F485359

General Info

Members Datasets Scaffolds Average Seq Length
907 414 888 313

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10034708|Ga0265314_100347083
Length 329
Sequence MSERLGPPLGAPLFDRLAVIGVGLIGSSIARAAKAQGAAGSIVATARSPATRRRVAELGLADQVVETNAAAVEGADLVIVSIPVGACGPVAKEIAAHLKPGAIVSDVGSVKGSVVRDMAPHLPKTVHFVPAHPVAGTEYSGPDAGFAELFVNRWCILTPPEGTDPAAVEKLATFWRLLGANVETMAPDHHDLVLAVTSHLPHLIAYTIVGTADELQTVTRSEVLKFSAGGFRDFTRIAASDPTMWRDVFLANKDAVLEMLGRFNEDISLLTKAIRNGDGDALFEHFTRTRAIRKGIVQIGQDSASPDFGRPHPDLXXEPLPKPYASDES

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
5 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
6 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
7 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
8 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
9 2854911287 Brucella lupini LUP21 Isolate Unclassified
10 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
11 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
12 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
13 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
14 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
15 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
16 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
17 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
18 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
19 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
20 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
21 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
22 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
23 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
29 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
219 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
223 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
224 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
225 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
226 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
227 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
228 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
229 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
230 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
231 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
232 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
233 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
283 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
291 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
292 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
352 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
353 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
383 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
384 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
390 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
391 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
392 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
393 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
394 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
395 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
396 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
397 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
398 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
399 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
400 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
401 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
402 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
403 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
406 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
409 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
410 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 641522639 Methylobacterium sp. 4-46 Isolate Nodule
414 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0.11
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.09
Nodule 0.22
Rhizoplane 6.95
Rhizosphere 87.32
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000095 3300000041 Bacteria 16151
2 ARSoilYngRDRAFT_c00083 3300000042 Bacteria 15786
3 ARcpr5yngRDRAFT_c000131 3300000043 Bacteria 11784
4 ARSoilOldRDRAFT_c000103 3300000044 Bacteria 15976
5 ARCol0yngRDRAFT_1000133 3300000652 Bacteria 13255
6 JGI24746J21847_1005106 3300001977 Bacteria 2055
7 JGI24739J22299_10014486 3300001989 Bacteria 2869
8 JGI24737J22298_10005379 3300001990 Bacteria 4425
9 JGI24737J22298_10011191 3300001990 Bacteria 2943
10 JGI24745J21846_1001233 3300002073 Bacteria 2461
11 JGI24738J21930_10002375 3300002075 Bacteria 4951
12 JGI24035J26624_1000776 3300002126 Bacteria 3004
13 JGI24742J22300_10000988 3300002244 Bacteria 4363
14 Ga0065712_10006492 3300005290 Bacteria 2793
15 Ga0065715_10108649 3300005293 Bacteria 2707
16 Ga0070658_10017799 3300005327 Bacteria 5682
17 Ga0070658_10048553 3300005327 Bacteria 3437
18 Ga0070658_10069462 3300005327 Bacteria 2882
19 Ga0070658_10088422 3300005327 Bacteria 2551
20 Ga0070676_10006196 3300005328 Bacteria 6386
21 Ga0070676_10131183 3300005328 Bacteria 1585
22 Ga0070683_100018166 3300005329 Bacteria 6223
23 Ga0070683_100032771 3300005329 Bacteria 4734
24 Ga0070690_100005074 3300005330 Bacteria 7380
25 Ga0070690_100012491 3300005330 Bacteria 4997
26 Ga0070690_100066481 3300005330 Bacteria 2334
27 Ga0070670_100037294 3300005331 Bacteria 4182
28 Ga0070670_100098901 3300005331 Bacteria 2510
29 Ga0070677_10000267 3300005333 Bacteria 18125
30 Ga0068869_100000991 3300005334 Bacteria 16479
31 Ga0068869_100097580 3300005334 Bacteria 2219
32 Ga0070666_10008226 3300005335 Bacteria 6464
33 Ga0070680_100007000 3300005336 Bacteria 8594
34 Ga0070680_100008439 3300005336 Bacteria 7888
35 Ga0070680_100076459 3300005336 Bacteria 2756
36 Ga0070680_100102952 3300005336 Bacteria 2371
37 Ga0070680_100121097 3300005336 Bacteria 2184
38 Ga0070680_100409988 3300005336 Bacteria 1156
39 Ga0070682_100002591 3300005337 Bacteria 9989
40 Ga0070660_100014299 3300005339 Bacteria 5715
41 Ga0070660_100191273 3300005339 Bacteria 1658
42 Ga0070689_100010361 3300005340 Bacteria 6646
43 Ga0070689_100015636 3300005340 Bacteria 5538
44 Ga0070689_100143000 3300005340 Bacteria 1925
45 Ga0070689_100256393 3300005340 Bacteria 1444
46 Ga0070687_100000879 3300005343 Bacteria 10108
47 Ga0070661_100017455 3300005344 Bacteria 5092
48 Ga0070661_100239399 3300005344 Bacteria 1397
49 Ga0070692_10173469 3300005345 Bacteria 1244
50 Ga0070668_100072405 3300005347 Bacteria 2685
51 Ga0070669_100071179 3300005353 Bacteria 2572
52 Ga0070669_100075580 3300005353 Bacteria 2499
53 Ga0070675_100010826 3300005354 Bacteria 7133
54 Ga0070675_100066926 3300005354 Bacteria 2972
55 Ga0070674_100044791 3300005356 Bacteria 3019
56 Ga0070674_100140374 3300005356 Bacteria 1813
57 Ga0070673_100001635 3300005364 Bacteria 13265
58 Ga0070673_100031619 3300005364 Bacteria 3975
59 Ga0070688_100018060 3300005365 Bacteria 4062
60 Ga0070688_100050394 3300005365 Bacteria 2593
61 Ga0070688_100069219 3300005365 Bacteria 2252
62 Ga0070659_100063170 3300005366 Bacteria 2929
63 Ga0070667_100001396 3300005367 Bacteria 21599
64 Ga0070667_100114682 3300005367 Bacteria 2339
65 Ga0070703_10010516 3300005406 Bacteria 2609
66 Ga0070709_10000722 3300005434 Bacteria 18707
67 Ga0070709_10029626 3300005434 Bacteria 3276
68 Ga0070709_10164191 3300005434 Bacteria 1547
69 Ga0070714_100008512 3300005435 Bacteria 8018
70 Ga0070714_100059337 3300005435 Bacteria 3280
71 Ga0070714_100150893 3300005435 Bacteria 2094
72 Ga0070713_100000642 3300005436 Bacteria 22311
73 Ga0070713_100036260 3300005436 Bacteria 3978
74 Ga0070713_100083089 3300005436 Bacteria 2737
75 Ga0070710_10020429 3300005437 Bacteria 3436
76 Ga0070701_10044211 3300005438 Bacteria 2281
77 Ga0070701_10089901 3300005438 Bacteria 1680
78 Ga0070711_100029980 3300005439 Bacteria 3596
79 Ga0070711_100044047 3300005439 Bacteria 3027
80 Ga0070711_100049734 3300005439 Bacteria 2871
81 Ga0070711_100110465 3300005439 Bacteria 2017
82 Ga0070711_100118741 3300005439 Bacteria 1952
83 Ga0070705_100014152 3300005440 Bacteria 4098
84 Ga0070705_100058630 3300005440 Bacteria 2276
85 Ga0070700_100004739 3300005441 Bacteria 7133
86 Ga0070700_100036560 3300005441 Bacteria 2979
87 Ga0070694_100041182 3300005444 Bacteria 3080
88 Ga0070694_100051168 3300005444 Bacteria 2787
89 Ga0070694_100109630 3300005444 Bacteria 1965
90 Ga0070663_100016280 3300005455 Bacteria 4824
91 Ga0070663_100047549 3300005455 Bacteria 3039
92 Ga0070663_100134901 3300005455 Bacteria 1878
93 Ga0070678_100002344 3300005456 Bacteria 10343
94 Ga0070662_100009494 3300005457 Bacteria 6362
95 Ga0070662_100043915 3300005457 Bacteria 3200
96 Ga0070662_100234460 3300005457 Bacteria 1469
97 Ga0070681_10004197 3300005458 Bacteria 13650
98 Ga0070681_10064688 3300005458 Bacteria 3627
99 Ga0070681_10068560 3300005458 Bacteria 3513
100 Ga0070681_10100056 3300005458 Bacteria 2845
101 Ga0070681_10271999 3300005458 Bacteria 1606
102 Ga0068867_100012755 3300005459 Bacteria 5946
103 Ga0070685_10012256 3300005466 Bacteria 4500
104 Ga0070679_100092414 3300005530 Bacteria 3013
105 Ga0070679_100374985 3300005530 Bacteria 1369
106 Ga0070679_100382741 3300005530 Bacteria 1354
107 Ga0070684_100026631 3300005535 Bacteria 4872
108 Ga0070697_100193023 3300005536 Bacteria 1729
109 Ga0068853_100051672 3300005539 Bacteria 3538
110 Ga0068853_100103408 3300005539 Bacteria 2521
111 Ga0070672_100001723 3300005543 Bacteria 13671
112 Ga0070686_100011069 3300005544 Bacteria 5109
113 Ga0070686_100030989 3300005544 Bacteria 3266
114 Ga0070695_100131536 3300005545 Bacteria 1725
115 Ga0070695_100185095 3300005545 Bacteria 1478
116 Ga0070696_100059816 3300005546 Bacteria 2663
117 Ga0070696_100084714 3300005546 Bacteria 2249
118 Ga0070693_100002926 3300005547 Bacteria 7888
119 Ga0070693_100017616 3300005547 Bacteria 3717
120 Ga0070693_100288632 3300005547 Bacteria 1101
121 Ga0070665_100041516 3300005548 Bacteria 4624
122 Ga0070704_100005673 3300005549 Bacteria 7291
123 Ga0068855_100061841 3300005563 Bacteria 4373
124 Ga0068855_100202945 3300005563 Bacteria 2231
125 Ga0070664_100056486 3300005564 Bacteria 3335
126 Ga0070664_100091886 3300005564 Bacteria 2627
127 Ga0070664_100103548 3300005564 Bacteria 2478
128 Ga0068857_100029605 3300005577 Bacteria 4832
129 Ga0068857_100092467 3300005577 Bacteria 2708
130 Ga0068854_100004810 3300005578 Bacteria 8523
131 Ga0068856_100000226 3300005614 Bacteria 61246
132 Ga0068856_100004424 3300005614 Bacteria 14002
133 Ga0068856_100077894 3300005614 Bacteria 3286
134 Ga0068856_100226076 3300005614 Bacteria 1887
135 Ga0070702_100080374 3300005615 Bacteria 1951
136 Ga0068852_100092806 3300005616 Bacteria 2704
137 Ga0068852_100171044 3300005616 Bacteria 2036
138 Ga0068852_100248068 3300005616 Bacteria 1704
139 Ga0068852_100271263 3300005616 Bacteria 1633
140 Ga0068859_100051438 3300005617 Bacteria 4141
141 Ga0068859_100098957 3300005617 Bacteria 2971
142 Ga0068864_100026210 3300005618 Bacteria 4915
143 Ga0068866_10004921 3300005718 Bacteria 5492
144 Ga0068866_10217040 3300005718 Bacteria 1152
145 Ga0068861_100002263 3300005719 Bacteria 12509
146 Ga0068861_100028372 3300005719 Bacteria 4083
147 Ga0068870_10000323 3300005840 Bacteria 17781
148 Ga0068858_100021358 3300005842 Bacteria 6047
149 Ga0068858_100030717 3300005842 Bacteria 4989
150 Ga0068858_100036975 3300005842 Bacteria 4526
151 Ga0068858_100107313 3300005842 Bacteria 2606
152 Ga0068860_100001886 3300005843 Bacteria 22272
153 Ga0068860_100102035 3300005843 Bacteria 2737
154 Ga0068860_100136842 3300005843 Bacteria 2352
155 Ga0068862_100001462 3300005844 Bacteria 21734
156 Ga0068862_100047241 3300005844 Bacteria 3673
157 Ga0068862_100308856 3300005844 Bacteria 1457
158 Ga0068862_100401730 3300005844 Bacteria 1282
159 Ga0081455_10000313 3300005937 Bacteria 63616
160 Ga0081455_10029513 3300005937 Bacteria 5000
161 Ga0081455_10062450 3300005937 Bacteria 3131
162 Ga0070717_10001127 3300006028 Bacteria 18067
163 Ga0070717_10026094 3300006028 Bacteria 4657
164 Ga0070717_10120190 3300006028 Bacteria 2250
165 Ga0070715_10013325 3300006163 Bacteria 3017
166 Ga0070716_100004315 3300006173 Bacteria 6777
167 Ga0070712_100002937 3300006175 Bacteria 10561
168 Ga0070712_100118608 3300006175 Bacteria 1987
169 Ga0070712_100255692 3300006175 Bacteria 1402
170 Ga0075367_10052512 3300006178 Bacteria 2413
171 Ga0097621_100006440 3300006237 Bacteria 8336
172 Ga0097621_100108031 3300006237 Bacteria 2349
173 Ga0068871_100004355 3300006358 Bacteria 9840
174 Ga0068871_100005719 3300006358 Bacteria 8729
175 Ga0068871_100041937 3300006358 Bacteria 3671
176 Ga0075430_100002289 3300006846 Bacteria 15872
177 Ga0075433_10049262 3300006852 Bacteria 3665
178 Ga0075433_10260286 3300006852 Bacteria 1538
179 Ga0075434_100038096 3300006871 Bacteria 4762
180 Ga0075434_100044263 3300006871 Bacteria 4416
181 Ga0075434_100065153 3300006871 Bacteria 3628
182 Ga0075434_100143973 3300006871 Bacteria 2404
183 Ga0075434_100147344 3300006871 Bacteria 2374
184 Ga0068865_100021120 3300006881 Bacteria 4232
185 Ga0068865_100160284 3300006881 Bacteria 1715
186 Ga0075436_100013190 3300006914 Bacteria 5667
187 Ga0097620_100051438 3300006931 Bacteria 4141
188 Ga0097620_100098964 3300006931 Bacteria 2971
189 Ga0075435_100012862 3300007076 Bacteria 6206
190 Ga0099795_10003299 3300007788 Bacteria 3974
191 Ga0099795_10022675 3300007788 Bacteria 2075
192 Ga0105240_10023127 3300009093 Bacteria 8229
193 Ga0105240_10102968 3300009093 Bacteria 3469
194 Ga0105240_10374892 3300009093 Bacteria 1608
195 Ga0111539_10002538 3300009094 Bacteria 24172
196 Ga0111539_10007068 3300009094 Bacteria 14397
197 Ga0111539_10020707 3300009094 Bacteria 8099
198 Ga0111539_10324603 3300009094 Bacteria 1791
199 Ga0105245_10775274 3300009098 Bacteria 996
200 Ga0105247_10003784 3300009101 Bacteria 9811
201 Ga0105247_10006797 3300009101 Bacteria 7054
202 Ga0105247_10033503 3300009101 Bacteria 3125
203 Ga0114129_10002965 3300009147 Bacteria 23749
204 Ga0114129_10006052 3300009147 Bacteria 17153
205 Ga0105243_10022668 3300009148 Bacteria 4775
206 Ga0105243_10027142 3300009148 Bacteria 4385
207 Ga0105243_10060557 3300009148 Bacteria 3024
208 Ga0105243_10367606 3300009148 Bacteria 1326
209 Ga0105241_10069695 3300009174 Bacteria 2727
210 Ga0105241_10221355 3300009174 Bacteria 1591
211 Ga0105242_10016257 3300009176 Bacteria 5784
212 Ga0105248_10002716 3300009177 Bacteria 19655
213 Ga0105248_10037966 3300009177 Bacteria 5388
214 Ga0105248_10057751 3300009177 Bacteria 4356
215 Ga0105237_10204320 3300009545 Bacteria 1976
216 Ga0105238_10015798 3300009551 Bacteria 7641
217 Ga0105238_10098322 3300009551 Bacteria 2911
218 Ga0105238_10178680 3300009551 Bacteria 2099
219 Ga0105249_10014021 3300009553 Bacteria 7084
220 Ga0105249_10046857 3300009553 Bacteria 3936
221 Ga0105249_10049985 3300009553 Bacteria 3813
222 Ga0105249_10603471 3300009553 Bacteria 1152
223 Ga0105239_10093887 3300010375 Bacteria 3313
224 Ga0105239_10125513 3300010375 Bacteria 2852
225 Ga0105239_10205243 3300010375 Bacteria 2208
226 Ga0105246_10000456 3300011119 Bacteria 21904
227 Ga0105246_10104698 3300011119 Bacteria 2067
228 Ga0157373_10035903 3300013100 Bacteria 3558
229 Ga0157371_10090061 3300013102 Bacteria 2173
230 Ga0157369_10346545 3300013105 Bacteria 1543
231 Ga0157369_10381609 3300013105 Bacteria 1463
232 Ga0157374_10015579 3300013296 Bacteria 6672
233 Ga0157374_10043090 3300013296 Bacteria 4166
234 Ga0157378_10012584 3300013297 Bacteria 7405
235 Ga0163162_10044487 3300013306 Bacteria 4447
236 Ga0163162_10309248 3300013306 Bacteria 1713
237 Ga0157372_10035536 3300013307 Bacteria 5487
238 Ga0157375_10005758 3300013308 Bacteria 10780
239 Ga0157375_10006049 3300013308 Bacteria 10552
240 Ga0157375_10055984 3300013308 Bacteria 3891
241 Ga0157375_10084758 3300013308 Bacteria 3218
242 Ga0163163_10126013 3300014325 Bacteria 2599
243 Ga0157380_10019473 3300014326 Bacteria 5057
244 Ga0157377_10083516 3300014745 Bacteria 1872
245 Ga0157379_10007196 3300014968 Bacteria 9626
246 Ga0157379_10013988 3300014968 Bacteria 7032
247 Ga0157379_10345840 3300014968 Bacteria 1361
248 Ga0157379_10355408 3300014968 Bacteria 1342
249 Ga0157376_10005756 3300014969 Bacteria 8681
250 Ga0157376_10018772 3300014969 Bacteria 5312
251 Ga0157376_10065841 3300014969 Bacteria 3062
252 Ga0157376_10142542 3300014969 Bacteria 2151
253 Ga0163161_10006245 3300017792 Bacteria 8254
254 Ga0163161_10053352 3300017792 Bacteria 2932
255 Ga0206353_10044632 3300020082 Bacteria 2548
256 Ga0213876_10013044 3300021384 Bacteria 4417
257 Ga0207666_1000483 3300025271 Bacteria 5007
258 Ga0207666_1001877 3300025271 Bacteria 2496
259 Ga0207673_1000591 3300025290 Bacteria 3853
260 Ga0209564_1010473 3300025295 Bacteria 4265
261 Ga0207426_1038120 3300025302 Bacteria 1515
262 Ga0207697_10008842 3300025315 Bacteria 4381
263 Ga0207697_10024058 3300025315 Bacteria 2495
264 Ga0207682_10000143 3300025893 Bacteria 32063
265 Ga0207692_10006694 3300025898 Bacteria 4685
266 Ga0207692_10032171 3300025898 Bacteria 2518
267 Ga0207692_10110690 3300025898 Bacteria 1522
268 Ga0207642_10008803 3300025899 Bacteria 3483
269 Ga0207642_10164011 3300025899 Bacteria 1196
270 Ga0207710_10038796 3300025900 Bacteria 2107
271 Ga0207710_10077566 3300025900 Bacteria 1535
272 Ga0207688_10001469 3300025901 Bacteria 12347
273 Ga0207688_10075359 3300025901 Bacteria 1920
274 Ga0207680_10022035 3300025903 Bacteria 3459
275 Ga0207680_10022742 3300025903 Bacteria 3414
276 Ga0207680_10077345 3300025903 Bacteria 2081
277 Ga0207647_10042117 3300025904 Bacteria 2867
278 Ga0207685_10117244 3300025905 Bacteria 1163
279 Ga0207699_10107335 3300025906 Bacteria 1783
280 Ga0207645_10002217 3300025907 Bacteria 15495
281 Ga0207645_10014177 3300025907 Bacteria 5339
282 Ga0207645_10034551 3300025907 Bacteria 3249
283 Ga0207643_10000336 3300025908 Bacteria 32116
284 Ga0207705_10003687 3300025909 Bacteria 11655
285 Ga0207705_10095154 3300025909 Bacteria 2185
286 Ga0207695_10274419 3300025913 Bacteria 1581
287 Ga0207695_10330798 3300025913 Bacteria 1412
288 Ga0207671_10156696 3300025914 Bacteria 1762
289 Ga0207671_10265686 3300025914 Bacteria 1351
290 Ga0207693_10003360 3300025915 Bacteria 13667
291 Ga0207693_10007237 3300025915 Bacteria 9133
292 Ga0207693_10027357 3300025915 Bacteria 4509
293 Ga0207693_10031159 3300025915 Bacteria 4213
294 Ga0207693_10109587 3300025915 Bacteria 2165
295 Ga0207663_10035519 3300025916 Bacteria 2991
296 Ga0207663_10137394 3300025916 Bacteria 1698
297 Ga0207660_10013553 3300025917 Bacteria 5344
298 Ga0207660_10022567 3300025917 Bacteria 4241
299 Ga0207660_10030666 3300025917 Bacteria 3697
300 Ga0207662_10022126 3300025918 Bacteria 3641
301 Ga0207657_10050255 3300025919 Bacteria 3629
302 Ga0207657_10077116 3300025919 Bacteria 2810
303 Ga0207657_10151445 3300025919 Bacteria 1889
304 Ga0207657_10167779 3300025919 Bacteria 1780
305 Ga0207649_10001348 3300025920 Bacteria 14601
306 Ga0207652_10027823 3300025921 Bacteria 4714
307 Ga0207652_10051777 3300025921 Bacteria 3521
308 Ga0207652_10052592 3300025921 Bacteria 3496
309 Ga0207681_10000782 3300025923 Bacteria 20961
310 Ga0207681_10220025 3300025923 Bacteria 1468
311 Ga0207694_10050122 3300025924 Bacteria 3232
312 Ga0207694_10255551 3300025924 Bacteria 1434
313 Ga0207650_10021793 3300025925 Bacteria 4531
314 Ga0207650_10147269 3300025925 Bacteria 1855
315 Ga0207659_10119646 3300025926 Bacteria 2016
316 Ga0207687_10047719 3300025927 Bacteria 2970
317 Ga0207687_10083224 3300025927 Bacteria 2316
318 Ga0207700_10001518 3300025928 Bacteria 13150
319 Ga0207700_10028277 3300025928 Bacteria 3939
320 Ga0207700_10065496 3300025928 Bacteria 2772
321 Ga0207664_10048993 3300025929 Bacteria 3324
322 Ga0207664_10071944 3300025929 Bacteria 2787
323 Ga0207664_10073474 3300025929 Bacteria 2759
324 Ga0207644_10007899 3300025931 Bacteria 6957
325 Ga0207644_10017834 3300025931 Bacteria 4800
326 Ga0207690_10019650 3300025932 Bacteria 4163
327 Ga0207690_10053988 3300025932 Bacteria 2699
328 Ga0207706_10007938 3300025933 Bacteria 9797
329 Ga0207706_10051355 3300025933 Bacteria 3641
330 Ga0207706_10061120 3300025933 Bacteria 3317
331 Ga0207686_10012238 3300025934 Bacteria 4713
332 Ga0207686_10017860 3300025934 Bacteria 4005
333 Ga0207709_10028191 3300025935 Bacteria 3245
334 Ga0207709_10032780 3300025935 Bacteria 3045
335 Ga0207670_10013045 3300025936 Bacteria 4886
336 Ga0207670_10094086 3300025936 Bacteria 2125
337 Ga0207669_10076620 3300025937 Bacteria 2123
338 Ga0207669_10100444 3300025937 Bacteria 1911
339 Ga0207704_10087197 3300025938 Bacteria 2038
340 Ga0207704_10320976 3300025938 Bacteria 1195
341 Ga0207665_10007323 3300025939 Bacteria 7301
342 Ga0207665_10012708 3300025939 Bacteria 5537
343 Ga0207691_10039514 3300025940 Bacteria 4365
344 Ga0207711_10002949 3300025941 Bacteria 14881
345 Ga0207689_10000929 3300025942 Bacteria 28093
346 Ga0207689_10112248 3300025942 Bacteria 2241
347 Ga0207661_10013325 3300025944 Bacteria 6005
348 Ga0207679_10001711 3300025945 Bacteria 13671
349 Ga0207667_10039139 3300025949 Bacteria 5055
350 Ga0207667_10079202 3300025949 Bacteria 3405
351 Ga0207667_10116137 3300025949 Bacteria 2758
352 Ga0207667_10457678 3300025949 Bacteria 1296
353 Ga0207651_10000218 3300025960 Bacteria 24731
354 Ga0207651_10027633 3300025960 Bacteria 3567
355 Ga0207651_10131464 3300025960 Bacteria 1917
356 Ga0207712_10064867 3300025961 Bacteria 2605
357 Ga0207712_10400520 3300025961 Bacteria 1153
358 Ga0207712_10403384 3300025961 Bacteria 1149
359 Ga0207640_10015886 3300025981 Bacteria 4367
360 Ga0207703_10185066 3300026035 Bacteria 1840
361 Ga0207703_10204039 3300026035 Bacteria 1758
362 Ga0207639_10015755 3300026041 Bacteria 5334
363 Ga0207639_10106278 3300026041 Bacteria 2278
364 Ga0207678_10009656 3300026067 Bacteria 8486
365 Ga0207678_10018073 3300026067 Bacteria 6193
366 Ga0207678_10031495 3300026067 Bacteria 4627
367 Ga0207678_10053209 3300026067 Bacteria 3489
368 Ga0207678_10105993 3300026067 Bacteria 2398
369 Ga0207678_10131872 3300026067 Bacteria 2132
370 Ga0207708_10039114 3300026075 Bacteria 3613
371 Ga0207708_10074019 3300026075 Bacteria 2611
372 Ga0207702_10000191 3300026078 Bacteria 72810
373 Ga0207702_10015377 3300026078 Bacteria 6342
374 Ga0207648_10005804 3300026089 Bacteria 12366
375 Ga0207648_10215844 3300026089 Bacteria 1704
376 Ga0207676_10082624 3300026095 Bacteria 2613
377 Ga0207674_10086803 3300026116 Bacteria 3123
378 Ga0207674_10123605 3300026116 Bacteria 2554
379 Ga0207675_100024105 3300026118 Bacteria 5657
380 Ga0207675_100058013 3300026118 Bacteria 3613
381 Ga0207675_100108485 3300026118 Bacteria 2618
382 Ga0207683_10001206 3300026121 Bacteria 23425
383 Ga0207683_10022893 3300026121 Bacteria 5368
384 Ga0207683_10049783 3300026121 Bacteria 3669
385 Ga0207683_10248106 3300026121 Bacteria 1624
386 Ga0209967_1004774 3300027364 Bacteria 1810
387 Ga0209998_10003154 3300027717 Bacteria 3654
388 Ga0209998_10018948 3300027717 Bacteria 1464
389 Ga0207428_10001593 3300027907 Bacteria 23627
390 Ga0207428_10005136 3300027907 Bacteria 12260
391 Ga0268266_10021360 3300028379 Bacteria 5515
392 Ga0268265_10001135 3300028380 Bacteria 23498
393 Ga0268265_10067414 3300028380 Bacteria 2770
394 Ga0268264_10069727 3300028381 Bacteria 2974
395 Ga0265337_1000296 3300028556 Bacteria 26607
396 Ga0265338_10030853 3300028800 Bacteria 5267
397 Ga0265330_10020750 3300031235 Bacteria 3001
398 Ga0265330_10045089 3300031235 Bacteria 1944
399 Ga0265325_10000690 3300031241 Bacteria 24604
400 Ga0265325_10009262 3300031241 Bacteria 5756
401 Ga0265325_10010027 3300031241 Bacteria 5506
402 Ga0265325_10010324 3300031241 Bacteria 5413
403 Ga0265325_10036062 3300031241 Bacteria 2623
404 Ga0265325_10046724 3300031241 Bacteria 2244
405 Ga0265325_10056738 3300031241 Bacteria 1999
406 Ga0265325_10074664 3300031241 Bacteria 1695
407 Ga0265325_10083197 3300031241 Bacteria 1587
408 Ga0265340_10018619 3300031247 Bacteria 3581
409 Ga0265340_10022625 3300031247 Bacteria 3213
410 Ga0265340_10045565 3300031247 Bacteria 2141
411 Ga0265340_10064973 3300031247 Bacteria 1738
412 Ga0265340_10101495 3300031247 Bacteria 1336
413 Ga0265339_10030920 3300031249 Bacteria 3029
414 Ga0265339_10032250 3300031249 Bacteria 2955
415 Ga0265331_10005916 3300031250 Bacteria 7314
416 Ga0265331_10069105 3300031250 Bacteria 1655
417 Ga0265316_10021856 3300031344 Bacteria 5409
418 Ga0265316_10149223 3300031344 Bacteria 1752
419 Ga0265316_10184280 3300031344 Bacteria 1553
420 Ga0265313_10000703 3300031595 Bacteria 34516
421 Ga0265313_10008364 3300031595 Bacteria 6883
422 Ga0265313_10009868 3300031595 Bacteria 6141
423 Ga0265313_10012459 3300031595 Bacteria 5188
424 Ga0316575_10047527 3300031665 Bacteria 1706
425 Ga0265314_10006018 3300031711 Bacteria 10810
426 Ga0265314_10034708 3300031711 Bacteria 3681
427 Ga0265314_10043299 3300031711 Bacteria 3202
428 Ga0265314_10070842 3300031711 Bacteria 2335
429 Ga0265342_10000546 3300031712 Bacteria 39732
430 Ga0265342_10066632 3300031712 Bacteria 2109
431 Ga0265342_10085799 3300031712 Bacteria 1811
432 Ga0316578_10031890 3300031728 Bacteria 3006
433 Ga0316583_10007186 3300032133 Bacteria 4004
434 Ga0373930_0000149 3300034816 Bacteria 7906
435 Ga0373930_0007507 3300034816 Bacteria 1879
436 Ga0373948_0003483 3300034817 Bacteria 2425
437 Ga0373950_0003847 3300034818 Bacteria 2177
438 Ga0373958_0001168 3300034819 Bacteria 3483
439 Ga0373959_0000590 3300034820 Bacteria 6366
440 Ga0373938_0003974 3300034957 Bacteria 2446
441 Ga0373938_0033337 3300034957 Bacteria 1113
442 Ga0373928_0000732 3300035084 Bacteria 6430
443 Ga0373928_0005790 3300035084 Bacteria 2364
444 Ga0373929_0005208 3300035085 Bacteria 2337
445 Ga0373929_0009379 3300035085 Bacteria 1814
446 Ga0373934_0003323 3300035086 Bacteria 5889
447 Ga0373940_0000020 3300035088 Bacteria 18639
448 Ga0373940_0006010 3300035088 Bacteria 2666
449 Ga0373944_0000638 3300035089 Bacteria 8357
450 Ga0373949_0001031 3300035090 Bacteria 8546
451 Ga0373949_0011131 3300035090 Bacteria 1978
452 Ga0373949_0036124 3300035090 Bacteria 1197
453 Ga0373951_0000632 3300035091 Bacteria 9701
454 Ga0373951_0009549 3300035091 Bacteria 2182
455 Ga0373952_0001849 3300035092 Bacteria 3843
456 Ga0373952_0015095 3300035092 Bacteria 1555
457 Ga0373923_0000650 3300035111 Bacteria 8771
458 Ga0373932_0000824 3300035112 Bacteria 9169
459 Ga0373936_0012916 3300035113 Bacteria 3184
460 Ga0373939_0000304 3300035114 Bacteria 12763
461 Ga0373939_0002434 3300035114 Bacteria 4388
462 Ga0373939_0015065 3300035114 Bacteria 2016
463 Ga0373941_0000096 3300035115 Bacteria 14448
464 Ga0373941_0005640 3300035115 Bacteria 2962
465 Ga0373941_0030973 3300035115 Bacteria 1590
466 Ga0373945_0003142 3300035116 Bacteria 5182
467 Ga0373953_0001936 3300035117 Bacteria 6155
468 Ga0373953_0005057 3300035117 Bacteria 4253
469 Ga0373953_0024935 3300035117 Bacteria 2279
470 Ga0373954_0016088 3300035118 Bacteria 3347
471 Ga0373956_0003652 3300035119 Bacteria 6215
472 Ga0373956_0013207 3300035119 Bacteria 3435
473 Ga0373956_0091553 3300035119 Bacteria 1403
474 Ga0373957_0004812 3300035120 Bacteria 4136
475 Ga0373957_0012323 3300035120 Bacteria 2877
476 Ga0373960_0002306 3300035121 Bacteria 4292
477 Ga0373960_0004034 3300035121 Bacteria 3351
478 Ga0373960_0004717 3300035121 Bacteria 3136
479 Ga0373943_0002507 3300035170 Bacteria 8346
480 Ga0373943_0011522 3300035170 Bacteria 3979
481 Ga0373943_0035932 3300035170 Bacteria 2371
482 Ga0373943_0051354 3300035170 Bacteria 2029
483 Ga0373946_0002136 3300035171 Bacteria 6931
484 Ga0373946_0004288 3300035171 Bacteria 5096
485 Ga0373955_0001041 3300035172 Bacteria 11788
486 Ga0373955_0003147 3300035172 Bacteria 7220
487 Ga0373955_0004535 3300035172 Bacteria 6156
488 Ga0373955_0006462 3300035172 Bacteria 5338
489 Ga0373955_0049303 3300035172 Bacteria 2286
490 Ga0373942_0000056 3300035207 Bacteria 22957
491 Ga0373961_0001928 3300035241 Bacteria 5621
492 Ga0373961_0002994 3300035241 Bacteria 4263
493 Ga0373962_0001582 3300035242 Bacteria 5397
494 Ga0373962_0021546 3300035242 Bacteria 1701
495 Ga0373962_0042868 3300035242 Bacteria 1280
496 Ga0316574_0000385 3300035398 Bacteria 17232
497 Ga0373924_0028034 3300035410 Bacteria 2242
498 Ga0373931_0008291 3300035691 Bacteria 4922
499 Ga0373931_0010243 3300035691 Bacteria 4503
500 Ga0373935_0011194 3300035692 Bacteria 5385
501 Ga0373935_0075860 3300035692 Bacteria 2176
502 Ga0373927_0006091 3300035695 Bacteria 8258
503 Ga0373927_0009888 3300035695 Bacteria 6396
504 Ga0373927_0116076 3300035695 Bacteria 1745
505 Ga0373933_0008436 3300035724 Bacteria 5622
506 Ga0373933_0012539 3300035724 Bacteria 4683
507 Ga0373933_0024099 3300035724 Bacteria 3483
508 Ga0373947_0003178 3300035725 Bacteria 9770
509 Ga0373947_0028811 3300035725 Bacteria 3257
510 Ga0373947_0053593 3300035725 Bacteria 2432
511 Ga0373947_0100287 3300035725 Bacteria 1819
512 Ga0373937_0003470 3300036401 Bacteria 13244
513 Ga0373937_0012538 3300036401 Bacteria 7457
514 Ga0373937_0017679 3300036401 Bacteria 6361
515 Ga0373937_0036810 3300036401 Bacteria 4458
516 Ga0316584_0005296 3300036712 Bacteria 8638
517 Ga0373925_0001829 3300037068 Bacteria 17750
518 Ga0373925_0024946 3300037068 Bacteria 4366
519 Ga0373925_0189047 3300037068 Bacteria 1633
520 Ga0373925_0231162 3300037068 Bacteria 1479
521 Ga0395899_0047062 3300037312 Bacteria 3211
522 Ga0395900_0003102 3300037418 Bacteria 18039
523 Ga0395898_0017292 3300037466 Bacteria 7366
524 Ga0395898_0021942 3300037466 Bacteria 6467
525 Ga0395898_0057531 3300037466 Bacteria 3789
526 Ga0395901_0005769 3300038443 Bacteria 12539
527 Ga0395901_0006170 3300038443 Bacteria 12147
528 Ga0395901_0081069 3300038443 Bacteria 3389
529 Ga0395901_0574320 3300038443 Bacteria 1140
530 Ga0436365_1505706 3300039437 Bacteria 2181
531 Ga0453684_0053448 3300044712 Bacteria 5272
532 Ga0466957_0240272 3300044842 Bacteria 1201
533 Ga0451576_0022284 3300045051 Bacteria 6871
534 Ga0466958_0034345 3300045836 Bacteria 3025
535 Ga0495592_0038830 3300046454 Bacteria 3580
536 Ga0495592_0057777 3300046454 Bacteria 2863
537 Ga0495592_0096833 3300046454 Bacteria 2108
538 Ga0495592_0163908 3300046454 Bacteria 1527
539 Ga0495603_0006355 3300046455 Bacteria 7070
540 Ga0495603_0029108 3300046455 Bacteria 3331
541 Ga0495603_0103661 3300046455 Bacteria 1660
542 Ga0495629_0001405 3300046459 Bacteria 18978
543 Ga0495638_0014270 3300046460 Bacteria 5377
544 Ga0495651_0004808 3300046462 Bacteria 10341
545 Ga0495651_0014217 3300046462 Bacteria 6153
546 Ga0495651_0014554 3300046462 Bacteria 6082
547 Ga0495653_0009990 3300046463 Bacteria 7763
548 Ga0495653_0012845 3300046463 Bacteria 6836
549 Ga0495653_0132672 3300046463 Bacteria 1761
550 Ga0495580_0023894 3300046472 Bacteria 4481
551 Ga0495582_0018717 3300046473 Bacteria 3785
552 Ga0495582_0056737 3300046473 Bacteria 2159
553 Ga0495639_0001451 3300046475 Bacteria 10596
554 Ga0495639_0027222 3300046475 Bacteria 2530
555 Ga0495662_0000915 3300046476 Bacteria 14429
556 Ga0495662_0105585 3300046476 Bacteria 1379
557 Ga0495664_0206710 3300046477 Bacteria 1189
558 Ga0495585_0003492 3300046492 Bacteria 10604
559 Ga0495594_0001091 3300046499 Bacteria 14170
560 Ga0495607_0011896 3300046501 Bacteria 5764
561 Ga0495606_0057691 3300046507 Bacteria 2499
562 Ga0495608_0002687 3300046511 Bacteria 12772
563 Ga0495608_0026075 3300046511 Bacteria 3988
564 Ga0495610_0031552 3300046512 Bacteria 2763
565 Ga0495616_0038249 3300046513 Bacteria 2464
566 Ga0495618_0005633 3300046514 Bacteria 7614
567 Ga0495618_0037562 3300046514 Bacteria 3041
568 Ga0495618_0046048 3300046514 Bacteria 2753
569 Ga0495628_0001666 3300046516 Bacteria 20271
570 Ga0495628_0075145 3300046516 Bacteria 2631
571 Ga0495631_0015064 3300046518 Bacteria 3715
572 Ga0495643_0049127 3300046522 Bacteria 2276
573 Ga0495644_0016379 3300046523 Bacteria 2837
574 Ga0495648_0058297 3300046524 Bacteria 2309
575 Ga0495663_0016623 3300046525 Bacteria 2080
576 Ga0495652_0002710 3300046529 Bacteria 17983
577 Ga0495652_0021936 3300046529 Bacteria 5677
578 Ga0495652_0046431 3300046529 Bacteria 3729
579 Ga0495654_0004466 3300046530 Bacteria 8294
580 Ga0495665_0002969 3300046531 Bacteria 9164
581 Ga0495640_0097203 3300046533 Bacteria 1936
582 Ga0495586_0019875 3300046535 Bacteria 3577
583 Ga0495586_0117263 3300046535 Bacteria 1485
584 Ga0495587_0003832 3300046536 Bacteria 9975
585 Ga0495587_0008130 3300046536 Bacteria 6761
586 Ga0495587_0015475 3300046536 Bacteria 4764
587 Ga0495587_0115668 3300046536 Bacteria 1538
588 Ga0495598_0005995 3300046537 Bacteria 2723
589 Ga0495645_0003698 3300046543 Bacteria 10399
590 Ga0495645_0013139 3300046543 Bacteria 5852
591 Ga0495645_0246251 3300046543 Bacteria 1190
592 Ga0495633_0002269 3300046558 Bacteria 13755
593 Ga0495667_0001506 3300046559 Bacteria 15362
594 Ga0495667_0003229 3300046559 Bacteria 10930
595 Ga0495667_0003312 3300046559 Bacteria 10787
596 Ga0495667_0013093 3300046559 Bacteria 5617
597 Ga0495656_0001233 3300046615 Bacteria 8320
598 Ga0495611_0036031 3300046648 Bacteria 2193
599 Ga0495635_0033677 3300046663 Bacteria 3553
600 Ga0495635_0035736 3300046663 Bacteria 3445
601 Ga0495635_0050370 3300046663 Bacteria 2871
602 Ga0495635_0076560 3300046663 Bacteria 2293
603 Ga0495661_0029084 3300046665 Bacteria 3530
604 Ga0495588_0002749 3300046674 Bacteria 7550
605 Ga0495657_0013684 3300046675 Bacteria 5976
606 Ga0495657_0137258 3300046675 Bacteria 1527
607 Ga0495599_0001517 3300046678 Bacteria 13353
608 Ga0495599_0048414 3300046678 Bacteria 2664
609 Ga0495623_0010442 3300046679 Bacteria 6012
610 Ga0495646_0017323 3300046680 Bacteria 4570
611 Ga0495647_0006888 3300046681 Bacteria 3782
612 Ga0495658_0000324 3300046683 Bacteria 26774
613 Ga0495658_0001251 3300046683 Bacteria 13345
614 Ga0495658_0047531 3300046683 Bacteria 2417
615 Ga0495658_0068107 3300046683 Bacteria 2060
616 Ga0495658_0146528 3300046683 Bacteria 1447
617 Ga0495624_0003658 3300046690 Bacteria 11369
618 Ga0495600_0001403 3300046809 Bacteria 13299
619 Ga0495600_0017296 3300046809 Bacteria 4584
620 Ga0495600_0020344 3300046809 Bacteria 4245
621 Ga0495600_0225695 3300046809 Bacteria 1197
622 Ga0495581_0002626 3300047315 Bacteria 10229
623 Ga0495581_0047755 3300047315 Bacteria 2473
624 Ga0495581_0076269 3300047315 Bacteria 1939
625 Ga0495604_0007422 3300047317 Bacteria 8684
626 Ga0495604_0017550 3300047317 Bacteria 5730
627 Ga0495604_0024775 3300047317 Bacteria 4787
628 Ga0495604_0074284 3300047317 Bacteria 2562
629 Ga0495674_0074947 3300047319 Bacteria 2912
630 Ga0495674_0083984 3300047319 Bacteria 2729
631 Ga0495672_0059986 3300047320 Bacteria 2199
632 Ga0495676_0027763 3300047321 Bacteria 4849
633 Ga0495676_0152287 3300047321 Bacteria 1644
634 Ga0495680_0003143 3300047322 Bacteria 16455
635 Ga0495680_0004047 3300047322 Bacteria 14135
636 Ga0495680_0015013 3300047322 Bacteria 6688
637 Ga0495680_0038646 3300047322 Bacteria 3812
638 Ga0495675_0000855 3300047444 Bacteria 18610
639 Ga0495684_0000281 3300047471 Bacteria 41079
640 Ga0495686_0011722 3300047472 Bacteria 6173
641 Ga0495686_0106555 3300047472 Bacteria 1685
642 Ga0495593_0005567 3300047673 Bacteria 7438
643 Ga0495593_0015975 3300047673 Bacteria 4240
644 Ga0495593_0140454 3300047673 Bacteria 1223
645 Ga0495602_0002833 3300048088 Bacteria 17757
646 Ga0495602_0008505 3300048088 Bacteria 10717
647 Ga0495602_0087698 3300048088 Bacteria 2593
648 Ga0495614_0038051 3300048089 Bacteria 2065
649 Ga0496100_0010454 3300048903 Bacteria 5252
650 Ga0496100_0021215 3300048903 Bacteria 3909
651 Ga0496100_0023528 3300048903 Bacteria 3744
652 Ga0496100_0030027 3300048903 Bacteria 3367
653 Ga0496100_0047320 3300048903 Bacteria 2770
654 Ga0496100_0283418 3300048903 Bacteria 1236
655 Ga0496101_0008129 3300048904 Bacteria 6845
656 Ga0496101_0024709 3300048904 Bacteria 4161
657 Ga0496101_0042381 3300048904 Bacteria 3249
658 Ga0496101_0086778 3300048904 Bacteria 2321
659 Ga0496101_0121121 3300048904 Bacteria 1978
660 Ga0496102_0085310 3300048905 Bacteria 2915
661 Ga0496102_0107030 3300048905 Bacteria 2603
662 Ga0496103_0010637 3300048906 Bacteria 5443
663 Ga0496103_0053737 3300048906 Bacteria 2496
664 Ga0496103_0132859 3300048906 Bacteria 1590
665 Ga0496104_0000140 3300048907 Bacteria 67259
666 Ga0496104_0006221 3300048907 Bacteria 10492
667 Ga0496104_0020669 3300048907 Bacteria 6037
668 Ga0496104_0046881 3300048907 Bacteria 4072
669 Ga0496104_0054049 3300048907 Bacteria 3796
670 Ga0496104_0100304 3300048907 Bacteria 2771
671 Ga0496105_0005705 3300048908 Bacteria 9477
672 Ga0496105_0012751 3300048908 Bacteria 6659
673 Ga0496105_0072320 3300048908 Bacteria 2850
674 Ga0496105_0396551 3300048908 Bacteria 1096
675 Ga0496106_0002682 3300048909 Bacteria 13223
676 Ga0496106_0053636 3300048909 Bacteria 3045
677 Ga0496106_0082620 3300048909 Bacteria 2469
678 Ga0496106_0096008 3300048909 Bacteria 2293
679 Ga0496106_0105050 3300048909 Bacteria 2194
680 Ga0496106_0129722 3300048909 Bacteria 1976
681 Ga0496106_0153113 3300048909 Bacteria 1820
682 Ga0496107_0006087 3300048910 Bacteria 8286
683 Ga0496107_0035062 3300048910 Bacteria 3596
684 Ga0496107_0045823 3300048910 Bacteria 3146
685 Ga0496107_0059168 3300048910 Bacteria 2772
686 Ga0496108_0000438 3300048911 Bacteria 33500
687 Ga0496108_0021157 3300048911 Bacteria 5345
688 Ga0496108_0026962 3300048911 Bacteria 4741
689 Ga0496108_0098818 3300048911 Bacteria 2487
690 Ga0496108_0164013 3300048911 Bacteria 1921
691 Ga0496108_0316383 3300048911 Bacteria 1360
692 Ga0496109_0000284 3300048912 Bacteria 48342
693 Ga0496110_0068389 3300048913 Bacteria 3143
694 Ga0496111_0072218 3300048914 Bacteria 2512
695 Ga0496111_0179410 3300048914 Bacteria 1574
696 Ga0496111_0349480 3300048914 Bacteria 1094
697 Ga0496112_0012575 3300048915 Bacteria 7778
698 Ga0496112_0028452 3300048915 Bacteria 5394
699 Ga0496112_0055487 3300048915 Bacteria 3895
700 Ga0496112_0180932 3300048915 Bacteria 2072
701 Ga0496112_0249096 3300048915 Bacteria 1728
702 Ga0496113_0026664 3300048916 Bacteria 4135
703 Ga0496113_0144838 3300048916 Bacteria 1871
704 Ga0496113_0151241 3300048916 Bacteria 1831
705 Ga0496114_0002231 3300048917 Bacteria 14760
706 Ga0496114_0004604 3300048917 Bacteria 10712
707 Ga0496114_0043220 3300048917 Bacteria 3737
708 Ga0496115_0014172 3300048918 Bacteria 6032
709 Ga0496115_0133498 3300048918 Bacteria 2046
710 Ga0496115_0448535 3300048918 Bacteria 1042
711 Ga0496116_0013606 3300048919 Bacteria 6544
712 Ga0496120_0132893 3300048923 Bacteria 1272
713 Ga0496121_0005635 3300048924 Bacteria 15934
714 Ga0496121_0013371 3300048924 Bacteria 8828
715 Ga0496123_0027014 3300048926 Bacteria 4284
716 Ga0496124_0082981 3300048927 Bacteria 2630
717 Ga0496126_0095850 3300048929 Bacteria 2602
718 Ga0496126_0178119 3300048929 Bacteria 1807
719 Ga0501031_0043334 3300049568 Bacteria 2937
720 Ga0501031_0057028 3300049568 Bacteria 2545
721 Ga0501032_0005947 3300049569 Bacteria 9008
722 Ga0501032_0161275 3300049569 Bacteria 1472
723 Ga0501033_0021507 3300049570 Bacteria 4866
724 Ga0501033_0023208 3300049570 Bacteria 4679
725 Ga0501033_0121794 3300049570 Bacteria 1893
726 Ga0501034_0000270 3300049571 Bacteria 94119
727 Ga0501034_0010212 3300049571 Bacteria 9794
728 Ga0501034_0013362 3300049571 Bacteria 8453
729 Ga0501034_0013429 3300049571 Bacteria 8430
730 Ga0501034_0017808 3300049571 Bacteria 7287
731 Ga0501034_0096972 3300049571 Bacteria 2944
732 Ga0501034_0139441 3300049571 Bacteria 2405
733 Ga0501034_0287307 3300049571 Bacteria 1583
734 Ga0501034_0448669 3300049571 Bacteria 1208
735 Ga0501036_0004953 3300049572 Bacteria 10765
736 Ga0501036_0151576 3300049572 Bacteria 1955
737 Ga0501036_0282314 3300049572 Bacteria 1389
738 Ga0501036_0315414 3300049572 Bacteria 1307
739 Ga0501037_0018866 3300049573 Bacteria 5083
740 Ga0501037_0032335 3300049573 Bacteria 3863
741 Ga0501037_0079093 3300049573 Bacteria 2386
742 Ga0501037_0109982 3300049573 Bacteria 1986
743 Ga0501037_0262880 3300049573 Bacteria 1205
744 Ga0501038_0008680 3300049574 Bacteria 9329
745 Ga0501038_0034613 3300049574 Bacteria 4440
746 Ga0501038_0142034 3300049574 Bacteria 1963
747 Ga0501038_0180916 3300049574 Bacteria 1701
748 Ga0501039_0037211 3300049575 Bacteria 3755
749 Ga0501039_0143813 3300049575 Bacteria 1874
750 Ga0501039_0174964 3300049575 Bacteria 1688
751 Ga0501039_0265864 3300049575 Bacteria 1348
752 Ga0501043_0036691 3300049579 Bacteria 3856
753 Ga0501043_0062266 3300049579 Bacteria 2929
754 Ga0501043_0102344 3300049579 Bacteria 2251
755 Ga0501043_0259896 3300049579 Bacteria 1336
756 Ga0501046_0016922 3300049580 Bacteria 6098
757 Ga0501046_0062967 3300049580 Bacteria 2897
758 Ga0501046_0088888 3300049580 Bacteria 2379
759 Ga0501047_0000161 3300049581 Bacteria 81928
760 Ga0501047_0005032 3300049581 Bacteria 12407
761 Ga0501047_0016545 3300049581 Bacteria 7041
762 Ga0501047_0034060 3300049581 Bacteria 4917
763 Ga0501047_0034247 3300049581 Bacteria 4904
764 Ga0501047_0051290 3300049581 Bacteria 3985
765 Ga0501047_0089657 3300049581 Bacteria 2952
766 Ga0501047_0119338 3300049581 Bacteria 2519
767 Ga0501047_0139223 3300049581 Bacteria 2306
768 Ga0501047_0279465 3300049581 Bacteria 1514
769 Ga0501048_0000030 3300049582 Bacteria 66042
770 Ga0501048_0055708 3300049582 Bacteria 2806
771 Ga0501068_0043317 3300049584 Bacteria 2707
772 Ga0501068_0071500 3300049584 Bacteria 2118
773 Ga0501069_0023259 3300049585 Bacteria 3377
774 Ga0501070_0006959 3300049586 Bacteria 9619
775 Ga0501070_0015016 3300049586 Bacteria 6516
776 Ga0501070_0025190 3300049586 Bacteria 4989
777 Ga0501070_0036467 3300049586 Bacteria 4106
778 Ga0501070_0044479 3300049586 Bacteria 3694
779 Ga0501070_0051337 3300049586 Bacteria 3424
780 Ga0501070_0167399 3300049586 Bacteria 1811
781 Ga0501070_0229961 3300049586 Bacteria 1519
782 Ga0501070_0233784 3300049586 Bacteria 1506
783 Ga0501071_0130486 3300049587 Bacteria 1866
784 Ga0501071_0253693 3300049587 Bacteria 1328
785 Ga0501072_0037043 3300049588 Bacteria 3826
786 Ga0501072_0074888 3300049588 Bacteria 2677
787 Ga0501072_0169530 3300049588 Bacteria 1742
788 Ga0501072_0216408 3300049588 Bacteria 1527
789 Ga0501073_0005865 3300049589 Bacteria 9166
790 Ga0501073_0017068 3300049589 Bacteria 5258
791 Ga0501073_0052312 3300049589 Bacteria 2860
792 Ga0501073_0088477 3300049589 Bacteria 2153
793 Ga0501073_0261103 3300049589 Bacteria 1195
794 Ga0501074_0006137 3300049590 Bacteria 8679
795 Ga0501074_0357467 3300049590 Bacteria 1036
796 Ga0501075_0142297 3300049591 Bacteria 1828
797 Ga0501076_0016049 3300049592 Bacteria 5670
798 Ga0501077_0021570 3300049593 Bacteria 4077
799 Ga0501080_0000181 3300049742 Bacteria 45949
800 Ga0501080_0019730 3300049742 Bacteria 6242
801 Ga0501080_0051657 3300049742 Bacteria 3825
802 Ga0501080_0179906 3300049742 Bacteria 1946
803 Ga0501080_0202604 3300049742 Bacteria 1821
804 Ga0501080_0261555 3300049742 Bacteria 1576
805 Ga0501083_0000710 3300049744 Bacteria 21688
806 Ga0501083_0013252 3300049744 Bacteria 5763
807 Ga0501083_0021446 3300049744 Bacteria 4490
808 Ga0501035_0000892 3300049822 Bacteria 31561
809 Ga0501035_0052560 3300049822 Bacteria 3645
810 Ga0501035_0120489 3300049822 Bacteria 2294
811 Ga0501035_0338830 3300049822 Bacteria 1260
812 Ga0501044_0012418 3300049823 Bacteria 9222
813 Ga0501044_0014232 3300049823 Bacteria 8591
814 Ga0501044_0021512 3300049823 Bacteria 6879
815 Ga0501044_0029915 3300049823 Bacteria 5741
816 Ga0501044_0029968 3300049823 Bacteria 5736
817 Ga0501044_0031672 3300049823 Bacteria 5565
818 Ga0501044_0083281 3300049823 Bacteria 3235
819 Ga0501044_0263505 3300049823 Bacteria 1661
820 Ga0501044_0320492 3300049823 Bacteria 1474
821 Ga0501044_0398381 3300049823 Bacteria 1289
822 Ga0501044_0446821 3300049823 Bacteria 1200
823 nmdc:mga00v17_9824_c1 3300050491 Bacteria 5198
824 nmdc:mga0qj67_178021_c1 3300050509 Bacteria 1727
825 nmdc:mga0qj67_313381_c1 3300050509 Bacteria 1270
826 nmdc:mga0qj67_736_c1 3300050509 Bacteria 22275
827 nmdc:mga08y16_4006_c1 3300050511 Bacteria 15356
828 nmdc:mga0n895_109403_c1 3300050512 Bacteria 2779
829 nmdc:mga0n895_147099_c1 3300050512 Bacteria 2386
830 nmdc:mga0n895_16263_c1 3300050512 Bacteria 6821
831 nmdc:mga0n895_23986_c1 3300050512 Bacteria 5742
832 nmdc:mga0n895_426934_c1 3300050512 Bacteria 1339
833 nmdc:mga0n895_63346_c1 3300050512 Bacteria 3656
834 nmdc:mga0rr50_135543_c1 3300050513 Bacteria 1976
835 nmdc:mga0rr50_401096_c1 3300050513 Bacteria 1158
836 nmdc:mga0a205_16026_c1 3300050515 Bacteria 7015
837 nmdc:mga0a205_329928_c1 3300050515 Bacteria 1395
838 nmdc:mga0a205_58410_c1 3300050515 Bacteria 3726
839 nmdc:mga0a205_89440_c1 3300050515 Bacteria 2976
840 nmdc:mga0sz30_18096_c1 3300050516 Bacteria 2816
841 Ga0495601_0001033 3300053077 Bacteria 15194
842 Ga0495601_0005565 3300053077 Bacteria 7347
843 Ga0495601_0006052 3300053077 Bacteria 7059
844 Ga0495601_0016338 3300053077 Bacteria 4497
845 Ga0495601_0114070 3300053077 Bacteria 1752
846 Ga0495612_0001141 3300053078 Bacteria 10900
847 Ga0495612_0001873 3300053078 Bacteria 8648
848 Ga0495612_0014902 3300053078 Bacteria 3119
849 Ga0495612_0030065 3300053078 Bacteria 2188
850 Ga0495595_0000992 3300053084 Bacteria 10951
851 Ga0495595_0001007 3300053084 Bacteria 10852
852 Ga0495595_0001438 3300053084 Bacteria 9274
853 Ga0495595_0004374 3300053084 Bacteria 5688
854 Ga0495595_0023135 3300053084 Bacteria 2733
855 Ga0495595_0124682 3300053084 Bacteria 1256
856 Ga0495619_0000421 3300053085 Bacteria 28651
857 Ga0495619_0000715 3300053085 Bacteria 21668
858 Ga0495619_0001421 3300053085 Bacteria 15730
859 Ga0495619_0013795 3300053085 Bacteria 5098
860 Ga0495619_0019647 3300053085 Bacteria 4296
861 Ga0495619_0077086 3300053085 Bacteria 2238
862 Ga0500651_0021439 3300053093 Bacteria 4029
863 Ga0500651_0040915 3300053093 Bacteria 2920
864 Ga0500566_0011031 3300053094 Bacteria 5324
865 Ga0500641_0002979 3300053096 Bacteria 5995
866 Ga0500556_0000051 3300053104 Bacteria 119031
867 Ga0500592_001888 3300053116 Bacteria 3370
868 Ga0500595_000006 3300053119 Bacteria 300857
869 Ga0500608_000364 3300053122 Bacteria 17525
870 Ga0500642_0000041 3300053130 Bacteria 89564
871 Ga0500642_0076015 3300053130 Bacteria 1535
872 Ga0500652_001272 3300053131 Bacteria 7993
873 Ga0500658_0127740 3300053134 Bacteria 1131
874 Ga0500559_0000878 3300053136 Bacteria 19226
875 Ga0500568_0004915 3300053139 Bacteria 7034
876 Ga0500586_002089 3300053145 Bacteria 4411
877 Ga0500590_048918 3300053148 Bacteria 2153
878 Ga0500616_0000001 3300053153 Bacteria 1986011
879 Ga0500616_0000150 3300053153 Bacteria 117918
880 Ga0500616_0070049 3300053153 Bacteria 1791
881 Ga0500622_0004154 3300053156 Bacteria 9267
882 Ga0500636_0000632 3300053177 Bacteria 18995
883 Ga0500645_000294 3300053730 Bacteria 35747
884 Ga0500645_035177 3300053730 Bacteria 1493
885 Ga0501084_0023384 3300054114 Bacteria 5157
886 Ga0501084_0073299 3300054114 Bacteria 2867
887 Ga0501084_0232186 3300054114 Bacteria 1557
888 Ga0501082_0023830 3300060353 Bacteria 5277

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0057028 Ga0501031_0057028_1374_2309 269
2 3300049570 Ga0501033_0021507 Ga0501033_0021507_3304_4239 269
3 3300049571 Ga0501034_0013362 Ga0501034_0013362_6732_7667 269
4 3300049573 Ga0501037_0262880 Ga0501037_0262880_192_1127 269
5 3300049575 Ga0501039_0174964 Ga0501039_0174964_486_1421 269
6 3300049581 Ga0501047_0005032 Ga0501047_0005032_6869_7804 269
7 3300049823 Ga0501044_0320492 Ga0501044_0320492_39_974 269
8 3300005457 Ga0070662_100234460 Ga0070662_1002344602 270
9 3300025933 Ga0207706_10061120 Ga0207706_100611203 270
10 3300049581 Ga0501047_0139223 Ga0501047_0139223_1181_2092 270
11 3300049570 Ga0501033_0121794 Ga0501033_0121794_843_1790 278
12 3300049575 Ga0501039_0037211 Ga0501039_0037211_1745_2692 278
13 3300049580 Ga0501046_0016922 Ga0501046_0016922_3730_4677 278
14 3300049581 Ga0501047_0051290 Ga0501047_0051290_1807_2754 278
15 3300049585 Ga0501069_0023259 Ga0501069_0023259_1496_2443 278
16 3300049586 Ga0501070_0044479 Ga0501070_0044479_1064_2011 278
17 3300049587 Ga0501071_0130486 Ga0501071_0130486_28_975 278
18 3300049742 Ga0501080_0051657 Ga0501080_0051657_1815_2762 278
19 3300025302 Ga0207426_1038120 Ga0207426_10381202 280
20 3300049588 Ga0501072_0216408 Ga0501072_0216408_389_1267 281
21 3300005334 Ga0068869_100097580 Ga0068869_1000975802 282
22 3300005844 Ga0068862_100308856 Ga0068862_1003088562 282
23 3300009553 Ga0105249_10014021 Ga0105249_100140212 282
24 3300010375 Ga0105239_10205243 Ga0105239_102052432 282
25 3300014968 Ga0157379_10355408 Ga0157379_103554081 282
26 3300017792 Ga0163161_10053352 Ga0163161_100533522 282
27 3300026067 Ga0207678_10131872 Ga0207678_101318722 282
28 3300048903 Ga0496100_0283418 Ga0496100_0283418_70_996 282
29 3300048904 Ga0496101_0042381 Ga0496101_0042381_2068_2994 282
30 3300048907 Ga0496104_0054049 Ga0496104_0054049_1670_2596 282
31 3300048908 Ga0496105_0072320 Ga0496105_0072320_1082_2008 282
32 3300048910 Ga0496107_0059168 Ga0496107_0059168_1223_2149 282
33 3300035117 Ga0373953_0024935 Ga0373953_0024935_1098_2069 283
34 3300036401 Ga0373937_0017679 Ga0373937_0017679_5290_6261 283
35 3300006881 Ga0068865_100021120 Ga0068865_1000211202 284
36 3300049822 Ga0501035_0120489 Ga0501035_0120489_307_1278 284
37 3300005440 Ga0070705_100058630 Ga0070705_1000586302 285
38 3300005458 Ga0070681_10068560 Ga0070681_100685601 285
39 3300014969 Ga0157376_10065841 Ga0157376_100658414 285
40 3300025913 Ga0207695_10330798 Ga0207695_103307982 285
41 3300005340 Ga0070689_100015636 Ga0070689_1000156366 286
42 3300005548 Ga0070665_100041516 Ga0070665_1000415162 286
43 3300005842 Ga0068858_100021358 Ga0068858_1000213583 286
44 3300009101 Ga0105247_10003784 Ga0105247_100037843 286
45 3300009174 Ga0105241_10221355 Ga0105241_102213552 286
46 3300013297 Ga0157378_10012584 Ga0157378_100125841 286
47 3300013308 Ga0157375_10006049 Ga0157375_100060496 286
48 3300014968 Ga0157379_10007196 Ga0157379_100071969 286
49 3300014969 Ga0157376_10018772 Ga0157376_100187725 286
50 3300026121 Ga0207683_10248106 Ga0207683_102481062 286
51 3300048903 Ga0496100_0010454 Ga0496100_0010454_3978_4904 286
52 3300048904 Ga0496101_0008129 Ga0496101_0008129_5810_6736 286
53 3300048905 Ga0496102_0107030 Ga0496102_0107030_994_1920 286
54 3300048906 Ga0496103_0132859 Ga0496103_0132859_14_940 286
55 3300048907 Ga0496104_0006221 Ga0496104_0006221_1456_2382 286
56 3300048908 Ga0496105_0005705 Ga0496105_0005705_2685_3611 286
57 3300048909 Ga0496106_0129722 Ga0496106_0129722_141_1067 286
58 3300048915 Ga0496112_0249096 Ga0496112_0249096_268_1194 286
59 3300048918 Ga0496115_0448535 Ga0496115_0448535_25_951 286
60 3300049822 Ga0501035_0000892 Ga0501035_0000892_17466_18431 287
61 iso_pu_bacteria 8057101203 8057105348 287
62 3300005844 Ga0068862_100401730 Ga0068862_1004017302 290
63 3300047472 Ga0495686_0106555 Ga0495686_0106555_606_1553 290
64 3300048929 Ga0496126_0178119 Ga0496126_0178119_626_1558 291
65 iso_pu_bacteria 2545555834 2545675941 291
66 iso_pu_bacteria 641522639 641645393 291
67 3300054114 Ga0501084_0232186 Ga0501084_0232186_168_1100 292
68 3300005937 Ga0081455_10029513 Ga0081455_100295131 293
69 3300031235 Ga0265330_10045089 Ga0265330_100450892 293
70 3300031247 Ga0265340_10045565 Ga0265340_100455651 293
71 3300031712 Ga0265342_10085799 Ga0265342_100857992 293
72 3300048917 Ga0496114_0002231 Ga0496114_0002231_11841_12767 293
73 3300049823 Ga0501044_0083281 Ga0501044_0083281_783_1754 293
74 iso_pu_bacteria 2917554339 2917554486 293
75 3300006175 Ga0070712_100002937 Ga0070712_1000029378 294
76 3300025915 Ga0207693_10003360 Ga0207693_100033603 294
77 3300031241 Ga0265325_10009262 Ga0265325_100092622 294
78 3300031247 Ga0265340_10022625 Ga0265340_100226254 294
79 3300031250 Ga0265331_10069105 Ga0265331_100691052 294
80 3300031344 Ga0265316_10184280 Ga0265316_101842802 294
81 3300031711 Ga0265314_10070842 Ga0265314_100708421 294
82 iso_pu_bacteria 2767802442 2770198600 294
83 iso_pu_bacteria 2775506902 2776270082 294
84 iso_pu_bacteria 2775506904 2776281255 294
85 iso_pu_bacteria 2840764183 2840765547 294
86 3300005436 Ga0070713_100083089 Ga0070713_1000830891 295
87 3300006028 Ga0070717_10120190 Ga0070717_101201902 295
88 3300009147 Ga0114129_10002965 Ga0114129_1000296512 295
89 3300025928 Ga0207700_10065496 Ga0207700_100654962 295
90 3300049586 Ga0501070_0233784 Ga0501070_0233784_349_1296 295
91 iso_pu_bacteria 2915650412 2915650464 295
92 iso_pu_bacteria 3003665799 3003670557 295
93 3300031595 Ga0265313_10000703 Ga0265313_1000070318 296
94 3300031665 Ga0316575_10047527 Ga0316575_100475271 296
95 3300031728 Ga0316578_10031890 Ga0316578_100318902 296
96 3300035398 Ga0316574_0000385 Ga0316574_0000385_11240_12205 296
97 3300036712 Ga0316584_0005296 Ga0316584_0005296_7551_8516 296
98 3300048904 Ga0496101_0121121 Ga0496101_0121121_450_1391 296
99 3300048907 Ga0496104_0020669 Ga0496104_0020669_985_1926 296
100 3300048909 Ga0496106_0002682 Ga0496106_0002682_516_1457 296
101 3300048910 Ga0496107_0006087 Ga0496107_0006087_1094_2035 296
102 3300048911 Ga0496108_0000438 Ga0496108_0000438_11833_12774 296
103 3300048912 Ga0496109_0000284 Ga0496109_0000284_11658_12599 296
104 3300048914 Ga0496111_0179410 Ga0496111_0179410_83_1024 296
105 3300048915 Ga0496112_0012575 Ga0496112_0012575_648_1589 296
106 3300048916 Ga0496113_0151241 Ga0496113_0151241_208_1149 296
107 3300049569 Ga0501032_0005947 Ga0501032_0005947_1438_2382 296
108 3300049571 Ga0501034_0010212 Ga0501034_0010212_195_1139 296
109 3300049572 Ga0501036_0004953 Ga0501036_0004953_214_1158 296
110 3300049573 Ga0501037_0032335 Ga0501037_0032335_274_1218 296
111 3300049579 Ga0501043_0062266 Ga0501043_0062266_559_1503 296
112 3300049581 Ga0501047_0000161 Ga0501047_0000161_66655_67599 296
113 3300049582 Ga0501048_0000030 Ga0501048_0000030_54394_55338 296
114 3300049586 Ga0501070_0006959 Ga0501070_0006959_5208_6152 296
115 3300049589 Ga0501073_0052312 Ga0501073_0052312_182_1126 296
116 3300049590 Ga0501074_0006137 Ga0501074_0006137_5005_5949 296
117 3300049742 Ga0501080_0000181 Ga0501080_0000181_11036_11980 296
118 3300049744 Ga0501083_0000710 Ga0501083_0000710_16304_17248 296
119 3300049823 Ga0501044_0012418 Ga0501044_0012418_1278_2222 296
120 iso_pu_bacteria 2854911287 2854913586 296
121 3300031241 Ga0265325_10010324 Ga0265325_100103243 297
122 3300031241 Ga0265325_10074664 Ga0265325_100746642 297
123 3300031247 Ga0265340_10064973 Ga0265340_100649732 297
124 3300031344 Ga0265316_10021856 Ga0265316_100218564 297
125 3300031595 Ga0265313_10012459 Ga0265313_100124592 297
126 3300031711 Ga0265314_10006018 Ga0265314_100060182 297
127 3300031712 Ga0265342_10066632 Ga0265342_100666322 297
128 3300037068 Ga0373925_0231162 Ga0373925_0231162_417_1343 297
129 3300049571 Ga0501034_0000270 Ga0501034_0000270_16626_17573 297
130 3300049581 Ga0501047_0279465 Ga0501047_0279465_80_1027 297
131 3300049586 Ga0501070_0229961 Ga0501070_0229961_440_1387 297
132 3300049588 Ga0501072_0169530 Ga0501072_0169530_241_1188 297
133 3300049742 Ga0501080_0179906 Ga0501080_0179906_710_1657 297
134 3300049742 Ga0501080_0261555 Ga0501080_0261555_602_1549 297
135 iso_pu_bacteria 2523231067 2523467802 297
136 iso_pu_bacteria 2738543031 2739349251 297
137 iso_pu_bacteria 2857524615 2857525684 297
138 iso_pu_bacteria 2861691609 2861691730 297
139 iso_pu_bacteria 2919073203 2919074524 297
140 3300005614 Ga0068856_100000226 Ga0068856_10000022621 298
141 3300025961 Ga0207712_10400520 Ga0207712_104005201 298
142 3300026078 Ga0207702_10000191 Ga0207702_1000019156 298
143 3300048924 Ga0496121_0005635 Ga0496121_0005635_11441_12373 298
144 iso_pu_bacteria 2893066018 2893071766 298
145 iso_pu_bacteria 3005710791 3005717522 298
146 3300025921 Ga0207652_10052592 Ga0207652_100525923 299
147 3300035172 Ga0373955_0049303 Ga0373955_0049303_42_1013 299
148 3300037312 Ga0395899_0047062 Ga0395899_0047062_1876_2844 299
149 3300037418 Ga0395900_0003102 Ga0395900_0003102_6588_7556 299
150 3300037466 Ga0395898_0017292 Ga0395898_0017292_500_1468 299
151 3300037466 Ga0395898_0021942 Ga0395898_0021942_3966_4934 299
152 3300038443 Ga0395901_0006170 Ga0395901_0006170_9875_10843 299
153 3300049588 Ga0501072_0074888 Ga0501072_0074888_1467_2438 299
154 3300049589 Ga0501073_0261103 Ga0501073_0261103_214_1146 299
155 3300049744 Ga0501083_0021446 Ga0501083_0021446_2265_3197 299
156 3300054114 Ga0501084_0023384 Ga0501084_0023384_2714_3646 299
157 3300006178 Ga0075367_10052512 Ga0075367_100525122 300
158 3300025295 Ga0209564_1010473 Ga0209564_10104732 300
159 3300026067 Ga0207678_10018073 Ga0207678_100180734 300
160 3300046460 Ga0495638_0014270 Ga0495638_0014270_2349_3287 300
161 3300046507 Ga0495606_0057691 Ga0495606_0057691_1016_1954 300
162 3300046512 Ga0495610_0031552 Ga0495610_0031552_79_1017 300
163 3300046513 Ga0495616_0038249 Ga0495616_0038249_795_1733 300
164 3300046518 Ga0495631_0015064 Ga0495631_0015064_138_1076 300
165 3300046522 Ga0495643_0049127 Ga0495643_0049127_126_1064 300
166 3300046524 Ga0495648_0058297 Ga0495648_0058297_453_1391 300
167 3300046530 Ga0495654_0004466 Ga0495654_0004466_6545_7483 300
168 3300046665 Ga0495661_0029084 Ga0495661_0029084_1516_2454 300
169 3300047320 Ga0495672_0059986 Ga0495672_0059986_1143_2081 300
170 3300047472 Ga0495686_0011722 Ga0495686_0011722_1060_1998 300
171 3300048909 Ga0496106_0105050 Ga0496106_0105050_1239_2177 300
172 3300048919 Ga0496116_0013606 Ga0496116_0013606_5565_6503 300
173 3300048923 Ga0496120_0132893 Ga0496120_0132893_101_1039 300
174 3300048924 Ga0496121_0013371 Ga0496121_0013371_1252_2190 300
175 3300048926 Ga0496123_0027014 Ga0496123_0027014_539_1477 300
176 3300048927 Ga0496124_0082981 Ga0496124_0082981_165_1103 300
177 3300048929 Ga0496126_0095850 Ga0496126_0095850_295_1233 300
178 3300049568 Ga0501031_0043334 Ga0501031_0043334_1491_2426 300
179 3300049581 Ga0501047_0016545 Ga0501047_0016545_2632_3567 300
180 3300049589 Ga0501073_0005865 Ga0501073_0005865_4446_5381 300
181 3300050491 nmdc:mga00v17_9824_c1 nmdc:mga00v17_9824_c1_3499_4437 300
182 3300050516 nmdc:mga0sz30_18096_c1 nmdc:mga0sz30_18096_c1_1139_2077 300
183 3300053093 Ga0500651_0040915 Ga0500651_0040915_1122_2060 300
184 3300053104 Ga0500556_0000051 Ga0500556_0000051_105440_106378 300
185 3300053116 Ga0500592_001888 Ga0500592_001888_1214_2152 300
186 3300053130 Ga0500642_0000041 Ga0500642_0000041_72479_73417 300
187 3300053131 Ga0500652_001272 Ga0500652_001272_164_1102 300
188 3300053134 Ga0500658_0127740 Ga0500658_0127740_107_1045 300
189 3300053139 Ga0500568_0004915 Ga0500568_0004915_5546_6484 300
190 3300053145 Ga0500586_002089 Ga0500586_002089_1987_2925 300
191 3300053153 Ga0500616_0000150 Ga0500616_0000150_104570_105508 300
192 3300053156 Ga0500622_0004154 Ga0500622_0004154_134_1072 300
193 3300053730 Ga0500645_035177 Ga0500645_035177_73_1011 300
194 3300006871 Ga0075434_100143973 Ga0075434_1001439732 301
195 3300009098 Ga0105245_10775274 Ga0105245_107752741 301
196 3300031241 Ga0265325_10010027 Ga0265325_100100275 301
197 3300031250 Ga0265331_10005916 Ga0265331_100059166 301
198 3300046476 Ga0495662_0105585 Ga0495662_0105585_32_973 301
199 3300049581 Ga0501047_0034247 Ga0501047_0034247_3466_4407 301
200 3300049586 Ga0501070_0036467 Ga0501070_0036467_2886_3827 301
201 3300049822 Ga0501035_0338830 Ga0501035_0338830_278_1219 301
202 3300049823 Ga0501044_0263505 Ga0501044_0263505_458_1399 301
203 3300050512 nmdc:mga0n895_23986_c1 nmdc:mga0n895_23986_c1_76_1047 301
204 3300053094 Ga0500566_0011031 Ga0500566_0011031_2587_3528 301
205 3300053122 Ga0500608_000364 Ga0500608_000364_3418_4359 301
206 3300053136 Ga0500559_0000878 Ga0500559_0000878_4852_5793 301
207 3300053148 Ga0500590_048918 Ga0500590_048918_152_1093 301
208 3300053177 Ga0500636_0000632 Ga0500636_0000632_15917_16858 301
209 3300005439 Ga0070711_100044047 Ga0070711_1000440472 302
210 3300006175 Ga0070712_100255692 Ga0070712_1002556921 302
211 3300009094 Ga0111539_10020707 Ga0111539_100207074 302
212 3300025905 Ga0207685_10117244 Ga0207685_101172442 302
213 3300025915 Ga0207693_10031159 Ga0207693_100311592 302
214 3300025916 Ga0207663_10035519 Ga0207663_100355192 302
215 3300048907 Ga0496104_0000140 Ga0496104_0000140_55380_56351 302
216 3300048917 Ga0496114_0043220 Ga0496114_0043220_1071_2042 302
217 3300049571 Ga0501034_0096972 Ga0501034_0096972_1684_2625 302
218 3300049589 Ga0501073_0017068 Ga0501073_0017068_2000_2941 302
219 3300050515 nmdc:mga0a205_89440_c1 nmdc:mga0a205_89440_c1_924_1895 302
220 3300021384 Ga0213876_10013044 Ga0213876_100130446 303
221 3300031241 Ga0265325_10083197 Ga0265325_100831971 303
222 3300031249 Ga0265339_10030920 Ga0265339_100309202 303
223 3300031344 Ga0265316_10149223 Ga0265316_101492232 303
224 3300035692 Ga0373935_0075860 Ga0373935_0075860_340_1311 303
225 3300035725 Ga0373947_0028811 Ga0373947_0028811_522_1493 303
226 3300037068 Ga0373925_0189047 Ga0373925_0189047_518_1489 303
227 3300046473 Ga0495582_0056737 Ga0495582_0056737_1053_2024 303
228 3300046683 Ga0495658_0047531 Ga0495658_0047531_555_1526 303
229 3300047315 Ga0495581_0076269 Ga0495581_0076269_42_1013 303
230 3300048903 Ga0496100_0023528 Ga0496100_0023528_116_1084 303
231 3300049569 Ga0501032_0161275 Ga0501032_0161275_418_1401 303
232 3300049571 Ga0501034_0013429 Ga0501034_0013429_1828_2796 303
233 3300049573 Ga0501037_0018866 Ga0501037_0018866_2783_3766 303
234 3300049581 Ga0501047_0119338 Ga0501047_0119338_185_1129 303
235 3300049584 Ga0501068_0043317 Ga0501068_0043317_1675_2658 303
236 3300049586 Ga0501070_0051337 Ga0501070_0051337_431_1399 303
237 3300049589 Ga0501073_0088477 Ga0501073_0088477_900_1883 303
238 3300049744 Ga0501083_0013252 Ga0501083_0013252_201_1145 303
239 3300049823 Ga0501044_0014232 Ga0501044_0014232_4030_5013 303
240 3300049823 Ga0501044_0031672 Ga0501044_0031672_940_1884 303
241 3300050509 nmdc:mga0qj67_178021_c1 nmdc:mga0qj67_178021_c1_19_978 303
242 3300050513 nmdc:mga0rr50_401096_c1 nmdc:mga0rr50_401096_c1_31_1005 303
243 3300054114 Ga0501084_0073299 Ga0501084_0073299_171_1115 303
244 3300060353 Ga0501082_0023830 Ga0501082_0023830_160_1104 303
245 3300031241 Ga0265325_10000690 Ga0265325_1000069013 304
246 3300031595 Ga0265313_10009868 Ga0265313_100098683 304
247 3300035118 Ga0373954_0016088 Ga0373954_0016088_655_1602 304
248 3300035119 Ga0373956_0003652 Ga0373956_0003652_5105_6052 304
249 3300035120 Ga0373957_0012323 Ga0373957_0012323_163_1110 304
250 3300035172 Ga0373955_0006462 Ga0373955_0006462_97_1044 304
251 3300035724 Ga0373933_0008436 Ga0373933_0008436_4341_5288 304
252 3300036401 Ga0373937_0003470 Ga0373937_0003470_12083_13030 304
253 3300046536 Ga0495587_0015475 Ga0495587_0015475_1606_2553 304
254 3300046663 Ga0495635_0050370 Ga0495635_0050370_1131_2078 304
255 3300046675 Ga0495657_0013684 Ga0495657_0013684_3429_4376 304
256 3300047322 Ga0495680_0015013 Ga0495680_0015013_3849_4796 304
257 3300050509 nmdc:mga0qj67_313381_c1 nmdc:mga0qj67_313381_c1_86_1054 304
258 3300053077 Ga0495601_0006052 Ga0495601_0006052_1732_2679 304
259 3300053078 Ga0495612_0014902 Ga0495612_0014902_1647_2594 304
260 3300005327 Ga0070658_10017799 Ga0070658_100177992 305
261 3300005435 Ga0070714_100150893 Ga0070714_1001508932 305
262 3300013105 Ga0157369_10346545 Ga0157369_103465452 305
263 3300025929 Ga0207664_10073474 Ga0207664_100734742 305
264 3300053096 Ga0500641_0002979 Ga0500641_0002979_1176_2132 305
265 3300007788 Ga0099795_10003299 Ga0099795_100032994 306
266 3300045836 Ga0466958_0034345 Ga0466958_0034345_792_1760 306
267 3300049575 Ga0501039_0143813 Ga0501039_0143813_442_1407 306
268 3300006846 Ga0075430_100002289 Ga0075430_1000022899 307
269 3300037466 Ga0395898_0057531 Ga0395898_0057531_2379_3338 307
270 3300038443 Ga0395901_0005769 Ga0395901_0005769_7369_8328 307
271 3300050509 nmdc:mga0qj67_736_c1 nmdc:mga0qj67_736_c1_7809_8777 307
272 3300053093 Ga0500651_0021439 Ga0500651_0021439_599_1570 307
273 3300053130 Ga0500642_0076015 Ga0500642_0076015_80_1051 307
274 3300049570 Ga0501033_0023208 Ga0501033_0023208_2215_3177 308
275 3300049571 Ga0501034_0017808 Ga0501034_0017808_2606_3568 308
276 3300049571 Ga0501034_0448669 Ga0501034_0448669_212_1174 308
277 3300049572 Ga0501036_0151576 Ga0501036_0151576_410_1369 308
278 3300049573 Ga0501037_0079093 Ga0501037_0079093_858_1817 308
279 3300049579 Ga0501043_0036691 Ga0501043_0036691_2156_3118 308
280 3300049579 Ga0501043_0102344 Ga0501043_0102344_519_1478 308
281 3300049580 Ga0501046_0062967 Ga0501046_0062967_1282_2244 308
282 3300049581 Ga0501047_0089657 Ga0501047_0089657_388_1350 308
283 3300049582 Ga0501048_0055708 Ga0501048_0055708_958_1920 308
284 3300049742 Ga0501080_0202604 Ga0501080_0202604_435_1394 308
285 3300049822 Ga0501035_0052560 Ga0501035_0052560_749_1711 308
286 3300049823 Ga0501044_0029915 Ga0501044_0029915_1385_2344 308
287 3300049823 Ga0501044_0029968 Ga0501044_0029968_1388_2350 308
288 3300049823 Ga0501044_0446821 Ga0501044_0446821_23_985 308
289 3300053084 Ga0495595_0023135 Ga0495595_0023135_961_1929 308
290 iso_pu_bacteria 2643221547 2643757783 308
291 3300005336 Ga0070680_100409988 Ga0070680_1004099882 309
292 3300006871 Ga0075434_100038096 Ga0075434_1000380964 309
293 3300007076 Ga0075435_100012862 Ga0075435_1000128626 309
294 3300007788 Ga0099795_10022675 Ga0099795_100226751 309
295 3300009147 Ga0114129_10006052 Ga0114129_1000605210 309
296 3300009551 Ga0105238_10015798 Ga0105238_100157984 309
297 3300025915 Ga0207693_10027357 Ga0207693_100273573 309
298 3300025915 Ga0207693_10109587 Ga0207693_101095873 309
299 3300025917 Ga0207660_10022567 Ga0207660_100225675 309
300 3300025919 Ga0207657_10167779 Ga0207657_101677792 309
301 3300025949 Ga0207667_10457678 Ga0207667_104576782 309
302 3300028556 Ga0265337_1000296 Ga0265337_100029618 309
303 3300028800 Ga0265338_10030853 Ga0265338_100308533 309
304 3300031235 Ga0265330_10020750 Ga0265330_100207502 309
305 3300031247 Ga0265340_10101495 Ga0265340_101014952 309
306 3300031249 Ga0265339_10032250 Ga0265339_100322503 309
307 3300050512 nmdc:mga0n895_109403_c1 nmdc:mga0n895_109403_c1_271_1242 309
308 3300050515 nmdc:mga0a205_58410_c1 nmdc:mga0a205_58410_c1_1042_2013 309
309 3300053730 Ga0500645_000294 Ga0500645_000294_21265_22236 309
310 3300005434 Ga0070709_10000722 Ga0070709_100007228 310
311 3300005435 Ga0070714_100008512 Ga0070714_1000085125 310
312 3300005466 Ga0070685_10012256 Ga0070685_100122564 310
313 3300005535 Ga0070684_100026631 Ga0070684_1000266314 310
314 3300006028 Ga0070717_10001127 Ga0070717_100011278 310
315 3300006173 Ga0070716_100004315 Ga0070716_1000043151 310
316 3300009148 Ga0105243_10022668 Ga0105243_100226684 310
317 3300009551 Ga0105238_10178680 Ga0105238_101786802 310
318 3300014325 Ga0163163_10126013 Ga0163163_101260132 310
319 3300025915 Ga0207693_10007237 Ga0207693_100072374 310
320 3300025928 Ga0207700_10001518 Ga0207700_100015182 310
321 3300025929 Ga0207664_10048993 Ga0207664_100489932 310
322 3300025931 Ga0207644_10017834 Ga0207644_100178342 310
323 3300025935 Ga0207709_10032780 Ga0207709_100327802 310
324 3300025939 Ga0207665_10012708 Ga0207665_100127083 310
325 3300025941 Ga0207711_10002949 Ga0207711_1000294914 310
326 3300025960 Ga0207651_10027633 Ga0207651_100276333 310
327 3300026067 Ga0207678_10053209 Ga0207678_100532092 310
328 3300026121 Ga0207683_10022893 Ga0207683_100228934 310
329 3300031711 Ga0265314_10043299 Ga0265314_100432992 310
330 3300032133 Ga0316583_10007186 Ga0316583_100071862 310
331 3300035117 Ga0373953_0001936 Ga0373953_0001936_4817_5782 310
332 3300035170 Ga0373943_0035932 Ga0373943_0035932_885_1850 310
333 3300035172 Ga0373955_0003147 Ga0373955_0003147_6084_7049 310
334 3300035724 Ga0373933_0024099 Ga0373933_0024099_1963_2928 310
335 3300035725 Ga0373947_0100287 Ga0373947_0100287_580_1560 310
336 3300036401 Ga0373937_0036810 Ga0373937_0036810_1330_2295 310
337 3300039437 Ga0436365_1505706 Ga0436365_1505706_207_1172 310
338 3300044842 Ga0466957_0240272 Ga0466957_0240272_52_1017 310
339 3300046454 Ga0495592_0038830 Ga0495592_0038830_56_1021 310
340 3300046462 Ga0495651_0014217 Ga0495651_0014217_2765_3730 310
341 3300046463 Ga0495653_0132672 Ga0495653_0132672_175_1140 310
342 3300046477 Ga0495664_0206710 Ga0495664_0206710_199_1164 310
343 3300046516 Ga0495628_0001666 Ga0495628_0001666_2535_3500 310
344 3300046529 Ga0495652_0021936 Ga0495652_0021936_2070_3035 310
345 3300046536 Ga0495587_0115668 Ga0495587_0115668_316_1281 310
346 3300046543 Ga0495645_0003698 Ga0495645_0003698_4442_5407 310
347 3300046559 Ga0495667_0003312 Ga0495667_0003312_7516_8481 310
348 3300046663 Ga0495635_0076560 Ga0495635_0076560_20_985 310
349 3300046675 Ga0495657_0137258 Ga0495657_0137258_502_1467 310
350 3300046680 Ga0495646_0017323 Ga0495646_0017323_1908_2873 310
351 3300046809 Ga0495600_0017296 Ga0495600_0017296_3094_4059 310
352 3300047317 Ga0495604_0017550 Ga0495604_0017550_3762_4727 310
353 3300047322 Ga0495680_0038646 Ga0495680_0038646_667_1632 310
354 3300048088 Ga0495602_0002833 Ga0495602_0002833_5104_6069 310
355 3300048903 Ga0496100_0030027 Ga0496100_0030027_733_1704 310
356 3300048909 Ga0496106_0053636 Ga0496106_0053636_411_1382 310
357 3300048911 Ga0496108_0316383 Ga0496108_0316383_179_1150 310
358 3300048913 Ga0496110_0068389 Ga0496110_0068389_1962_2933 310
359 3300048917 Ga0496114_0004604 Ga0496114_0004604_6813_7784 310
360 3300049571 Ga0501034_0139441 Ga0501034_0139441_178_1143 310
361 3300049571 Ga0501034_0287307 Ga0501034_0287307_94_1059 310
362 3300049572 Ga0501036_0282314 Ga0501036_0282314_40_1005 310
363 3300049572 Ga0501036_0315414 Ga0501036_0315414_272_1237 310
364 3300049574 Ga0501038_0008680 Ga0501038_0008680_7145_8116 310
365 3300049574 Ga0501038_0142034 Ga0501038_0142034_910_1875 310
366 3300049574 Ga0501038_0180916 Ga0501038_0180916_453_1418 310
367 3300049575 Ga0501039_0265864 Ga0501039_0265864_321_1286 310
368 3300049579 Ga0501043_0259896 Ga0501043_0259896_66_1031 310
369 3300049581 Ga0501047_0034060 Ga0501047_0034060_743_1714 310
370 3300049584 Ga0501068_0071500 Ga0501068_0071500_679_1644 310
371 3300049586 Ga0501070_0015016 Ga0501070_0015016_68_1039 310
372 3300049586 Ga0501070_0167399 Ga0501070_0167399_797_1762 310
373 3300049587 Ga0501071_0253693 Ga0501071_0253693_226_1191 310
374 3300049588 Ga0501072_0037043 Ga0501072_0037043_318_1283 310
375 3300049590 Ga0501074_0357467 Ga0501074_0357467_10_975 310
376 3300049742 Ga0501080_0019730 Ga0501080_0019730_538_1503 310
377 3300049823 Ga0501044_0398381 Ga0501044_0398381_193_1158 310
378 3300050512 nmdc:mga0n895_426934_c1 nmdc:mga0n895_426934_c1_324_1295 310
379 3300053077 Ga0495601_0001033 Ga0495601_0001033_3361_4326 310
380 3300053078 Ga0495612_0001873 Ga0495612_0001873_5371_6336 310
381 3300053084 Ga0495595_0001438 Ga0495595_0001438_235_1200 310
382 3300053085 Ga0495619_0000421 Ga0495619_0000421_11732_12697 310
383 3300053153 Ga0500616_0000001 Ga0500616_0000001_458997_459968 310
384 3300053153 Ga0500616_0070049 Ga0500616_0070049_490_1461 310
385 3300005327 Ga0070658_10048553 Ga0070658_100485532 311
386 3300005327 Ga0070658_10069462 Ga0070658_100694621 311
387 3300005327 Ga0070658_10088422 Ga0070658_100884221 311
388 3300005329 Ga0070683_100032771 Ga0070683_1000327714 311
389 3300005336 Ga0070680_100076459 Ga0070680_1000764591 311
390 3300005336 Ga0070680_100121097 Ga0070680_1001210972 311
391 3300005339 Ga0070660_100191273 Ga0070660_1001912732 311
392 3300005344 Ga0070661_100239399 Ga0070661_1002393992 311
393 3300005434 Ga0070709_10029626 Ga0070709_100296263 311
394 3300005435 Ga0070714_100059337 Ga0070714_1000593372 311
395 3300005436 Ga0070713_100000642 Ga0070713_10000064218 311
396 3300005437 Ga0070710_10020429 Ga0070710_100204293 311
397 3300005439 Ga0070711_100118741 Ga0070711_1001187412 311
398 3300005458 Ga0070681_10064688 Ga0070681_100646882 311
399 3300005458 Ga0070681_10100056 Ga0070681_101000561 311
400 3300005547 Ga0070693_100017616 Ga0070693_1000176162 311
401 3300005563 Ga0068855_100061841 Ga0068855_1000618412 311
402 3300005563 Ga0068855_100202945 Ga0068855_1002029452 311
403 3300005614 Ga0068856_100226076 Ga0068856_1002260762 311
404 3300005615 Ga0070702_100080374 Ga0070702_1000803742 311
405 3300005616 Ga0068852_100171044 Ga0068852_1001710442 311
406 3300005616 Ga0068852_100248068 Ga0068852_1002480681 311
407 3300006028 Ga0070717_10026094 Ga0070717_100260943 311
408 3300006175 Ga0070712_100118608 Ga0070712_1001186082 311
409 3300009093 Ga0105240_10023127 Ga0105240_100231276 311
410 3300009174 Ga0105241_10069695 Ga0105241_100696952 311
411 3300009551 Ga0105238_10098322 Ga0105238_100983223 311
412 3300013102 Ga0157371_10090061 Ga0157371_100900611 311
413 3300013105 Ga0157369_10381609 Ga0157369_103816092 311
414 3300020082 Ga0206353_10044632 Ga0206353_100446322 311
415 3300025898 Ga0207692_10006694 Ga0207692_100066942 311
416 3300025906 Ga0207699_10107335 Ga0207699_101073352 311
417 3300025909 Ga0207705_10003687 Ga0207705_100036877 311
418 3300025909 Ga0207705_10095154 Ga0207705_100951542 311
419 3300025913 Ga0207695_10274419 Ga0207695_102744192 311
420 3300025917 Ga0207660_10013553 Ga0207660_100135535 311
421 3300025921 Ga0207652_10027823 Ga0207652_100278232 311
422 3300025924 Ga0207694_10050122 Ga0207694_100501223 311
423 3300025927 Ga0207687_10047719 Ga0207687_100477193 311
424 3300025928 Ga0207700_10028277 Ga0207700_100282774 311
425 3300025949 Ga0207667_10039139 Ga0207667_100391395 311
426 3300025949 Ga0207667_10079202 Ga0207667_100792022 311
427 3300025949 Ga0207667_10116137 Ga0207667_101161372 311
428 3300031241 Ga0265325_10036062 Ga0265325_100360623 311
429 3300031241 Ga0265325_10056738 Ga0265325_100567382 311
430 3300031247 Ga0265340_10018619 Ga0265340_100186192 311
431 3300031595 Ga0265313_10008364 Ga0265313_100083644 311
432 3300031712 Ga0265342_10000546 Ga0265342_100005468 311
433 3300035170 Ga0373943_0051354 Ga0373943_0051354_89_1060 311
434 3300035410 Ga0373924_0028034 Ga0373924_0028034_671_1642 311
435 3300035695 Ga0373927_0116076 Ga0373927_0116076_169_1140 311
436 3300035725 Ga0373947_0053593 Ga0373947_0053593_1325_2296 311
437 3300038443 Ga0395901_0081069 Ga0395901_0081069_2192_3160 311
438 3300038443 Ga0395901_0574320 Ga0395901_0574320_51_1022 311
439 3300046455 Ga0495603_0103661 Ga0495603_0103661_89_1060 311
440 3300046475 Ga0495639_0027222 Ga0495639_0027222_875_1846 311
441 3300047315 Ga0495581_0047755 Ga0495581_0047755_841_1812 311
442 3300047319 Ga0495674_0083984 Ga0495674_0083984_1086_2057 311
443 3300047321 Ga0495676_0152287 Ga0495676_0152287_466_1437 311
444 3300047673 Ga0495593_0140454 Ga0495593_0140454_163_1134 311
445 3300048089 Ga0495614_0038051 Ga0495614_0038051_520_1491 311
446 3300049573 Ga0501037_0109982 Ga0501037_0109982_107_1075 311
447 3300049574 Ga0501038_0034613 Ga0501038_0034613_348_1316 311
448 3300049580 Ga0501046_0088888 Ga0501046_0088888_542_1510 311
449 3300049586 Ga0501070_0025190 Ga0501070_0025190_1717_2685 311
450 3300049823 Ga0501044_0021512 Ga0501044_0021512_5229_6197 311
451 3300053077 Ga0495601_0114070 Ga0495601_0114070_93_1061 311
452 3300053085 Ga0495619_0019647 Ga0495619_0019647_328_1299 311
453 3300000041 ARcpr5oldR_c000095 ARcpr5oldR_0000959 312
454 3300000042 ARSoilYngRDRAFT_c00083 ARSoilYngRDRAFT_000839 312
455 3300000043 ARcpr5yngRDRAFT_c000131 ARcpr5yngRDRAFT_00013110 312
456 3300000044 ARSoilOldRDRAFT_c000103 ARSoilOldRDRAFT_0001038 312
457 3300000652 ARCol0yngRDRAFT_1000133 ARCol0yngRDRAFT_10001333 312
458 3300001977 JGI24746J21847_1005106 JGI24746J21847_10051062 312
459 3300001989 JGI24739J22299_10014486 JGI24739J22299_100144863 312
460 3300001990 JGI24737J22298_10005379 JGI24737J22298_100053793 312
461 3300001990 JGI24737J22298_10011191 JGI24737J22298_100111913 312
462 3300002073 JGI24745J21846_1001233 JGI24745J21846_10012332 312
463 3300002075 JGI24738J21930_10002375 JGI24738J21930_100023754 312
464 3300002126 JGI24035J26624_1000776 JGI24035J26624_10007764 312
465 3300002244 JGI24742J22300_10000988 JGI24742J22300_100009883 312
466 3300005290 Ga0065712_10006492 Ga0065712_100064922 312
467 3300005293 Ga0065715_10108649 Ga0065715_101086492 312
468 3300005328 Ga0070676_10006196 Ga0070676_100061962 312
469 3300005328 Ga0070676_10131183 Ga0070676_101311832 312
470 3300005329 Ga0070683_100018166 Ga0070683_1000181662 312
471 3300005330 Ga0070690_100005074 Ga0070690_1000050749 312
472 3300005330 Ga0070690_100012491 Ga0070690_1000124912 312
473 3300005330 Ga0070690_100066481 Ga0070690_1000664812 312
474 3300005331 Ga0070670_100037294 Ga0070670_1000372942 312
475 3300005331 Ga0070670_100098901 Ga0070670_1000989012 312
476 3300005333 Ga0070677_10000267 Ga0070677_100002679 312
477 3300005334 Ga0068869_100000991 Ga0068869_1000009916 312
478 3300005335 Ga0070666_10008226 Ga0070666_100082263 312
479 3300005336 Ga0070680_100007000 Ga0070680_10000700011 312
480 3300005336 Ga0070680_100008439 Ga0070680_1000084393 312
481 3300005336 Ga0070680_100102952 Ga0070680_1001029522 312
482 3300005337 Ga0070682_100002591 Ga0070682_1000025919 312
483 3300005339 Ga0070660_100014299 Ga0070660_1000142992 312
484 3300005340 Ga0070689_100010361 Ga0070689_1000103612 312
485 3300005340 Ga0070689_100143000 Ga0070689_1001430002 312
486 3300005340 Ga0070689_100256393 Ga0070689_1002563932 312
487 3300005343 Ga0070687_100000879 Ga0070687_1000008798 312
488 3300005344 Ga0070661_100017455 Ga0070661_1000174553 312
489 3300005345 Ga0070692_10173469 Ga0070692_101734691 312
490 3300005347 Ga0070668_100072405 Ga0070668_1000724052 312
491 3300005353 Ga0070669_100071179 Ga0070669_1000711793 312
492 3300005353 Ga0070669_100075580 Ga0070669_1000755802 312
493 3300005354 Ga0070675_100010826 Ga0070675_1000108262 312
494 3300005354 Ga0070675_100066926 Ga0070675_1000669262 312
495 3300005356 Ga0070674_100044791 Ga0070674_1000447912 312
496 3300005356 Ga0070674_100140374 Ga0070674_1001403742 312
497 3300005364 Ga0070673_100001635 Ga0070673_10000163510 312
498 3300005364 Ga0070673_100031619 Ga0070673_1000316194 312
499 3300005365 Ga0070688_100018060 Ga0070688_1000180604 312
500 3300005365 Ga0070688_100050394 Ga0070688_1000503942 312
501 3300005365 Ga0070688_100069219 Ga0070688_1000692192 312
502 3300005366 Ga0070659_100063170 Ga0070659_1000631703 312
503 3300005367 Ga0070667_100001396 Ga0070667_10000139624 312
504 3300005367 Ga0070667_100114682 Ga0070667_1001146822 312
505 3300005406 Ga0070703_10010516 Ga0070703_100105162 312
506 3300005434 Ga0070709_10164191 Ga0070709_101641912 312
507 3300005436 Ga0070713_100036260 Ga0070713_1000362604 312
508 3300005438 Ga0070701_10044211 Ga0070701_100442112 312
509 3300005438 Ga0070701_10089901 Ga0070701_100899012 312
510 3300005439 Ga0070711_100029980 Ga0070711_1000299803 312
511 3300005439 Ga0070711_100049734 Ga0070711_1000497342 312
512 3300005439 Ga0070711_100110465 Ga0070711_1001104652 312
513 3300005440 Ga0070705_100014152 Ga0070705_1000141524 312
514 3300005441 Ga0070700_100004739 Ga0070700_1000047397 312
515 3300005441 Ga0070700_100036560 Ga0070700_1000365603 312
516 3300005444 Ga0070694_100041182 Ga0070694_1000411822 312
517 3300005444 Ga0070694_100051168 Ga0070694_1000511682 312
518 3300005444 Ga0070694_100109630 Ga0070694_1001096302 312
519 3300005455 Ga0070663_100016280 Ga0070663_1000162806 312
520 3300005455 Ga0070663_100047549 Ga0070663_1000475493 312
521 3300005455 Ga0070663_100134901 Ga0070663_1001349011 312
522 3300005456 Ga0070678_100002344 Ga0070678_1000023449 312
523 3300005457 Ga0070662_100009494 Ga0070662_1000094946 312
524 3300005457 Ga0070662_100043915 Ga0070662_1000439152 312
525 3300005458 Ga0070681_10004197 Ga0070681_100041972 312
526 3300005458 Ga0070681_10271999 Ga0070681_102719992 312
527 3300005459 Ga0068867_100012755 Ga0068867_1000127552 312
528 3300005530 Ga0070679_100092414 Ga0070679_1000924141 312
529 3300005530 Ga0070679_100374985 Ga0070679_1003749851 312
530 3300005530 Ga0070679_100382741 Ga0070679_1003827411 312
531 3300005536 Ga0070697_100193023 Ga0070697_1001930232 312
532 3300005539 Ga0068853_100051672 Ga0068853_1000516723 312
533 3300005539 Ga0068853_100103408 Ga0068853_1001034081 312
534 3300005543 Ga0070672_100001723 Ga0070672_1000017233 312
535 3300005544 Ga0070686_100011069 Ga0070686_1000110694 312
536 3300005544 Ga0070686_100030989 Ga0070686_1000309891 312
537 3300005545 Ga0070695_100131536 Ga0070695_1001315362 312
538 3300005545 Ga0070695_100185095 Ga0070695_1001850952 312
539 3300005546 Ga0070696_100059816 Ga0070696_1000598162 312
540 3300005546 Ga0070696_100084714 Ga0070696_1000847141 312
541 3300005547 Ga0070693_100002926 Ga0070693_1000029263 312
542 3300005547 Ga0070693_100288632 Ga0070693_1002886321 312
543 3300005549 Ga0070704_100005673 Ga0070704_1000056732 312
544 3300005564 Ga0070664_100056486 Ga0070664_1000564862 312
545 3300005564 Ga0070664_100091886 Ga0070664_1000918862 312
546 3300005564 Ga0070664_100103548 Ga0070664_1001035482 312
547 3300005577 Ga0068857_100029605 Ga0068857_1000296055 312
548 3300005577 Ga0068857_100092467 Ga0068857_1000924672 312
549 3300005578 Ga0068854_100004810 Ga0068854_1000048103 312
550 3300005614 Ga0068856_100004424 Ga0068856_10000442415 312
551 3300005614 Ga0068856_100077894 Ga0068856_1000778942 312
552 3300005616 Ga0068852_100092806 Ga0068852_1000928062 312
553 3300005616 Ga0068852_100271263 Ga0068852_1002712632 312
554 3300005617 Ga0068859_100051438 Ga0068859_1000514383 312
555 3300005617 Ga0068859_100098957 Ga0068859_1000989573 312
556 3300005618 Ga0068864_100026210 Ga0068864_1000262103 312
557 3300005718 Ga0068866_10004921 Ga0068866_100049215 312
558 3300005718 Ga0068866_10217040 Ga0068866_102170401 312
559 3300005719 Ga0068861_100002263 Ga0068861_10000226312 312
560 3300005719 Ga0068861_100028372 Ga0068861_1000283723 312
561 3300005840 Ga0068870_10000323 Ga0068870_100003239 312
562 3300005842 Ga0068858_100030717 Ga0068858_1000307174 312
563 3300005842 Ga0068858_100036975 Ga0068858_1000369752 312
564 3300005842 Ga0068858_100107313 Ga0068858_1001073132 312
565 3300005843 Ga0068860_100001886 Ga0068860_10000188624 312
566 3300005843 Ga0068860_100102035 Ga0068860_1001020353 312
567 3300005843 Ga0068860_100136842 Ga0068860_1001368421 312
568 3300005844 Ga0068862_100001462 Ga0068862_10000146220 312
569 3300005844 Ga0068862_100047241 Ga0068862_1000472411 312
570 3300005937 Ga0081455_10000313 Ga0081455_1000031358 312
571 3300005937 Ga0081455_10062450 Ga0081455_100624502 312
572 3300006163 Ga0070715_10013325 Ga0070715_100133253 312
573 3300006237 Ga0097621_100006440 Ga0097621_10000644010 312
574 3300006237 Ga0097621_100108031 Ga0097621_1001080312 312
575 3300006358 Ga0068871_100004355 Ga0068871_1000043556 312
576 3300006358 Ga0068871_100005719 Ga0068871_1000057198 312
577 3300006358 Ga0068871_100041937 Ga0068871_1000419372 312
578 3300006852 Ga0075433_10049262 Ga0075433_100492622 312
579 3300006852 Ga0075433_10260286 Ga0075433_102602862 312
580 3300006871 Ga0075434_100044263 Ga0075434_1000442633 312
581 3300006871 Ga0075434_100065153 Ga0075434_1000651533 312
582 3300006871 Ga0075434_100147344 Ga0075434_1001473442 312
583 3300006881 Ga0068865_100160284 Ga0068865_1001602842 312
584 3300006914 Ga0075436_100013190 Ga0075436_1000131905 312
585 3300006931 Ga0097620_100051438 Ga0097620_1000514383 312
586 3300006931 Ga0097620_100098964 Ga0097620_1000989643 312
587 3300009093 Ga0105240_10102968 Ga0105240_101029683 312
588 3300009093 Ga0105240_10374892 Ga0105240_103748922 312
589 3300009094 Ga0111539_10002538 Ga0111539_100025383 312
590 3300009094 Ga0111539_10007068 Ga0111539_100070683 312
591 3300009094 Ga0111539_10324603 Ga0111539_103246032 312
592 3300009101 Ga0105247_10006797 Ga0105247_100067973 312
593 3300009101 Ga0105247_10033503 Ga0105247_100335032 312
594 3300009148 Ga0105243_10027142 Ga0105243_100271424 312
595 3300009148 Ga0105243_10060557 Ga0105243_100605571 312
596 3300009148 Ga0105243_10367606 Ga0105243_103676062 312
597 3300009176 Ga0105242_10016257 Ga0105242_100162575 312
598 3300009177 Ga0105248_10002716 Ga0105248_1000271618 312
599 3300009177 Ga0105248_10037966 Ga0105248_100379665 312
600 3300009177 Ga0105248_10057751 Ga0105248_100577513 312
601 3300009545 Ga0105237_10204320 Ga0105237_102043202 312
602 3300009553 Ga0105249_10046857 Ga0105249_100468573 312
603 3300009553 Ga0105249_10049985 Ga0105249_100499853 312
604 3300009553 Ga0105249_10603471 Ga0105249_106034711 312
605 3300010375 Ga0105239_10093887 Ga0105239_100938872 312
606 3300010375 Ga0105239_10125513 Ga0105239_101255133 312
607 3300011119 Ga0105246_10000456 Ga0105246_100004563 312
608 3300011119 Ga0105246_10104698 Ga0105246_101046982 312
609 3300013100 Ga0157373_10035903 Ga0157373_100359034 312
610 3300013296 Ga0157374_10015579 Ga0157374_100155793 312
611 3300013296 Ga0157374_10043090 Ga0157374_100430902 312
612 3300013306 Ga0163162_10044487 Ga0163162_100444873 312
613 3300013306 Ga0163162_10309248 Ga0163162_103092482 312
614 3300013307 Ga0157372_10035536 Ga0157372_100355363 312
615 3300013308 Ga0157375_10005758 Ga0157375_100057583 312
616 3300013308 Ga0157375_10055984 Ga0157375_100559843 312
617 3300013308 Ga0157375_10084758 Ga0157375_100847582 312
618 3300014326 Ga0157380_10019473 Ga0157380_100194733 312
619 3300014745 Ga0157377_10083516 Ga0157377_100835162 312
620 3300014968 Ga0157379_10013988 Ga0157379_100139882 312
621 3300014968 Ga0157379_10345840 Ga0157379_103458402 312
622 3300014969 Ga0157376_10005756 Ga0157376_100057563 312
623 3300014969 Ga0157376_10142542 Ga0157376_101425422 312
624 3300017792 Ga0163161_10006245 Ga0163161_1000624510 312
625 3300025271 Ga0207666_1000483 Ga0207666_10004833 312
626 3300025271 Ga0207666_1001877 Ga0207666_10018773 312
627 3300025290 Ga0207673_1000591 Ga0207673_10005912 312
628 3300025315 Ga0207697_10008842 Ga0207697_100088423 312
629 3300025315 Ga0207697_10024058 Ga0207697_100240582 312
630 3300025893 Ga0207682_10000143 Ga0207682_1000014310 312
631 3300025898 Ga0207692_10032171 Ga0207692_100321712 312
632 3300025898 Ga0207692_10110690 Ga0207692_101106902 312
633 3300025899 Ga0207642_10008803 Ga0207642_100088032 312
634 3300025899 Ga0207642_10164011 Ga0207642_101640111 312
635 3300025900 Ga0207710_10038796 Ga0207710_100387962 312
636 3300025900 Ga0207710_10077566 Ga0207710_100775662 312
637 3300025901 Ga0207688_10001469 Ga0207688_100014692 312
638 3300025901 Ga0207688_10075359 Ga0207688_100753592 312
639 3300025903 Ga0207680_10022035 Ga0207680_100220352 312
640 3300025903 Ga0207680_10022742 Ga0207680_100227422 312
641 3300025903 Ga0207680_10077345 Ga0207680_100773452 312
642 3300025904 Ga0207647_10042117 Ga0207647_100421173 312
643 3300025907 Ga0207645_10002217 Ga0207645_1000221712 312
644 3300025907 Ga0207645_10014177 Ga0207645_100141772 312
645 3300025907 Ga0207645_10034551 Ga0207645_100345511 312
646 3300025908 Ga0207643_10000336 Ga0207643_1000033610 312
647 3300025914 Ga0207671_10156696 Ga0207671_101566962 312
648 3300025914 Ga0207671_10265686 Ga0207671_102656862 312
649 3300025916 Ga0207663_10137394 Ga0207663_101373941 312
650 3300025917 Ga0207660_10030666 Ga0207660_100306662 312
651 3300025918 Ga0207662_10022126 Ga0207662_100221263 312
652 3300025919 Ga0207657_10050255 Ga0207657_100502553 312
653 3300025919 Ga0207657_10077116 Ga0207657_100771162 312
654 3300025919 Ga0207657_10151445 Ga0207657_101514452 312
655 3300025920 Ga0207649_10001348 Ga0207649_100013484 312
656 3300025921 Ga0207652_10051777 Ga0207652_100517775 312
657 3300025923 Ga0207681_10000782 Ga0207681_100007822 312
658 3300025923 Ga0207681_10220025 Ga0207681_102200252 312
659 3300025924 Ga0207694_10255551 Ga0207694_102555512 312
660 3300025925 Ga0207650_10021793 Ga0207650_100217935 312
661 3300025925 Ga0207650_10147269 Ga0207650_101472692 312
662 3300025926 Ga0207659_10119646 Ga0207659_101196462 312
663 3300025927 Ga0207687_10083224 Ga0207687_100832242 312
664 3300025929 Ga0207664_10071944 Ga0207664_100719442 312
665 3300025931 Ga0207644_10007899 Ga0207644_100078995 312
666 3300025932 Ga0207690_10019650 Ga0207690_100196503 312
667 3300025932 Ga0207690_10053988 Ga0207690_100539883 312
668 3300025933 Ga0207706_10007938 Ga0207706_1000793810 312
669 3300025933 Ga0207706_10051355 Ga0207706_100513553 312
670 3300025934 Ga0207686_10012238 Ga0207686_100122382 312
671 3300025934 Ga0207686_10017860 Ga0207686_100178602 312
672 3300025935 Ga0207709_10028191 Ga0207709_100281913 312
673 3300025936 Ga0207670_10013045 Ga0207670_100130452 312
674 3300025936 Ga0207670_10094086 Ga0207670_100940861 312
675 3300025937 Ga0207669_10076620 Ga0207669_100766202 312
676 3300025937 Ga0207669_10100444 Ga0207669_101004442 312
677 3300025938 Ga0207704_10087197 Ga0207704_100871972 312
678 3300025938 Ga0207704_10320976 Ga0207704_103209761 312
679 3300025939 Ga0207665_10007323 Ga0207665_100073232 312
680 3300025940 Ga0207691_10039514 Ga0207691_100395143 312
681 3300025942 Ga0207689_10000929 Ga0207689_1000092910 312
682 3300025942 Ga0207689_10112248 Ga0207689_101122481 312
683 3300025944 Ga0207661_10013325 Ga0207661_100133253 312
684 3300025945 Ga0207679_10001711 Ga0207679_100017112 312
685 3300025960 Ga0207651_10000218 Ga0207651_1000021810 312
686 3300025960 Ga0207651_10131464 Ga0207651_101314642 312
687 3300025961 Ga0207712_10064867 Ga0207712_100648673 312
688 3300025961 Ga0207712_10403384 Ga0207712_104033842 312
689 3300025981 Ga0207640_10015886 Ga0207640_100158864 312
690 3300026035 Ga0207703_10185066 Ga0207703_101850661 312
691 3300026035 Ga0207703_10204039 Ga0207703_102040392 312
692 3300026041 Ga0207639_10015755 Ga0207639_100157552 312
693 3300026041 Ga0207639_10106278 Ga0207639_101062782 312
694 3300026067 Ga0207678_10009656 Ga0207678_100096563 312
695 3300026067 Ga0207678_10031495 Ga0207678_100314953 312
696 3300026067 Ga0207678_10105993 Ga0207678_101059932 312
697 3300026075 Ga0207708_10039114 Ga0207708_100391142 312
698 3300026075 Ga0207708_10074019 Ga0207708_100740192 312
699 3300026078 Ga0207702_10015377 Ga0207702_100153776 312
700 3300026089 Ga0207648_10005804 Ga0207648_100058042 312
701 3300026089 Ga0207648_10215844 Ga0207648_102158442 312
702 3300026095 Ga0207676_10082624 Ga0207676_100826243 312
703 3300026116 Ga0207674_10086803 Ga0207674_100868033 312
704 3300026116 Ga0207674_10123605 Ga0207674_101236052 312
705 3300026118 Ga0207675_100024105 Ga0207675_1000241054 312
706 3300026118 Ga0207675_100058013 Ga0207675_1000580132 312
707 3300026118 Ga0207675_100108485 Ga0207675_1001084852 312
708 3300026121 Ga0207683_10001206 Ga0207683_100012064 312
709 3300026121 Ga0207683_10049783 Ga0207683_100497833 312
710 3300027364 Ga0209967_1004774 Ga0209967_10047742 312
711 3300027717 Ga0209998_10003154 Ga0209998_100031543 312
712 3300027717 Ga0209998_10018948 Ga0209998_100189482 312
713 3300027907 Ga0207428_10001593 Ga0207428_100015933 312
714 3300027907 Ga0207428_10005136 Ga0207428_100051363 312
715 3300028379 Ga0268266_10021360 Ga0268266_100213604 312
716 3300028380 Ga0268265_10001135 Ga0268265_1000113523 312
717 3300028380 Ga0268265_10067414 Ga0268265_100674141 312
718 3300028381 Ga0268264_10069727 Ga0268264_100697272 312
719 3300031241 Ga0265325_10046724 Ga0265325_100467242 312
720 3300031711 Ga0265314_10034708 Ga0265314_100347083 312
721 3300034816 Ga0373930_0000149 Ga0373930_0000149_1730_2701 312
722 3300034816 Ga0373930_0007507 Ga0373930_0007507_504_1475 312
723 3300034817 Ga0373948_0003483 Ga0373948_0003483_1202_2173 312
724 3300034818 Ga0373950_0003847 Ga0373950_0003847_274_1245 312
725 3300034819 Ga0373958_0001168 Ga0373958_0001168_971_1942 312
726 3300034820 Ga0373959_0000590 Ga0373959_0000590_1405_2376 312
727 3300034957 Ga0373938_0003974 Ga0373938_0003974_226_1197 312
728 3300034957 Ga0373938_0033337 Ga0373938_0033337_20_991 312
729 3300035084 Ga0373928_0000732 Ga0373928_0000732_2680_3651 312
730 3300035084 Ga0373928_0005790 Ga0373928_0005790_1329_2300 312
731 3300035085 Ga0373929_0005208 Ga0373929_0005208_1314_2285 312
732 3300035085 Ga0373929_0009379 Ga0373929_0009379_783_1754 312
733 3300035086 Ga0373934_0003323 Ga0373934_0003323_357_1328 312
734 3300035088 Ga0373940_0000020 Ga0373940_0000020_11639_12610 312
735 3300035088 Ga0373940_0006010 Ga0373940_0006010_757_1728 312
736 3300035089 Ga0373944_0000638 Ga0373944_0000638_2204_3175 312
737 3300035090 Ga0373949_0001031 Ga0373949_0001031_1938_2909 312
738 3300035090 Ga0373949_0011131 Ga0373949_0011131_44_1015 312
739 3300035090 Ga0373949_0036124 Ga0373949_0036124_142_1113 312
740 3300035091 Ga0373951_0000632 Ga0373951_0000632_5336_6307 312
741 3300035091 Ga0373951_0009549 Ga0373951_0009549_1028_1999 312
742 3300035092 Ga0373952_0001849 Ga0373952_0001849_1798_2769 312
743 3300035092 Ga0373952_0015095 Ga0373952_0015095_221_1192 312
744 3300035111 Ga0373923_0000650 Ga0373923_0000650_517_1488 312
745 3300035112 Ga0373932_0000824 Ga0373932_0000824_2039_3010 312
746 3300035113 Ga0373936_0012916 Ga0373936_0012916_506_1477 312
747 3300035114 Ga0373939_0000304 Ga0373939_0000304_6608_7579 312
748 3300035114 Ga0373939_0002434 Ga0373939_0002434_187_1158 312
749 3300035114 Ga0373939_0015065 Ga0373939_0015065_11_982 312
750 3300035115 Ga0373941_0000096 Ga0373941_0000096_12136_13107 312
751 3300035115 Ga0373941_0005640 Ga0373941_0005640_1784_2755 312
752 3300035115 Ga0373941_0030973 Ga0373941_0030973_142_1113 312
753 3300035116 Ga0373945_0003142 Ga0373945_0003142_1709_2680 312
754 3300035117 Ga0373953_0005057 Ga0373953_0005057_1936_2907 312
755 3300035119 Ga0373956_0013207 Ga0373956_0013207_55_1026 312
756 3300035119 Ga0373956_0091553 Ga0373956_0091553_310_1281 312
757 3300035120 Ga0373957_0004812 Ga0373957_0004812_2430_3401 312
758 3300035121 Ga0373960_0002306 Ga0373960_0002306_760_1731 312
759 3300035121 Ga0373960_0004034 Ga0373960_0004034_1180_2151 312
760 3300035121 Ga0373960_0004717 Ga0373960_0004717_1225_2196 312
761 3300035170 Ga0373943_0002507 Ga0373943_0002507_3363_4334 312
762 3300035170 Ga0373943_0011522 Ga0373943_0011522_105_1076 312
763 3300035171 Ga0373946_0002136 Ga0373946_0002136_1087_2058 312
764 3300035171 Ga0373946_0004288 Ga0373946_0004288_3709_4680 312
765 3300035172 Ga0373955_0001041 Ga0373955_0001041_7836_8807 312
766 3300035172 Ga0373955_0004535 Ga0373955_0004535_4847_5818 312
767 3300035207 Ga0373942_0000056 Ga0373942_0000056_1900_2871 312
768 3300035241 Ga0373961_0001928 Ga0373961_0001928_3469_4440 312
769 3300035241 Ga0373961_0002994 Ga0373961_0002994_2687_3658 312
770 3300035242 Ga0373962_0001582 Ga0373962_0001582_2707_3678 312
771 3300035242 Ga0373962_0021546 Ga0373962_0021546_81_1052 312
772 3300035242 Ga0373962_0042868 Ga0373962_0042868_212_1183 312
773 3300035691 Ga0373931_0008291 Ga0373931_0008291_53_1024 312
774 3300035691 Ga0373931_0010243 Ga0373931_0010243_2305_3276 312
775 3300035692 Ga0373935_0011194 Ga0373935_0011194_4182_5153 312
776 3300035695 Ga0373927_0006091 Ga0373927_0006091_1424_2395 312
777 3300035695 Ga0373927_0009888 Ga0373927_0009888_2418_3389 312
778 3300035724 Ga0373933_0012539 Ga0373933_0012539_702_1673 312
779 3300035725 Ga0373947_0003178 Ga0373947_0003178_4656_5627 312
780 3300036401 Ga0373937_0012538 Ga0373937_0012538_2827_3798 312
781 3300037068 Ga0373925_0001829 Ga0373925_0001829_7219_8190 312
782 3300037068 Ga0373925_0024946 Ga0373925_0024946_1687_2658 312
783 3300044712 Ga0453684_0053448 Ga0453684_0053448_882_1853 312
784 3300045051 Ga0451576_0022284 Ga0451576_0022284_1927_2898 312
785 3300046454 Ga0495592_0057777 Ga0495592_0057777_671_1642 312
786 3300046454 Ga0495592_0096833 Ga0495592_0096833_535_1506 312
787 3300046454 Ga0495592_0163908 Ga0495592_0163908_492_1463 312
788 3300046455 Ga0495603_0006355 Ga0495603_0006355_2252_3223 312
789 3300046455 Ga0495603_0029108 Ga0495603_0029108_1581_2552 312
790 3300046459 Ga0495629_0001405 Ga0495629_0001405_13339_14310 312
791 3300046462 Ga0495651_0004808 Ga0495651_0004808_5103_6074 312
792 3300046462 Ga0495651_0014554 Ga0495651_0014554_648_1619 312
793 3300046463 Ga0495653_0009990 Ga0495653_0009990_5085_6056 312
794 3300046463 Ga0495653_0012845 Ga0495653_0012845_2236_3207 312
795 3300046472 Ga0495580_0023894 Ga0495580_0023894_2288_3259 312
796 3300046473 Ga0495582_0018717 Ga0495582_0018717_1702_2673 312
797 3300046475 Ga0495639_0001451 Ga0495639_0001451_7702_8673 312
798 3300046476 Ga0495662_0000915 Ga0495662_0000915_8268_9239 312
799 3300046492 Ga0495585_0003492 Ga0495585_0003492_4690_5661 312
800 3300046499 Ga0495594_0001091 Ga0495594_0001091_11418_12389 312
801 3300046501 Ga0495607_0011896 Ga0495607_0011896_779_1750 312
802 3300046511 Ga0495608_0002687 Ga0495608_0002687_5807_6778 312
803 3300046511 Ga0495608_0026075 Ga0495608_0026075_710_1681 312
804 3300046514 Ga0495618_0005633 Ga0495618_0005633_3332_4303 312
805 3300046514 Ga0495618_0037562 Ga0495618_0037562_1223_2194 312
806 3300046514 Ga0495618_0046048 Ga0495618_0046048_1150_2121 312
807 3300046516 Ga0495628_0075145 Ga0495628_0075145_963_1934 312
808 3300046523 Ga0495644_0016379 Ga0495644_0016379_1174_2145 312
809 3300046525 Ga0495663_0016623 Ga0495663_0016623_131_1102 312
810 3300046529 Ga0495652_0002710 Ga0495652_0002710_11434_12405 312
811 3300046529 Ga0495652_0046431 Ga0495652_0046431_2358_3329 312
812 3300046531 Ga0495665_0002969 Ga0495665_0002969_4965_5936 312
813 3300046533 Ga0495640_0097203 Ga0495640_0097203_449_1420 312
814 3300046535 Ga0495586_0019875 Ga0495586_0019875_2127_3098 312
815 3300046535 Ga0495586_0117263 Ga0495586_0117263_22_993 312
816 3300046536 Ga0495587_0003832 Ga0495587_0003832_4998_5969 312
817 3300046536 Ga0495587_0008130 Ga0495587_0008130_4082_5053 312
818 3300046537 Ga0495598_0005995 Ga0495598_0005995_87_1058 312
819 3300046543 Ga0495645_0013139 Ga0495645_0013139_3791_4762 312
820 3300046543 Ga0495645_0246251 Ga0495645_0246251_166_1137 312
821 3300046558 Ga0495633_0002269 Ga0495633_0002269_1361_2347 312
822 3300046559 Ga0495667_0001506 Ga0495667_0001506_780_1751 312
823 3300046559 Ga0495667_0003229 Ga0495667_0003229_7451_8422 312
824 3300046559 Ga0495667_0013093 Ga0495667_0013093_1091_2062 312
825 3300046615 Ga0495656_0001233 Ga0495656_0001233_5312_6283 312
826 3300046648 Ga0495611_0036031 Ga0495611_0036031_171_1142 312
827 3300046663 Ga0495635_0033677 Ga0495635_0033677_1039_2010 312
828 3300046663 Ga0495635_0035736 Ga0495635_0035736_1708_2679 312
829 3300046674 Ga0495588_0002749 Ga0495588_0002749_3374_4345 312
830 3300046678 Ga0495599_0001517 Ga0495599_0001517_980_1951 312
831 3300046678 Ga0495599_0048414 Ga0495599_0048414_1091_2062 312
832 3300046679 Ga0495623_0010442 Ga0495623_0010442_4380_5351 312
833 3300046681 Ga0495647_0006888 Ga0495647_0006888_2055_3026 312
834 3300046683 Ga0495658_0000324 Ga0495658_0000324_17489_18460 312
835 3300046683 Ga0495658_0001251 Ga0495658_0001251_10977_11948 312
836 3300046683 Ga0495658_0068107 Ga0495658_0068107_622_1593 312
837 3300046683 Ga0495658_0146528 Ga0495658_0146528_107_1078 312
838 3300046690 Ga0495624_0003658 Ga0495624_0003658_5510_6481 312
839 3300046809 Ga0495600_0001403 Ga0495600_0001403_5684_6655 312
840 3300046809 Ga0495600_0020344 Ga0495600_0020344_3008_3979 312
841 3300046809 Ga0495600_0225695 Ga0495600_0225695_196_1167 312
842 3300047315 Ga0495581_0002626 Ga0495581_0002626_7861_8832 312
843 3300047317 Ga0495604_0007422 Ga0495604_0007422_779_1750 312
844 3300047317 Ga0495604_0024775 Ga0495604_0024775_3784_4755 312
845 3300047317 Ga0495604_0074284 Ga0495604_0074284_1091_2062 312
846 3300047319 Ga0495674_0074947 Ga0495674_0074947_1709_2680 312
847 3300047321 Ga0495676_0027763 Ga0495676_0027763_719_1690 312
848 3300047322 Ga0495680_0003143 Ga0495680_0003143_12069_13040 312
849 3300047322 Ga0495680_0004047 Ga0495680_0004047_9322_10293 312
850 3300047444 Ga0495675_0000855 Ga0495675_0000855_10287_11258 312
851 3300047471 Ga0495684_0000281 Ga0495684_0000281_28422_29393 312
852 3300047673 Ga0495593_0005567 Ga0495593_0005567_2367_3338 312
853 3300047673 Ga0495593_0015975 Ga0495593_0015975_1380_2351 312
854 3300048088 Ga0495602_0008505 Ga0495602_0008505_5315_6286 312
855 3300048088 Ga0495602_0087698 Ga0495602_0087698_592_1563 312
856 3300048903 Ga0496100_0021215 Ga0496100_0021215_1127_2098 312
857 3300048903 Ga0496100_0047320 Ga0496100_0047320_847_1818 312
858 3300048904 Ga0496101_0024709 Ga0496101_0024709_102_1073 312
859 3300048904 Ga0496101_0086778 Ga0496101_0086778_950_1921 312
860 3300048905 Ga0496102_0085310 Ga0496102_0085310_1623_2594 312
861 3300048906 Ga0496103_0010637 Ga0496103_0010637_474_1445 312
862 3300048906 Ga0496103_0053737 Ga0496103_0053737_57_1028 312
863 3300048907 Ga0496104_0046881 Ga0496104_0046881_1750_2721 312
864 3300048907 Ga0496104_0100304 Ga0496104_0100304_1642_2613 312
865 3300048908 Ga0496105_0012751 Ga0496105_0012751_5545_6516 312
866 3300048908 Ga0496105_0396551 Ga0496105_0396551_71_1042 312
867 3300048909 Ga0496106_0082620 Ga0496106_0082620_1152_2123 312
868 3300048909 Ga0496106_0096008 Ga0496106_0096008_803_1774 312
869 3300048909 Ga0496106_0153113 Ga0496106_0153113_376_1347 312
870 3300048910 Ga0496107_0035062 Ga0496107_0035062_2447_3418 312
871 3300048910 Ga0496107_0045823 Ga0496107_0045823_1069_2040 312
872 3300048911 Ga0496108_0021157 Ga0496108_0021157_4234_5205 312
873 3300048911 Ga0496108_0026962 Ga0496108_0026962_515_1486 312
874 3300048911 Ga0496108_0098818 Ga0496108_0098818_1427_2398 312
875 3300048911 Ga0496108_0164013 Ga0496108_0164013_847_1818 312
876 3300048914 Ga0496111_0072218 Ga0496111_0072218_1217_2188 312
877 3300048914 Ga0496111_0349480 Ga0496111_0349480_49_1020 312
878 3300048915 Ga0496112_0028452 Ga0496112_0028452_401_1372 312
879 3300048915 Ga0496112_0055487 Ga0496112_0055487_266_1237 312
880 3300048915 Ga0496112_0180932 Ga0496112_0180932_142_1113 312
881 3300048916 Ga0496113_0026664 Ga0496113_0026664_1493_2464 312
882 3300048916 Ga0496113_0144838 Ga0496113_0144838_816_1787 312
883 3300048918 Ga0496115_0014172 Ga0496115_0014172_4141_5112 312
884 3300048918 Ga0496115_0133498 Ga0496115_0133498_296_1267 312
885 3300049591 Ga0501075_0142297 Ga0501075_0142297_300_1271 312
886 3300049592 Ga0501076_0016049 Ga0501076_0016049_3800_4771 312
887 3300049593 Ga0501077_0021570 Ga0501077_0021570_2624_3595 312
888 3300050511 nmdc:mga08y16_4006_c1 nmdc:mga08y16_4006_c1_11238_12209 312
889 3300050512 nmdc:mga0n895_147099_c1 nmdc:mga0n895_147099_c1_652_1623 312
890 3300050512 nmdc:mga0n895_16263_c1 nmdc:mga0n895_16263_c1_3232_4203 312
891 3300050512 nmdc:mga0n895_63346_c1 nmdc:mga0n895_63346_c1_1713_2684 312
892 3300050513 nmdc:mga0rr50_135543_c1 nmdc:mga0rr50_135543_c1_823_1794 312
893 3300050515 nmdc:mga0a205_16026_c1 nmdc:mga0a205_16026_c1_4524_5495 312
894 3300050515 nmdc:mga0a205_329928_c1 nmdc:mga0a205_329928_c1_305_1276 312
895 3300053077 Ga0495601_0005565 Ga0495601_0005565_5414_6385 312
896 3300053077 Ga0495601_0016338 Ga0495601_0016338_3167_4138 312
897 3300053078 Ga0495612_0001141 Ga0495612_0001141_4681_5652 312
898 3300053078 Ga0495612_0030065 Ga0495612_0030065_683_1654 312
899 3300053084 Ga0495595_0000992 Ga0495595_0000992_9308_10279 312
900 3300053084 Ga0495595_0001007 Ga0495595_0001007_6227_7198 312
901 3300053084 Ga0495595_0004374 Ga0495595_0004374_3729_4700 312
902 3300053084 Ga0495595_0124682 Ga0495595_0124682_194_1165 312
903 3300053085 Ga0495619_0000715 Ga0495619_0000715_14498_15469 312
904 3300053085 Ga0495619_0001421 Ga0495619_0001421_4656_5627 312
905 3300053085 Ga0495619_0013795 Ga0495619_0013795_3593_4564 312
906 3300053085 Ga0495619_0077086 Ga0495619_0077086_963_1934 312
907 3300053119 Ga0500595_000006 Ga0500595_000006_50237_51208 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02153

PDH_N

Prephenate dehydrogenase, nucleotide-binding domain

29

184

0.98

PF20463

PDH_C

Prephenate dehydrogenase, dimerization domain

186

288

0.94

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

16

149

0.87

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

16

109

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpq-assembly1.cif.gz_A crystal structure of ctde in complex with fad 0.8744 9 45
8fox-assembly1.cif.gz_A abeh (tryptophan-5-halogenase) 0.8631 8 41
5tui-assembly2.cif.gz_B crystal structure of tetracycline destructase tet(50) in complex with chlortetracycline 0.8585 9 42
3nks-assembly1.cif.gz_A structure of human protoporphyrinogen ix oxidase 0.8546 9 42
7dve-assembly1.cif.gz_A crystal structure of fad-dependent c-glycoside oxidase 0.8537 9 45
ID Description Score Start End Superfamily
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9158 10 168 3.40.50.720
af_Q2FYS1_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9138 9 170 3.40.50.720
2g5cD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9089 9 166 3.40.50.720
5uscB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9044 9 168 3.40.50.720
af_Q9Y7N4_8_341_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9015 9 42 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A257QIA3-F1-model_v4 Cyclohexadienyl dehydrogenase 0.9892 8 97 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A537SP33-F1-model_v4 Prephenate/arogenate dehydrogenase family protein 0.9827 2 72
AF-A0A2E1KVZ6-F1-model_v4 Prephenate/arogenate dehydrogenase domain-containing protein 0.9771 8 105 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A432J8H5-F1-model_v4 deleted 0.9719 8 105
AF-A0A0F9J666-F1-model_v4 Prephenate/arogenate dehydrogenase domain-containing protein 0.9637 8 177 GO:0004665
GO:0006571
GO:0008977
GO:0070403

Feature Viewer

pLDDT pTM Quality
82.86 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map