403
430 Ga0207669_10081984 3300025937 Unclassified 2069
431 Ga0207669_10148534 3300025937 Bacteria 1638
432 Ga0207704_10015704 3300025938 Bacteria 3868
433 Ga0207704_10039945 3300025938 Bacteria 2738
434 Ga0207704_10242019 3300025938 Bacteria 1349
435 Ga0207691_10001667 3300025940 Bacteria 21972
436 Ga0207691_10002873 3300025940 Bacteria 16783
437 Ga0207691_10051864 3300025940 Bacteria 3748
438 Ga0207691_10076454 3300025940 Bacteria 3017
439 Ga0207691_10083064 3300025940 Bacteria 2876
440 Ga0207691_10153754 3300025940 Unclassified 2022
441 Ga0207711_10062541 3300025941 Bacteria 3210
442 Ga0207711_10122026 3300025941 Unclassified 2327
443 Ga0207689_10002528 3300025942 Bacteria 16994
444 Ga0207689_10026578 3300025942 Bacteria 4849
445 Ga0207689_10052931 3300025942 Unclassified 3344
446 Ga0207661_10001218 3300025944 Bacteria 17203
447 Ga0207661_10001484 3300025944 Bacteria 15869
448 Ga0207661_10004649 3300025944 Bacteria 9615
449 Ga0207661_10029599 3300025944 Bacteria 4208
450 Ga0207661_10030228 3300025944 Bacteria 4170
451 Ga0207661_10036321 3300025944 Bacteria 3845
452 Ga0207661_10036765 3300025944 Bacteria 3825
453 Ga0207661_10056093 3300025944 Bacteria 3162
454 Ga0207661_10056723 3300025944 Bacteria 3145
455 Ga0207661_10092237 3300025944 Bacteria 2525
456 Ga0207661_10198756 3300025944 Unclassified 1761
457 Ga0207661_10239702 3300025944 Bacteria 1609
458 Ga0207679_10001557 3300025945 Bacteria 14345
459 Ga0207679_10002457 3300025945 Bacteria 11407
460 Ga0207679_10004253 3300025945 Bacteria 8897
461 Ga0207679_10005859 3300025945 Bacteria 7717
462 Ga0207679_10010095 3300025945 Bacteria 6070
463 Ga0207679_10032647 3300025945 Bacteria 3658
464 Ga0207679_10342587 3300025945 Bacteria 1300
465 Ga0207667_10031049 3300025949 Bacteria 5771
466 Ga0207667_10035036 3300025949 Bacteria 5387
467 Ga0207667_10040067 3300025949 Bacteria 4988
468 Ga0207667_10049996 3300025949 Bacteria 4412
469 Ga0207667_10082511 3300025949 Unclassified 3330
470 Ga0207667_10085208 3300025949 Bacteria 3271
471 Ga0207667_10176364 3300025949 Bacteria 2196
472 Ga0207651_10036591 3300025960 Unclassified 3206
473 Ga0207651_10047786 3300025960 Unclassified 2888
474 Ga0207651_10298038 3300025960 Bacteria 1340
475 Ga0207712_10000098 3300025961 Bacteria 99232
476 Ga0207712_10006052 3300025961 Bacteria 7630
477 Ga0207712_10006933 3300025961 Bacteria 7148
478 Ga0207712_10054232 3300025961 Bacteria 2815
479 Ga0207668_10004444 3300025972 Bacteria 8236
480 Ga0207668_10022463 3300025972 Bacteria 4040
481 Ga0207668_10115466 3300025972 Unclassified 2022
482 Ga0207668_10308656 3300025972 Bacteria 1308
483 Ga0207658_10034360 3300025986 Bacteria 3624
484 Ga0207703_10111400 3300026035 Bacteria 2336
485 Ga0207639_10014233 3300026041 Bacteria 5587
486 Ga0207639_10017698 3300026041 Bacteria 5053
487 Ga0207639_10051221 3300026041 Unclassified 3140
488 Ga0207639_10087937 3300026041 Bacteria 2478
489 Ga0207639_10152823 3300026041 Bacteria 1935
490 Ga0207639_10197106 3300026041 Bacteria 1724
491 Ga0207678_10065631 3300026067 Bacteria 3116
492 Ga0207678_10067512 3300026067 Unclassified 3069
493 Ga0207708_10049485 3300026075 Bacteria 3200
494 Ga0207708_10054665 3300026075 Bacteria 3044
495 Ga0207708_10135588 3300026075 Bacteria 1928
496 Ga0207708_10215516 3300026075 Unclassified 1536
497 Ga0207702_10004386 3300026078 Bacteria 12569
498 Ga0207702_10123904 3300026078 Bacteria 2317
499 Ga0207702_10246561 3300026078 Unclassified 1676
500 Ga0207641_10006591 3300026088 Bacteria 9756
501 Ga0207641_10116238 3300026088 Unclassified 2380
502 Ga0207641_10122881 3300026088 Bacteria 2320
503 Ga0207641_10169066 3300026088 Unclassified 1994
504 Ga0207648_10016415 3300026089 Bacteria 6765
505 Ga0207648_10022484 3300026089 Bacteria 5660
506 Ga0207648_10122403 3300026089 Bacteria 2288
507 Ga0207648_10334173 3300026089 Bacteria 1363
508 Ga0207676_10002872 3300026095 Bacteria 12275
509 Ga0207676_10141081 3300026095 Bacteria 2063
510 Ga0207676_10320237 3300026095 Bacteria 1423
511 Ga0207676_10423341 3300026095 Bacteria 1249
512 Ga0207674_10000809 3300026116 Bacteria 40695
513 Ga0207674_10001550 3300026116 Bacteria 29596
514 Ga0207674_10001551 3300026116 Bacteria 29595
515 Ga0207674_10015403 3300026116 Bacteria 8400
516 Ga0207674_10017983 3300026116 Bacteria 7700
517 Ga0207674_10026402 3300026116 Bacteria 6169
518 Ga0207674_10109385 3300026116 Bacteria 2740
519 Ga0207675_100001026 3300026118 Bacteria 27652
520 Ga0207675_100163441 3300026118 Unclassified 2125
521 Ga0207675_100174751 3300026118 Viruses 2055
522 Ga0207675_100242322 3300026118 Bacteria 1743
523 Ga0207683_10039859 3300026121 Bacteria 4098
524 Ga0207683_10116397 3300026121 Bacteria 2396
525 Ga0207683_10188451 3300026121 Unclassified 1872
526 Ga0207698_10004902 3300026142 Bacteria 8208
527 Ga0207698_10018642 3300026142 Bacteria 4736
528 Ga0207698_10033827 3300026142 Bacteria 3719
529 Ga0207698_10039732 3300026142 Bacteria 3488
530 Ga0207698_10068467 3300026142 Unclassified 2803
531 Ga0207698_10651159 3300026142 Bacteria 1044
532 Ga0209966_1006371 3300027695 Bacteria 2046
533 Ga0209998_10000274 3300027717 Bacteria 16290
534 Ga0209974_10024251 3300027876 Bacteria 2007
535 Ga0207428_10096596 3300027907 Unclassified 2288
536 Ga0207428_10190486 3300027907 Bacteria 1546
537 Ga0207428_10235367 3300027907 Bacteria 1369
538 Ga0268266_10040493 3300028379 Bacteria 3971
539 Ga0268266_10231605 3300028379 Bacteria 1702
540 Ga0268265_10003561 3300028380 Bacteria 11130
541 Ga0268265_10025393 3300028380 Bacteria 4204
542 Ga0268265_10167716 3300028380 Unclassified 1873
543 Ga0268264_10062479 3300028381 Unclassified 3127
544 Ga0268264_10487534 3300028381 Bacteria 1200
545 Ga0265337_1004238 3300028556 Bacteria 5997
546 Ga0265337_1015539 3300028556 Bacteria 2489
547 Ga0265337_1029943 3300028556 Bacteria 1625
548 Ga0265326_10003616 3300028558 Bacteria 5052
549 Ga0265319_1000161 3300028563 Bacteria 50866
550 Ga0265334_10000919 3300028573 Bacteria 14702
551 Ga0265334_10007271 3300028573 Bacteria 4750
552 Ga0265318_10002008 3300028577 Bacteria 11278
553 Ga0265322_10039859 3300028654 Bacteria 1337
554 Ga0265336_10039431 3300028666 Bacteria 1448
555 Ga0265338_10007668 3300028800 Bacteria 13304
556 Ga0265338_10050207 3300028800 Bacteria 3773
557 Ga0265338_10055085 3300028800 Bacteria 3540
558 Ga0265330_10000006 3300031235 Bacteria 215296
559 Ga0265332_10000057 3300031238 Bacteria 102893
560 Ga0265332_10008139 3300031238 Bacteria 4715
561 Ga0265325_10018846 3300031241 Bacteria 3824
562 Ga0265329_10005906 3300031242 Bacteria 4907
563 Ga0265340_10024591 3300031247 Unclassified 3058
564 Ga0265331_10007368 3300031250 Bacteria 6374
565 Ga0265316_10000023 3300031344 Bacteria 172893
566 Ga0307408_100007627 3300031548 Bacteria 7156
567 Ga0307408_100095341 3300031548 Bacteria 2255
568 Ga0316575_10021565 3300031665 Bacteria 2480
569 Ga0316579_10001523 3300031691 Bacteria 8436
570 Ga0265314_10000019 3300031711 Bacteria 326248
571 Ga0265342_10000010 3300031712 Bacteria 210877
572 Ga0265342_10020882 3300031712 Bacteria 4190
573 Ga0316576_10004250 3300031727 Bacteria 8558
574 Ga0316576_10029267 3300031727 Bacteria 3892
575 Ga0316578_10004047 3300031728 Bacteria 6850
576 Ga0316578_10135330 3300031728 Bacteria 1483
577 Ga0307405_10030236 3300031731 Bacteria 3174
578 Ga0307405_10082186 3300031731 Bacteria 2108
579 Ga0307405_10137179 3300031731 Bacteria 1700
580 Ga0307405_10222094 3300031731 Bacteria 1387
581 Ga0316577_10001255 3300031733 Bacteria 11834
582 Ga0307413_10068731 3300031824 Bacteria 2220
583 Ga0307413_10071638 3300031824 Bacteria 2185
584 Ga0307413_10112627 3300031824 Bacteria 1824
585 Ga0307410_10040121 3300031852 Bacteria 3079
586 Ga0307410_10051378 3300031852 Bacteria 2778
587 Ga0307410_10053205 3300031852 Bacteria 2739
588 Ga0307406_10001667 3300031901 Bacteria 12207
589 Ga0307406_10019878 3300031901 Bacteria 3946
590 Ga0307406_10132277 3300031901 Unclassified 1753
591 Ga0307406_10230829 3300031901 Bacteria 1382
592 Ga0307407_10040280 3300031903 Bacteria 2604
593 Ga0307407_10060474 3300031903 Unclassified 2211
594 Ga0307412_10005921 3300031911 Bacteria 6892
595 Ga0307412_10006175 3300031911 Bacteria 6753
596 Ga0307412_10262565 3300031911 Bacteria 1347
597 Ga0307409_100017363 3300031995 Bacteria 4793
598 Ga0307409_100074067 3300031995 Unclassified 2719
599 Ga0307409_100086010 3300031995 Bacteria 2558
600 Ga0307416_100033976 3300032002 Bacteria 3874
601 Ga0307416_100055905 3300032002 Bacteria 3181
602 Ga0307416_100082932 3300032002 Bacteria 2718
603 Ga0307416_100123655 3300032002 Bacteria 2313
604 Ga0307416_100225804 3300032002 Bacteria 1801
605 Ga0307416_100640336 3300032002 Unclassified 1147
606 Ga0307414_10137754 3300032004 Bacteria 1906
607 Ga0307411_10060531 3300032005 Unclassified 2515
608 Ga0307411_10115990 3300032005 Bacteria 1927
609 Ga0307415_100042972 3300032126 Unclassified 3012
610 Ga0307415_100161989 3300032126 Unclassified 1735
611 Ga0307415_100241510 3300032126 Bacteria 1461
612 Ga0316583_10000021 3300032133 Bacteria 29938
613 Ga0316580_10005912 3300032139 Bacteria 3591
614 Ga0373926_0000731 3300035083 Bacteria 9111
615 Ga0373934_0002803 3300035086 Bacteria 6387
616 Ga0373934_0035797 3300035086 Unclassified 1954
617 Ga0373939_0056675 3300035114 Bacteria 1234
618 Ga0373953_0004240 3300035117 Unclassified 4552
619 Ga0373956_0008121 3300035119 Bacteria 4247
620 Ga0373957_0021116 3300035120 Bacteria 2308
621 Ga0373943_0024931 3300035170 Bacteria 2792
622 Ga0373943_0052615 3300035170 Bacteria 2008
623 Ga0373955_0024317 3300035172 Bacteria 3097
624 Ga0373955_0042205 3300035172 Bacteria 2448
625 Ga0373955_0065489 3300035172 Bacteria 2017
626 Ga0373955_0181796 3300035172 Bacteria 1248
627 Ga0373955_0217716 3300035172 Bacteria 1140
628 Ga0316574_0062057 3300035398 Bacteria 2348
629 Ga0316574_0102126 3300035398 Bacteria 1836
630 Ga0316574_0105154 3300035398 Bacteria 1808
631 Ga0316574_0152560 3300035398 Bacteria 1488
632 Ga0373931_0002236 3300035691 Bacteria 8557
633 Ga0373935_0138346 3300035692 Unclassified 1643
634 Ga0373927_0163695 3300035695 Unclassified 1458
635 Ga0373933_0008609 3300035724 Bacteria 5565
636 Ga0373947_0002620 3300035725 Bacteria 10799
637 Ga0373947_0046564 3300035725 Bacteria 2597
638 Ga0373937_0008385 3300036401 Bacteria 8979
639 Ga0373937_0008633 3300036401 Bacteria 8852
640 Ga0373937_0047280 3300036401 Bacteria 3937
641 Ga0373937_0136061 3300036401 Bacteria 2297
642 Ga0373937_0140843 3300036401 Bacteria 2256
643 Ga0373937_0195111 3300036401 Bacteria 1903
644 Ga0316582_0004354 3300036647 Bacteria 7133
645 Ga0316582_0015735 3300036647 Bacteria 4336
646 Ga0316584_0000036 3300036712 Bacteria 48276
647 Ga0316584_0011426 3300036712 Bacteria 6238
648 Ga0316584_0103924 3300036712 Bacteria 2126
649 Ga0373925_0002987 3300037068 Bacteria 13332
650 Ga0373925_0065811 3300037068 Bacteria 2731
651 Ga0395899_0054189 3300037312 Bacteria 2968
652 Ga0395900_0019850 3300037418 Bacteria 6851
653 Ga0395905_0004652 3300037471 Bacteria 14191
654 Ga0395905_0208661 3300037471 Bacteria 1831
655 Ga0316581_0016270 3300037588 Unclassified 2134
656 Ga0395901_0005373 3300038443 Bacteria 12953
657 Ga0400486_30464 3300038742 Unclassified 1112
658 Ga0400489_04212 3300039093 Unclassified 1590
659 Ga0436365_0164142 3300039437 Bacteria 22278
660 Ga0436365_0320936 3300039437 Bacteria 1236
661 Ga0436365_0521568 3300039437 Unclassified 3623
662 Ga0436365_0812650 3300039437 Bacteria 3046
663 Ga0451787_068143 3300041441 Unclassified 1037
664 Ga0451800_1055042 3300041459 Bacteria 1956
665 Ga0439433_0024824 3300041999 Unclassified 1352
666 Ga0439462_0042386 3300042015 Bacteria 1216
667 Ga0439446_0029089 3300042156 Bacteria 1594
668 Ga0451577_0000001 3300042876 Bacteria 2461803
669 Ga0451577_0003144 3300042876 Bacteria 18597
670 Ga0451577_0012030 3300042876 Bacteria 8144
671 Ga0451577_0092077 3300042876 Bacteria 2707
672 Ga0451577_0228310 3300042876 Bacteria 1683
673 Ga0466966_0011886 3300044684 Bacteria 5767
674 Ga0466963_0142898 3300044694 Bacteria 1659
675 Ga0453684_0000132 3300044712 Bacteria 331157
676 Ga0453684_0001936 3300044712 Bacteria 53406
677 Ga0453684_0028229 3300044712 Bacteria 8018
678 Ga0453684_0068150 3300044712 Bacteria 4519
679 Ga0453684_0074978 3300044712 Bacteria 4255
680 Ga0466959_0055220 3300045049 Unclassified 2900
681 Ga0451576_0008152 3300045051 Bacteria 12334
682 Ga0451576_0019886 3300045051 Bacteria 7323
683 Ga0451576_0020415 3300045051 Bacteria 7216
684 Ga0451576_0055803 3300045051 Bacteria 4132
685 Ga0451576_0279479 3300045051 Bacteria 1746
686 Ga0466958_0138440 3300045836 Bacteria 1532
687 Ga0466967_0138127 3300045976 Bacteria 2268
688 Ga0495592_0024160 3300046454 Bacteria 4620
689 Ga0495603_0002982 3300046455 Bacteria 10011
690 Ga0495603_0027422 3300046455 Bacteria 3438
691 Ga0495629_0066215 3300046459 Bacteria 2521
692 Ga0495629_0095829 3300046459 Bacteria 2070
693 Ga0495629_0125581 3300046459 Bacteria 1787
694 Ga0495651_0012210 3300046462 Bacteria 6615
695 Ga0495651_0043458 3300046462 Bacteria 3487
696 Ga0495651_0113749 3300046462 Bacteria 1997
697 Ga0495653_0019406 3300046463 Bacteria 5513
698 Ga0495580_0005679 3300046472 Bacteria 10261
699 Ga0495580_0028551 3300046472 Bacteria 4055
700 Ga0495582_0005504 3300046473 Bacteria 7053
701 Ga0495582_0009433 3300046473 Bacteria 5375
702 Ga0495582_0021050 3300046473 Bacteria 3571
703 Ga0495582_0023600 3300046473 Bacteria 3365
704 Ga0495639_0000704 3300046475 Bacteria 15302
705 Ga0495639_0022193 3300046475 Unclassified 2783
706 Ga0495664_0018129 3300046477 Bacteria 4027
707 Ga0495664_0071612 3300046477 Unclassified 2070
708 Ga0495594_0004139 3300046499 Bacteria 7452
709 Ga0495594_0007835 3300046499 Bacteria 5492
710 Ga0495594_0008344 3300046499 Bacteria 5336
711 Ga0495594_0034729 3300046499 Bacteria 2744
712 Ga0495608_0013916 3300046511 Bacteria 5583
713 Ga0495608_0029791 3300046511 Unclassified 3699
714 Ga0495608_0042808 3300046511 Bacteria 3027
715 Ga0495608_0093653 3300046511 Bacteria 1941
716 Ga0495618_0002382 3300046514 Bacteria 12097
717 Ga0495618_0019341 3300046514 Bacteria 4189
718 Ga0495628_0005937 3300046516 Bacteria 10685
719 Ga0495628_0070342 3300046516 Bacteria 2728
720 Ga0495628_0072022 3300046516 Bacteria 2693
721 Ga0495628_0097241 3300046516 Bacteria 2274
722 Ga0495630_0014259 3300046517 Bacteria 5787
723 Ga0495630_0059822 3300046517 Bacteria 2859
724 Ga0495630_0065124 3300046517 Bacteria 2738
725 Ga0495643_0000249 3300046522 Bacteria 79178
726 Ga0495666_0021697 3300046526 Bacteria 3178
727 Ga0495652_0053520 3300046529 Bacteria 3440
728 Ga0495652_0058304 3300046529 Bacteria 3269
729 Ga0495665_0001067 3300046531 Bacteria 14571
730 Ga0495665_0009112 3300046531 Bacteria 5379
731 Ga0495665_0011106 3300046531 Bacteria 4875
732 Ga0495665_0142276 3300046531 Bacteria 1253
733 Ga0495640_0017040 3300046533 Bacteria 5422
734 Ga0495586_0002088 3300046535 Bacteria 10856
735 Ga0495586_0007235 3300046535 Bacteria 5922
736 Ga0495586_0013582 3300046535 Bacteria 4320
737 Ga0495586_0099118 3300046535 Bacteria 1616
738 Ga0495586_0150624 3300046535 Unclassified 1308
739 Ga0495586_0175489 3300046535 Unclassified 1211
740 Ga0495586_0198377 3300046535 Bacteria 1137
741 Ga0495587_0000778 3300046536 Bacteria 21285
742 Ga0495587_0007410 3300046536 Bacteria 7106
743 Ga0495587_0010356 3300046536 Bacteria 5939
744 Ga0495645_0000693 3300046543 Bacteria 23140
745 Ga0495645_0015144 3300046543 Bacteria 5482
746 Ga0495645_0040476 3300046543 Bacteria 3399
747 Ga0495645_0055755 3300046543 Bacteria 2870
748 Ga0495645_0067933 3300046543 Bacteria 2574
749 Ga0495645_0122432 3300046543 Bacteria 1830
750 Ga0495645_0312270 3300046543 Bacteria 1023
751 Ga0495667_0006744 3300046559 Bacteria 7791
752 Ga0495667_0069316 3300046559 Bacteria 2301
753 Ga0495635_0004505 3300046663 Bacteria 9651
754 Ga0495635_0011934 3300046663 Bacteria 6086
755 Ga0495659_0000687 3300046664 Bacteria 12225
756 Ga0495588_0001415 3300046674 Bacteria 10249
757 Ga0495588_0098669 3300046674 Bacteria 1534
758 Ga0495657_0015202 3300046675 Bacteria 5636
759 Ga0495657_0129942 3300046675 Bacteria 1578
760 Ga0495599_0004117 3300046678 Bacteria 8585
761 Ga0495599_0007818 3300046678 Bacteria 6489
762 Ga0495599_0010839 3300046678 Bacteria 5585
763 Ga0495599_0013143 3300046678 Bacteria 5116
764 Ga0495599_0032011 3300046678 Bacteria 3301
765 Ga0495599_0105902 3300046678 Bacteria 1752
766 Ga0495623_0002993 3300046679 Bacteria 11115
767 Ga0495623_0013570 3300046679 Bacteria 5280
768 Ga0495623_0069957 3300046679 Bacteria 2186
769 Ga0495623_0085078 3300046679 Bacteria 1951
770 Ga0495646_0035286 3300046680 Bacteria 3103
771 Ga0495646_0051771 3300046680 Unclassified 2483
772 Ga0495647_0018682 3300046681 Bacteria 2472
773 Ga0495658_0001668 3300046683 Bacteria 11553
774 Ga0495658_0003108 3300046683 Bacteria 8284
775 Ga0495658_0043441 3300046683 Bacteria 2514
776 Ga0495658_0085899 3300046683 Bacteria 1855
777 Ga0495613_0004936 3300046689 Bacteria 10021
778 Ga0495613_0005287 3300046689 Bacteria 9700
779 Ga0495613_0111318 3300046689 Bacteria 1972
780 Ga0495624_0053630 3300046690 Bacteria 2545
781 Ga0495600_0003030 3300046809 Bacteria 9812
782 Ga0495600_0019873 3300046809 Bacteria 4293
783 Ga0495600_0022976 3300046809 Bacteria 4010
784 Ga0495600_0127759 3300046809 Unclassified 1653
785 Ga0495581_0000809 3300047315 Bacteria 16635
786 Ga0495581_0019533 3300047315 Bacteria 3932
787 Ga0495581_0062390 3300047315 Bacteria 2153
788 Ga0495581_0277521 3300047315 Bacteria 980
789 Ga0495604_0005420 3300047317 Bacteria 10117
790 Ga0495604_0075934 3300047317 Bacteria 2529
791 Ga0495604_0132104 3300047317 Bacteria 1793
792 Ga0495674_0006248 3300047319 Bacteria 11431
793 Ga0495674_0007711 3300047319 Bacteria 10282
794 Ga0495674_0011877 3300047319 Bacteria 8209
795 Ga0495674_0026894 3300047319 Bacteria 5262
796 Ga0495674_0139436 3300047319 Bacteria 2039
797 Ga0495672_0047261 3300047320 Bacteria 2561
798 Ga0495680_0001042 3300047322 Bacteria 30684
799 Ga0495680_0025992 3300047322 Bacteria 4835
800 Ga0495680_0033497 3300047322 Bacteria 4158
801 Ga0495675_0007997 3300047444 Bacteria 6541
802 Ga0495675_0046723 3300047444 Bacteria 2756
803 Ga0495675_0165219 3300047444 Bacteria 1361
804 Ga0495684_0005933 3300047471 Bacteria 9491
805 Ga0495684_0054724 3300047471 Bacteria 3043
806 Ga0495684_0072477 3300047471 Unclassified 2617
807 Ga0495684_0082616 3300047471 Bacteria 2437
808 Ga0495684_0219635 3300047471 Bacteria 1394
809 Ga0495593_0002738 3300047673 Bacteria 10610
810 Ga0495602_0003786 3300048088 Bacteria 15729
811 Ga0495602_0048921 3300048088 Bacteria 3793
812 Ga0495602_0075894 3300048088 Bacteria 2851
813 Ga0495602_0094817 3300048088 Bacteria 2465
814 Ga0495614_0000708 3300048089 Bacteria 14038
815 Ga0496104_0073425 3300048907 Bacteria 3255
816 Ga0496109_0143407 3300048912 Bacteria 2234
817 Ga0496109_0230039 3300048912 Bacteria 1744
818 Ga0496109_0679926 3300048912 Unclassified 967
819 Ga0496112_0021609 3300048915 Bacteria 6121
820 Ga0496112_0333312 3300048915 Bacteria 1461
821 Ga0496113_0040616 3300048916 Bacteria 3429
822 Ga0501031_0133171 3300049568 Bacteria 1624
823 Ga0501033_0005653 3300049570 Bacteria 9877
824 Ga0501034_0003782 3300049571 Bacteria 17079
825 Ga0501034_0071629 3300049571 Bacteria 3476
826 Ga0501034_0523522 3300049571 Bacteria 1097
827 Ga0501036_0117710 3300049572 Bacteria 2244
828 Ga0501040_0190029 3300049576 Bacteria 1457
829 Ga0501041_0022108 3300049577 Bacteria 3809
830 Ga0501041_0074157 3300049577 Bacteria 2091
831 Ga0501042_0079590 3300049578 Bacteria 2348
832 Ga0501043_0042806 3300049579 Bacteria 3559
833 Ga0501043_0064822 3300049579 Unclassified 2869
834 Ga0501043_0144005 3300049579 Bacteria 1866
835 Ga0501046_0086357 3300049580 Bacteria 2419
836 Ga0501046_0111244 3300049580 Bacteria 2092
837 Ga0501046_0171874 3300049580 Bacteria 1626
838 Ga0501047_0002652 3300049581 Bacteria 17033
839 Ga0501047_0007988 3300049581 Bacteria 9977
840 Ga0501047_0072927 3300049581 Bacteria 3305
841 Ga0501047_0119107 3300049581 Bacteria 2522
842 Ga0501048_0025852 3300049582 Bacteria 4277
843 Ga0501071_0040223 3300049587 Bacteria 3345
844 Ga0501071_0264526 3300049587 Bacteria 1299
845 Ga0501072_0066376 3300049588 Bacteria 2846
846 Ga0501072_0068431 3300049588 Bacteria 2803
847 Ga0501072_0203100 3300049588 Bacteria 1580
848 Ga0501074_0044063 3300049590 Bacteria 3231
849 Ga0501074_0076166 3300049590 Bacteria 2408
850 Ga0501075_0076978 3300049591 Bacteria 2524
851 Ga0501075_0225159 3300049591 Bacteria 1430
852 Ga0501076_0076129 3300049592 Bacteria 2691
853 Ga0501076_0161366 3300049592 Bacteria 1826
854 Ga0501076_0412731 3300049592 Bacteria 1111
855 Ga0501235_016965 3300049669 Unclassified 1610
856 Ga0501259_005763 3300049688 Unclassified 1967
857 Ga0501079_0072898 3300049741 Bacteria 2654
858 Ga0501079_0075862 3300049741 Bacteria 2600
859 Ga0501080_0032533 3300049742 Bacteria 4865
860 Ga0501080_0046841 3300049742 Bacteria 4025
861 Ga0501080_0114460 3300049742 Unclassified 2501
862 Ga0501081_0008109 3300049743 Bacteria 6816
863 Ga0501081_0017211 3300049743 Bacteria 4782
864 Ga0501268_000435 3300049765 Unclassified 4502
865 Ga0501268_020257 3300049765 Bacteria 1132
866 Ga0501270_001697 3300049767 Unclassified 2157
867 Ga0501035_0034312 3300049822 Bacteria 4611
868 Ga0501044_0001375 3300049823 Bacteria 28520
869 Ga0501044_0004890 3300049823 Bacteria 14973
870 Ga0501044_0026721 3300049823 Bacteria 6109
871 Ga0501044_0294074 3300049823 Bacteria 1555
872 Ga0501045_0013793 3300049824 Bacteria 5714
873 Ga0501045_0130981 3300049824 Bacteria 1864
874 nmdc:mga05p37_25234_c1 3300050507 Bacteria 7227
875 nmdc:mga09592_17168_c1 3300050508 Bacteria 5927
876 nmdc:mga09592_20657_c1 3300050508 Bacteria 5418
877 nmdc:mga09592_206955_c1 3300050508 Bacteria 1699
878 nmdc:mga09592_67409_c1 3300050508 Bacteria 3035
879 nmdc:mga09592_72272_c1 3300050508 Unclassified 2929
880 nmdc:mga0qj67_196918_c1 3300050509 Bacteria 1637
881 nmdc:mga0qj67_24652_c1 3300050509 Bacteria 4640
882 nmdc:mga0qj67_3124_c1 3300050509 Bacteria 11922
883 nmdc:mga0qj67_64380_c1 3300050509 Unclassified 2916
884 nmdc:mga06r32_100161_c1 3300050510 Bacteria 2842
885 nmdc:mga06r32_209184_c1 3300050510 Bacteria 1939
886 nmdc:mga06r32_217302_c1 3300050510 Bacteria 1899
887 nmdc:mga06r32_50553_c1 3300050510 Bacteria 3976
888 nmdc:mga06r32_99343_c1 3300050510 Unclassified 2854
889 nmdc:mga08y16_127858_c1 3300050511 Bacteria 2643
890 nmdc:mga08y16_15652_c1 3300050511 Bacteria 7975
891 nmdc:mga08y16_211857_c1 3300050511 Unclassified 2007
892 nmdc:mga0n895_23636_c1 3300050512 Bacteria 5780
893 nmdc:mga0n895_25229_c1 3300050512 Bacteria 5614
894 nmdc:mga0n895_48397_c1 3300050512 Bacteria 4161
895 nmdc:mga0n895_49920_c1 3300050512 Bacteria 4102
896 nmdc:mga0rr50_357190_c1 3300050513 Bacteria 1229
897 nmdc:mga0rr50_94518_c1 3300050513 Bacteria 2335
898 nmdc:mga08x19_15238_c2 3300050514 Bacteria 3833
899 nmdc:mga08x19_84009_c1 3300050514 Bacteria 2094
900 nmdc:mga0a205_301813_c1 3300050515 Unclassified 1474
901 nmdc:mga0a205_44896_c1 3300050515 Bacteria 3576
902 Ga0495601_0053274 3300053077 Bacteria 2557
903 Ga0495601_0166955 3300053077 Bacteria 1438
904 Ga0495612_0006380 3300053078 Unclassified 4854
905 Ga0495595_0020340 3300053084 Bacteria 2889
906 Ga0495619_0082773 3300053085 Bacteria 2163
907 Ga0501082_0142423 3300060353 Bacteria 2081
908 Ga0307406_10223985
909 Ga0065712_10003029
910 Ga0065712_10138054
911 Ga0065712_10149732
912 Ga0070658_10009375
913 Ga0070658_10014406
914 Ga0070658_10094457
915 Ga0070658_10196858
916 Ga0070676_10008782
917 Ga0070683_100003005
918 Ga0070683_100006639
919 Ga0070683_100018701
920 Ga0070683_100030201
921 Ga0070683_100048126
922 Ga0070683_100060072
923 Ga0070683_100086600
924 Ga0070683_100220952
925 Ga0070683_100254090
926 Ga0070690_100011725
927 Ga0070690_100032100
928 Ga0070690_100049302
929 Ga0070670_100013576
930 Ga0070670_100041223
931 Ga0070670_100133419
932 Ga0070677_10079024
933 Ga0070677_10088784
934 Ga0068869_100024550
935 Ga0068869_100056894
936 Ga0068869_100228568
937 Ga0070680_100001244
938 Ga0070680_100002160
939 Ga0070680_100002198
940 Ga0070680_100002238
941 Ga0070680_100067711
942 Ga0070680_100091770
943 Ga0070682_100005851
944 Ga0068868_100016583
945 Ga0070660_100003351
946 Ga0070660_100148056
947 Ga0070660_100177660
948 Ga0070689_100007804
949 Ga0070689_100043212
950 Ga0070689_100116121
951 Ga0070689_100149006
952 Ga0070691_10012993
953 Ga0070661_100003761
954 Ga0070661_100004963
955 Ga0070661_100010690
956 Ga0070661_100016018
957 Ga0070661_100053819
958 Ga0070661_100218014
959 Ga0070661_100289918
960 Ga0070668_100002904
961 Ga0070668_100023889
962 Ga0070668_100032312
963 Ga0070668_100051041
964 Ga0070668_100082635
965 Ga0070668_100133282
966 Ga0070669_100019178
967 Ga0070669_100039291
968 Ga0070669_100063110
969 Ga0070669_100109364
970 Ga0070675_100001661
971 Ga0070675_100002764
972 Ga0070675_100009557
973 Ga0070671_100037881
974 Ga0070671_100090433
975 Ga0070671_100184589
976 Ga0070674_100020405
977 Ga0070674_100105008
978 Ga0070673_100010604
979 Ga0070673_100069622
980 Ga0070688_100035262
981 Ga0070688_100061124
982 Ga0070688_100072297
983 Ga0070659_100001454
984 Ga0070659_100006033
985 Ga0070659_100023795
986 Ga0070667_100014476
987 Ga0070667_100098838
988 Ga0070709_10023328
989 Ga0070709_10036117
990 Ga0070714_100000538
991 Ga0070714_100026372
992 Ga0070714_100031913
993 Ga0070714_100078321
994 Ga0070714_100167124
995 Ga0070714_100255502
996 Ga0070713_100000365
997 Ga0070713_100030808
998 Ga0070713_100052178
999 Ga0070713_100147092
1000 Ga0070713_100167892
1001 Ga0070710_10090533
1002 Ga0070701_10063364
1003 Ga0070711_100072603
1004 Ga0070711_100153467
1005 Ga0070700_100040629
1006 Ga0070700_100044616
1007 Ga0070700_100100475
1008 Ga0070694_100040041
1009 Ga0070708_100000024
1010 Ga0070663_100008355
1011 Ga0070663_100021824
1012 Ga0070663_100038762
1013 Ga0070678_100059962
1014 Ga0070662_100004241
1015 Ga0070662_100033053
1016 Ga0070662_100033697
1017 Ga0070662_100209385
1018 Ga0070681_10000119
1019 Ga0070681_10001192
1020 Ga0070681_10011247
1021 Ga0070681_10011256
1022 Ga0070681_10012112
1023 Ga0070681_10012713
1024 Ga0070681_10166556
1025 Ga0070681_10277655
1026 Ga0068867_100187417
1027 Ga0070706_100033519
1028 Ga0070698_100010365
1029 Ga0070698_100026323
1030 Ga0070698_100197923
1031 Ga0070699_100034453
1032 Ga0070679_100000066
1033 Ga0070679_100001382
1034 Ga0070679_100003354
1035 Ga0070679_100003412
1036 Ga0070679_100027193
1037 Ga0070679_100046894
1038 Ga0070679_100084719
1039 Ga0070679_100115196
1040 Ga0070679_100176109
1041 Ga0070679_100226461
1042 Ga0070679_100262834
1043 Ga0070679_100271332
1044 Ga0070679_100280753
1045 Ga0070684_100005054
1046 Ga0070684_100005381
1047 Ga0070684_100009052
1048 Ga0070684_100022465
1049 Ga0070684_100024204
1050 Ga0070684_100075181
1051 Ga0070684_100076346
1052 Ga0070684_100077151
1053 Ga0070684_100118273
1054 Ga0070684_100294503
1055 Ga0068853_100048373
1056 Ga0068853_100055729
1057 Ga0068853_100074201
1058 Ga0068853_100098265
1059 Ga0070672_100004646
1060 Ga0070672_100052796
1061 Ga0070672_100071515
1062 Ga0070672_100080035
1063 Ga0070672_100490400
1064 Ga0070695_100001852
1065 Ga0070693_100005385
1066 Ga0070693_100006308
1067 Ga0070665_100024001
1068 Ga0070704_100101741
1069 Ga0070704_100192926
1070 Ga0068855_100026559
1071 Ga0068855_100029474
1072 Ga0068855_100044173
1073 Ga0068855_100206108
1074 Ga0070664_100010557
1075 Ga0070664_100013933
1076 Ga0070664_100015468
1077 Ga0070664_100018942
1078 Ga0070664_100024285
1079 Ga0070664_100028779
1080 Ga0070664_100043630
1081 Ga0070664_100091040
1082 Ga0070664_100102986
1083 Ga0070664_100214932
1084 Ga0070664_100282996
1085 Ga0070664_100523699
1086 Ga0068857_100007641
1087 Ga0068857_100014570
1088 Ga0068857_100014785
1089 Ga0068856_100002006
1090 Ga0068856_100014375
1091 Ga0068856_100018036
1092 Ga0070702_100000558
1093 Ga0068852_100026491
1094 Ga0068852_100035480
1095 Ga0068852_100037150
1096 Ga0068859_100005085
1097 Ga0068859_100023584
1098 Ga0068859_100060965
1099 Ga0068864_100008399
1100 Ga0068864_100455442
1101 Ga0068866_10149984
1102 Ga0068861_100018071
1103 Ga0068870_10002264
1104 Ga0068870_10052716
1105 Ga0068863_100007732
1106 Ga0068863_100083253
1107 Ga0068863_100306132
1108 Ga0068858_100027910
1109 Ga0068858_100453532
1110 Ga0068860_100008276
1111 Ga0068860_100077426
1112 Ga0068860_100151798
1113 Ga0068862_100000563
1114 Ga0068862_100016777
1115 Ga0068862_100044961
1116 Ga0068862_100068810
1117 Ga0081539_10062495
1118 Ga0070717_10005342
1119 Ga0070717_10271348
1120 Ga0097621_100095933
1121 Ga0068871_100004583
1122 Ga0068871_100328105
1123 Ga0075428_100092576
1124 Ga0075428_100392764
1125 Ga0075430_100002009
1126 Ga0075430_100019563
1127 Ga0075430_100241307
1128 Ga0075431_100005920
1129 Ga0075431_100041102
1130 Ga0075431_100065851
1131 Ga0075431_100212459
1132 Ga0075431_100350061
1133 Ga0075433_10002539
1134 Ga0075434_100010409
1135 Ga0075434_100055851
1136 Ga0075434_100059637
1137 Ga0075434_100094626
1138 Ga0075434_100118868
1139 Ga0075434_100195571
1140 Ga0075434_100208109
1141 Ga0075429_100025615
1142 Ga0075429_100031901
1143 Ga0075429_100044871
1144 Ga0075429_100237587
1145 Ga0068865_100019307
1146 Ga0068865_100026342
1147 Ga0075436_100027536
1148 Ga0075436_100072530
1149 Ga0097620_100005085
1150 Ga0097620_100023584
1151 Ga0097620_100060955
1152 Ga0075435_100171464
1153 Ga0105240_10032537
1154 Ga0105240_10066320
1155 Ga0105240_10094276
1156 Ga0105240_10433805
1157 Ga0111539_10016990
1158 Ga0111539_10118385
1159 Ga0111539_10574112
1160 Ga0105245_10004657
1161 Ga0105245_10230918
1162 Ga0114129_10016042
1163 Ga0114129_10018210
1164 Ga0114129_10041097
1165 Ga0114129_10382224
1166 Ga0105243_10059148
1167 Ga0105243_10166298
1168 Ga0105241_10059640
1169 Ga0105241_10189441
1170 Ga0105242_10066442
1171 Ga0105242_10068259
1172 Ga0105248_10003619
1173 Ga0105248_10027477
1174 Ga0105248_10102481
1175 Ga0105248_10111900
1176 Ga0105248_10112466
1177 Ga0105248_10433165
1178 Ga0105238_10004021
1179 Ga0105238_10029562
1180 Ga0105249_10000133
1181 Ga0105249_10000662
1182 Ga0105249_10005645
1183 Ga0099796_10018133
1184 Ga0105239_10020462
1185 Ga0105239_10116400
1186 Ga0105246_10003077
1187 Ga0157373_10010157
1188 Ga0157373_10021338
1189 Ga0157373_10028435
1190 Ga0157371_10009393
1191 Ga0157371_10025629
1192 Ga0157371_10033766
1193 Ga0157371_10203293
1194 Ga0157370_10006918
1195 Ga0157370_10008158
1196 Ga0157370_10026219
1197 Ga0157370_10038898
1198 Ga0157369_10015385
1199 Ga0157369_10016784
1200 Ga0157369_10034675
1201 Ga0157369_10055735
1202 Ga0157369_10084620
1203 Ga0157369_10127726
1204 Ga0157369_10146712
1205 Ga0157369_10183652
1206 Ga0157369_10543221
1207 Ga0157374_10073904
1208 Ga0157374_10199297
1209 Ga0157378_10214060
1210 Ga0157378_10237091
1211 Ga0163162_10021469
1212 Ga0163162_10189061
1213 Ga0163162_10265521
1214 Ga0157372_10003051
1215 Ga0157372_10012575
1216 Ga0157372_10025436
1217 Ga0157372_10033314
1218 Ga0157372_10040174
1219 Ga0157372_10042027
1220 Ga0157372_10077526
1221 Ga0157372_10093733
1222 Ga0157372_10109041
1223 Ga0157372_10149850
1224 Ga0157372_10323170
1225 Ga0157372_10476717
1226 Ga0157372_10555109
1227 Ga0157375_10006374
1228 Ga0157375_10036954
1229 Ga0157375_10051129
1230 Ga0157375_10070807
1231 Ga0157375_10084533
1232 Ga0157375_10225077
1233 Ga0157375_10416172
1234 Ga0163163_10022697
1235 Ga0157380_10001269
1236 Ga0157380_10047019
1237 Ga0157380_10104727
1238 Ga0182008_10001887
1239 Ga0157377_10003414
1240 Ga0157377_10009008
1241 Ga0157379_10009985
1242 Ga0157376_10012034
1243 Ga0157376_10119725
1244 Ga0157376_10399703
1245 Ga0163161_10005930
1246 Ga0206354_10083716
1247 Ga0213876_10001912
1248 Ga0213876_10026985
1249 Ga0207697_10033385
1250 Ga0207656_10013681
1251 Ga0207680_10064904
1252 Ga0207699_10009835
1253 Ga0207699_10047210
1254 Ga0207645_10005607
1255 Ga0207645_10006068
1256 Ga0207643_10041895
1257 Ga0207705_10015020
1258 Ga0207705_10069417
1259 Ga0207705_10093179
1260 Ga0207705_10167514
1261 Ga0207684_10101209
1262 Ga0207654_10048996
1263 Ga0207707_10001516
1264 Ga0207707_10003111
1265 Ga0207707_10003275
1266 Ga0207707_10004812
1267 Ga0207707_10032034
1268 Ga0207707_10159479
1269 Ga0207707_10183193
1270 Ga0207695_10008489
1271 Ga0207695_10036015
1272 Ga0207695_10054884
1273 Ga0207693_10004234
1274 Ga0207693_10010340
1275 Ga0207693_10318559
1276 Ga0207663_10039106
1277 Ga0207663_10131359
1278 Ga0207660_10000015
1279 Ga0207660_10003814
1280 Ga0207660_10007775
1281 Ga0207660_10028138
1282 Ga0207660_10045397
1283 Ga0207660_10090639
1284 Ga0207660_10104415
1285 Ga0207662_10001456
1286 Ga0207657_10003620
1287 Ga0207657_10019361
1288 Ga0207657_10120649
1289 Ga0207657_10162028
1290 Ga0207657_10206843
1291 Ga0207649_10001109
1292 Ga0207649_10004268
1293 Ga0207649_10020418
1294 Ga0207652_10002383
1295 Ga0207652_10019280
1296 Ga0207652_10034855
1297 Ga0207652_10036295
1298 Ga0207652_10040876
1299 Ga0207652_10050915
1300 Ga0207652_10055427
1301 Ga0207652_10065106
1302 Ga0207652_10128860
1303 Ga0207646_10173081
1304 Ga0207681_10008681
1305 Ga0207681_10069098
1306 Ga0207681_10187552
1307 Ga0207694_10000020
1308 Ga0207694_10020485
1309 Ga0207694_10121204
1310 Ga0207694_10286233
1311 Ga0207650_10005451
1312 Ga0207650_10018343
1313 Ga0207650_10038997
1314 Ga0207650_10262835
1315 Ga0207659_10019929
1316 Ga0207659_10020893
1317 Ga0207659_10053962
1318 Ga0207687_10002121
1319 Ga0207687_10019639
1320 Ga0207700_10000601
1321 Ga0207700_10011250
1322 Ga0207700_10314522
1323 Ga0207664_10041483
1324 Ga0207664_10055110
1325 Ga0207664_10060871
1326 Ga0207664_10080967
1327 Ga0207664_10150218
1328 Ga0207644_10037448
1329 Ga0207690_10009752
1330 Ga0207690_10009969
1331 Ga0207706_10000155
1332 Ga0207706_10021799
1333 Ga0207706_10082578
1334 Ga0207686_10051080
1335 Ga0207670_10094161
1336 Ga0207670_10237253
1337 Ga0207669_10081984
1338 Ga0207669_10148534
1339 Ga0207704_10015704
1340 Ga0207704_10039945
1341 Ga0207704_10242019
1342 Ga0207691_10001667
1343 Ga0207691_10002873
1344 Ga0207691_10051864
1345 Ga0207691_10076454
1346 Ga0207691_10083064
1347 Ga0207691_10153754
1348 Ga0207711_10062541
1349 Ga0207711_10122026
1350 Ga0207689_10002528
1351 Ga0207689_10026578
1352 Ga0207689_10052931
1353 Ga0207661_10001218
1354 Ga0207661_10001484
1355 Ga0207661_10004649
1356 Ga0207661_10029599
1357 Ga0207661_10030228
1358 Ga0207661_10036321
1359 Ga0207661_10036765
1360 Ga0207661_10056093
1361 Ga0207661_10056723
1362 Ga0207661_10092237
1363 Ga0207661_10198756
1364 Ga0207661_10239702
1365 Ga0207679_10001557
1366 Ga0207679_10002457
1367 Ga0207679_10004253
1368 Ga0207679_10005859
1369 Ga0207679_10010095
1370 Ga0207679_10032647
1371 Ga0207679_10342587
1372 Ga0207667_10031049
1373 Ga0207667_10035036
1374 Ga0207667_10040067
1375 Ga0207667_10049996
1376 Ga0207667_10082511
1377 Ga0207667_10085208
1378 Ga0207667_10176364
1379 Ga0207651_10036591
1380 Ga0207651_10047786
1381 Ga0207651_10298038
1382 Ga0207712_10000098
1383 Ga0207712_10006052
1384 Ga0207712_10006933
1385 Ga0207712_10054232
1386 Ga0207668_10004444
1387 Ga0207668_10022463
1388 Ga0207668_10115466
1389 Ga0207668_10308656
1390 Ga0207658_10034360
1391 Ga0207703_10111400
1392 Ga0207639_10014233
1393 Ga0207639_10017698
1394 Ga0207639_10051221
1395 Ga0207639_10087937
1396 Ga0207639_10152823
1397 Ga0207639_10197106
1398 Ga0207678_10065631
1399 Ga0207678_10067512
1400 Ga0207708_10049485
1401 Ga0207708_10054665
1402 Ga0207708_10135588
1403 Ga0207708_10215516
1404 Ga0207702_10004386
1405 Ga0207702_10123904
1406 Ga0207702_10246561
1407 Ga0207641_10006591
1408 Ga0207641_10116238
1409 Ga0207641_10122881
1410 Ga0207641_10169066
1411 Ga0207648_10016415
1412 Ga0207648_10022484
1413 Ga0207648_10122403
1414 Ga0207648_10334173
1415 Ga0207676_10002872
1416 Ga0207676_10141081
1417 Ga0207676_10320237
1418 Ga0207676_10423341
1419 Ga0207674_10000809
1420 Ga0207674_10001550
1421 Ga0207674_10001551
1422 Ga0207674_10015403
1423 Ga0207674_10017983
1424 Ga0207674_10026402
1425 Ga0207674_10109385
1426 Ga0207675_100001026
1427 Ga0207675_100163441
1428 Ga0207675_100174751
1429 Ga0207675_100242322
1430 Ga0207683_10039859
1431 Ga0207683_10116397
1432 Ga0207683_10188451
1433 Ga0207698_10004902
1434 Ga0207698_10018642
1435 Ga0207698_10033827
1436 Ga0207698_10039732
1437 Ga0207698_10068467
1438 Ga0207698_10651159
1439 Ga0209966_1006371
1440 Ga0209998_10000274
1441 Ga0209974_10024251
1442 Ga0207428_10096596
1443 Ga0207428_10190486
1444 Ga0207428_10235367
1445 Ga0268266_10040493
1446 Ga0268266_10231605
1447 Ga0268265_10003561
1448 Ga0268265_10025393
1449 Ga0268265_10167716
1450 Ga0268264_10062479
1451 Ga0268264_10487534
1452 Ga0265337_1004238
1453 Ga0265337_1015539
1454 Ga0265337_1029943
1455 Ga0265326_10003616
1456 Ga0265319_1000161
1457 Ga0265334_10000919
1458 Ga0265334_10007271
1459 Ga0265318_10002008
1460 Ga0265322_10039859
1461 Ga0265336_10039431
1462 Ga0265338_10007668
1463 Ga0265338_10050207
1464 Ga0265338_10055085
1465 Ga0265330_10000006
1466 Ga0265332_10000057
1467 Ga0265332_10008139
1468 Ga0265325_10018846
1469 Ga0265329_10005906
1470 Ga0265340_10024591
1471 Ga0265331_10007368
1472 Ga0265316_10000023
1473 Ga0307408_100007627
1474 Ga0307408_100095341
1475 Ga0316575_10021565
1476 Ga0316579_10001523
1477 Ga0265314_10000019
1478 Ga0265342_10000010
1479 Ga0265342_10020882
1480 Ga0316576_10004250
1481 Ga0316576_10029267
1482 Ga0316578_10004047
1483 Ga0316578_10135330
1484 Ga0307405_10030236
1485 Ga0307405_10082186
1486 Ga0307405_10137179
1487 Ga0307405_10222094
1488 Ga0316577_10001255
1489 Ga0307413_10068731
1490 Ga0307413_10071638
1491 Ga0307413_10112627
1492 Ga0307410_10040121
1493 Ga0307410_10051378
1494 Ga0307410_10053205
1495 Ga0307406_10001667
1496 Ga0307406_10019878
1497 Ga0307406_10132277
1498 Ga0307406_10230829
1499 Ga0307407_10040280
1500 Ga0307407_10060474
1501 Ga0307412_10005921
1502 Ga0307412_10006175
1503 Ga0307412_10262565
1504 Ga0307409_100017363
1505 Ga0307409_100074067
1506 Ga0307409_100086010
1507 Ga0307416_100033976
1508 Ga0307416_100055905
1509 Ga0307416_100082932
1510 Ga0307416_100123655
1511 Ga0307416_100225804
1512 Ga0307416_100640336
1513 Ga0307414_10137754
1514 Ga0307411_10060531
1515 Ga0307411_10115990
1516 Ga0307415_100042972
1517 Ga0307415_100161989
1518 Ga0307415_100241510
1519 Ga0316583_10000021
1520 Ga0316580_10005912
1521 Ga0373926_0000731
1522 Ga0373934_0002803
1523 Ga0373934_0035797
1524 Ga0373939_0056675
1525 Ga0373953_0004240
1526 Ga0373956_0008121
1527 Ga0373957_0021116
1528 Ga0373943_0024931
1529 Ga0373943_0052615
1530 Ga0373955_0024317
1531 Ga0373955_0042205
1532 Ga0373955_0065489
1533 Ga0373955_0181796
1534 Ga0373955_0217716
1535 Ga0316574_0062057
1536 Ga0316574_0102126
1537 Ga0316574_0105154
1538 Ga0316574_0152560
1539 Ga0373931_0002236
1540 Ga0373935_0138346
1541 Ga0373927_0163695
1542 Ga0373933_0008609
1543 Ga0373947_0002620
1544 Ga0373947_0046564
1545 Ga0373937_0008385
1546 Ga0373937_0008633
1547 Ga0373937_0047280
1548 Ga0373937_0136061
1549 Ga0373937_0140843
1550 Ga0373937_0195111
1551 Ga0316582_0004354
1552 Ga0316582_0015735
1553 Ga0316584_0000036
1554 Ga0316584_0011426
1555 Ga0316584_0103924
1556 Ga0373925_0002987
1557 Ga0373925_0065811
1558 Ga0395899_0054189
1559 Ga0395900_0019850
1560 Ga0395905_0004652
1561 Ga0395905_0208661
1562 Ga0316581_0016270
1563 Ga0395901_0005373
1564 Ga0400486_30464
1565 Ga0400489_04212
1566 Ga0436365_0164142
1567 Ga0436365_0320936
1568 Ga0436365_0521568
1569 Ga0436365_0812650
1570 Ga0451787_068143
1571 Ga0451800_1055042
1572 Ga0439433_0024824
1573 Ga0439462_0042386
1574 Ga0439446_0029089
1575 Ga0451577_0000001
1576 Ga0451577_0003144
1577 Ga0451577_0012030
1578 Ga0451577_0092077
1579 Ga0451577_0228310
1580 Ga0466966_0011886
1581 Ga0466963_0142898
1582 Ga0453684_0000132
1583 Ga0453684_0001936
1584 Ga0453684_0028229
1585 Ga0453684_0068150
1586 Ga0453684_0074978
1587 Ga0466959_0055220
1588 Ga0451576_0008152
1589 Ga0451576_0019886
1590 Ga0451576_0020415
1591 Ga0451576_0055803
1592 Ga0451576_0279479
1593 Ga0466958_0138440
1594 Ga0466967_0138127
1595 Ga0495592_0024160
1596 Ga0495603_0002982
1597 Ga0495603_0027422
1598 Ga0495629_0066215
1599 Ga0495629_0095829
1600 Ga0495629_0125581
1601 Ga0495651_0012210
1602 Ga0495651_0043458
1603 Ga0495651_0113749
1604 Ga0495653_0019406
1605 Ga0495580_0005679
1606 Ga0495580_0028551
1607 Ga0495582_0005504
1608 Ga0495582_0009433
1609 Ga0495582_0021050
1610 Ga0495582_0023600
1611 Ga0495639_0000704
1612 Ga0495639_0022193
1613 Ga0495664_0018129
1614 Ga0495664_0071612
1615 Ga0495594_0004139
1616 Ga0495594_0007835
1617 Ga0495594_0008344
1618 Ga0495594_0034729
1619 Ga0495608_0013916
1620 Ga0495608_0029791
1621 Ga0495608_0042808
1622 Ga0495608_0093653
1623 Ga0495618_0002382
1624 Ga0495618_0019341
1625 Ga0495628_0005937
1626 Ga0495628_0070342
1627 Ga0495628_0072022
1628 Ga0495628_0097241
1629 Ga0495630_0014259
1630 Ga0495630_0059822
1631 Ga0495630_0065124
1632 Ga0495643_0000249
1633 Ga0495666_0021697
1634 Ga0495652_0053520
1635 Ga0495652_0058304
1636 Ga0495665_0001067
1637 Ga0495665_0009112
1638 Ga0495665_0011106
1639 Ga0495665_0142276
1640 Ga0495640_0017040
1641 Ga0495586_0002088
1642 Ga0495586_0007235
1643 Ga0495586_0013582
1644 Ga0495586_0099118
1645 Ga0495586_0150624
1646 Ga0495586_0175489
1647 Ga0495586_0198377
1648 Ga0495587_0000778
1649 Ga0495587_0007410
1650 Ga0495587_0010356
1651 Ga0495645_0000693
1652 Ga0495645_0015144
1653 Ga0495645_0040476
1654 Ga0495645_0055755
1655 Ga0495645_0067933
1656 Ga0495645_0122432
1657 Ga0495645_0312270
1658 Ga0495667_0006744
1659 Ga0495667_0069316
1660 Ga0495635_0004505
1661 Ga0495635_0011934
1662 Ga0495659_0000687
1663 Ga0495588_0001415
1664 Ga0495588_0098669
1665 Ga0495657_0015202
1666 Ga0495657_0129942
1667 Ga0495599_0004117
1668 Ga0495599_0007818
1669 Ga0495599_0010839
1670 Ga0495599_0013143
1671 Ga0495599_0032011
1672 Ga0495599_0105902
1673 Ga0495623_0002993
1674 Ga0495623_0013570
1675 Ga0495623_0069957
1676 Ga0495623_0085078
1677 Ga0495646_0035286
1678 Ga0495646_0051771
1679 Ga0495647_0018682
1680 Ga0495658_0001668
1681 Ga0495658_0003108
1682 Ga0495658_0043441
1683 Ga0495658_0085899
1684 Ga0495613_0004936
1685 Ga0495613_0005287
1686 Ga0495613_0111318
1687 Ga0495624_0053630
1688 Ga0495600_0003030
1689 Ga0495600_0019873
1690 Ga0495600_0022976
1691 Ga0495600_0127759
1692 Ga0495581_0000809
1693 Ga0495581_0019533
1694 Ga0495581_0062390
1695 Ga0495581_0277521
1696 Ga0495604_0005420
1697 Ga0495604_0075934
1698 Ga0495604_0132104
1699 Ga0495674_0006248
1700 Ga0495674_0007711
1701 Ga0495674_0011877
1702 Ga0495674_0026894
1703 Ga0495674_0139436
1704 Ga0495672_0047261
1705 Ga0495680_0001042
1706 Ga0495680_0025992
1707 Ga0495680_0033497
1708 Ga0495675_0007997
1709 Ga0495675_0046723
1710 Ga0495675_0165219
1711 Ga0495684_0005933
1712 Ga0495684_0054724
1713 Ga0495684_0072477
1714 Ga0495684_0082616
1715 Ga0495684_0219635
1716 Ga0495593_0002738
1717 Ga0495602_0003786
1718 Ga0495602_0048921
1719 Ga0495602_0075894
1720 Ga0495602_0094817
1721 Ga0495614_0000708
1722 Ga0496104_0073425
1723 Ga0496109_0143407
1724 Ga0496109_0230039
1725 Ga0496109_0679926
1726 Ga0496112_0021609
1727 Ga0496112_0333312
1728 Ga0496113_0040616
1729 Ga0501031_0133171
1730 Ga0501033_0005653
1731 Ga0501034_0003782
1732 Ga0501034_0071629
1733 Ga0501034_0523522
1734 Ga0501036_0117710
1735 Ga0501040_0190029
1736 Ga0501041_0022108
1737 Ga0501041_0074157
1738 Ga0501042_0079590
1739 Ga0501043_0042806
1740 Ga0501043_0064822
1741 Ga0501043_0144005
1742 Ga0501046_0086357
1743 Ga0501046_0111244
1744 Ga0501046_0171874
1745 Ga0501047_0002652
1746 Ga0501047_0007988
1747 Ga0501047_0072927
1748 Ga0501047_0119107
1749 Ga0501048_0025852
1750 Ga0501071_0040223
1751 Ga0501071_0264526
1752 Ga0501072_0066376
1753 Ga0501072_0068431
1754 Ga0501072_0203100
1755 Ga0501074_0044063
1756 Ga0501074_0076166
1757 Ga0501075_0076978
1758 Ga0501075_0225159
1759 Ga0501076_0076129
1760 Ga0501076_0161366
1761 Ga0501076_0412731
1762 Ga0501235_016965
1763 Ga0501259_005763
1764 Ga0501079_0072898
1765 Ga0501079_0075862
1766 Ga0501080_0032533
1767 Ga0501080_0046841
1768 Ga0501080_0114460
1769 Ga0501081_0008109
1770 Ga0501081_0017211
1771 Ga0501268_000435
1772 Ga0501268_020257
1773 Ga0501270_001697
1774 Ga0501035_0034312
1775 Ga0501044_0001375
1776 Ga0501044_0004890
1777 Ga0501044_0026721
1778 Ga0501044_0294074
1779 Ga0501045_0013793
1780 Ga0501045_0130981
1781 nmdc:mga05p37_25234_c1
1782 nmdc:mga09592_17168_c1
1783 nmdc:mga09592_20657_c1
1784 nmdc:mga09592_206955_c1
1785 nmdc:mga09592_67409_c1
1786 nmdc:mga09592_72272_c1
1787 nmdc:mga0qj67_196918_c1
1788 nmdc:mga0qj67_24652_c1
1789 nmdc:mga0qj67_3124_c1
1790 nmdc:mga0qj67_64380_c1
1791 nmdc:mga06r32_100161_c1
1792 nmdc:mga06r32_209184_c1
1793 nmdc:mga06r32_217302_c1
1794 nmdc:mga06r32_50553_c1
1795 nmdc:mga06r32_99343_c1
1796 nmdc:mga08y16_127858_c1
1797 nmdc:mga08y16_15652_c1
1798 nmdc:mga08y16_211857_c1
1799 nmdc:mga0n895_23636_c1
1800 nmdc:mga0n895_25229_c1
1801 nmdc:mga0n895_48397_c1
1802 nmdc:mga0n895_49920_c1
1803 nmdc:mga0rr50_357190_c1
1804 nmdc:mga0rr50_94518_c1
1805 nmdc:mga08x19_15238_c2
1806 nmdc:mga08x19_84009_c1
1807 nmdc:mga0a205_301813_c1
1808 nmdc:mga0a205_44896_c1
1809 Ga0495601_0053274
1810 Ga0495601_0166955
1811 Ga0495612_0006380
1812 Ga0495595_0020340
1813 Ga0495619_0082773
1814 Ga0501082_0142423

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07475

Hpr_kinase_C

HPr Serine kinase C-terminal domain

134

305

0.98

PF02603

Hpr_kinase_N

HPr Serine kinase N terminus

5

132

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kkl-assembly1.cif.gz_C l.casei hprk/p in complex with b.subtilis hpr 0.975 121 296
1kkl-assembly1.cif.gz_B-2 l.casei hprk/p in complex with b.subtilis hpr 0.9711 122 292
1kkm-assembly1.cif.gz_B l.casei hprk/p in complex with b.subtilis p-ser-hpr 0.9679 122 298
1kkl-assembly1.cif.gz_C l.casei hprk/p in complex with b.subtilis hpr 0.9637 121 296
1kkm-assembly1.cif.gz_B l.casei hprk/p in complex with b.subtilis p-ser-hpr 0.9626 122 298
ID Description Score Start End Superfamily
1knxD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9331 122 293 3.40.50.300
1ko7A01 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;HprK N-terminal domain-like 0.9263 15 120 3.40.1390.20
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9257 124 274 3.40.50.300
1knxD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9228 122 293 3.40.50.300
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.902 124 274 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538SZT1-F1-model_v4 HPr(Ser) kinase/phosphorylase N-terminal domain-containing protein 0.9901 2 122 GO:0000155
GO:0005524
GO:0006109
AF-A0A317YKF1-F1-model_v4 HPr kinase/phosphorylase 0.9872 126 211 GO:0000155
GO:0005524
GO:0006109
AF-A0A371IZW4-F1-model_v4 HPr(Ser) kinase/phosphatase 0.9826 130 294 GO:0000155
GO:0005524
GO:0006109
AF-A0A3D3FJ41-F1-model_v4 HPr kinase/phosphorylase 0.9817 117 259 GO:0000155
GO:0005524
GO:0006109
AF-A0A3N5K3D0-F1-model_v4 HPr(Ser) kinase/phosphatase 0.9809 124 288 GO:0000155
GO:0005524
GO:0006109

Map