F485359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 907 | 414 | 888 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300031711|Ga0265314_10034708|Ga0265314_100347083 |
| Length | 329 |
| Sequence | MSERLGPPLGAPLFDRLAVIGVGLIGSSIARAAKAQGAAGSIVATARSPATRRRVAELGLADQVVETNAAAVEGADLVIVSIPVGACGPVAKEIAAHLKPGAIVSDVGSVKGSVVRDMAPHLPKTVHFVPAHPVAGTEYSGPDAGFAELFVNRWCILTPPEGTDPAAVEKLATFWRLLGANVETMAPDHHDLVLAVTSHLPHLIAYTIVGTADELQTVTRSEVLKFSAGGFRDFTRIAASDPTMWRDVFLANKDAVLEMLGRFNEDISLLTKAIRNGDGDALFEHFTRTRAIRKGIVQIGQDSASPDFGRPHPDLXXEPLPKPYASDES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 2 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 5 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 6 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 7 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 8 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 9 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 10 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 11 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 12 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 13 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 14 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 15 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 16 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 17 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 18 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 19 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 20 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 21 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 22 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 23 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 24 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 25 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 26 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 27 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 28 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 29 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 223 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 224 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 351 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 352 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 353 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 354 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 355 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 356 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 394 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 396 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 398 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 400 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 401 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 402 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 406 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 407 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 409 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 414 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.79 |
| Metatranscriptomes | 0.11 |
| Isolates | 2.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.09 |
| Nodule | 0.22 |
| Rhizoplane | 6.95 |
| Rhizosphere | 87.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000095 | 3300000041 | Bacteria | 16151 |
| 2 | ARSoilYngRDRAFT_c00083 | 3300000042 | Bacteria | 15786 |
| 3 | ARcpr5yngRDRAFT_c000131 | 3300000043 | Bacteria | 11784 |
| 4 | ARSoilOldRDRAFT_c000103 | 3300000044 | Bacteria | 15976 |
| 5 | ARCol0yngRDRAFT_1000133 | 3300000652 | Bacteria | 13255 |
| 6 | JGI24746J21847_1005106 | 3300001977 | Bacteria | 2055 |
| 7 | JGI24739J22299_10014486 | 3300001989 | Bacteria | 2869 |
| 8 | JGI24737J22298_10005379 | 3300001990 | Bacteria | 4425 |
| 9 | JGI24737J22298_10011191 | 3300001990 | Bacteria | 2943 |
| 10 | JGI24745J21846_1001233 | 3300002073 | Bacteria | 2461 |
| 11 | JGI24738J21930_10002375 | 3300002075 | Bacteria | 4951 |
| 12 | JGI24035J26624_1000776 | 3300002126 | Bacteria | 3004 |
| 13 | JGI24742J22300_10000988 | 3300002244 | Bacteria | 4363 |
| 14 | Ga0065712_10006492 | 3300005290 | Bacteria | 2793 |
| 15 | Ga0065715_10108649 | 3300005293 | Bacteria | 2707 |
| 16 | Ga0070658_10017799 | 3300005327 | Bacteria | 5682 |
| 17 | Ga0070658_10048553 | 3300005327 | Bacteria | 3437 |
| 18 | Ga0070658_10069462 | 3300005327 | Bacteria | 2882 |
| 19 | Ga0070658_10088422 | 3300005327 | Bacteria | 2551 |
| 20 | Ga0070676_10006196 | 3300005328 | Bacteria | 6386 |
| 21 | Ga0070676_10131183 | 3300005328 | Bacteria | 1585 |
| 22 | Ga0070683_100018166 | 3300005329 | Bacteria | 6223 |
| 23 | Ga0070683_100032771 | 3300005329 | Bacteria | 4734 |
| 24 | Ga0070690_100005074 | 3300005330 | Bacteria | 7380 |
| 25 | Ga0070690_100012491 | 3300005330 | Bacteria | 4997 |
| 26 | Ga0070690_100066481 | 3300005330 | Bacteria | 2334 |
| 27 | Ga0070670_100037294 | 3300005331 | Bacteria | 4182 |
| 28 | Ga0070670_100098901 | 3300005331 | Bacteria | 2510 |
| 29 | Ga0070677_10000267 | 3300005333 | Bacteria | 18125 |
| 30 | Ga0068869_100000991 | 3300005334 | Bacteria | 16479 |
| 31 | Ga0068869_100097580 | 3300005334 | Bacteria | 2219 |
| 32 | Ga0070666_10008226 | 3300005335 | Bacteria | 6464 |
| 33 | Ga0070680_100007000 | 3300005336 | Bacteria | 8594 |
| 34 | Ga0070680_100008439 | 3300005336 | Bacteria | 7888 |
| 35 | Ga0070680_100076459 | 3300005336 | Bacteria | 2756 |
| 36 | Ga0070680_100102952 | 3300005336 | Bacteria | 2371 |
| 37 | Ga0070680_100121097 | 3300005336 | Bacteria | 2184 |
| 38 | Ga0070680_100409988 | 3300005336 | Bacteria | 1156 |
| 39 | Ga0070682_100002591 | 3300005337 | Bacteria | 9989 |
| 40 | Ga0070660_100014299 | 3300005339 | Bacteria | 5715 |
| 41 | Ga0070660_100191273 | 3300005339 | Bacteria | 1658 |
| 42 | Ga0070689_100010361 | 3300005340 | Bacteria | 6646 |
| 43 | Ga0070689_100015636 | 3300005340 | Bacteria | 5538 |
| 44 | Ga0070689_100143000 | 3300005340 | Bacteria | 1925 |
| 45 | Ga0070689_100256393 | 3300005340 | Bacteria | 1444 |
| 46 | Ga0070687_100000879 | 3300005343 | Bacteria | 10108 |
| 47 | Ga0070661_100017455 | 3300005344 | Bacteria | 5092 |
| 48 | Ga0070661_100239399 | 3300005344 | Bacteria | 1397 |
| 49 | Ga0070692_10173469 | 3300005345 | Bacteria | 1244 |
| 50 | Ga0070668_100072405 | 3300005347 | Bacteria | 2685 |
| 51 | Ga0070669_100071179 | 3300005353 | Bacteria | 2572 |
| 52 | Ga0070669_100075580 | 3300005353 | Bacteria | 2499 |
| 53 | Ga0070675_100010826 | 3300005354 | Bacteria | 7133 |
| 54 | Ga0070675_100066926 | 3300005354 | Bacteria | 2972 |
| 55 | Ga0070674_100044791 | 3300005356 | Bacteria | 3019 |
| 56 | Ga0070674_100140374 | 3300005356 | Bacteria | 1813 |
| 57 | Ga0070673_100001635 | 3300005364 | Bacteria | 13265 |
| 58 | Ga0070673_100031619 | 3300005364 | Bacteria | 3975 |
| 59 | Ga0070688_100018060 | 3300005365 | Bacteria | 4062 |
| 60 | Ga0070688_100050394 | 3300005365 | Bacteria | 2593 |
| 61 | Ga0070688_100069219 | 3300005365 | Bacteria | 2252 |
| 62 | Ga0070659_100063170 | 3300005366 | Bacteria | 2929 |
| 63 | Ga0070667_100001396 | 3300005367 | Bacteria | 21599 |
| 64 | Ga0070667_100114682 | 3300005367 | Bacteria | 2339 |
| 65 | Ga0070703_10010516 | 3300005406 | Bacteria | 2609 |
| 66 | Ga0070709_10000722 | 3300005434 | Bacteria | 18707 |
| 67 | Ga0070709_10029626 | 3300005434 | Bacteria | 3276 |
| 68 | Ga0070709_10164191 | 3300005434 | Bacteria | 1547 |
| 69 | Ga0070714_100008512 | 3300005435 | Bacteria | 8018 |
| 70 | Ga0070714_100059337 | 3300005435 | Bacteria | 3280 |
| 71 | Ga0070714_100150893 | 3300005435 | Bacteria | 2094 |
| 72 | Ga0070713_100000642 | 3300005436 | Bacteria | 22311 |
| 73 | Ga0070713_100036260 | 3300005436 | Bacteria | 3978 |
| 74 | Ga0070713_100083089 | 3300005436 | Bacteria | 2737 |
| 75 | Ga0070710_10020429 | 3300005437 | Bacteria | 3436 |
| 76 | Ga0070701_10044211 | 3300005438 | Bacteria | 2281 |
| 77 | Ga0070701_10089901 | 3300005438 | Bacteria | 1680 |
| 78 | Ga0070711_100029980 | 3300005439 | Bacteria | 3596 |
| 79 | Ga0070711_100044047 | 3300005439 | Bacteria | 3027 |
| 80 | Ga0070711_100049734 | 3300005439 | Bacteria | 2871 |
| 81 | Ga0070711_100110465 | 3300005439 | Bacteria | 2017 |
| 82 | Ga0070711_100118741 | 3300005439 | Bacteria | 1952 |
| 83 | Ga0070705_100014152 | 3300005440 | Bacteria | 4098 |
| 84 | Ga0070705_100058630 | 3300005440 | Bacteria | 2276 |
| 85 | Ga0070700_100004739 | 3300005441 | Bacteria | 7133 |
| 86 | Ga0070700_100036560 | 3300005441 | Bacteria | 2979 |
| 87 | Ga0070694_100041182 | 3300005444 | Bacteria | 3080 |
| 88 | Ga0070694_100051168 | 3300005444 | Bacteria | 2787 |
| 89 | Ga0070694_100109630 | 3300005444 | Bacteria | 1965 |
| 90 | Ga0070663_100016280 | 3300005455 | Bacteria | 4824 |
| 91 | Ga0070663_100047549 | 3300005455 | Bacteria | 3039 |
| 92 | Ga0070663_100134901 | 3300005455 | Bacteria | 1878 |
| 93 | Ga0070678_100002344 | 3300005456 | Bacteria | 10343 |
| 94 | Ga0070662_100009494 | 3300005457 | Bacteria | 6362 |
| 95 | Ga0070662_100043915 | 3300005457 | Bacteria | 3200 |
| 96 | Ga0070662_100234460 | 3300005457 | Bacteria | 1469 |
| 97 | Ga0070681_10004197 | 3300005458 | Bacteria | 13650 |
| 98 | Ga0070681_10064688 | 3300005458 | Bacteria | 3627 |
| 99 | Ga0070681_10068560 | 3300005458 | Bacteria | 3513 |
| 100 | Ga0070681_10100056 | 3300005458 | Bacteria | 2845 |
| 101 | Ga0070681_10271999 | 3300005458 | Bacteria | 1606 |
| 102 | Ga0068867_100012755 | 3300005459 | Bacteria | 5946 |
| 103 | Ga0070685_10012256 | 3300005466 | Bacteria | 4500 |
| 104 | Ga0070679_100092414 | 3300005530 | Bacteria | 3013 |
| 105 | Ga0070679_100374985 | 3300005530 | Bacteria | 1369 |
| 106 | Ga0070679_100382741 | 3300005530 | Bacteria | 1354 |
| 107 | Ga0070684_100026631 | 3300005535 | Bacteria | 4872 |
| 108 | Ga0070697_100193023 | 3300005536 | Bacteria | 1729 |
| 109 | Ga0068853_100051672 | 3300005539 | Bacteria | 3538 |
| 110 | Ga0068853_100103408 | 3300005539 | Bacteria | 2521 |
| 111 | Ga0070672_100001723 | 3300005543 | Bacteria | 13671 |
| 112 | Ga0070686_100011069 | 3300005544 | Bacteria | 5109 |
| 113 | Ga0070686_100030989 | 3300005544 | Bacteria | 3266 |
| 114 | Ga0070695_100131536 | 3300005545 | Bacteria | 1725 |
| 115 | Ga0070695_100185095 | 3300005545 | Bacteria | 1478 |
| 116 | Ga0070696_100059816 | 3300005546 | Bacteria | 2663 |
| 117 | Ga0070696_100084714 | 3300005546 | Bacteria | 2249 |
| 118 | Ga0070693_100002926 | 3300005547 | Bacteria | 7888 |
| 119 | Ga0070693_100017616 | 3300005547 | Bacteria | 3717 |
| 120 | Ga0070693_100288632 | 3300005547 | Bacteria | 1101 |
| 121 | Ga0070665_100041516 | 3300005548 | Bacteria | 4624 |
| 122 | Ga0070704_100005673 | 3300005549 | Bacteria | 7291 |
| 123 | Ga0068855_100061841 | 3300005563 | Bacteria | 4373 |
| 124 | Ga0068855_100202945 | 3300005563 | Bacteria | 2231 |
| 125 | Ga0070664_100056486 | 3300005564 | Bacteria | 3335 |
| 126 | Ga0070664_100091886 | 3300005564 | Bacteria | 2627 |
| 127 | Ga0070664_100103548 | 3300005564 | Bacteria | 2478 |
| 128 | Ga0068857_100029605 | 3300005577 | Bacteria | 4832 |
| 129 | Ga0068857_100092467 | 3300005577 | Bacteria | 2708 |
| 130 | Ga0068854_100004810 | 3300005578 | Bacteria | 8523 |
| 131 | Ga0068856_100000226 | 3300005614 | Bacteria | 61246 |
| 132 | Ga0068856_100004424 | 3300005614 | Bacteria | 14002 |
| 133 | Ga0068856_100077894 | 3300005614 | Bacteria | 3286 |
| 134 | Ga0068856_100226076 | 3300005614 | Bacteria | 1887 |
| 135 | Ga0070702_100080374 | 3300005615 | Bacteria | 1951 |
| 136 | Ga0068852_100092806 | 3300005616 | Bacteria | 2704 |
| 137 | Ga0068852_100171044 | 3300005616 | Bacteria | 2036 |
| 138 | Ga0068852_100248068 | 3300005616 | Bacteria | 1704 |
| 139 | Ga0068852_100271263 | 3300005616 | Bacteria | 1633 |
| 140 | Ga0068859_100051438 | 3300005617 | Bacteria | 4141 |
| 141 | Ga0068859_100098957 | 3300005617 | Bacteria | 2971 |
| 142 | Ga0068864_100026210 | 3300005618 | Bacteria | 4915 |
| 143 | Ga0068866_10004921 | 3300005718 | Bacteria | 5492 |
| 144 | Ga0068866_10217040 | 3300005718 | Bacteria | 1152 |
| 145 | Ga0068861_100002263 | 3300005719 | Bacteria | 12509 |
| 146 | Ga0068861_100028372 | 3300005719 | Bacteria | 4083 |
| 147 | Ga0068870_10000323 | 3300005840 | Bacteria | 17781 |
| 148 | Ga0068858_100021358 | 3300005842 | Bacteria | 6047 |
| 149 | Ga0068858_100030717 | 3300005842 | Bacteria | 4989 |
| 150 | Ga0068858_100036975 | 3300005842 | Bacteria | 4526 |
| 151 | Ga0068858_100107313 | 3300005842 | Bacteria | 2606 |
| 152 | Ga0068860_100001886 | 3300005843 | Bacteria | 22272 |
| 153 | Ga0068860_100102035 | 3300005843 | Bacteria | 2737 |
| 154 | Ga0068860_100136842 | 3300005843 | Bacteria | 2352 |
| 155 | Ga0068862_100001462 | 3300005844 | Bacteria | 21734 |
| 156 | Ga0068862_100047241 | 3300005844 | Bacteria | 3673 |
| 157 | Ga0068862_100308856 | 3300005844 | Bacteria | 1457 |
| 158 | Ga0068862_100401730 | 3300005844 | Bacteria | 1282 |
| 159 | Ga0081455_10000313 | 3300005937 | Bacteria | 63616 |
| 160 | Ga0081455_10029513 | 3300005937 | Bacteria | 5000 |
| 161 | Ga0081455_10062450 | 3300005937 | Bacteria | 3131 |
| 162 | Ga0070717_10001127 | 3300006028 | Bacteria | 18067 |
| 163 | Ga0070717_10026094 | 3300006028 | Bacteria | 4657 |
| 164 | Ga0070717_10120190 | 3300006028 | Bacteria | 2250 |
| 165 | Ga0070715_10013325 | 3300006163 | Bacteria | 3017 |
| 166 | Ga0070716_100004315 | 3300006173 | Bacteria | 6777 |
| 167 | Ga0070712_100002937 | 3300006175 | Bacteria | 10561 |
| 168 | Ga0070712_100118608 | 3300006175 | Bacteria | 1987 |
| 169 | Ga0070712_100255692 | 3300006175 | Bacteria | 1402 |
| 170 | Ga0075367_10052512 | 3300006178 | Bacteria | 2413 |
| 171 | Ga0097621_100006440 | 3300006237 | Bacteria | 8336 |
| 172 | Ga0097621_100108031 | 3300006237 | Bacteria | 2349 |
| 173 | Ga0068871_100004355 | 3300006358 | Bacteria | 9840 |
| 174 | Ga0068871_100005719 | 3300006358 | Bacteria | 8729 |
| 175 | Ga0068871_100041937 | 3300006358 | Bacteria | 3671 |
| 176 | Ga0075430_100002289 | 3300006846 | Bacteria | 15872 |
| 177 | Ga0075433_10049262 | 3300006852 | Bacteria | 3665 |
| 178 | Ga0075433_10260286 | 3300006852 | Bacteria | 1538 |
| 179 | Ga0075434_100038096 | 3300006871 | Bacteria | 4762 |
| 180 | Ga0075434_100044263 | 3300006871 | Bacteria | 4416 |
| 181 | Ga0075434_100065153 | 3300006871 | Bacteria | 3628 |
| 182 | Ga0075434_100143973 | 3300006871 | Bacteria | 2404 |
| 183 | Ga0075434_100147344 | 3300006871 | Bacteria | 2374 |
| 184 | Ga0068865_100021120 | 3300006881 | Bacteria | 4232 |
| 185 | Ga0068865_100160284 | 3300006881 | Bacteria | 1715 |
| 186 | Ga0075436_100013190 | 3300006914 | Bacteria | 5667 |
| 187 | Ga0097620_100051438 | 3300006931 | Bacteria | 4141 |
| 188 | Ga0097620_100098964 | 3300006931 | Bacteria | 2971 |
| 189 | Ga0075435_100012862 | 3300007076 | Bacteria | 6206 |
| 190 | Ga0099795_10003299 | 3300007788 | Bacteria | 3974 |
| 191 | Ga0099795_10022675 | 3300007788 | Bacteria | 2075 |
| 192 | Ga0105240_10023127 | 3300009093 | Bacteria | 8229 |
| 193 | Ga0105240_10102968 | 3300009093 | Bacteria | 3469 |
| 194 | Ga0105240_10374892 | 3300009093 | Bacteria | 1608 |
| 195 | Ga0111539_10002538 | 3300009094 | Bacteria | 24172 |
| 196 | Ga0111539_10007068 | 3300009094 | Bacteria | 14397 |
| 197 | Ga0111539_10020707 | 3300009094 | Bacteria | 8099 |
| 198 | Ga0111539_10324603 | 3300009094 | Bacteria | 1791 |
| 199 | Ga0105245_10775274 | 3300009098 | Bacteria | 996 |
| 200 | Ga0105247_10003784 | 3300009101 | Bacteria | 9811 |
| 201 | Ga0105247_10006797 | 3300009101 | Bacteria | 7054 |
| 202 | Ga0105247_10033503 | 3300009101 | Bacteria | 3125 |
| 203 | Ga0114129_10002965 | 3300009147 | Bacteria | 23749 |
| 204 | Ga0114129_10006052 | 3300009147 | Bacteria | 17153 |
| 205 | Ga0105243_10022668 | 3300009148 | Bacteria | 4775 |
| 206 | Ga0105243_10027142 | 3300009148 | Bacteria | 4385 |
| 207 | Ga0105243_10060557 | 3300009148 | Bacteria | 3024 |
| 208 | Ga0105243_10367606 | 3300009148 | Bacteria | 1326 |
| 209 | Ga0105241_10069695 | 3300009174 | Bacteria | 2727 |
| 210 | Ga0105241_10221355 | 3300009174 | Bacteria | 1591 |
| 211 | Ga0105242_10016257 | 3300009176 | Bacteria | 5784 |
| 212 | Ga0105248_10002716 | 3300009177 | Bacteria | 19655 |
| 213 | Ga0105248_10037966 | 3300009177 | Bacteria | 5388 |
| 214 | Ga0105248_10057751 | 3300009177 | Bacteria | 4356 |
| 215 | Ga0105237_10204320 | 3300009545 | Bacteria | 1976 |
| 216 | Ga0105238_10015798 | 3300009551 | Bacteria | 7641 |
| 217 | Ga0105238_10098322 | 3300009551 | Bacteria | 2911 |
| 218 | Ga0105238_10178680 | 3300009551 | Bacteria | 2099 |
| 219 | Ga0105249_10014021 | 3300009553 | Bacteria | 7084 |
| 220 | Ga0105249_10046857 | 3300009553 | Bacteria | 3936 |
| 221 | Ga0105249_10049985 | 3300009553 | Bacteria | 3813 |
| 222 | Ga0105249_10603471 | 3300009553 | Bacteria | 1152 |
| 223 | Ga0105239_10093887 | 3300010375 | Bacteria | 3313 |
| 224 | Ga0105239_10125513 | 3300010375 | Bacteria | 2852 |
| 225 | Ga0105239_10205243 | 3300010375 | Bacteria | 2208 |
| 226 | Ga0105246_10000456 | 3300011119 | Bacteria | 21904 |
| 227 | Ga0105246_10104698 | 3300011119 | Bacteria | 2067 |
| 228 | Ga0157373_10035903 | 3300013100 | Bacteria | 3558 |
| 229 | Ga0157371_10090061 | 3300013102 | Bacteria | 2173 |
| 230 | Ga0157369_10346545 | 3300013105 | Bacteria | 1543 |
| 231 | Ga0157369_10381609 | 3300013105 | Bacteria | 1463 |
| 232 | Ga0157374_10015579 | 3300013296 | Bacteria | 6672 |
| 233 | Ga0157374_10043090 | 3300013296 | Bacteria | 4166 |
| 234 | Ga0157378_10012584 | 3300013297 | Bacteria | 7405 |
| 235 | Ga0163162_10044487 | 3300013306 | Bacteria | 4447 |
| 236 | Ga0163162_10309248 | 3300013306 | Bacteria | 1713 |
| 237 | Ga0157372_10035536 | 3300013307 | Bacteria | 5487 |
| 238 | Ga0157375_10005758 | 3300013308 | Bacteria | 10780 |
| 239 | Ga0157375_10006049 | 3300013308 | Bacteria | 10552 |
| 240 | Ga0157375_10055984 | 3300013308 | Bacteria | 3891 |
| 241 | Ga0157375_10084758 | 3300013308 | Bacteria | 3218 |
| 242 | Ga0163163_10126013 | 3300014325 | Bacteria | 2599 |
| 243 | Ga0157380_10019473 | 3300014326 | Bacteria | 5057 |
| 244 | Ga0157377_10083516 | 3300014745 | Bacteria | 1872 |
| 245 | Ga0157379_10007196 | 3300014968 | Bacteria | 9626 |
| 246 | Ga0157379_10013988 | 3300014968 | Bacteria | 7032 |
| 247 | Ga0157379_10345840 | 3300014968 | Bacteria | 1361 |
| 248 | Ga0157379_10355408 | 3300014968 | Bacteria | 1342 |
| 249 | Ga0157376_10005756 | 3300014969 | Bacteria | 8681 |
| 250 | Ga0157376_10018772 | 3300014969 | Bacteria | 5312 |
| 251 | Ga0157376_10065841 | 3300014969 | Bacteria | 3062 |
| 252 | Ga0157376_10142542 | 3300014969 | Bacteria | 2151 |
| 253 | Ga0163161_10006245 | 3300017792 | Bacteria | 8254 |
| 254 | Ga0163161_10053352 | 3300017792 | Bacteria | 2932 |
| 255 | Ga0206353_10044632 | 3300020082 | Bacteria | 2548 |
| 256 | Ga0213876_10013044 | 3300021384 | Bacteria | 4417 |
| 257 | Ga0207666_1000483 | 3300025271 | Bacteria | 5007 |
| 258 | Ga0207666_1001877 | 3300025271 | Bacteria | 2496 |
| 259 | Ga0207673_1000591 | 3300025290 | Bacteria | 3853 |
| 260 | Ga0209564_1010473 | 3300025295 | Bacteria | 4265 |
| 261 | Ga0207426_1038120 | 3300025302 | Bacteria | 1515 |
| 262 | Ga0207697_10008842 | 3300025315 | Bacteria | 4381 |
| 263 | Ga0207697_10024058 | 3300025315 | Bacteria | 2495 |
| 264 | Ga0207682_10000143 | 3300025893 | Bacteria | 32063 |
| 265 | Ga0207692_10006694 | 3300025898 | Bacteria | 4685 |
| 266 | Ga0207692_10032171 | 3300025898 | Bacteria | 2518 |
| 267 | Ga0207692_10110690 | 3300025898 | Bacteria | 1522 |
| 268 | Ga0207642_10008803 | 3300025899 | Bacteria | 3483 |
| 269 | Ga0207642_10164011 | 3300025899 | Bacteria | 1196 |
| 270 | Ga0207710_10038796 | 3300025900 | Bacteria | 2107 |
| 271 | Ga0207710_10077566 | 3300025900 | Bacteria | 1535 |
| 272 | Ga0207688_10001469 | 3300025901 | Bacteria | 12347 |
| 273 | Ga0207688_10075359 | 3300025901 | Bacteria | 1920 |
| 274 | Ga0207680_10022035 | 3300025903 | Bacteria | 3459 |
| 275 | Ga0207680_10022742 | 3300025903 | Bacteria | 3414 |
| 276 | Ga0207680_10077345 | 3300025903 | Bacteria | 2081 |
| 277 | Ga0207647_10042117 | 3300025904 | Bacteria | 2867 |
| 278 | Ga0207685_10117244 | 3300025905 | Bacteria | 1163 |
| 279 | Ga0207699_10107335 | 3300025906 | Bacteria | 1783 |
| 280 | Ga0207645_10002217 | 3300025907 | Bacteria | 15495 |
| 281 | Ga0207645_10014177 | 3300025907 | Bacteria | 5339 |
| 282 | Ga0207645_10034551 | 3300025907 | Bacteria | 3249 |
| 283 | Ga0207643_10000336 | 3300025908 | Bacteria | 32116 |
| 284 | Ga0207705_10003687 | 3300025909 | Bacteria | 11655 |
| 285 | Ga0207705_10095154 | 3300025909 | Bacteria | 2185 |
| 286 | Ga0207695_10274419 | 3300025913 | Bacteria | 1581 |
| 287 | Ga0207695_10330798 | 3300025913 | Bacteria | 1412 |
| 288 | Ga0207671_10156696 | 3300025914 | Bacteria | 1762 |
| 289 | Ga0207671_10265686 | 3300025914 | Bacteria | 1351 |
| 290 | Ga0207693_10003360 | 3300025915 | Bacteria | 13667 |
| 291 | Ga0207693_10007237 | 3300025915 | Bacteria | 9133 |
| 292 | Ga0207693_10027357 | 3300025915 | Bacteria | 4509 |
| 293 | Ga0207693_10031159 | 3300025915 | Bacteria | 4213 |
| 294 | Ga0207693_10109587 | 3300025915 | Bacteria | 2165 |
| 295 | Ga0207663_10035519 | 3300025916 | Bacteria | 2991 |
| 296 | Ga0207663_10137394 | 3300025916 | Bacteria | 1698 |
| 297 | Ga0207660_10013553 | 3300025917 | Bacteria | 5344 |
| 298 | Ga0207660_10022567 | 3300025917 | Bacteria | 4241 |
| 299 | Ga0207660_10030666 | 3300025917 | Bacteria | 3697 |
| 300 | Ga0207662_10022126 | 3300025918 | Bacteria | 3641 |
| 301 | Ga0207657_10050255 | 3300025919 | Bacteria | 3629 |
| 302 | Ga0207657_10077116 | 3300025919 | Bacteria | 2810 |
| 303 | Ga0207657_10151445 | 3300025919 | Bacteria | 1889 |
| 304 | Ga0207657_10167779 | 3300025919 | Bacteria | 1780 |
| 305 | Ga0207649_10001348 | 3300025920 | Bacteria | 14601 |
| 306 | Ga0207652_10027823 | 3300025921 | Bacteria | 4714 |
| 307 | Ga0207652_10051777 | 3300025921 | Bacteria | 3521 |
| 308 | Ga0207652_10052592 | 3300025921 | Bacteria | 3496 |
| 309 | Ga0207681_10000782 | 3300025923 | Bacteria | 20961 |
| 310 | Ga0207681_10220025 | 3300025923 | Bacteria | 1468 |
| 311 | Ga0207694_10050122 | 3300025924 | Bacteria | 3232 |
| 312 | Ga0207694_10255551 | 3300025924 | Bacteria | 1434 |
| 313 | Ga0207650_10021793 | 3300025925 | Bacteria | 4531 |
| 314 | Ga0207650_10147269 | 3300025925 | Bacteria | 1855 |
| 315 | Ga0207659_10119646 | 3300025926 | Bacteria | 2016 |
| 316 | Ga0207687_10047719 | 3300025927 | Bacteria | 2970 |
| 317 | Ga0207687_10083224 | 3300025927 | Bacteria | 2316 |
| 318 | Ga0207700_10001518 | 3300025928 | Bacteria | 13150 |
| 319 | Ga0207700_10028277 | 3300025928 | Bacteria | 3939 |
| 320 | Ga0207700_10065496 | 3300025928 | Bacteria | 2772 |
| 321 | Ga0207664_10048993 | 3300025929 | Bacteria | 3324 |
| 322 | Ga0207664_10071944 | 3300025929 | Bacteria | 2787 |
| 323 | Ga0207664_10073474 | 3300025929 | Bacteria | 2759 |
| 324 | Ga0207644_10007899 | 3300025931 | Bacteria | 6957 |
| 325 | Ga0207644_10017834 | 3300025931 | Bacteria | 4800 |
| 326 | Ga0207690_10019650 | 3300025932 | Bacteria | 4163 |
| 327 | Ga0207690_10053988 | 3300025932 | Bacteria | 2699 |
| 328 | Ga0207706_10007938 | 3300025933 | Bacteria | 9797 |
| 329 | Ga0207706_10051355 | 3300025933 | Bacteria | 3641 |
| 330 | Ga0207706_10061120 | 3300025933 | Bacteria | 3317 |
| 331 | Ga0207686_10012238 | 3300025934 | Bacteria | 4713 |
| 332 | Ga0207686_10017860 | 3300025934 | Bacteria | 4005 |
| 333 | Ga0207709_10028191 | 3300025935 | Bacteria | 3245 |
| 334 | Ga0207709_10032780 | 3300025935 | Bacteria | 3045 |
| 335 | Ga0207670_10013045 | 3300025936 | Bacteria | 4886 |
| 336 | Ga0207670_10094086 | 3300025936 | Bacteria | 2125 |
| 337 | Ga0207669_10076620 | 3300025937 | Bacteria | 2123 |
| 338 | Ga0207669_10100444 | 3300025937 | Bacteria | 1911 |
| 339 | Ga0207704_10087197 | 3300025938 | Bacteria | 2038 |
| 340 | Ga0207704_10320976 | 3300025938 | Bacteria | 1195 |
| 341 | Ga0207665_10007323 | 3300025939 | Bacteria | 7301 |
| 342 | Ga0207665_10012708 | 3300025939 | Bacteria | 5537 |
| 343 | Ga0207691_10039514 | 3300025940 | Bacteria | 4365 |
| 344 | Ga0207711_10002949 | 3300025941 | Bacteria | 14881 |
| 345 | Ga0207689_10000929 | 3300025942 | Bacteria | 28093 |
| 346 | Ga0207689_10112248 | 3300025942 | Bacteria | 2241 |
| 347 | Ga0207661_10013325 | 3300025944 | Bacteria | 6005 |
| 348 | Ga0207679_10001711 | 3300025945 | Bacteria | 13671 |
| 349 | Ga0207667_10039139 | 3300025949 | Bacteria | 5055 |
| 350 | Ga0207667_10079202 | 3300025949 | Bacteria | 3405 |
| 351 | Ga0207667_10116137 | 3300025949 | Bacteria | 2758 |
| 352 | Ga0207667_10457678 | 3300025949 | Bacteria | 1296 |
| 353 | Ga0207651_10000218 | 3300025960 | Bacteria | 24731 |
| 354 | Ga0207651_10027633 | 3300025960 | Bacteria | 3567 |
| 355 | Ga0207651_10131464 | 3300025960 | Bacteria | 1917 |
| 356 | Ga0207712_10064867 | 3300025961 | Bacteria | 2605 |
| 357 | Ga0207712_10400520 | 3300025961 | Bacteria | 1153 |
| 358 | Ga0207712_10403384 | 3300025961 | Bacteria | 1149 |
| 359 | Ga0207640_10015886 | 3300025981 | Bacteria | 4367 |
| 360 | Ga0207703_10185066 | 3300026035 | Bacteria | 1840 |
| 361 | Ga0207703_10204039 | 3300026035 | Bacteria | 1758 |
| 362 | Ga0207639_10015755 | 3300026041 | Bacteria | 5334 |
| 363 | Ga0207639_10106278 | 3300026041 | Bacteria | 2278 |
| 364 | Ga0207678_10009656 | 3300026067 | Bacteria | 8486 |
| 365 | Ga0207678_10018073 | 3300026067 | Bacteria | 6193 |
| 366 | Ga0207678_10031495 | 3300026067 | Bacteria | 4627 |
| 367 | Ga0207678_10053209 | 3300026067 | Bacteria | 3489 |
| 368 | Ga0207678_10105993 | 3300026067 | Bacteria | 2398 |
| 369 | Ga0207678_10131872 | 3300026067 | Bacteria | 2132 |
| 370 | Ga0207708_10039114 | 3300026075 | Bacteria | 3613 |
| 371 | Ga0207708_10074019 | 3300026075 | Bacteria | 2611 |
| 372 | Ga0207702_10000191 | 3300026078 | Bacteria | 72810 |
| 373 | Ga0207702_10015377 | 3300026078 | Bacteria | 6342 |
| 374 | Ga0207648_10005804 | 3300026089 | Bacteria | 12366 |
| 375 | Ga0207648_10215844 | 3300026089 | Bacteria | 1704 |
| 376 | Ga0207676_10082624 | 3300026095 | Bacteria | 2613 |
| 377 | Ga0207674_10086803 | 3300026116 | Bacteria | 3123 |
| 378 | Ga0207674_10123605 | 3300026116 | Bacteria | 2554 |
| 379 | Ga0207675_100024105 | 3300026118 | Bacteria | 5657 |
| 380 | Ga0207675_100058013 | 3300026118 | Bacteria | 3613 |
| 381 | Ga0207675_100108485 | 3300026118 | Bacteria | 2618 |
| 382 | Ga0207683_10001206 | 3300026121 | Bacteria | 23425 |
| 383 | Ga0207683_10022893 | 3300026121 | Bacteria | 5368 |
| 384 | Ga0207683_10049783 | 3300026121 | Bacteria | 3669 |
| 385 | Ga0207683_10248106 | 3300026121 | Bacteria | 1624 |
| 386 | Ga0209967_1004774 | 3300027364 | Bacteria | 1810 |
| 387 | Ga0209998_10003154 | 3300027717 | Bacteria | 3654 |
| 388 | Ga0209998_10018948 | 3300027717 | Bacteria | 1464 |
| 389 | Ga0207428_10001593 | 3300027907 | Bacteria | 23627 |
| 390 | Ga0207428_10005136 | 3300027907 | Bacteria | 12260 |
| 391 | Ga0268266_10021360 | 3300028379 | Bacteria | 5515 |
| 392 | Ga0268265_10001135 | 3300028380 | Bacteria | 23498 |
| 393 | Ga0268265_10067414 | 3300028380 | Bacteria | 2770 |
| 394 | Ga0268264_10069727 | 3300028381 | Bacteria | 2974 |
| 395 | Ga0265337_1000296 | 3300028556 | Bacteria | 26607 |
| 396 | Ga0265338_10030853 | 3300028800 | Bacteria | 5267 |
| 397 | Ga0265330_10020750 | 3300031235 | Bacteria | 3001 |
| 398 | Ga0265330_10045089 | 3300031235 | Bacteria | 1944 |
| 399 | Ga0265325_10000690 | 3300031241 | Bacteria | 24604 |
| 400 | Ga0265325_10009262 | 3300031241 | Bacteria | 5756 |
| 401 | Ga0265325_10010027 | 3300031241 | Bacteria | 5506 |
| 402 | Ga0265325_10010324 | 3300031241 | Bacteria | 5413 |
| 403 | Ga0265325_10036062 | 3300031241 | Bacteria | 2623 |
| 404 | Ga0265325_10046724 | 3300031241 | Bacteria | 2244 |
| 405 | Ga0265325_10056738 | 3300031241 | Bacteria | 1999 |
| 406 | Ga0265325_10074664 | 3300031241 | Bacteria | 1695 |
| 407 | Ga0265325_10083197 | 3300031241 | Bacteria | 1587 |
| 408 | Ga0265340_10018619 | 3300031247 | Bacteria | 3581 |
| 409 | Ga0265340_10022625 | 3300031247 | Bacteria | 3213 |
| 410 | Ga0265340_10045565 | 3300031247 | Bacteria | 2141 |
| 411 | Ga0265340_10064973 | 3300031247 | Bacteria | 1738 |
| 412 | Ga0265340_10101495 | 3300031247 | Bacteria | 1336 |
| 413 | Ga0265339_10030920 | 3300031249 | Bacteria | 3029 |
| 414 | Ga0265339_10032250 | 3300031249 | Bacteria | 2955 |
| 415 | Ga0265331_10005916 | 3300031250 | Bacteria | 7314 |
| 416 | Ga0265331_10069105 | 3300031250 | Bacteria | 1655 |
| 417 | Ga0265316_10021856 | 3300031344 | Bacteria | 5409 |
| 418 | Ga0265316_10149223 | 3300031344 | Bacteria | 1752 |
| 419 | Ga0265316_10184280 | 3300031344 | Bacteria | 1553 |
| 420 | Ga0265313_10000703 | 3300031595 | Bacteria | 34516 |
| 421 | Ga0265313_10008364 | 3300031595 | Bacteria | 6883 |
| 422 | Ga0265313_10009868 | 3300031595 | Bacteria | 6141 |
| 423 | Ga0265313_10012459 | 3300031595 | Bacteria | 5188 |
| 424 | Ga0316575_10047527 | 3300031665 | Bacteria | 1706 |
| 425 | Ga0265314_10006018 | 3300031711 | Bacteria | 10810 |
| 426 | Ga0265314_10034708 | 3300031711 | Bacteria | 3681 |
| 427 | Ga0265314_10043299 | 3300031711 | Bacteria | 3202 |
| 428 | Ga0265314_10070842 | 3300031711 | Bacteria | 2335 |
| 429 | Ga0265342_10000546 | 3300031712 | Bacteria | 39732 |
| 430 | Ga0265342_10066632 | 3300031712 | Bacteria | 2109 |
| 431 | Ga0265342_10085799 | 3300031712 | Bacteria | 1811 |
| 432 | Ga0316578_10031890 | 3300031728 | Bacteria | 3006 |
| 433 | Ga0316583_10007186 | 3300032133 | Bacteria | 4004 |
| 434 | Ga0373930_0000149 | 3300034816 | Bacteria | 7906 |
| 435 | Ga0373930_0007507 | 3300034816 | Bacteria | 1879 |
| 436 | Ga0373948_0003483 | 3300034817 | Bacteria | 2425 |
| 437 | Ga0373950_0003847 | 3300034818 | Bacteria | 2177 |
| 438 | Ga0373958_0001168 | 3300034819 | Bacteria | 3483 |
| 439 | Ga0373959_0000590 | 3300034820 | Bacteria | 6366 |
| 440 | Ga0373938_0003974 | 3300034957 | Bacteria | 2446 |
| 441 | Ga0373938_0033337 | 3300034957 | Bacteria | 1113 |
| 442 | Ga0373928_0000732 | 3300035084 | Bacteria | 6430 |
| 443 | Ga0373928_0005790 | 3300035084 | Bacteria | 2364 |
| 444 | Ga0373929_0005208 | 3300035085 | Bacteria | 2337 |
| 445 | Ga0373929_0009379 | 3300035085 | Bacteria | 1814 |
| 446 | Ga0373934_0003323 | 3300035086 | Bacteria | 5889 |
| 447 | Ga0373940_0000020 | 3300035088 | Bacteria | 18639 |
| 448 | Ga0373940_0006010 | 3300035088 | Bacteria | 2666 |
| 449 | Ga0373944_0000638 | 3300035089 | Bacteria | 8357 |
| 450 | Ga0373949_0001031 | 3300035090 | Bacteria | 8546 |
| 451 | Ga0373949_0011131 | 3300035090 | Bacteria | 1978 |
| 452 | Ga0373949_0036124 | 3300035090 | Bacteria | 1197 |
| 453 | Ga0373951_0000632 | 3300035091 | Bacteria | 9701 |
| 454 | Ga0373951_0009549 | 3300035091 | Bacteria | 2182 |
| 455 | Ga0373952_0001849 | 3300035092 | Bacteria | 3843 |
| 456 | Ga0373952_0015095 | 3300035092 | Bacteria | 1555 |
| 457 | Ga0373923_0000650 | 3300035111 | Bacteria | 8771 |
| 458 | Ga0373932_0000824 | 3300035112 | Bacteria | 9169 |
| 459 | Ga0373936_0012916 | 3300035113 | Bacteria | 3184 |
| 460 | Ga0373939_0000304 | 3300035114 | Bacteria | 12763 |
| 461 | Ga0373939_0002434 | 3300035114 | Bacteria | 4388 |
| 462 | Ga0373939_0015065 | 3300035114 | Bacteria | 2016 |
| 463 | Ga0373941_0000096 | 3300035115 | Bacteria | 14448 |
| 464 | Ga0373941_0005640 | 3300035115 | Bacteria | 2962 |
| 465 | Ga0373941_0030973 | 3300035115 | Bacteria | 1590 |
| 466 | Ga0373945_0003142 | 3300035116 | Bacteria | 5182 |
| 467 | Ga0373953_0001936 | 3300035117 | Bacteria | 6155 |
| 468 | Ga0373953_0005057 | 3300035117 | Bacteria | 4253 |
| 469 | Ga0373953_0024935 | 3300035117 | Bacteria | 2279 |
| 470 | Ga0373954_0016088 | 3300035118 | Bacteria | 3347 |
| 471 | Ga0373956_0003652 | 3300035119 | Bacteria | 6215 |
| 472 | Ga0373956_0013207 | 3300035119 | Bacteria | 3435 |
| 473 | Ga0373956_0091553 | 3300035119 | Bacteria | 1403 |
| 474 | Ga0373957_0004812 | 3300035120 | Bacteria | 4136 |
| 475 | Ga0373957_0012323 | 3300035120 | Bacteria | 2877 |
| 476 | Ga0373960_0002306 | 3300035121 | Bacteria | 4292 |
| 477 | Ga0373960_0004034 | 3300035121 | Bacteria | 3351 |
| 478 | Ga0373960_0004717 | 3300035121 | Bacteria | 3136 |
| 479 | Ga0373943_0002507 | 3300035170 | Bacteria | 8346 |
| 480 | Ga0373943_0011522 | 3300035170 | Bacteria | 3979 |
| 481 | Ga0373943_0035932 | 3300035170 | Bacteria | 2371 |
| 482 | Ga0373943_0051354 | 3300035170 | Bacteria | 2029 |
| 483 | Ga0373946_0002136 | 3300035171 | Bacteria | 6931 |
| 484 | Ga0373946_0004288 | 3300035171 | Bacteria | 5096 |
| 485 | Ga0373955_0001041 | 3300035172 | Bacteria | 11788 |
| 486 | Ga0373955_0003147 | 3300035172 | Bacteria | 7220 |
| 487 | Ga0373955_0004535 | 3300035172 | Bacteria | 6156 |
| 488 | Ga0373955_0006462 | 3300035172 | Bacteria | 5338 |
| 489 | Ga0373955_0049303 | 3300035172 | Bacteria | 2286 |
| 490 | Ga0373942_0000056 | 3300035207 | Bacteria | 22957 |
| 491 | Ga0373961_0001928 | 3300035241 | Bacteria | 5621 |
| 492 | Ga0373961_0002994 | 3300035241 | Bacteria | 4263 |
| 493 | Ga0373962_0001582 | 3300035242 | Bacteria | 5397 |
| 494 | Ga0373962_0021546 | 3300035242 | Bacteria | 1701 |
| 495 | Ga0373962_0042868 | 3300035242 | Bacteria | 1280 |
| 496 | Ga0316574_0000385 | 3300035398 | Bacteria | 17232 |
| 497 | Ga0373924_0028034 | 3300035410 | Bacteria | 2242 |
| 498 | Ga0373931_0008291 | 3300035691 | Bacteria | 4922 |
| 499 | Ga0373931_0010243 | 3300035691 | Bacteria | 4503 |
| 500 | Ga0373935_0011194 | 3300035692 | Bacteria | 5385 |
| 501 | Ga0373935_0075860 | 3300035692 | Bacteria | 2176 |
| 502 | Ga0373927_0006091 | 3300035695 | Bacteria | 8258 |
| 503 | Ga0373927_0009888 | 3300035695 | Bacteria | 6396 |
| 504 | Ga0373927_0116076 | 3300035695 | Bacteria | 1745 |
| 505 | Ga0373933_0008436 | 3300035724 | Bacteria | 5622 |
| 506 | Ga0373933_0012539 | 3300035724 | Bacteria | 4683 |
| 507 | Ga0373933_0024099 | 3300035724 | Bacteria | 3483 |
| 508 | Ga0373947_0003178 | 3300035725 | Bacteria | 9770 |
| 509 | Ga0373947_0028811 | 3300035725 | Bacteria | 3257 |
| 510 | Ga0373947_0053593 | 3300035725 | Bacteria | 2432 |
| 511 | Ga0373947_0100287 | 3300035725 | Bacteria | 1819 |
| 512 | Ga0373937_0003470 | 3300036401 | Bacteria | 13244 |
| 513 | Ga0373937_0012538 | 3300036401 | Bacteria | 7457 |
| 514 | Ga0373937_0017679 | 3300036401 | Bacteria | 6361 |
| 515 | Ga0373937_0036810 | 3300036401 | Bacteria | 4458 |
| 516 | Ga0316584_0005296 | 3300036712 | Bacteria | 8638 |
| 517 | Ga0373925_0001829 | 3300037068 | Bacteria | 17750 |
| 518 | Ga0373925_0024946 | 3300037068 | Bacteria | 4366 |
| 519 | Ga0373925_0189047 | 3300037068 | Bacteria | 1633 |
| 520 | Ga0373925_0231162 | 3300037068 | Bacteria | 1479 |
| 521 | Ga0395899_0047062 | 3300037312 | Bacteria | 3211 |
| 522 | Ga0395900_0003102 | 3300037418 | Bacteria | 18039 |
| 523 | Ga0395898_0017292 | 3300037466 | Bacteria | 7366 |
| 524 | Ga0395898_0021942 | 3300037466 | Bacteria | 6467 |
| 525 | Ga0395898_0057531 | 3300037466 | Bacteria | 3789 |
| 526 | Ga0395901_0005769 | 3300038443 | Bacteria | 12539 |
| 527 | Ga0395901_0006170 | 3300038443 | Bacteria | 12147 |
| 528 | Ga0395901_0081069 | 3300038443 | Bacteria | 3389 |
| 529 | Ga0395901_0574320 | 3300038443 | Bacteria | 1140 |
| 530 | Ga0436365_1505706 | 3300039437 | Bacteria | 2181 |
| 531 | Ga0453684_0053448 | 3300044712 | Bacteria | 5272 |
| 532 | Ga0466957_0240272 | 3300044842 | Bacteria | 1201 |
| 533 | Ga0451576_0022284 | 3300045051 | Bacteria | 6871 |
| 534 | Ga0466958_0034345 | 3300045836 | Bacteria | 3025 |
| 535 | Ga0495592_0038830 | 3300046454 | Bacteria | 3580 |
| 536 | Ga0495592_0057777 | 3300046454 | Bacteria | 2863 |
| 537 | Ga0495592_0096833 | 3300046454 | Bacteria | 2108 |
| 538 | Ga0495592_0163908 | 3300046454 | Bacteria | 1527 |
| 539 | Ga0495603_0006355 | 3300046455 | Bacteria | 7070 |
| 540 | Ga0495603_0029108 | 3300046455 | Bacteria | 3331 |
| 541 | Ga0495603_0103661 | 3300046455 | Bacteria | 1660 |
| 542 | Ga0495629_0001405 | 3300046459 | Bacteria | 18978 |
| 543 | Ga0495638_0014270 | 3300046460 | Bacteria | 5377 |
| 544 | Ga0495651_0004808 | 3300046462 | Bacteria | 10341 |
| 545 | Ga0495651_0014217 | 3300046462 | Bacteria | 6153 |
| 546 | Ga0495651_0014554 | 3300046462 | Bacteria | 6082 |
| 547 | Ga0495653_0009990 | 3300046463 | Bacteria | 7763 |
| 548 | Ga0495653_0012845 | 3300046463 | Bacteria | 6836 |
| 549 | Ga0495653_0132672 | 3300046463 | Bacteria | 1761 |
| 550 | Ga0495580_0023894 | 3300046472 | Bacteria | 4481 |
| 551 | Ga0495582_0018717 | 3300046473 | Bacteria | 3785 |
| 552 | Ga0495582_0056737 | 3300046473 | Bacteria | 2159 |
| 553 | Ga0495639_0001451 | 3300046475 | Bacteria | 10596 |
| 554 | Ga0495639_0027222 | 3300046475 | Bacteria | 2530 |
| 555 | Ga0495662_0000915 | 3300046476 | Bacteria | 14429 |
| 556 | Ga0495662_0105585 | 3300046476 | Bacteria | 1379 |
| 557 | Ga0495664_0206710 | 3300046477 | Bacteria | 1189 |
| 558 | Ga0495585_0003492 | 3300046492 | Bacteria | 10604 |
| 559 | Ga0495594_0001091 | 3300046499 | Bacteria | 14170 |
| 560 | Ga0495607_0011896 | 3300046501 | Bacteria | 5764 |
| 561 | Ga0495606_0057691 | 3300046507 | Bacteria | 2499 |
| 562 | Ga0495608_0002687 | 3300046511 | Bacteria | 12772 |
| 563 | Ga0495608_0026075 | 3300046511 | Bacteria | 3988 |
| 564 | Ga0495610_0031552 | 3300046512 | Bacteria | 2763 |
| 565 | Ga0495616_0038249 | 3300046513 | Bacteria | 2464 |
| 566 | Ga0495618_0005633 | 3300046514 | Bacteria | 7614 |
| 567 | Ga0495618_0037562 | 3300046514 | Bacteria | 3041 |
| 568 | Ga0495618_0046048 | 3300046514 | Bacteria | 2753 |
| 569 | Ga0495628_0001666 | 3300046516 | Bacteria | 20271 |
| 570 | Ga0495628_0075145 | 3300046516 | Bacteria | 2631 |
| 571 | Ga0495631_0015064 | 3300046518 | Bacteria | 3715 |
| 572 | Ga0495643_0049127 | 3300046522 | Bacteria | 2276 |
| 573 | Ga0495644_0016379 | 3300046523 | Bacteria | 2837 |
| 574 | Ga0495648_0058297 | 3300046524 | Bacteria | 2309 |
| 575 | Ga0495663_0016623 | 3300046525 | Bacteria | 2080 |
| 576 | Ga0495652_0002710 | 3300046529 | Bacteria | 17983 |
| 577 | Ga0495652_0021936 | 3300046529 | Bacteria | 5677 |
| 578 | Ga0495652_0046431 | 3300046529 | Bacteria | 3729 |
| 579 | Ga0495654_0004466 | 3300046530 | Bacteria | 8294 |
| 580 | Ga0495665_0002969 | 3300046531 | Bacteria | 9164 |
| 581 | Ga0495640_0097203 | 3300046533 | Bacteria | 1936 |
| 582 | Ga0495586_0019875 | 3300046535 | Bacteria | 3577 |
| 583 | Ga0495586_0117263 | 3300046535 | Bacteria | 1485 |
| 584 | Ga0495587_0003832 | 3300046536 | Bacteria | 9975 |
| 585 | Ga0495587_0008130 | 3300046536 | Bacteria | 6761 |
| 586 | Ga0495587_0015475 | 3300046536 | Bacteria | 4764 |
| 587 | Ga0495587_0115668 | 3300046536 | Bacteria | 1538 |
| 588 | Ga0495598_0005995 | 3300046537 | Bacteria | 2723 |
| 589 | Ga0495645_0003698 | 3300046543 | Bacteria | 10399 |
| 590 | Ga0495645_0013139 | 3300046543 | Bacteria | 5852 |
| 591 | Ga0495645_0246251 | 3300046543 | Bacteria | 1190 |
| 592 | Ga0495633_0002269 | 3300046558 | Bacteria | 13755 |
| 593 | Ga0495667_0001506 | 3300046559 | Bacteria | 15362 |
| 594 | Ga0495667_0003229 | 3300046559 | Bacteria | 10930 |
| 595 | Ga0495667_0003312 | 3300046559 | Bacteria | 10787 |
| 596 | Ga0495667_0013093 | 3300046559 | Bacteria | 5617 |
| 597 | Ga0495656_0001233 | 3300046615 | Bacteria | 8320 |
| 598 | Ga0495611_0036031 | 3300046648 | Bacteria | 2193 |
| 599 | Ga0495635_0033677 | 3300046663 | Bacteria | 3553 |
| 600 | Ga0495635_0035736 | 3300046663 | Bacteria | 3445 |
| 601 | Ga0495635_0050370 | 3300046663 | Bacteria | 2871 |
| 602 | Ga0495635_0076560 | 3300046663 | Bacteria | 2293 |
| 603 | Ga0495661_0029084 | 3300046665 | Bacteria | 3530 |
| 604 | Ga0495588_0002749 | 3300046674 | Bacteria | 7550 |
| 605 | Ga0495657_0013684 | 3300046675 | Bacteria | 5976 |
| 606 | Ga0495657_0137258 | 3300046675 | Bacteria | 1527 |
| 607 | Ga0495599_0001517 | 3300046678 | Bacteria | 13353 |
| 608 | Ga0495599_0048414 | 3300046678 | Bacteria | 2664 |
| 609 | Ga0495623_0010442 | 3300046679 | Bacteria | 6012 |
| 610 | Ga0495646_0017323 | 3300046680 | Bacteria | 4570 |
| 611 | Ga0495647_0006888 | 3300046681 | Bacteria | 3782 |
| 612 | Ga0495658_0000324 | 3300046683 | Bacteria | 26774 |
| 613 | Ga0495658_0001251 | 3300046683 | Bacteria | 13345 |
| 614 | Ga0495658_0047531 | 3300046683 | Bacteria | 2417 |
| 615 | Ga0495658_0068107 | 3300046683 | Bacteria | 2060 |
| 616 | Ga0495658_0146528 | 3300046683 | Bacteria | 1447 |
| 617 | Ga0495624_0003658 | 3300046690 | Bacteria | 11369 |
| 618 | Ga0495600_0001403 | 3300046809 | Bacteria | 13299 |
| 619 | Ga0495600_0017296 | 3300046809 | Bacteria | 4584 |
| 620 | Ga0495600_0020344 | 3300046809 | Bacteria | 4245 |
| 621 | Ga0495600_0225695 | 3300046809 | Bacteria | 1197 |
| 622 | Ga0495581_0002626 | 3300047315 | Bacteria | 10229 |
| 623 | Ga0495581_0047755 | 3300047315 | Bacteria | 2473 |
| 624 | Ga0495581_0076269 | 3300047315 | Bacteria | 1939 |
| 625 | Ga0495604_0007422 | 3300047317 | Bacteria | 8684 |
| 626 | Ga0495604_0017550 | 3300047317 | Bacteria | 5730 |
| 627 | Ga0495604_0024775 | 3300047317 | Bacteria | 4787 |
| 628 | Ga0495604_0074284 | 3300047317 | Bacteria | 2562 |
| 629 | Ga0495674_0074947 | 3300047319 | Bacteria | 2912 |
| 630 | Ga0495674_0083984 | 3300047319 | Bacteria | 2729 |
| 631 | Ga0495672_0059986 | 3300047320 | Bacteria | 2199 |
| 632 | Ga0495676_0027763 | 3300047321 | Bacteria | 4849 |
| 633 | Ga0495676_0152287 | 3300047321 | Bacteria | 1644 |
| 634 | Ga0495680_0003143 | 3300047322 | Bacteria | 16455 |
| 635 | Ga0495680_0004047 | 3300047322 | Bacteria | 14135 |
| 636 | Ga0495680_0015013 | 3300047322 | Bacteria | 6688 |
| 637 | Ga0495680_0038646 | 3300047322 | Bacteria | 3812 |
| 638 | Ga0495675_0000855 | 3300047444 | Bacteria | 18610 |
| 639 | Ga0495684_0000281 | 3300047471 | Bacteria | 41079 |
| 640 | Ga0495686_0011722 | 3300047472 | Bacteria | 6173 |
| 641 | Ga0495686_0106555 | 3300047472 | Bacteria | 1685 |
| 642 | Ga0495593_0005567 | 3300047673 | Bacteria | 7438 |
| 643 | Ga0495593_0015975 | 3300047673 | Bacteria | 4240 |
| 644 | Ga0495593_0140454 | 3300047673 | Bacteria | 1223 |
| 645 | Ga0495602_0002833 | 3300048088 | Bacteria | 17757 |
| 646 | Ga0495602_0008505 | 3300048088 | Bacteria | 10717 |
| 647 | Ga0495602_0087698 | 3300048088 | Bacteria | 2593 |
| 648 | Ga0495614_0038051 | 3300048089 | Bacteria | 2065 |
| 649 | Ga0496100_0010454 | 3300048903 | Bacteria | 5252 |
| 650 | Ga0496100_0021215 | 3300048903 | Bacteria | 3909 |
| 651 | Ga0496100_0023528 | 3300048903 | Bacteria | 3744 |
| 652 | Ga0496100_0030027 | 3300048903 | Bacteria | 3367 |
| 653 | Ga0496100_0047320 | 3300048903 | Bacteria | 2770 |
| 654 | Ga0496100_0283418 | 3300048903 | Bacteria | 1236 |
| 655 | Ga0496101_0008129 | 3300048904 | Bacteria | 6845 |
| 656 | Ga0496101_0024709 | 3300048904 | Bacteria | 4161 |
| 657 | Ga0496101_0042381 | 3300048904 | Bacteria | 3249 |
| 658 | Ga0496101_0086778 | 3300048904 | Bacteria | 2321 |
| 659 | Ga0496101_0121121 | 3300048904 | Bacteria | 1978 |
| 660 | Ga0496102_0085310 | 3300048905 | Bacteria | 2915 |
| 661 | Ga0496102_0107030 | 3300048905 | Bacteria | 2603 |
| 662 | Ga0496103_0010637 | 3300048906 | Bacteria | 5443 |
| 663 | Ga0496103_0053737 | 3300048906 | Bacteria | 2496 |
| 664 | Ga0496103_0132859 | 3300048906 | Bacteria | 1590 |
| 665 | Ga0496104_0000140 | 3300048907 | Bacteria | 67259 |
| 666 | Ga0496104_0006221 | 3300048907 | Bacteria | 10492 |
| 667 | Ga0496104_0020669 | 3300048907 | Bacteria | 6037 |
| 668 | Ga0496104_0046881 | 3300048907 | Bacteria | 4072 |
| 669 | Ga0496104_0054049 | 3300048907 | Bacteria | 3796 |
| 670 | Ga0496104_0100304 | 3300048907 | Bacteria | 2771 |
| 671 | Ga0496105_0005705 | 3300048908 | Bacteria | 9477 |
| 672 | Ga0496105_0012751 | 3300048908 | Bacteria | 6659 |
| 673 | Ga0496105_0072320 | 3300048908 | Bacteria | 2850 |
| 674 | Ga0496105_0396551 | 3300048908 | Bacteria | 1096 |
| 675 | Ga0496106_0002682 | 3300048909 | Bacteria | 13223 |
| 676 | Ga0496106_0053636 | 3300048909 | Bacteria | 3045 |
| 677 | Ga0496106_0082620 | 3300048909 | Bacteria | 2469 |
| 678 | Ga0496106_0096008 | 3300048909 | Bacteria | 2293 |
| 679 | Ga0496106_0105050 | 3300048909 | Bacteria | 2194 |
| 680 | Ga0496106_0129722 | 3300048909 | Bacteria | 1976 |
| 681 | Ga0496106_0153113 | 3300048909 | Bacteria | 1820 |
| 682 | Ga0496107_0006087 | 3300048910 | Bacteria | 8286 |
| 683 | Ga0496107_0035062 | 3300048910 | Bacteria | 3596 |
| 684 | Ga0496107_0045823 | 3300048910 | Bacteria | 3146 |
| 685 | Ga0496107_0059168 | 3300048910 | Bacteria | 2772 |
| 686 | Ga0496108_0000438 | 3300048911 | Bacteria | 33500 |
| 687 | Ga0496108_0021157 | 3300048911 | Bacteria | 5345 |
| 688 | Ga0496108_0026962 | 3300048911 | Bacteria | 4741 |
| 689 | Ga0496108_0098818 | 3300048911 | Bacteria | 2487 |
| 690 | Ga0496108_0164013 | 3300048911 | Bacteria | 1921 |
| 691 | Ga0496108_0316383 | 3300048911 | Bacteria | 1360 |
| 692 | Ga0496109_0000284 | 3300048912 | Bacteria | 48342 |
| 693 | Ga0496110_0068389 | 3300048913 | Bacteria | 3143 |
| 694 | Ga0496111_0072218 | 3300048914 | Bacteria | 2512 |
| 695 | Ga0496111_0179410 | 3300048914 | Bacteria | 1574 |
| 696 | Ga0496111_0349480 | 3300048914 | Bacteria | 1094 |
| 697 | Ga0496112_0012575 | 3300048915 | Bacteria | 7778 |
| 698 | Ga0496112_0028452 | 3300048915 | Bacteria | 5394 |
| 699 | Ga0496112_0055487 | 3300048915 | Bacteria | 3895 |
| 700 | Ga0496112_0180932 | 3300048915 | Bacteria | 2072 |
| 701 | Ga0496112_0249096 | 3300048915 | Bacteria | 1728 |
| 702 | Ga0496113_0026664 | 3300048916 | Bacteria | 4135 |
| 703 | Ga0496113_0144838 | 3300048916 | Bacteria | 1871 |
| 704 | Ga0496113_0151241 | 3300048916 | Bacteria | 1831 |
| 705 | Ga0496114_0002231 | 3300048917 | Bacteria | 14760 |
| 706 | Ga0496114_0004604 | 3300048917 | Bacteria | 10712 |
| 707 | Ga0496114_0043220 | 3300048917 | Bacteria | 3737 |
| 708 | Ga0496115_0014172 | 3300048918 | Bacteria | 6032 |
| 709 | Ga0496115_0133498 | 3300048918 | Bacteria | 2046 |
| 710 | Ga0496115_0448535 | 3300048918 | Bacteria | 1042 |
| 711 | Ga0496116_0013606 | 3300048919 | Bacteria | 6544 |
| 712 | Ga0496120_0132893 | 3300048923 | Bacteria | 1272 |
| 713 | Ga0496121_0005635 | 3300048924 | Bacteria | 15934 |
| 714 | Ga0496121_0013371 | 3300048924 | Bacteria | 8828 |
| 715 | Ga0496123_0027014 | 3300048926 | Bacteria | 4284 |
| 716 | Ga0496124_0082981 | 3300048927 | Bacteria | 2630 |
| 717 | Ga0496126_0095850 | 3300048929 | Bacteria | 2602 |
| 718 | Ga0496126_0178119 | 3300048929 | Bacteria | 1807 |
| 719 | Ga0501031_0043334 | 3300049568 | Bacteria | 2937 |
| 720 | Ga0501031_0057028 | 3300049568 | Bacteria | 2545 |
| 721 | Ga0501032_0005947 | 3300049569 | Bacteria | 9008 |
| 722 | Ga0501032_0161275 | 3300049569 | Bacteria | 1472 |
| 723 | Ga0501033_0021507 | 3300049570 | Bacteria | 4866 |
| 724 | Ga0501033_0023208 | 3300049570 | Bacteria | 4679 |
| 725 | Ga0501033_0121794 | 3300049570 | Bacteria | 1893 |
| 726 | Ga0501034_0000270 | 3300049571 | Bacteria | 94119 |
| 727 | Ga0501034_0010212 | 3300049571 | Bacteria | 9794 |
| 728 | Ga0501034_0013362 | 3300049571 | Bacteria | 8453 |
| 729 | Ga0501034_0013429 | 3300049571 | Bacteria | 8430 |
| 730 | Ga0501034_0017808 | 3300049571 | Bacteria | 7287 |
| 731 | Ga0501034_0096972 | 3300049571 | Bacteria | 2944 |
| 732 | Ga0501034_0139441 | 3300049571 | Bacteria | 2405 |
| 733 | Ga0501034_0287307 | 3300049571 | Bacteria | 1583 |
| 734 | Ga0501034_0448669 | 3300049571 | Bacteria | 1208 |
| 735 | Ga0501036_0004953 | 3300049572 | Bacteria | 10765 |
| 736 | Ga0501036_0151576 | 3300049572 | Bacteria | 1955 |
| 737 | Ga0501036_0282314 | 3300049572 | Bacteria | 1389 |
| 738 | Ga0501036_0315414 | 3300049572 | Bacteria | 1307 |
| 739 | Ga0501037_0018866 | 3300049573 | Bacteria | 5083 |
| 740 | Ga0501037_0032335 | 3300049573 | Bacteria | 3863 |
| 741 | Ga0501037_0079093 | 3300049573 | Bacteria | 2386 |
| 742 | Ga0501037_0109982 | 3300049573 | Bacteria | 1986 |
| 743 | Ga0501037_0262880 | 3300049573 | Bacteria | 1205 |
| 744 | Ga0501038_0008680 | 3300049574 | Bacteria | 9329 |
| 745 | Ga0501038_0034613 | 3300049574 | Bacteria | 4440 |
| 746 | Ga0501038_0142034 | 3300049574 | Bacteria | 1963 |
| 747 | Ga0501038_0180916 | 3300049574 | Bacteria | 1701 |
| 748 | Ga0501039_0037211 | 3300049575 | Bacteria | 3755 |
| 749 | Ga0501039_0143813 | 3300049575 | Bacteria | 1874 |
| 750 | Ga0501039_0174964 | 3300049575 | Bacteria | 1688 |
| 751 | Ga0501039_0265864 | 3300049575 | Bacteria | 1348 |
| 752 | Ga0501043_0036691 | 3300049579 | Bacteria | 3856 |
| 753 | Ga0501043_0062266 | 3300049579 | Bacteria | 2929 |
| 754 | Ga0501043_0102344 | 3300049579 | Bacteria | 2251 |
| 755 | Ga0501043_0259896 | 3300049579 | Bacteria | 1336 |
| 756 | Ga0501046_0016922 | 3300049580 | Bacteria | 6098 |
| 757 | Ga0501046_0062967 | 3300049580 | Bacteria | 2897 |
| 758 | Ga0501046_0088888 | 3300049580 | Bacteria | 2379 |
| 759 | Ga0501047_0000161 | 3300049581 | Bacteria | 81928 |
| 760 | Ga0501047_0005032 | 3300049581 | Bacteria | 12407 |
| 761 | Ga0501047_0016545 | 3300049581 | Bacteria | 7041 |
| 762 | Ga0501047_0034060 | 3300049581 | Bacteria | 4917 |
| 763 | Ga0501047_0034247 | 3300049581 | Bacteria | 4904 |
| 764 | Ga0501047_0051290 | 3300049581 | Bacteria | 3985 |
| 765 | Ga0501047_0089657 | 3300049581 | Bacteria | 2952 |
| 766 | Ga0501047_0119338 | 3300049581 | Bacteria | 2519 |
| 767 | Ga0501047_0139223 | 3300049581 | Bacteria | 2306 |
| 768 | Ga0501047_0279465 | 3300049581 | Bacteria | 1514 |
| 769 | Ga0501048_0000030 | 3300049582 | Bacteria | 66042 |
| 770 | Ga0501048_0055708 | 3300049582 | Bacteria | 2806 |
| 771 | Ga0501068_0043317 | 3300049584 | Bacteria | 2707 |
| 772 | Ga0501068_0071500 | 3300049584 | Bacteria | 2118 |
| 773 | Ga0501069_0023259 | 3300049585 | Bacteria | 3377 |
| 774 | Ga0501070_0006959 | 3300049586 | Bacteria | 9619 |
| 775 | Ga0501070_0015016 | 3300049586 | Bacteria | 6516 |
| 776 | Ga0501070_0025190 | 3300049586 | Bacteria | 4989 |
| 777 | Ga0501070_0036467 | 3300049586 | Bacteria | 4106 |
| 778 | Ga0501070_0044479 | 3300049586 | Bacteria | 3694 |
| 779 | Ga0501070_0051337 | 3300049586 | Bacteria | 3424 |
| 780 | Ga0501070_0167399 | 3300049586 | Bacteria | 1811 |
| 781 | Ga0501070_0229961 | 3300049586 | Bacteria | 1519 |
| 782 | Ga0501070_0233784 | 3300049586 | Bacteria | 1506 |
| 783 | Ga0501071_0130486 | 3300049587 | Bacteria | 1866 |
| 784 | Ga0501071_0253693 | 3300049587 | Bacteria | 1328 |
| 785 | Ga0501072_0037043 | 3300049588 | Bacteria | 3826 |
| 786 | Ga0501072_0074888 | 3300049588 | Bacteria | 2677 |
| 787 | Ga0501072_0169530 | 3300049588 | Bacteria | 1742 |
| 788 | Ga0501072_0216408 | 3300049588 | Bacteria | 1527 |
| 789 | Ga0501073_0005865 | 3300049589 | Bacteria | 9166 |
| 790 | Ga0501073_0017068 | 3300049589 | Bacteria | 5258 |
| 791 | Ga0501073_0052312 | 3300049589 | Bacteria | 2860 |
| 792 | Ga0501073_0088477 | 3300049589 | Bacteria | 2153 |
| 793 | Ga0501073_0261103 | 3300049589 | Bacteria | 1195 |
| 794 | Ga0501074_0006137 | 3300049590 | Bacteria | 8679 |
| 795 | Ga0501074_0357467 | 3300049590 | Bacteria | 1036 |
| 796 | Ga0501075_0142297 | 3300049591 | Bacteria | 1828 |
| 797 | Ga0501076_0016049 | 3300049592 | Bacteria | 5670 |
| 798 | Ga0501077_0021570 | 3300049593 | Bacteria | 4077 |
| 799 | Ga0501080_0000181 | 3300049742 | Bacteria | 45949 |
| 800 | Ga0501080_0019730 | 3300049742 | Bacteria | 6242 |
| 801 | Ga0501080_0051657 | 3300049742 | Bacteria | 3825 |
| 802 | Ga0501080_0179906 | 3300049742 | Bacteria | 1946 |
| 803 | Ga0501080_0202604 | 3300049742 | Bacteria | 1821 |
| 804 | Ga0501080_0261555 | 3300049742 | Bacteria | 1576 |
| 805 | Ga0501083_0000710 | 3300049744 | Bacteria | 21688 |
| 806 | Ga0501083_0013252 | 3300049744 | Bacteria | 5763 |
| 807 | Ga0501083_0021446 | 3300049744 | Bacteria | 4490 |
| 808 | Ga0501035_0000892 | 3300049822 | Bacteria | 31561 |
| 809 | Ga0501035_0052560 | 3300049822 | Bacteria | 3645 |
| 810 | Ga0501035_0120489 | 3300049822 | Bacteria | 2294 |
| 811 | Ga0501035_0338830 | 3300049822 | Bacteria | 1260 |
| 812 | Ga0501044_0012418 | 3300049823 | Bacteria | 9222 |
| 813 | Ga0501044_0014232 | 3300049823 | Bacteria | 8591 |
| 814 | Ga0501044_0021512 | 3300049823 | Bacteria | 6879 |
| 815 | Ga0501044_0029915 | 3300049823 | Bacteria | 5741 |
| 816 | Ga0501044_0029968 | 3300049823 | Bacteria | 5736 |
| 817 | Ga0501044_0031672 | 3300049823 | Bacteria | 5565 |
| 818 | Ga0501044_0083281 | 3300049823 | Bacteria | 3235 |
| 819 | Ga0501044_0263505 | 3300049823 | Bacteria | 1661 |
| 820 | Ga0501044_0320492 | 3300049823 | Bacteria | 1474 |
| 821 | Ga0501044_0398381 | 3300049823 | Bacteria | 1289 |
| 822 | Ga0501044_0446821 | 3300049823 | Bacteria | 1200 |
| 823 | nmdc:mga00v17_9824_c1 | 3300050491 | Bacteria | 5198 |
| 824 | nmdc:mga0qj67_178021_c1 | 3300050509 | Bacteria | 1727 |
| 825 | nmdc:mga0qj67_313381_c1 | 3300050509 | Bacteria | 1270 |
| 826 | nmdc:mga0qj67_736_c1 | 3300050509 | Bacteria | 22275 |
| 827 | nmdc:mga08y16_4006_c1 | 3300050511 | Bacteria | 15356 |
| 828 | nmdc:mga0n895_109403_c1 | 3300050512 | Bacteria | 2779 |
| 829 | nmdc:mga0n895_147099_c1 | 3300050512 | Bacteria | 2386 |
| 830 | nmdc:mga0n895_16263_c1 | 3300050512 | Bacteria | 6821 |
| 831 | nmdc:mga0n895_23986_c1 | 3300050512 | Bacteria | 5742 |
| 832 | nmdc:mga0n895_426934_c1 | 3300050512 | Bacteria | 1339 |
| 833 | nmdc:mga0n895_63346_c1 | 3300050512 | Bacteria | 3656 |
| 834 | nmdc:mga0rr50_135543_c1 | 3300050513 | Bacteria | 1976 |
| 835 | nmdc:mga0rr50_401096_c1 | 3300050513 | Bacteria | 1158 |
| 836 | nmdc:mga0a205_16026_c1 | 3300050515 | Bacteria | 7015 |
| 837 | nmdc:mga0a205_329928_c1 | 3300050515 | Bacteria | 1395 |
| 838 | nmdc:mga0a205_58410_c1 | 3300050515 | Bacteria | 3726 |
| 839 | nmdc:mga0a205_89440_c1 | 3300050515 | Bacteria | 2976 |
| 840 | nmdc:mga0sz30_18096_c1 | 3300050516 | Bacteria | 2816 |
| 841 | Ga0495601_0001033 | 3300053077 | Bacteria | 15194 |
| 842 | Ga0495601_0005565 | 3300053077 | Bacteria | 7347 |
| 843 | Ga0495601_0006052 | 3300053077 | Bacteria | 7059 |
| 844 | Ga0495601_0016338 | 3300053077 | Bacteria | 4497 |
| 845 | Ga0495601_0114070 | 3300053077 | Bacteria | 1752 |
| 846 | Ga0495612_0001141 | 3300053078 | Bacteria | 10900 |
| 847 | Ga0495612_0001873 | 3300053078 | Bacteria | 8648 |
| 848 | Ga0495612_0014902 | 3300053078 | Bacteria | 3119 |
| 849 | Ga0495612_0030065 | 3300053078 | Bacteria | 2188 |
| 850 | Ga0495595_0000992 | 3300053084 | Bacteria | 10951 |
| 851 | Ga0495595_0001007 | 3300053084 | Bacteria | 10852 |
| 852 | Ga0495595_0001438 | 3300053084 | Bacteria | 9274 |
| 853 | Ga0495595_0004374 | 3300053084 | Bacteria | 5688 |
| 854 | Ga0495595_0023135 | 3300053084 | Bacteria | 2733 |
| 855 | Ga0495595_0124682 | 3300053084 | Bacteria | 1256 |
| 856 | Ga0495619_0000421 | 3300053085 | Bacteria | 28651 |
| 857 | Ga0495619_0000715 | 3300053085 | Bacteria | 21668 |
| 858 | Ga0495619_0001421 | 3300053085 | Bacteria | 15730 |
| 859 | Ga0495619_0013795 | 3300053085 | Bacteria | 5098 |
| 860 | Ga0495619_0019647 | 3300053085 | Bacteria | 4296 |
| 861 | Ga0495619_0077086 | 3300053085 | Bacteria | 2238 |
| 862 | Ga0500651_0021439 | 3300053093 | Bacteria | 4029 |
| 863 | Ga0500651_0040915 | 3300053093 | Bacteria | 2920 |
| 864 | Ga0500566_0011031 | 3300053094 | Bacteria | 5324 |
| 865 | Ga0500641_0002979 | 3300053096 | Bacteria | 5995 |
| 866 | Ga0500556_0000051 | 3300053104 | Bacteria | 119031 |
| 867 | Ga0500592_001888 | 3300053116 | Bacteria | 3370 |
| 868 | Ga0500595_000006 | 3300053119 | Bacteria | 300857 |
| 869 | Ga0500608_000364 | 3300053122 | Bacteria | 17525 |
| 870 | Ga0500642_0000041 | 3300053130 | Bacteria | 89564 |
| 871 | Ga0500642_0076015 | 3300053130 | Bacteria | 1535 |
| 872 | Ga0500652_001272 | 3300053131 | Bacteria | 7993 |
| 873 | Ga0500658_0127740 | 3300053134 | Bacteria | 1131 |
| 874 | Ga0500559_0000878 | 3300053136 | Bacteria | 19226 |
| 875 | Ga0500568_0004915 | 3300053139 | Bacteria | 7034 |
| 876 | Ga0500586_002089 | 3300053145 | Bacteria | 4411 |
| 877 | Ga0500590_048918 | 3300053148 | Bacteria | 2153 |
| 878 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 879 | Ga0500616_0000150 | 3300053153 | Bacteria | 117918 |
| 880 | Ga0500616_0070049 | 3300053153 | Bacteria | 1791 |
| 881 | Ga0500622_0004154 | 3300053156 | Bacteria | 9267 |
| 882 | Ga0500636_0000632 | 3300053177 | Bacteria | 18995 |
| 883 | Ga0500645_000294 | 3300053730 | Bacteria | 35747 |
| 884 | Ga0500645_035177 | 3300053730 | Bacteria | 1493 |
| 885 | Ga0501084_0023384 | 3300054114 | Bacteria | 5157 |
| 886 | Ga0501084_0073299 | 3300054114 | Bacteria | 2867 |
| 887 | Ga0501084_0232186 | 3300054114 | Bacteria | 1557 |
| 888 | Ga0501082_0023830 | 3300060353 | Bacteria | 5277 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0057028 | Ga0501031_0057028_1374_2309 | 269 |
| 2 | 3300049570 | Ga0501033_0021507 | Ga0501033_0021507_3304_4239 | 269 |
| 3 | 3300049571 | Ga0501034_0013362 | Ga0501034_0013362_6732_7667 | 269 |
| 4 | 3300049573 | Ga0501037_0262880 | Ga0501037_0262880_192_1127 | 269 |
| 5 | 3300049575 | Ga0501039_0174964 | Ga0501039_0174964_486_1421 | 269 |
| 6 | 3300049581 | Ga0501047_0005032 | Ga0501047_0005032_6869_7804 | 269 |
| 7 | 3300049823 | Ga0501044_0320492 | Ga0501044_0320492_39_974 | 269 |
| 8 | 3300005457 | Ga0070662_100234460 | Ga0070662_1002344602 | 270 |
| 9 | 3300025933 | Ga0207706_10061120 | Ga0207706_100611203 | 270 |
| 10 | 3300049581 | Ga0501047_0139223 | Ga0501047_0139223_1181_2092 | 270 |
| 11 | 3300049570 | Ga0501033_0121794 | Ga0501033_0121794_843_1790 | 278 |
| 12 | 3300049575 | Ga0501039_0037211 | Ga0501039_0037211_1745_2692 | 278 |
| 13 | 3300049580 | Ga0501046_0016922 | Ga0501046_0016922_3730_4677 | 278 |
| 14 | 3300049581 | Ga0501047_0051290 | Ga0501047_0051290_1807_2754 | 278 |
| 15 | 3300049585 | Ga0501069_0023259 | Ga0501069_0023259_1496_2443 | 278 |
| 16 | 3300049586 | Ga0501070_0044479 | Ga0501070_0044479_1064_2011 | 278 |
| 17 | 3300049587 | Ga0501071_0130486 | Ga0501071_0130486_28_975 | 278 |
| 18 | 3300049742 | Ga0501080_0051657 | Ga0501080_0051657_1815_2762 | 278 |
| 19 | 3300025302 | Ga0207426_1038120 | Ga0207426_10381202 | 280 |
| 20 | 3300049588 | Ga0501072_0216408 | Ga0501072_0216408_389_1267 | 281 |
| 21 | 3300005334 | Ga0068869_100097580 | Ga0068869_1000975802 | 282 |
| 22 | 3300005844 | Ga0068862_100308856 | Ga0068862_1003088562 | 282 |
| 23 | 3300009553 | Ga0105249_10014021 | Ga0105249_100140212 | 282 |
| 24 | 3300010375 | Ga0105239_10205243 | Ga0105239_102052432 | 282 |
| 25 | 3300014968 | Ga0157379_10355408 | Ga0157379_103554081 | 282 |
| 26 | 3300017792 | Ga0163161_10053352 | Ga0163161_100533522 | 282 |
| 27 | 3300026067 | Ga0207678_10131872 | Ga0207678_101318722 | 282 |
| 28 | 3300048903 | Ga0496100_0283418 | Ga0496100_0283418_70_996 | 282 |
| 29 | 3300048904 | Ga0496101_0042381 | Ga0496101_0042381_2068_2994 | 282 |
| 30 | 3300048907 | Ga0496104_0054049 | Ga0496104_0054049_1670_2596 | 282 |
| 31 | 3300048908 | Ga0496105_0072320 | Ga0496105_0072320_1082_2008 | 282 |
| 32 | 3300048910 | Ga0496107_0059168 | Ga0496107_0059168_1223_2149 | 282 |
| 33 | 3300035117 | Ga0373953_0024935 | Ga0373953_0024935_1098_2069 | 283 |
| 34 | 3300036401 | Ga0373937_0017679 | Ga0373937_0017679_5290_6261 | 283 |
| 35 | 3300006881 | Ga0068865_100021120 | Ga0068865_1000211202 | 284 |
| 36 | 3300049822 | Ga0501035_0120489 | Ga0501035_0120489_307_1278 | 284 |
| 37 | 3300005440 | Ga0070705_100058630 | Ga0070705_1000586302 | 285 |
| 38 | 3300005458 | Ga0070681_10068560 | Ga0070681_100685601 | 285 |
| 39 | 3300014969 | Ga0157376_10065841 | Ga0157376_100658414 | 285 |
| 40 | 3300025913 | Ga0207695_10330798 | Ga0207695_103307982 | 285 |
| 41 | 3300005340 | Ga0070689_100015636 | Ga0070689_1000156366 | 286 |
| 42 | 3300005548 | Ga0070665_100041516 | Ga0070665_1000415162 | 286 |
| 43 | 3300005842 | Ga0068858_100021358 | Ga0068858_1000213583 | 286 |
| 44 | 3300009101 | Ga0105247_10003784 | Ga0105247_100037843 | 286 |
| 45 | 3300009174 | Ga0105241_10221355 | Ga0105241_102213552 | 286 |
| 46 | 3300013297 | Ga0157378_10012584 | Ga0157378_100125841 | 286 |
| 47 | 3300013308 | Ga0157375_10006049 | Ga0157375_100060496 | 286 |
| 48 | 3300014968 | Ga0157379_10007196 | Ga0157379_100071969 | 286 |
| 49 | 3300014969 | Ga0157376_10018772 | Ga0157376_100187725 | 286 |
| 50 | 3300026121 | Ga0207683_10248106 | Ga0207683_102481062 | 286 |
| 51 | 3300048903 | Ga0496100_0010454 | Ga0496100_0010454_3978_4904 | 286 |
| 52 | 3300048904 | Ga0496101_0008129 | Ga0496101_0008129_5810_6736 | 286 |
| 53 | 3300048905 | Ga0496102_0107030 | Ga0496102_0107030_994_1920 | 286 |
| 54 | 3300048906 | Ga0496103_0132859 | Ga0496103_0132859_14_940 | 286 |
| 55 | 3300048907 | Ga0496104_0006221 | Ga0496104_0006221_1456_2382 | 286 |
| 56 | 3300048908 | Ga0496105_0005705 | Ga0496105_0005705_2685_3611 | 286 |
| 57 | 3300048909 | Ga0496106_0129722 | Ga0496106_0129722_141_1067 | 286 |
| 58 | 3300048915 | Ga0496112_0249096 | Ga0496112_0249096_268_1194 | 286 |
| 59 | 3300048918 | Ga0496115_0448535 | Ga0496115_0448535_25_951 | 286 |
| 60 | 3300049822 | Ga0501035_0000892 | Ga0501035_0000892_17466_18431 | 287 |
| 61 | iso_pu_bacteria | 8057101203 | 8057105348 | 287 |
| 62 | 3300005844 | Ga0068862_100401730 | Ga0068862_1004017302 | 290 |
| 63 | 3300047472 | Ga0495686_0106555 | Ga0495686_0106555_606_1553 | 290 |
| 64 | 3300048929 | Ga0496126_0178119 | Ga0496126_0178119_626_1558 | 291 |
| 65 | iso_pu_bacteria | 2545555834 | 2545675941 | 291 |
| 66 | iso_pu_bacteria | 641522639 | 641645393 | 291 |
| 67 | 3300054114 | Ga0501084_0232186 | Ga0501084_0232186_168_1100 | 292 |
| 68 | 3300005937 | Ga0081455_10029513 | Ga0081455_100295131 | 293 |
| 69 | 3300031235 | Ga0265330_10045089 | Ga0265330_100450892 | 293 |
| 70 | 3300031247 | Ga0265340_10045565 | Ga0265340_100455651 | 293 |
| 71 | 3300031712 | Ga0265342_10085799 | Ga0265342_100857992 | 293 |
| 72 | 3300048917 | Ga0496114_0002231 | Ga0496114_0002231_11841_12767 | 293 |
| 73 | 3300049823 | Ga0501044_0083281 | Ga0501044_0083281_783_1754 | 293 |
| 74 | iso_pu_bacteria | 2917554339 | 2917554486 | 293 |
| 75 | 3300006175 | Ga0070712_100002937 | Ga0070712_1000029378 | 294 |
| 76 | 3300025915 | Ga0207693_10003360 | Ga0207693_100033603 | 294 |
| 77 | 3300031241 | Ga0265325_10009262 | Ga0265325_100092622 | 294 |
| 78 | 3300031247 | Ga0265340_10022625 | Ga0265340_100226254 | 294 |
| 79 | 3300031250 | Ga0265331_10069105 | Ga0265331_100691052 | 294 |
| 80 | 3300031344 | Ga0265316_10184280 | Ga0265316_101842802 | 294 |
| 81 | 3300031711 | Ga0265314_10070842 | Ga0265314_100708421 | 294 |
| 82 | iso_pu_bacteria | 2767802442 | 2770198600 | 294 |
| 83 | iso_pu_bacteria | 2775506902 | 2776270082 | 294 |
| 84 | iso_pu_bacteria | 2775506904 | 2776281255 | 294 |
| 85 | iso_pu_bacteria | 2840764183 | 2840765547 | 294 |
| 86 | 3300005436 | Ga0070713_100083089 | Ga0070713_1000830891 | 295 |
| 87 | 3300006028 | Ga0070717_10120190 | Ga0070717_101201902 | 295 |
| 88 | 3300009147 | Ga0114129_10002965 | Ga0114129_1000296512 | 295 |
| 89 | 3300025928 | Ga0207700_10065496 | Ga0207700_100654962 | 295 |
| 90 | 3300049586 | Ga0501070_0233784 | Ga0501070_0233784_349_1296 | 295 |
| 91 | iso_pu_bacteria | 2915650412 | 2915650464 | 295 |
| 92 | iso_pu_bacteria | 3003665799 | 3003670557 | 295 |
| 93 | 3300031595 | Ga0265313_10000703 | Ga0265313_1000070318 | 296 |
| 94 | 3300031665 | Ga0316575_10047527 | Ga0316575_100475271 | 296 |
| 95 | 3300031728 | Ga0316578_10031890 | Ga0316578_100318902 | 296 |
| 96 | 3300035398 | Ga0316574_0000385 | Ga0316574_0000385_11240_12205 | 296 |
| 97 | 3300036712 | Ga0316584_0005296 | Ga0316584_0005296_7551_8516 | 296 |
| 98 | 3300048904 | Ga0496101_0121121 | Ga0496101_0121121_450_1391 | 296 |
| 99 | 3300048907 | Ga0496104_0020669 | Ga0496104_0020669_985_1926 | 296 |
| 100 | 3300048909 | Ga0496106_0002682 | Ga0496106_0002682_516_1457 | 296 |
| 101 | 3300048910 | Ga0496107_0006087 | Ga0496107_0006087_1094_2035 | 296 |
| 102 | 3300048911 | Ga0496108_0000438 | Ga0496108_0000438_11833_12774 | 296 |
| 103 | 3300048912 | Ga0496109_0000284 | Ga0496109_0000284_11658_12599 | 296 |
| 104 | 3300048914 | Ga0496111_0179410 | Ga0496111_0179410_83_1024 | 296 |
| 105 | 3300048915 | Ga0496112_0012575 | Ga0496112_0012575_648_1589 | 296 |
| 106 | 3300048916 | Ga0496113_0151241 | Ga0496113_0151241_208_1149 | 296 |
| 107 | 3300049569 | Ga0501032_0005947 | Ga0501032_0005947_1438_2382 | 296 |
| 108 | 3300049571 | Ga0501034_0010212 | Ga0501034_0010212_195_1139 | 296 |
| 109 | 3300049572 | Ga0501036_0004953 | Ga0501036_0004953_214_1158 | 296 |
| 110 | 3300049573 | Ga0501037_0032335 | Ga0501037_0032335_274_1218 | 296 |
| 111 | 3300049579 | Ga0501043_0062266 | Ga0501043_0062266_559_1503 | 296 |
| 112 | 3300049581 | Ga0501047_0000161 | Ga0501047_0000161_66655_67599 | 296 |
| 113 | 3300049582 | Ga0501048_0000030 | Ga0501048_0000030_54394_55338 | 296 |
| 114 | 3300049586 | Ga0501070_0006959 | Ga0501070_0006959_5208_6152 | 296 |
| 115 | 3300049589 | Ga0501073_0052312 | Ga0501073_0052312_182_1126 | 296 |
| 116 | 3300049590 | Ga0501074_0006137 | Ga0501074_0006137_5005_5949 | 296 |
| 117 | 3300049742 | Ga0501080_0000181 | Ga0501080_0000181_11036_11980 | 296 |
| 118 | 3300049744 | Ga0501083_0000710 | Ga0501083_0000710_16304_17248 | 296 |
| 119 | 3300049823 | Ga0501044_0012418 | Ga0501044_0012418_1278_2222 | 296 |
| 120 | iso_pu_bacteria | 2854911287 | 2854913586 | 296 |
| 121 | 3300031241 | Ga0265325_10010324 | Ga0265325_100103243 | 297 |
| 122 | 3300031241 | Ga0265325_10074664 | Ga0265325_100746642 | 297 |
| 123 | 3300031247 | Ga0265340_10064973 | Ga0265340_100649732 | 297 |
| 124 | 3300031344 | Ga0265316_10021856 | Ga0265316_100218564 | 297 |
| 125 | 3300031595 | Ga0265313_10012459 | Ga0265313_100124592 | 297 |
| 126 | 3300031711 | Ga0265314_10006018 | Ga0265314_100060182 | 297 |
| 127 | 3300031712 | Ga0265342_10066632 | Ga0265342_100666322 | 297 |
| 128 | 3300037068 | Ga0373925_0231162 | Ga0373925_0231162_417_1343 | 297 |
| 129 | 3300049571 | Ga0501034_0000270 | Ga0501034_0000270_16626_17573 | 297 |
| 130 | 3300049581 | Ga0501047_0279465 | Ga0501047_0279465_80_1027 | 297 |
| 131 | 3300049586 | Ga0501070_0229961 | Ga0501070_0229961_440_1387 | 297 |
| 132 | 3300049588 | Ga0501072_0169530 | Ga0501072_0169530_241_1188 | 297 |
| 133 | 3300049742 | Ga0501080_0179906 | Ga0501080_0179906_710_1657 | 297 |
| 134 | 3300049742 | Ga0501080_0261555 | Ga0501080_0261555_602_1549 | 297 |
| 135 | iso_pu_bacteria | 2523231067 | 2523467802 | 297 |
| 136 | iso_pu_bacteria | 2738543031 | 2739349251 | 297 |
| 137 | iso_pu_bacteria | 2857524615 | 2857525684 | 297 |
| 138 | iso_pu_bacteria | 2861691609 | 2861691730 | 297 |
| 139 | iso_pu_bacteria | 2919073203 | 2919074524 | 297 |
| 140 | 3300005614 | Ga0068856_100000226 | Ga0068856_10000022621 | 298 |
| 141 | 3300025961 | Ga0207712_10400520 | Ga0207712_104005201 | 298 |
| 142 | 3300026078 | Ga0207702_10000191 | Ga0207702_1000019156 | 298 |
| 143 | 3300048924 | Ga0496121_0005635 | Ga0496121_0005635_11441_12373 | 298 |
| 144 | iso_pu_bacteria | 2893066018 | 2893071766 | 298 |
| 145 | iso_pu_bacteria | 3005710791 | 3005717522 | 298 |
| 146 | 3300025921 | Ga0207652_10052592 | Ga0207652_100525923 | 299 |
| 147 | 3300035172 | Ga0373955_0049303 | Ga0373955_0049303_42_1013 | 299 |
| 148 | 3300037312 | Ga0395899_0047062 | Ga0395899_0047062_1876_2844 | 299 |
| 149 | 3300037418 | Ga0395900_0003102 | Ga0395900_0003102_6588_7556 | 299 |
| 150 | 3300037466 | Ga0395898_0017292 | Ga0395898_0017292_500_1468 | 299 |
| 151 | 3300037466 | Ga0395898_0021942 | Ga0395898_0021942_3966_4934 | 299 |
| 152 | 3300038443 | Ga0395901_0006170 | Ga0395901_0006170_9875_10843 | 299 |
| 153 | 3300049588 | Ga0501072_0074888 | Ga0501072_0074888_1467_2438 | 299 |
| 154 | 3300049589 | Ga0501073_0261103 | Ga0501073_0261103_214_1146 | 299 |
| 155 | 3300049744 | Ga0501083_0021446 | Ga0501083_0021446_2265_3197 | 299 |
| 156 | 3300054114 | Ga0501084_0023384 | Ga0501084_0023384_2714_3646 | 299 |
| 157 | 3300006178 | Ga0075367_10052512 | Ga0075367_100525122 | 300 |
| 158 | 3300025295 | Ga0209564_1010473 | Ga0209564_10104732 | 300 |
| 159 | 3300026067 | Ga0207678_10018073 | Ga0207678_100180734 | 300 |
| 160 | 3300046460 | Ga0495638_0014270 | Ga0495638_0014270_2349_3287 | 300 |
| 161 | 3300046507 | Ga0495606_0057691 | Ga0495606_0057691_1016_1954 | 300 |
| 162 | 3300046512 | Ga0495610_0031552 | Ga0495610_0031552_79_1017 | 300 |
| 163 | 3300046513 | Ga0495616_0038249 | Ga0495616_0038249_795_1733 | 300 |
| 164 | 3300046518 | Ga0495631_0015064 | Ga0495631_0015064_138_1076 | 300 |
| 165 | 3300046522 | Ga0495643_0049127 | Ga0495643_0049127_126_1064 | 300 |
| 166 | 3300046524 | Ga0495648_0058297 | Ga0495648_0058297_453_1391 | 300 |
| 167 | 3300046530 | Ga0495654_0004466 | Ga0495654_0004466_6545_7483 | 300 |
| 168 | 3300046665 | Ga0495661_0029084 | Ga0495661_0029084_1516_2454 | 300 |
| 169 | 3300047320 | Ga0495672_0059986 | Ga0495672_0059986_1143_2081 | 300 |
| 170 | 3300047472 | Ga0495686_0011722 | Ga0495686_0011722_1060_1998 | 300 |
| 171 | 3300048909 | Ga0496106_0105050 | Ga0496106_0105050_1239_2177 | 300 |
| 172 | 3300048919 | Ga0496116_0013606 | Ga0496116_0013606_5565_6503 | 300 |
| 173 | 3300048923 | Ga0496120_0132893 | Ga0496120_0132893_101_1039 | 300 |
| 174 | 3300048924 | Ga0496121_0013371 | Ga0496121_0013371_1252_2190 | 300 |
| 175 | 3300048926 | Ga0496123_0027014 | Ga0496123_0027014_539_1477 | 300 |
| 176 | 3300048927 | Ga0496124_0082981 | Ga0496124_0082981_165_1103 | 300 |
| 177 | 3300048929 | Ga0496126_0095850 | Ga0496126_0095850_295_1233 | 300 |
| 178 | 3300049568 | Ga0501031_0043334 | Ga0501031_0043334_1491_2426 | 300 |
| 179 | 3300049581 | Ga0501047_0016545 | Ga0501047_0016545_2632_3567 | 300 |
| 180 | 3300049589 | Ga0501073_0005865 | Ga0501073_0005865_4446_5381 | 300 |
| 181 | 3300050491 | nmdc:mga00v17_9824_c1 | nmdc:mga00v17_9824_c1_3499_4437 | 300 |
| 182 | 3300050516 | nmdc:mga0sz30_18096_c1 | nmdc:mga0sz30_18096_c1_1139_2077 | 300 |
| 183 | 3300053093 | Ga0500651_0040915 | Ga0500651_0040915_1122_2060 | 300 |
| 184 | 3300053104 | Ga0500556_0000051 | Ga0500556_0000051_105440_106378 | 300 |
| 185 | 3300053116 | Ga0500592_001888 | Ga0500592_001888_1214_2152 | 300 |
| 186 | 3300053130 | Ga0500642_0000041 | Ga0500642_0000041_72479_73417 | 300 |
| 187 | 3300053131 | Ga0500652_001272 | Ga0500652_001272_164_1102 | 300 |
| 188 | 3300053134 | Ga0500658_0127740 | Ga0500658_0127740_107_1045 | 300 |
| 189 | 3300053139 | Ga0500568_0004915 | Ga0500568_0004915_5546_6484 | 300 |
| 190 | 3300053145 | Ga0500586_002089 | Ga0500586_002089_1987_2925 | 300 |
| 191 | 3300053153 | Ga0500616_0000150 | Ga0500616_0000150_104570_105508 | 300 |
| 192 | 3300053156 | Ga0500622_0004154 | Ga0500622_0004154_134_1072 | 300 |
| 193 | 3300053730 | Ga0500645_035177 | Ga0500645_035177_73_1011 | 300 |
| 194 | 3300006871 | Ga0075434_100143973 | Ga0075434_1001439732 | 301 |
| 195 | 3300009098 | Ga0105245_10775274 | Ga0105245_107752741 | 301 |
| 196 | 3300031241 | Ga0265325_10010027 | Ga0265325_100100275 | 301 |
| 197 | 3300031250 | Ga0265331_10005916 | Ga0265331_100059166 | 301 |
| 198 | 3300046476 | Ga0495662_0105585 | Ga0495662_0105585_32_973 | 301 |
| 199 | 3300049581 | Ga0501047_0034247 | Ga0501047_0034247_3466_4407 | 301 |
| 200 | 3300049586 | Ga0501070_0036467 | Ga0501070_0036467_2886_3827 | 301 |
| 201 | 3300049822 | Ga0501035_0338830 | Ga0501035_0338830_278_1219 | 301 |
| 202 | 3300049823 | Ga0501044_0263505 | Ga0501044_0263505_458_1399 | 301 |
| 203 | 3300050512 | nmdc:mga0n895_23986_c1 | nmdc:mga0n895_23986_c1_76_1047 | 301 |
| 204 | 3300053094 | Ga0500566_0011031 | Ga0500566_0011031_2587_3528 | 301 |
| 205 | 3300053122 | Ga0500608_000364 | Ga0500608_000364_3418_4359 | 301 |
| 206 | 3300053136 | Ga0500559_0000878 | Ga0500559_0000878_4852_5793 | 301 |
| 207 | 3300053148 | Ga0500590_048918 | Ga0500590_048918_152_1093 | 301 |
| 208 | 3300053177 | Ga0500636_0000632 | Ga0500636_0000632_15917_16858 | 301 |
| 209 | 3300005439 | Ga0070711_100044047 | Ga0070711_1000440472 | 302 |
| 210 | 3300006175 | Ga0070712_100255692 | Ga0070712_1002556921 | 302 |
| 211 | 3300009094 | Ga0111539_10020707 | Ga0111539_100207074 | 302 |
| 212 | 3300025905 | Ga0207685_10117244 | Ga0207685_101172442 | 302 |
| 213 | 3300025915 | Ga0207693_10031159 | Ga0207693_100311592 | 302 |
| 214 | 3300025916 | Ga0207663_10035519 | Ga0207663_100355192 | 302 |
| 215 | 3300048907 | Ga0496104_0000140 | Ga0496104_0000140_55380_56351 | 302 |
| 216 | 3300048917 | Ga0496114_0043220 | Ga0496114_0043220_1071_2042 | 302 |
| 217 | 3300049571 | Ga0501034_0096972 | Ga0501034_0096972_1684_2625 | 302 |
| 218 | 3300049589 | Ga0501073_0017068 | Ga0501073_0017068_2000_2941 | 302 |
| 219 | 3300050515 | nmdc:mga0a205_89440_c1 | nmdc:mga0a205_89440_c1_924_1895 | 302 |
| 220 | 3300021384 | Ga0213876_10013044 | Ga0213876_100130446 | 303 |
| 221 | 3300031241 | Ga0265325_10083197 | Ga0265325_100831971 | 303 |
| 222 | 3300031249 | Ga0265339_10030920 | Ga0265339_100309202 | 303 |
| 223 | 3300031344 | Ga0265316_10149223 | Ga0265316_101492232 | 303 |
| 224 | 3300035692 | Ga0373935_0075860 | Ga0373935_0075860_340_1311 | 303 |
| 225 | 3300035725 | Ga0373947_0028811 | Ga0373947_0028811_522_1493 | 303 |
| 226 | 3300037068 | Ga0373925_0189047 | Ga0373925_0189047_518_1489 | 303 |
| 227 | 3300046473 | Ga0495582_0056737 | Ga0495582_0056737_1053_2024 | 303 |
| 228 | 3300046683 | Ga0495658_0047531 | Ga0495658_0047531_555_1526 | 303 |
| 229 | 3300047315 | Ga0495581_0076269 | Ga0495581_0076269_42_1013 | 303 |
| 230 | 3300048903 | Ga0496100_0023528 | Ga0496100_0023528_116_1084 | 303 |
| 231 | 3300049569 | Ga0501032_0161275 | Ga0501032_0161275_418_1401 | 303 |
| 232 | 3300049571 | Ga0501034_0013429 | Ga0501034_0013429_1828_2796 | 303 |
| 233 | 3300049573 | Ga0501037_0018866 | Ga0501037_0018866_2783_3766 | 303 |
| 234 | 3300049581 | Ga0501047_0119338 | Ga0501047_0119338_185_1129 | 303 |
| 235 | 3300049584 | Ga0501068_0043317 | Ga0501068_0043317_1675_2658 | 303 |
| 236 | 3300049586 | Ga0501070_0051337 | Ga0501070_0051337_431_1399 | 303 |
| 237 | 3300049589 | Ga0501073_0088477 | Ga0501073_0088477_900_1883 | 303 |
| 238 | 3300049744 | Ga0501083_0013252 | Ga0501083_0013252_201_1145 | 303 |
| 239 | 3300049823 | Ga0501044_0014232 | Ga0501044_0014232_4030_5013 | 303 |
| 240 | 3300049823 | Ga0501044_0031672 | Ga0501044_0031672_940_1884 | 303 |
| 241 | 3300050509 | nmdc:mga0qj67_178021_c1 | nmdc:mga0qj67_178021_c1_19_978 | 303 |
| 242 | 3300050513 | nmdc:mga0rr50_401096_c1 | nmdc:mga0rr50_401096_c1_31_1005 | 303 |
| 243 | 3300054114 | Ga0501084_0073299 | Ga0501084_0073299_171_1115 | 303 |
| 244 | 3300060353 | Ga0501082_0023830 | Ga0501082_0023830_160_1104 | 303 |
| 245 | 3300031241 | Ga0265325_10000690 | Ga0265325_1000069013 | 304 |
| 246 | 3300031595 | Ga0265313_10009868 | Ga0265313_100098683 | 304 |
| 247 | 3300035118 | Ga0373954_0016088 | Ga0373954_0016088_655_1602 | 304 |
| 248 | 3300035119 | Ga0373956_0003652 | Ga0373956_0003652_5105_6052 | 304 |
| 249 | 3300035120 | Ga0373957_0012323 | Ga0373957_0012323_163_1110 | 304 |
| 250 | 3300035172 | Ga0373955_0006462 | Ga0373955_0006462_97_1044 | 304 |
| 251 | 3300035724 | Ga0373933_0008436 | Ga0373933_0008436_4341_5288 | 304 |
| 252 | 3300036401 | Ga0373937_0003470 | Ga0373937_0003470_12083_13030 | 304 |
| 253 | 3300046536 | Ga0495587_0015475 | Ga0495587_0015475_1606_2553 | 304 |
| 254 | 3300046663 | Ga0495635_0050370 | Ga0495635_0050370_1131_2078 | 304 |
| 255 | 3300046675 | Ga0495657_0013684 | Ga0495657_0013684_3429_4376 | 304 |
| 256 | 3300047322 | Ga0495680_0015013 | Ga0495680_0015013_3849_4796 | 304 |
| 257 | 3300050509 | nmdc:mga0qj67_313381_c1 | nmdc:mga0qj67_313381_c1_86_1054 | 304 |
| 258 | 3300053077 | Ga0495601_0006052 | Ga0495601_0006052_1732_2679 | 304 |
| 259 | 3300053078 | Ga0495612_0014902 | Ga0495612_0014902_1647_2594 | 304 |
| 260 | 3300005327 | Ga0070658_10017799 | Ga0070658_100177992 | 305 |
| 261 | 3300005435 | Ga0070714_100150893 | Ga0070714_1001508932 | 305 |
| 262 | 3300013105 | Ga0157369_10346545 | Ga0157369_103465452 | 305 |
| 263 | 3300025929 | Ga0207664_10073474 | Ga0207664_100734742 | 305 |
| 264 | 3300053096 | Ga0500641_0002979 | Ga0500641_0002979_1176_2132 | 305 |
| 265 | 3300007788 | Ga0099795_10003299 | Ga0099795_100032994 | 306 |
| 266 | 3300045836 | Ga0466958_0034345 | Ga0466958_0034345_792_1760 | 306 |
| 267 | 3300049575 | Ga0501039_0143813 | Ga0501039_0143813_442_1407 | 306 |
| 268 | 3300006846 | Ga0075430_100002289 | Ga0075430_1000022899 | 307 |
| 269 | 3300037466 | Ga0395898_0057531 | Ga0395898_0057531_2379_3338 | 307 |
| 270 | 3300038443 | Ga0395901_0005769 | Ga0395901_0005769_7369_8328 | 307 |
| 271 | 3300050509 | nmdc:mga0qj67_736_c1 | nmdc:mga0qj67_736_c1_7809_8777 | 307 |
| 272 | 3300053093 | Ga0500651_0021439 | Ga0500651_0021439_599_1570 | 307 |
| 273 | 3300053130 | Ga0500642_0076015 | Ga0500642_0076015_80_1051 | 307 |
| 274 | 3300049570 | Ga0501033_0023208 | Ga0501033_0023208_2215_3177 | 308 |
| 275 | 3300049571 | Ga0501034_0017808 | Ga0501034_0017808_2606_3568 | 308 |
| 276 | 3300049571 | Ga0501034_0448669 | Ga0501034_0448669_212_1174 | 308 |
| 277 | 3300049572 | Ga0501036_0151576 | Ga0501036_0151576_410_1369 | 308 |
| 278 | 3300049573 | Ga0501037_0079093 | Ga0501037_0079093_858_1817 | 308 |
| 279 | 3300049579 | Ga0501043_0036691 | Ga0501043_0036691_2156_3118 | 308 |
| 280 | 3300049579 | Ga0501043_0102344 | Ga0501043_0102344_519_1478 | 308 |
| 281 | 3300049580 | Ga0501046_0062967 | Ga0501046_0062967_1282_2244 | 308 |
| 282 | 3300049581 | Ga0501047_0089657 | Ga0501047_0089657_388_1350 | 308 |
| 283 | 3300049582 | Ga0501048_0055708 | Ga0501048_0055708_958_1920 | 308 |
| 284 | 3300049742 | Ga0501080_0202604 | Ga0501080_0202604_435_1394 | 308 |
| 285 | 3300049822 | Ga0501035_0052560 | Ga0501035_0052560_749_1711 | 308 |
| 286 | 3300049823 | Ga0501044_0029915 | Ga0501044_0029915_1385_2344 | 308 |
| 287 | 3300049823 | Ga0501044_0029968 | Ga0501044_0029968_1388_2350 | 308 |
| 288 | 3300049823 | Ga0501044_0446821 | Ga0501044_0446821_23_985 | 308 |
| 289 | 3300053084 | Ga0495595_0023135 | Ga0495595_0023135_961_1929 | 308 |
| 290 | iso_pu_bacteria | 2643221547 | 2643757783 | 308 |
| 291 | 3300005336 | Ga0070680_100409988 | Ga0070680_1004099882 | 309 |
| 292 | 3300006871 | Ga0075434_100038096 | Ga0075434_1000380964 | 309 |
| 293 | 3300007076 | Ga0075435_100012862 | Ga0075435_1000128626 | 309 |
| 294 | 3300007788 | Ga0099795_10022675 | Ga0099795_100226751 | 309 |
| 295 | 3300009147 | Ga0114129_10006052 | Ga0114129_1000605210 | 309 |
| 296 | 3300009551 | Ga0105238_10015798 | Ga0105238_100157984 | 309 |
| 297 | 3300025915 | Ga0207693_10027357 | Ga0207693_100273573 | 309 |
| 298 | 3300025915 | Ga0207693_10109587 | Ga0207693_101095873 | 309 |
| 299 | 3300025917 | Ga0207660_10022567 | Ga0207660_100225675 | 309 |
| 300 | 3300025919 | Ga0207657_10167779 | Ga0207657_101677792 | 309 |
| 301 | 3300025949 | Ga0207667_10457678 | Ga0207667_104576782 | 309 |
| 302 | 3300028556 | Ga0265337_1000296 | Ga0265337_100029618 | 309 |
| 303 | 3300028800 | Ga0265338_10030853 | Ga0265338_100308533 | 309 |
| 304 | 3300031235 | Ga0265330_10020750 | Ga0265330_100207502 | 309 |
| 305 | 3300031247 | Ga0265340_10101495 | Ga0265340_101014952 | 309 |
| 306 | 3300031249 | Ga0265339_10032250 | Ga0265339_100322503 | 309 |
| 307 | 3300050512 | nmdc:mga0n895_109403_c1 | nmdc:mga0n895_109403_c1_271_1242 | 309 |
| 308 | 3300050515 | nmdc:mga0a205_58410_c1 | nmdc:mga0a205_58410_c1_1042_2013 | 309 |
| 309 | 3300053730 | Ga0500645_000294 | Ga0500645_000294_21265_22236 | 309 |
| 310 | 3300005434 | Ga0070709_10000722 | Ga0070709_100007228 | 310 |
| 311 | 3300005435 | Ga0070714_100008512 | Ga0070714_1000085125 | 310 |
| 312 | 3300005466 | Ga0070685_10012256 | Ga0070685_100122564 | 310 |
| 313 | 3300005535 | Ga0070684_100026631 | Ga0070684_1000266314 | 310 |
| 314 | 3300006028 | Ga0070717_10001127 | Ga0070717_100011278 | 310 |
| 315 | 3300006173 | Ga0070716_100004315 | Ga0070716_1000043151 | 310 |
| 316 | 3300009148 | Ga0105243_10022668 | Ga0105243_100226684 | 310 |
| 317 | 3300009551 | Ga0105238_10178680 | Ga0105238_101786802 | 310 |
| 318 | 3300014325 | Ga0163163_10126013 | Ga0163163_101260132 | 310 |
| 319 | 3300025915 | Ga0207693_10007237 | Ga0207693_100072374 | 310 |
| 320 | 3300025928 | Ga0207700_10001518 | Ga0207700_100015182 | 310 |
| 321 | 3300025929 | Ga0207664_10048993 | Ga0207664_100489932 | 310 |
| 322 | 3300025931 | Ga0207644_10017834 | Ga0207644_100178342 | 310 |
| 323 | 3300025935 | Ga0207709_10032780 | Ga0207709_100327802 | 310 |
| 324 | 3300025939 | Ga0207665_10012708 | Ga0207665_100127083 | 310 |
| 325 | 3300025941 | Ga0207711_10002949 | Ga0207711_1000294914 | 310 |
| 326 | 3300025960 | Ga0207651_10027633 | Ga0207651_100276333 | 310 |
| 327 | 3300026067 | Ga0207678_10053209 | Ga0207678_100532092 | 310 |
| 328 | 3300026121 | Ga0207683_10022893 | Ga0207683_100228934 | 310 |
| 329 | 3300031711 | Ga0265314_10043299 | Ga0265314_100432992 | 310 |
| 330 | 3300032133 | Ga0316583_10007186 | Ga0316583_100071862 | 310 |
| 331 | 3300035117 | Ga0373953_0001936 | Ga0373953_0001936_4817_5782 | 310 |
| 332 | 3300035170 | Ga0373943_0035932 | Ga0373943_0035932_885_1850 | 310 |
| 333 | 3300035172 | Ga0373955_0003147 | Ga0373955_0003147_6084_7049 | 310 |
| 334 | 3300035724 | Ga0373933_0024099 | Ga0373933_0024099_1963_2928 | 310 |
| 335 | 3300035725 | Ga0373947_0100287 | Ga0373947_0100287_580_1560 | 310 |
| 336 | 3300036401 | Ga0373937_0036810 | Ga0373937_0036810_1330_2295 | 310 |
| 337 | 3300039437 | Ga0436365_1505706 | Ga0436365_1505706_207_1172 | 310 |
| 338 | 3300044842 | Ga0466957_0240272 | Ga0466957_0240272_52_1017 | 310 |
| 339 | 3300046454 | Ga0495592_0038830 | Ga0495592_0038830_56_1021 | 310 |
| 340 | 3300046462 | Ga0495651_0014217 | Ga0495651_0014217_2765_3730 | 310 |
| 341 | 3300046463 | Ga0495653_0132672 | Ga0495653_0132672_175_1140 | 310 |
| 342 | 3300046477 | Ga0495664_0206710 | Ga0495664_0206710_199_1164 | 310 |
| 343 | 3300046516 | Ga0495628_0001666 | Ga0495628_0001666_2535_3500 | 310 |
| 344 | 3300046529 | Ga0495652_0021936 | Ga0495652_0021936_2070_3035 | 310 |
| 345 | 3300046536 | Ga0495587_0115668 | Ga0495587_0115668_316_1281 | 310 |
| 346 | 3300046543 | Ga0495645_0003698 | Ga0495645_0003698_4442_5407 | 310 |
| 347 | 3300046559 | Ga0495667_0003312 | Ga0495667_0003312_7516_8481 | 310 |
| 348 | 3300046663 | Ga0495635_0076560 | Ga0495635_0076560_20_985 | 310 |
| 349 | 3300046675 | Ga0495657_0137258 | Ga0495657_0137258_502_1467 | 310 |
| 350 | 3300046680 | Ga0495646_0017323 | Ga0495646_0017323_1908_2873 | 310 |
| 351 | 3300046809 | Ga0495600_0017296 | Ga0495600_0017296_3094_4059 | 310 |
| 352 | 3300047317 | Ga0495604_0017550 | Ga0495604_0017550_3762_4727 | 310 |
| 353 | 3300047322 | Ga0495680_0038646 | Ga0495680_0038646_667_1632 | 310 |
| 354 | 3300048088 | Ga0495602_0002833 | Ga0495602_0002833_5104_6069 | 310 |
| 355 | 3300048903 | Ga0496100_0030027 | Ga0496100_0030027_733_1704 | 310 |
| 356 | 3300048909 | Ga0496106_0053636 | Ga0496106_0053636_411_1382 | 310 |
| 357 | 3300048911 | Ga0496108_0316383 | Ga0496108_0316383_179_1150 | 310 |
| 358 | 3300048913 | Ga0496110_0068389 | Ga0496110_0068389_1962_2933 | 310 |
| 359 | 3300048917 | Ga0496114_0004604 | Ga0496114_0004604_6813_7784 | 310 |
| 360 | 3300049571 | Ga0501034_0139441 | Ga0501034_0139441_178_1143 | 310 |
| 361 | 3300049571 | Ga0501034_0287307 | Ga0501034_0287307_94_1059 | 310 |
| 362 | 3300049572 | Ga0501036_0282314 | Ga0501036_0282314_40_1005 | 310 |
| 363 | 3300049572 | Ga0501036_0315414 | Ga0501036_0315414_272_1237 | 310 |
| 364 | 3300049574 | Ga0501038_0008680 | Ga0501038_0008680_7145_8116 | 310 |
| 365 | 3300049574 | Ga0501038_0142034 | Ga0501038_0142034_910_1875 | 310 |
| 366 | 3300049574 | Ga0501038_0180916 | Ga0501038_0180916_453_1418 | 310 |
| 367 | 3300049575 | Ga0501039_0265864 | Ga0501039_0265864_321_1286 | 310 |
| 368 | 3300049579 | Ga0501043_0259896 | Ga0501043_0259896_66_1031 | 310 |
| 369 | 3300049581 | Ga0501047_0034060 | Ga0501047_0034060_743_1714 | 310 |
| 370 | 3300049584 | Ga0501068_0071500 | Ga0501068_0071500_679_1644 | 310 |
| 371 | 3300049586 | Ga0501070_0015016 | Ga0501070_0015016_68_1039 | 310 |
| 372 | 3300049586 | Ga0501070_0167399 | Ga0501070_0167399_797_1762 | 310 |
| 373 | 3300049587 | Ga0501071_0253693 | Ga0501071_0253693_226_1191 | 310 |
| 374 | 3300049588 | Ga0501072_0037043 | Ga0501072_0037043_318_1283 | 310 |
| 375 | 3300049590 | Ga0501074_0357467 | Ga0501074_0357467_10_975 | 310 |
| 376 | 3300049742 | Ga0501080_0019730 | Ga0501080_0019730_538_1503 | 310 |
| 377 | 3300049823 | Ga0501044_0398381 | Ga0501044_0398381_193_1158 | 310 |
| 378 | 3300050512 | nmdc:mga0n895_426934_c1 | nmdc:mga0n895_426934_c1_324_1295 | 310 |
| 379 | 3300053077 | Ga0495601_0001033 | Ga0495601_0001033_3361_4326 | 310 |
| 380 | 3300053078 | Ga0495612_0001873 | Ga0495612_0001873_5371_6336 | 310 |
| 381 | 3300053084 | Ga0495595_0001438 | Ga0495595_0001438_235_1200 | 310 |
| 382 | 3300053085 | Ga0495619_0000421 | Ga0495619_0000421_11732_12697 | 310 |
| 383 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_458997_459968 | 310 |
| 384 | 3300053153 | Ga0500616_0070049 | Ga0500616_0070049_490_1461 | 310 |
| 385 | 3300005327 | Ga0070658_10048553 | Ga0070658_100485532 | 311 |
| 386 | 3300005327 | Ga0070658_10069462 | Ga0070658_100694621 | 311 |
| 387 | 3300005327 | Ga0070658_10088422 | Ga0070658_100884221 | 311 |
| 388 | 3300005329 | Ga0070683_100032771 | Ga0070683_1000327714 | 311 |
| 389 | 3300005336 | Ga0070680_100076459 | Ga0070680_1000764591 | 311 |
| 390 | 3300005336 | Ga0070680_100121097 | Ga0070680_1001210972 | 311 |
| 391 | 3300005339 | Ga0070660_100191273 | Ga0070660_1001912732 | 311 |
| 392 | 3300005344 | Ga0070661_100239399 | Ga0070661_1002393992 | 311 |
| 393 | 3300005434 | Ga0070709_10029626 | Ga0070709_100296263 | 311 |
| 394 | 3300005435 | Ga0070714_100059337 | Ga0070714_1000593372 | 311 |
| 395 | 3300005436 | Ga0070713_100000642 | Ga0070713_10000064218 | 311 |
| 396 | 3300005437 | Ga0070710_10020429 | Ga0070710_100204293 | 311 |
| 397 | 3300005439 | Ga0070711_100118741 | Ga0070711_1001187412 | 311 |
| 398 | 3300005458 | Ga0070681_10064688 | Ga0070681_100646882 | 311 |
| 399 | 3300005458 | Ga0070681_10100056 | Ga0070681_101000561 | 311 |
| 400 | 3300005547 | Ga0070693_100017616 | Ga0070693_1000176162 | 311 |
| 401 | 3300005563 | Ga0068855_100061841 | Ga0068855_1000618412 | 311 |
| 402 | 3300005563 | Ga0068855_100202945 | Ga0068855_1002029452 | 311 |
| 403 | 3300005614 | Ga0068856_100226076 | Ga0068856_1002260762 | 311 |
| 404 | 3300005615 | Ga0070702_100080374 | Ga0070702_1000803742 | 311 |
| 405 | 3300005616 | Ga0068852_100171044 | Ga0068852_1001710442 | 311 |
| 406 | 3300005616 | Ga0068852_100248068 | Ga0068852_1002480681 | 311 |
| 407 | 3300006028 | Ga0070717_10026094 | Ga0070717_100260943 | 311 |
| 408 | 3300006175 | Ga0070712_100118608 | Ga0070712_1001186082 | 311 |
| 409 | 3300009093 | Ga0105240_10023127 | Ga0105240_100231276 | 311 |
| 410 | 3300009174 | Ga0105241_10069695 | Ga0105241_100696952 | 311 |
| 411 | 3300009551 | Ga0105238_10098322 | Ga0105238_100983223 | 311 |
| 412 | 3300013102 | Ga0157371_10090061 | Ga0157371_100900611 | 311 |
| 413 | 3300013105 | Ga0157369_10381609 | Ga0157369_103816092 | 311 |
| 414 | 3300020082 | Ga0206353_10044632 | Ga0206353_100446322 | 311 |
| 415 | 3300025898 | Ga0207692_10006694 | Ga0207692_100066942 | 311 |
| 416 | 3300025906 | Ga0207699_10107335 | Ga0207699_101073352 | 311 |
| 417 | 3300025909 | Ga0207705_10003687 | Ga0207705_100036877 | 311 |
| 418 | 3300025909 | Ga0207705_10095154 | Ga0207705_100951542 | 311 |
| 419 | 3300025913 | Ga0207695_10274419 | Ga0207695_102744192 | 311 |
| 420 | 3300025917 | Ga0207660_10013553 | Ga0207660_100135535 | 311 |
| 421 | 3300025921 | Ga0207652_10027823 | Ga0207652_100278232 | 311 |
| 422 | 3300025924 | Ga0207694_10050122 | Ga0207694_100501223 | 311 |
| 423 | 3300025927 | Ga0207687_10047719 | Ga0207687_100477193 | 311 |
| 424 | 3300025928 | Ga0207700_10028277 | Ga0207700_100282774 | 311 |
| 425 | 3300025949 | Ga0207667_10039139 | Ga0207667_100391395 | 311 |
| 426 | 3300025949 | Ga0207667_10079202 | Ga0207667_100792022 | 311 |
| 427 | 3300025949 | Ga0207667_10116137 | Ga0207667_101161372 | 311 |
| 428 | 3300031241 | Ga0265325_10036062 | Ga0265325_100360623 | 311 |
| 429 | 3300031241 | Ga0265325_10056738 | Ga0265325_100567382 | 311 |
| 430 | 3300031247 | Ga0265340_10018619 | Ga0265340_100186192 | 311 |
| 431 | 3300031595 | Ga0265313_10008364 | Ga0265313_100083644 | 311 |
| 432 | 3300031712 | Ga0265342_10000546 | Ga0265342_100005468 | 311 |
| 433 | 3300035170 | Ga0373943_0051354 | Ga0373943_0051354_89_1060 | 311 |
| 434 | 3300035410 | Ga0373924_0028034 | Ga0373924_0028034_671_1642 | 311 |
| 435 | 3300035695 | Ga0373927_0116076 | Ga0373927_0116076_169_1140 | 311 |
| 436 | 3300035725 | Ga0373947_0053593 | Ga0373947_0053593_1325_2296 | 311 |
| 437 | 3300038443 | Ga0395901_0081069 | Ga0395901_0081069_2192_3160 | 311 |
| 438 | 3300038443 | Ga0395901_0574320 | Ga0395901_0574320_51_1022 | 311 |
| 439 | 3300046455 | Ga0495603_0103661 | Ga0495603_0103661_89_1060 | 311 |
| 440 | 3300046475 | Ga0495639_0027222 | Ga0495639_0027222_875_1846 | 311 |
| 441 | 3300047315 | Ga0495581_0047755 | Ga0495581_0047755_841_1812 | 311 |
| 442 | 3300047319 | Ga0495674_0083984 | Ga0495674_0083984_1086_2057 | 311 |
| 443 | 3300047321 | Ga0495676_0152287 | Ga0495676_0152287_466_1437 | 311 |
| 444 | 3300047673 | Ga0495593_0140454 | Ga0495593_0140454_163_1134 | 311 |
| 445 | 3300048089 | Ga0495614_0038051 | Ga0495614_0038051_520_1491 | 311 |
| 446 | 3300049573 | Ga0501037_0109982 | Ga0501037_0109982_107_1075 | 311 |
| 447 | 3300049574 | Ga0501038_0034613 | Ga0501038_0034613_348_1316 | 311 |
| 448 | 3300049580 | Ga0501046_0088888 | Ga0501046_0088888_542_1510 | 311 |
| 449 | 3300049586 | Ga0501070_0025190 | Ga0501070_0025190_1717_2685 | 311 |
| 450 | 3300049823 | Ga0501044_0021512 | Ga0501044_0021512_5229_6197 | 311 |
| 451 | 3300053077 | Ga0495601_0114070 | Ga0495601_0114070_93_1061 | 311 |
| 452 | 3300053085 | Ga0495619_0019647 | Ga0495619_0019647_328_1299 | 311 |
| 453 | 3300000041 | ARcpr5oldR_c000095 | ARcpr5oldR_0000959 | 312 |
| 454 | 3300000042 | ARSoilYngRDRAFT_c00083 | ARSoilYngRDRAFT_000839 | 312 |
| 455 | 3300000043 | ARcpr5yngRDRAFT_c000131 | ARcpr5yngRDRAFT_00013110 | 312 |
| 456 | 3300000044 | ARSoilOldRDRAFT_c000103 | ARSoilOldRDRAFT_0001038 | 312 |
| 457 | 3300000652 | ARCol0yngRDRAFT_1000133 | ARCol0yngRDRAFT_10001333 | 312 |
| 458 | 3300001977 | JGI24746J21847_1005106 | JGI24746J21847_10051062 | 312 |
| 459 | 3300001989 | JGI24739J22299_10014486 | JGI24739J22299_100144863 | 312 |
| 460 | 3300001990 | JGI24737J22298_10005379 | JGI24737J22298_100053793 | 312 |
| 461 | 3300001990 | JGI24737J22298_10011191 | JGI24737J22298_100111913 | 312 |
| 462 | 3300002073 | JGI24745J21846_1001233 | JGI24745J21846_10012332 | 312 |
| 463 | 3300002075 | JGI24738J21930_10002375 | JGI24738J21930_100023754 | 312 |
| 464 | 3300002126 | JGI24035J26624_1000776 | JGI24035J26624_10007764 | 312 |
| 465 | 3300002244 | JGI24742J22300_10000988 | JGI24742J22300_100009883 | 312 |
| 466 | 3300005290 | Ga0065712_10006492 | Ga0065712_100064922 | 312 |
| 467 | 3300005293 | Ga0065715_10108649 | Ga0065715_101086492 | 312 |
| 468 | 3300005328 | Ga0070676_10006196 | Ga0070676_100061962 | 312 |
| 469 | 3300005328 | Ga0070676_10131183 | Ga0070676_101311832 | 312 |
| 470 | 3300005329 | Ga0070683_100018166 | Ga0070683_1000181662 | 312 |
| 471 | 3300005330 | Ga0070690_100005074 | Ga0070690_1000050749 | 312 |
| 472 | 3300005330 | Ga0070690_100012491 | Ga0070690_1000124912 | 312 |
| 473 | 3300005330 | Ga0070690_100066481 | Ga0070690_1000664812 | 312 |
| 474 | 3300005331 | Ga0070670_100037294 | Ga0070670_1000372942 | 312 |
| 475 | 3300005331 | Ga0070670_100098901 | Ga0070670_1000989012 | 312 |
| 476 | 3300005333 | Ga0070677_10000267 | Ga0070677_100002679 | 312 |
| 477 | 3300005334 | Ga0068869_100000991 | Ga0068869_1000009916 | 312 |
| 478 | 3300005335 | Ga0070666_10008226 | Ga0070666_100082263 | 312 |
| 479 | 3300005336 | Ga0070680_100007000 | Ga0070680_10000700011 | 312 |
| 480 | 3300005336 | Ga0070680_100008439 | Ga0070680_1000084393 | 312 |
| 481 | 3300005336 | Ga0070680_100102952 | Ga0070680_1001029522 | 312 |
| 482 | 3300005337 | Ga0070682_100002591 | Ga0070682_1000025919 | 312 |
| 483 | 3300005339 | Ga0070660_100014299 | Ga0070660_1000142992 | 312 |
| 484 | 3300005340 | Ga0070689_100010361 | Ga0070689_1000103612 | 312 |
| 485 | 3300005340 | Ga0070689_100143000 | Ga0070689_1001430002 | 312 |
| 486 | 3300005340 | Ga0070689_100256393 | Ga0070689_1002563932 | 312 |
| 487 | 3300005343 | Ga0070687_100000879 | Ga0070687_1000008798 | 312 |
| 488 | 3300005344 | Ga0070661_100017455 | Ga0070661_1000174553 | 312 |
| 489 | 3300005345 | Ga0070692_10173469 | Ga0070692_101734691 | 312 |
| 490 | 3300005347 | Ga0070668_100072405 | Ga0070668_1000724052 | 312 |
| 491 | 3300005353 | Ga0070669_100071179 | Ga0070669_1000711793 | 312 |
| 492 | 3300005353 | Ga0070669_100075580 | Ga0070669_1000755802 | 312 |
| 493 | 3300005354 | Ga0070675_100010826 | Ga0070675_1000108262 | 312 |
| 494 | 3300005354 | Ga0070675_100066926 | Ga0070675_1000669262 | 312 |
| 495 | 3300005356 | Ga0070674_100044791 | Ga0070674_1000447912 | 312 |
| 496 | 3300005356 | Ga0070674_100140374 | Ga0070674_1001403742 | 312 |
| 497 | 3300005364 | Ga0070673_100001635 | Ga0070673_10000163510 | 312 |
| 498 | 3300005364 | Ga0070673_100031619 | Ga0070673_1000316194 | 312 |
| 499 | 3300005365 | Ga0070688_100018060 | Ga0070688_1000180604 | 312 |
| 500 | 3300005365 | Ga0070688_100050394 | Ga0070688_1000503942 | 312 |
| 501 | 3300005365 | Ga0070688_100069219 | Ga0070688_1000692192 | 312 |
| 502 | 3300005366 | Ga0070659_100063170 | Ga0070659_1000631703 | 312 |
| 503 | 3300005367 | Ga0070667_100001396 | Ga0070667_10000139624 | 312 |
| 504 | 3300005367 | Ga0070667_100114682 | Ga0070667_1001146822 | 312 |
| 505 | 3300005406 | Ga0070703_10010516 | Ga0070703_100105162 | 312 |
| 506 | 3300005434 | Ga0070709_10164191 | Ga0070709_101641912 | 312 |
| 507 | 3300005436 | Ga0070713_100036260 | Ga0070713_1000362604 | 312 |
| 508 | 3300005438 | Ga0070701_10044211 | Ga0070701_100442112 | 312 |
| 509 | 3300005438 | Ga0070701_10089901 | Ga0070701_100899012 | 312 |
| 510 | 3300005439 | Ga0070711_100029980 | Ga0070711_1000299803 | 312 |
| 511 | 3300005439 | Ga0070711_100049734 | Ga0070711_1000497342 | 312 |
| 512 | 3300005439 | Ga0070711_100110465 | Ga0070711_1001104652 | 312 |
| 513 | 3300005440 | Ga0070705_100014152 | Ga0070705_1000141524 | 312 |
| 514 | 3300005441 | Ga0070700_100004739 | Ga0070700_1000047397 | 312 |
| 515 | 3300005441 | Ga0070700_100036560 | Ga0070700_1000365603 | 312 |
| 516 | 3300005444 | Ga0070694_100041182 | Ga0070694_1000411822 | 312 |
| 517 | 3300005444 | Ga0070694_100051168 | Ga0070694_1000511682 | 312 |
| 518 | 3300005444 | Ga0070694_100109630 | Ga0070694_1001096302 | 312 |
| 519 | 3300005455 | Ga0070663_100016280 | Ga0070663_1000162806 | 312 |
| 520 | 3300005455 | Ga0070663_100047549 | Ga0070663_1000475493 | 312 |
| 521 | 3300005455 | Ga0070663_100134901 | Ga0070663_1001349011 | 312 |
| 522 | 3300005456 | Ga0070678_100002344 | Ga0070678_1000023449 | 312 |
| 523 | 3300005457 | Ga0070662_100009494 | Ga0070662_1000094946 | 312 |
| 524 | 3300005457 | Ga0070662_100043915 | Ga0070662_1000439152 | 312 |
| 525 | 3300005458 | Ga0070681_10004197 | Ga0070681_100041972 | 312 |
| 526 | 3300005458 | Ga0070681_10271999 | Ga0070681_102719992 | 312 |
| 527 | 3300005459 | Ga0068867_100012755 | Ga0068867_1000127552 | 312 |
| 528 | 3300005530 | Ga0070679_100092414 | Ga0070679_1000924141 | 312 |
| 529 | 3300005530 | Ga0070679_100374985 | Ga0070679_1003749851 | 312 |
| 530 | 3300005530 | Ga0070679_100382741 | Ga0070679_1003827411 | 312 |
| 531 | 3300005536 | Ga0070697_100193023 | Ga0070697_1001930232 | 312 |
| 532 | 3300005539 | Ga0068853_100051672 | Ga0068853_1000516723 | 312 |
| 533 | 3300005539 | Ga0068853_100103408 | Ga0068853_1001034081 | 312 |
| 534 | 3300005543 | Ga0070672_100001723 | Ga0070672_1000017233 | 312 |
| 535 | 3300005544 | Ga0070686_100011069 | Ga0070686_1000110694 | 312 |
| 536 | 3300005544 | Ga0070686_100030989 | Ga0070686_1000309891 | 312 |
| 537 | 3300005545 | Ga0070695_100131536 | Ga0070695_1001315362 | 312 |
| 538 | 3300005545 | Ga0070695_100185095 | Ga0070695_1001850952 | 312 |
| 539 | 3300005546 | Ga0070696_100059816 | Ga0070696_1000598162 | 312 |
| 540 | 3300005546 | Ga0070696_100084714 | Ga0070696_1000847141 | 312 |
| 541 | 3300005547 | Ga0070693_100002926 | Ga0070693_1000029263 | 312 |
| 542 | 3300005547 | Ga0070693_100288632 | Ga0070693_1002886321 | 312 |
| 543 | 3300005549 | Ga0070704_100005673 | Ga0070704_1000056732 | 312 |
| 544 | 3300005564 | Ga0070664_100056486 | Ga0070664_1000564862 | 312 |
| 545 | 3300005564 | Ga0070664_100091886 | Ga0070664_1000918862 | 312 |
| 546 | 3300005564 | Ga0070664_100103548 | Ga0070664_1001035482 | 312 |
| 547 | 3300005577 | Ga0068857_100029605 | Ga0068857_1000296055 | 312 |
| 548 | 3300005577 | Ga0068857_100092467 | Ga0068857_1000924672 | 312 |
| 549 | 3300005578 | Ga0068854_100004810 | Ga0068854_1000048103 | 312 |
| 550 | 3300005614 | Ga0068856_100004424 | Ga0068856_10000442415 | 312 |
| 551 | 3300005614 | Ga0068856_100077894 | Ga0068856_1000778942 | 312 |
| 552 | 3300005616 | Ga0068852_100092806 | Ga0068852_1000928062 | 312 |
| 553 | 3300005616 | Ga0068852_100271263 | Ga0068852_1002712632 | 312 |
| 554 | 3300005617 | Ga0068859_100051438 | Ga0068859_1000514383 | 312 |
| 555 | 3300005617 | Ga0068859_100098957 | Ga0068859_1000989573 | 312 |
| 556 | 3300005618 | Ga0068864_100026210 | Ga0068864_1000262103 | 312 |
| 557 | 3300005718 | Ga0068866_10004921 | Ga0068866_100049215 | 312 |
| 558 | 3300005718 | Ga0068866_10217040 | Ga0068866_102170401 | 312 |
| 559 | 3300005719 | Ga0068861_100002263 | Ga0068861_10000226312 | 312 |
| 560 | 3300005719 | Ga0068861_100028372 | Ga0068861_1000283723 | 312 |
| 561 | 3300005840 | Ga0068870_10000323 | Ga0068870_100003239 | 312 |
| 562 | 3300005842 | Ga0068858_100030717 | Ga0068858_1000307174 | 312 |
| 563 | 3300005842 | Ga0068858_100036975 | Ga0068858_1000369752 | 312 |
| 564 | 3300005842 | Ga0068858_100107313 | Ga0068858_1001073132 | 312 |
| 565 | 3300005843 | Ga0068860_100001886 | Ga0068860_10000188624 | 312 |
| 566 | 3300005843 | Ga0068860_100102035 | Ga0068860_1001020353 | 312 |
| 567 | 3300005843 | Ga0068860_100136842 | Ga0068860_1001368421 | 312 |
| 568 | 3300005844 | Ga0068862_100001462 | Ga0068862_10000146220 | 312 |
| 569 | 3300005844 | Ga0068862_100047241 | Ga0068862_1000472411 | 312 |
| 570 | 3300005937 | Ga0081455_10000313 | Ga0081455_1000031358 | 312 |
| 571 | 3300005937 | Ga0081455_10062450 | Ga0081455_100624502 | 312 |
| 572 | 3300006163 | Ga0070715_10013325 | Ga0070715_100133253 | 312 |
| 573 | 3300006237 | Ga0097621_100006440 | Ga0097621_10000644010 | 312 |
| 574 | 3300006237 | Ga0097621_100108031 | Ga0097621_1001080312 | 312 |
| 575 | 3300006358 | Ga0068871_100004355 | Ga0068871_1000043556 | 312 |
| 576 | 3300006358 | Ga0068871_100005719 | Ga0068871_1000057198 | 312 |
| 577 | 3300006358 | Ga0068871_100041937 | Ga0068871_1000419372 | 312 |
| 578 | 3300006852 | Ga0075433_10049262 | Ga0075433_100492622 | 312 |
| 579 | 3300006852 | Ga0075433_10260286 | Ga0075433_102602862 | 312 |
| 580 | 3300006871 | Ga0075434_100044263 | Ga0075434_1000442633 | 312 |
| 581 | 3300006871 | Ga0075434_100065153 | Ga0075434_1000651533 | 312 |
| 582 | 3300006871 | Ga0075434_100147344 | Ga0075434_1001473442 | 312 |
| 583 | 3300006881 | Ga0068865_100160284 | Ga0068865_1001602842 | 312 |
| 584 | 3300006914 | Ga0075436_100013190 | Ga0075436_1000131905 | 312 |
| 585 | 3300006931 | Ga0097620_100051438 | Ga0097620_1000514383 | 312 |
| 586 | 3300006931 | Ga0097620_100098964 | Ga0097620_1000989643 | 312 |
| 587 | 3300009093 | Ga0105240_10102968 | Ga0105240_101029683 | 312 |
| 588 | 3300009093 | Ga0105240_10374892 | Ga0105240_103748922 | 312 |
| 589 | 3300009094 | Ga0111539_10002538 | Ga0111539_100025383 | 312 |
| 590 | 3300009094 | Ga0111539_10007068 | Ga0111539_100070683 | 312 |
| 591 | 3300009094 | Ga0111539_10324603 | Ga0111539_103246032 | 312 |
| 592 | 3300009101 | Ga0105247_10006797 | Ga0105247_100067973 | 312 |
| 593 | 3300009101 | Ga0105247_10033503 | Ga0105247_100335032 | 312 |
| 594 | 3300009148 | Ga0105243_10027142 | Ga0105243_100271424 | 312 |
| 595 | 3300009148 | Ga0105243_10060557 | Ga0105243_100605571 | 312 |
| 596 | 3300009148 | Ga0105243_10367606 | Ga0105243_103676062 | 312 |
| 597 | 3300009176 | Ga0105242_10016257 | Ga0105242_100162575 | 312 |
| 598 | 3300009177 | Ga0105248_10002716 | Ga0105248_1000271618 | 312 |
| 599 | 3300009177 | Ga0105248_10037966 | Ga0105248_100379665 | 312 |
| 600 | 3300009177 | Ga0105248_10057751 | Ga0105248_100577513 | 312 |
| 601 | 3300009545 | Ga0105237_10204320 | Ga0105237_102043202 | 312 |
| 602 | 3300009553 | Ga0105249_10046857 | Ga0105249_100468573 | 312 |
| 603 | 3300009553 | Ga0105249_10049985 | Ga0105249_100499853 | 312 |
| 604 | 3300009553 | Ga0105249_10603471 | Ga0105249_106034711 | 312 |
| 605 | 3300010375 | Ga0105239_10093887 | Ga0105239_100938872 | 312 |
| 606 | 3300010375 | Ga0105239_10125513 | Ga0105239_101255133 | 312 |
| 607 | 3300011119 | Ga0105246_10000456 | Ga0105246_100004563 | 312 |
| 608 | 3300011119 | Ga0105246_10104698 | Ga0105246_101046982 | 312 |
| 609 | 3300013100 | Ga0157373_10035903 | Ga0157373_100359034 | 312 |
| 610 | 3300013296 | Ga0157374_10015579 | Ga0157374_100155793 | 312 |
| 611 | 3300013296 | Ga0157374_10043090 | Ga0157374_100430902 | 312 |
| 612 | 3300013306 | Ga0163162_10044487 | Ga0163162_100444873 | 312 |
| 613 | 3300013306 | Ga0163162_10309248 | Ga0163162_103092482 | 312 |
| 614 | 3300013307 | Ga0157372_10035536 | Ga0157372_100355363 | 312 |
| 615 | 3300013308 | Ga0157375_10005758 | Ga0157375_100057583 | 312 |
| 616 | 3300013308 | Ga0157375_10055984 | Ga0157375_100559843 | 312 |
| 617 | 3300013308 | Ga0157375_10084758 | Ga0157375_100847582 | 312 |
| 618 | 3300014326 | Ga0157380_10019473 | Ga0157380_100194733 | 312 |
| 619 | 3300014745 | Ga0157377_10083516 | Ga0157377_100835162 | 312 |
| 620 | 3300014968 | Ga0157379_10013988 | Ga0157379_100139882 | 312 |
| 621 | 3300014968 | Ga0157379_10345840 | Ga0157379_103458402 | 312 |
| 622 | 3300014969 | Ga0157376_10005756 | Ga0157376_100057563 | 312 |
| 623 | 3300014969 | Ga0157376_10142542 | Ga0157376_101425422 | 312 |
| 624 | 3300017792 | Ga0163161_10006245 | Ga0163161_1000624510 | 312 |
| 625 | 3300025271 | Ga0207666_1000483 | Ga0207666_10004833 | 312 |
| 626 | 3300025271 | Ga0207666_1001877 | Ga0207666_10018773 | 312 |
| 627 | 3300025290 | Ga0207673_1000591 | Ga0207673_10005912 | 312 |
| 628 | 3300025315 | Ga0207697_10008842 | Ga0207697_100088423 | 312 |
| 629 | 3300025315 | Ga0207697_10024058 | Ga0207697_100240582 | 312 |
| 630 | 3300025893 | Ga0207682_10000143 | Ga0207682_1000014310 | 312 |
| 631 | 3300025898 | Ga0207692_10032171 | Ga0207692_100321712 | 312 |
| 632 | 3300025898 | Ga0207692_10110690 | Ga0207692_101106902 | 312 |
| 633 | 3300025899 | Ga0207642_10008803 | Ga0207642_100088032 | 312 |
| 634 | 3300025899 | Ga0207642_10164011 | Ga0207642_101640111 | 312 |
| 635 | 3300025900 | Ga0207710_10038796 | Ga0207710_100387962 | 312 |
| 636 | 3300025900 | Ga0207710_10077566 | Ga0207710_100775662 | 312 |
| 637 | 3300025901 | Ga0207688_10001469 | Ga0207688_100014692 | 312 |
| 638 | 3300025901 | Ga0207688_10075359 | Ga0207688_100753592 | 312 |
| 639 | 3300025903 | Ga0207680_10022035 | Ga0207680_100220352 | 312 |
| 640 | 3300025903 | Ga0207680_10022742 | Ga0207680_100227422 | 312 |
| 641 | 3300025903 | Ga0207680_10077345 | Ga0207680_100773452 | 312 |
| 642 | 3300025904 | Ga0207647_10042117 | Ga0207647_100421173 | 312 |
| 643 | 3300025907 | Ga0207645_10002217 | Ga0207645_1000221712 | 312 |
| 644 | 3300025907 | Ga0207645_10014177 | Ga0207645_100141772 | 312 |
| 645 | 3300025907 | Ga0207645_10034551 | Ga0207645_100345511 | 312 |
| 646 | 3300025908 | Ga0207643_10000336 | Ga0207643_1000033610 | 312 |
| 647 | 3300025914 | Ga0207671_10156696 | Ga0207671_101566962 | 312 |
| 648 | 3300025914 | Ga0207671_10265686 | Ga0207671_102656862 | 312 |
| 649 | 3300025916 | Ga0207663_10137394 | Ga0207663_101373941 | 312 |
| 650 | 3300025917 | Ga0207660_10030666 | Ga0207660_100306662 | 312 |
| 651 | 3300025918 | Ga0207662_10022126 | Ga0207662_100221263 | 312 |
| 652 | 3300025919 | Ga0207657_10050255 | Ga0207657_100502553 | 312 |
| 653 | 3300025919 | Ga0207657_10077116 | Ga0207657_100771162 | 312 |
| 654 | 3300025919 | Ga0207657_10151445 | Ga0207657_101514452 | 312 |
| 655 | 3300025920 | Ga0207649_10001348 | Ga0207649_100013484 | 312 |
| 656 | 3300025921 | Ga0207652_10051777 | Ga0207652_100517775 | 312 |
| 657 | 3300025923 | Ga0207681_10000782 | Ga0207681_100007822 | 312 |
| 658 | 3300025923 | Ga0207681_10220025 | Ga0207681_102200252 | 312 |
| 659 | 3300025924 | Ga0207694_10255551 | Ga0207694_102555512 | 312 |
| 660 | 3300025925 | Ga0207650_10021793 | Ga0207650_100217935 | 312 |
| 661 | 3300025925 | Ga0207650_10147269 | Ga0207650_101472692 | 312 |
| 662 | 3300025926 | Ga0207659_10119646 | Ga0207659_101196462 | 312 |
| 663 | 3300025927 | Ga0207687_10083224 | Ga0207687_100832242 | 312 |
| 664 | 3300025929 | Ga0207664_10071944 | Ga0207664_100719442 | 312 |
| 665 | 3300025931 | Ga0207644_10007899 | Ga0207644_100078995 | 312 |
| 666 | 3300025932 | Ga0207690_10019650 | Ga0207690_100196503 | 312 |
| 667 | 3300025932 | Ga0207690_10053988 | Ga0207690_100539883 | 312 |
| 668 | 3300025933 | Ga0207706_10007938 | Ga0207706_1000793810 | 312 |
| 669 | 3300025933 | Ga0207706_10051355 | Ga0207706_100513553 | 312 |
| 670 | 3300025934 | Ga0207686_10012238 | Ga0207686_100122382 | 312 |
| 671 | 3300025934 | Ga0207686_10017860 | Ga0207686_100178602 | 312 |
| 672 | 3300025935 | Ga0207709_10028191 | Ga0207709_100281913 | 312 |
| 673 | 3300025936 | Ga0207670_10013045 | Ga0207670_100130452 | 312 |
| 674 | 3300025936 | Ga0207670_10094086 | Ga0207670_100940861 | 312 |
| 675 | 3300025937 | Ga0207669_10076620 | Ga0207669_100766202 | 312 |
| 676 | 3300025937 | Ga0207669_10100444 | Ga0207669_101004442 | 312 |
| 677 | 3300025938 | Ga0207704_10087197 | Ga0207704_100871972 | 312 |
| 678 | 3300025938 | Ga0207704_10320976 | Ga0207704_103209761 | 312 |
| 679 | 3300025939 | Ga0207665_10007323 | Ga0207665_100073232 | 312 |
| 680 | 3300025940 | Ga0207691_10039514 | Ga0207691_100395143 | 312 |
| 681 | 3300025942 | Ga0207689_10000929 | Ga0207689_1000092910 | 312 |
| 682 | 3300025942 | Ga0207689_10112248 | Ga0207689_101122481 | 312 |
| 683 | 3300025944 | Ga0207661_10013325 | Ga0207661_100133253 | 312 |
| 684 | 3300025945 | Ga0207679_10001711 | Ga0207679_100017112 | 312 |
| 685 | 3300025960 | Ga0207651_10000218 | Ga0207651_1000021810 | 312 |
| 686 | 3300025960 | Ga0207651_10131464 | Ga0207651_101314642 | 312 |
| 687 | 3300025961 | Ga0207712_10064867 | Ga0207712_100648673 | 312 |
| 688 | 3300025961 | Ga0207712_10403384 | Ga0207712_104033842 | 312 |
| 689 | 3300025981 | Ga0207640_10015886 | Ga0207640_100158864 | 312 |
| 690 | 3300026035 | Ga0207703_10185066 | Ga0207703_101850661 | 312 |
| 691 | 3300026035 | Ga0207703_10204039 | Ga0207703_102040392 | 312 |
| 692 | 3300026041 | Ga0207639_10015755 | Ga0207639_100157552 | 312 |
| 693 | 3300026041 | Ga0207639_10106278 | Ga0207639_101062782 | 312 |
| 694 | 3300026067 | Ga0207678_10009656 | Ga0207678_100096563 | 312 |
| 695 | 3300026067 | Ga0207678_10031495 | Ga0207678_100314953 | 312 |
| 696 | 3300026067 | Ga0207678_10105993 | Ga0207678_101059932 | 312 |
| 697 | 3300026075 | Ga0207708_10039114 | Ga0207708_100391142 | 312 |
| 698 | 3300026075 | Ga0207708_10074019 | Ga0207708_100740192 | 312 |
| 699 | 3300026078 | Ga0207702_10015377 | Ga0207702_100153776 | 312 |
| 700 | 3300026089 | Ga0207648_10005804 | Ga0207648_100058042 | 312 |
| 701 | 3300026089 | Ga0207648_10215844 | Ga0207648_102158442 | 312 |
| 702 | 3300026095 | Ga0207676_10082624 | Ga0207676_100826243 | 312 |
| 703 | 3300026116 | Ga0207674_10086803 | Ga0207674_100868033 | 312 |
| 704 | 3300026116 | Ga0207674_10123605 | Ga0207674_101236052 | 312 |
| 705 | 3300026118 | Ga0207675_100024105 | Ga0207675_1000241054 | 312 |
| 706 | 3300026118 | Ga0207675_100058013 | Ga0207675_1000580132 | 312 |
| 707 | 3300026118 | Ga0207675_100108485 | Ga0207675_1001084852 | 312 |
| 708 | 3300026121 | Ga0207683_10001206 | Ga0207683_100012064 | 312 |
| 709 | 3300026121 | Ga0207683_10049783 | Ga0207683_100497833 | 312 |
| 710 | 3300027364 | Ga0209967_1004774 | Ga0209967_10047742 | 312 |
| 711 | 3300027717 | Ga0209998_10003154 | Ga0209998_100031543 | 312 |
| 712 | 3300027717 | Ga0209998_10018948 | Ga0209998_100189482 | 312 |
| 713 | 3300027907 | Ga0207428_10001593 | Ga0207428_100015933 | 312 |
| 714 | 3300027907 | Ga0207428_10005136 | Ga0207428_100051363 | 312 |
| 715 | 3300028379 | Ga0268266_10021360 | Ga0268266_100213604 | 312 |
| 716 | 3300028380 | Ga0268265_10001135 | Ga0268265_1000113523 | 312 |
| 717 | 3300028380 | Ga0268265_10067414 | Ga0268265_100674141 | 312 |
| 718 | 3300028381 | Ga0268264_10069727 | Ga0268264_100697272 | 312 |
| 719 | 3300031241 | Ga0265325_10046724 | Ga0265325_100467242 | 312 |
| 720 | 3300031711 | Ga0265314_10034708 | Ga0265314_100347083 | 312 |
| 721 | 3300034816 | Ga0373930_0000149 | Ga0373930_0000149_1730_2701 | 312 |
| 722 | 3300034816 | Ga0373930_0007507 | Ga0373930_0007507_504_1475 | 312 |
| 723 | 3300034817 | Ga0373948_0003483 | Ga0373948_0003483_1202_2173 | 312 |
| 724 | 3300034818 | Ga0373950_0003847 | Ga0373950_0003847_274_1245 | 312 |
| 725 | 3300034819 | Ga0373958_0001168 | Ga0373958_0001168_971_1942 | 312 |
| 726 | 3300034820 | Ga0373959_0000590 | Ga0373959_0000590_1405_2376 | 312 |
| 727 | 3300034957 | Ga0373938_0003974 | Ga0373938_0003974_226_1197 | 312 |
| 728 | 3300034957 | Ga0373938_0033337 | Ga0373938_0033337_20_991 | 312 |
| 729 | 3300035084 | Ga0373928_0000732 | Ga0373928_0000732_2680_3651 | 312 |
| 730 | 3300035084 | Ga0373928_0005790 | Ga0373928_0005790_1329_2300 | 312 |
| 731 | 3300035085 | Ga0373929_0005208 | Ga0373929_0005208_1314_2285 | 312 |
| 732 | 3300035085 | Ga0373929_0009379 | Ga0373929_0009379_783_1754 | 312 |
| 733 | 3300035086 | Ga0373934_0003323 | Ga0373934_0003323_357_1328 | 312 |
| 734 | 3300035088 | Ga0373940_0000020 | Ga0373940_0000020_11639_12610 | 312 |
| 735 | 3300035088 | Ga0373940_0006010 | Ga0373940_0006010_757_1728 | 312 |
| 736 | 3300035089 | Ga0373944_0000638 | Ga0373944_0000638_2204_3175 | 312 |
| 737 | 3300035090 | Ga0373949_0001031 | Ga0373949_0001031_1938_2909 | 312 |
| 738 | 3300035090 | Ga0373949_0011131 | Ga0373949_0011131_44_1015 | 312 |
| 739 | 3300035090 | Ga0373949_0036124 | Ga0373949_0036124_142_1113 | 312 |
| 740 | 3300035091 | Ga0373951_0000632 | Ga0373951_0000632_5336_6307 | 312 |
| 741 | 3300035091 | Ga0373951_0009549 | Ga0373951_0009549_1028_1999 | 312 |
| 742 | 3300035092 | Ga0373952_0001849 | Ga0373952_0001849_1798_2769 | 312 |
| 743 | 3300035092 | Ga0373952_0015095 | Ga0373952_0015095_221_1192 | 312 |
| 744 | 3300035111 | Ga0373923_0000650 | Ga0373923_0000650_517_1488 | 312 |
| 745 | 3300035112 | Ga0373932_0000824 | Ga0373932_0000824_2039_3010 | 312 |
| 746 | 3300035113 | Ga0373936_0012916 | Ga0373936_0012916_506_1477 | 312 |
| 747 | 3300035114 | Ga0373939_0000304 | Ga0373939_0000304_6608_7579 | 312 |
| 748 | 3300035114 | Ga0373939_0002434 | Ga0373939_0002434_187_1158 | 312 |
| 749 | 3300035114 | Ga0373939_0015065 | Ga0373939_0015065_11_982 | 312 |
| 750 | 3300035115 | Ga0373941_0000096 | Ga0373941_0000096_12136_13107 | 312 |
| 751 | 3300035115 | Ga0373941_0005640 | Ga0373941_0005640_1784_2755 | 312 |
| 752 | 3300035115 | Ga0373941_0030973 | Ga0373941_0030973_142_1113 | 312 |
| 753 | 3300035116 | Ga0373945_0003142 | Ga0373945_0003142_1709_2680 | 312 |
| 754 | 3300035117 | Ga0373953_0005057 | Ga0373953_0005057_1936_2907 | 312 |
| 755 | 3300035119 | Ga0373956_0013207 | Ga0373956_0013207_55_1026 | 312 |
| 756 | 3300035119 | Ga0373956_0091553 | Ga0373956_0091553_310_1281 | 312 |
| 757 | 3300035120 | Ga0373957_0004812 | Ga0373957_0004812_2430_3401 | 312 |
| 758 | 3300035121 | Ga0373960_0002306 | Ga0373960_0002306_760_1731 | 312 |
| 759 | 3300035121 | Ga0373960_0004034 | Ga0373960_0004034_1180_2151 | 312 |
| 760 | 3300035121 | Ga0373960_0004717 | Ga0373960_0004717_1225_2196 | 312 |
| 761 | 3300035170 | Ga0373943_0002507 | Ga0373943_0002507_3363_4334 | 312 |
| 762 | 3300035170 | Ga0373943_0011522 | Ga0373943_0011522_105_1076 | 312 |
| 763 | 3300035171 | Ga0373946_0002136 | Ga0373946_0002136_1087_2058 | 312 |
| 764 | 3300035171 | Ga0373946_0004288 | Ga0373946_0004288_3709_4680 | 312 |
| 765 | 3300035172 | Ga0373955_0001041 | Ga0373955_0001041_7836_8807 | 312 |
| 766 | 3300035172 | Ga0373955_0004535 | Ga0373955_0004535_4847_5818 | 312 |
| 767 | 3300035207 | Ga0373942_0000056 | Ga0373942_0000056_1900_2871 | 312 |
| 768 | 3300035241 | Ga0373961_0001928 | Ga0373961_0001928_3469_4440 | 312 |
| 769 | 3300035241 | Ga0373961_0002994 | Ga0373961_0002994_2687_3658 | 312 |
| 770 | 3300035242 | Ga0373962_0001582 | Ga0373962_0001582_2707_3678 | 312 |
| 771 | 3300035242 | Ga0373962_0021546 | Ga0373962_0021546_81_1052 | 312 |
| 772 | 3300035242 | Ga0373962_0042868 | Ga0373962_0042868_212_1183 | 312 |
| 773 | 3300035691 | Ga0373931_0008291 | Ga0373931_0008291_53_1024 | 312 |
| 774 | 3300035691 | Ga0373931_0010243 | Ga0373931_0010243_2305_3276 | 312 |
| 775 | 3300035692 | Ga0373935_0011194 | Ga0373935_0011194_4182_5153 | 312 |
| 776 | 3300035695 | Ga0373927_0006091 | Ga0373927_0006091_1424_2395 | 312 |
| 777 | 3300035695 | Ga0373927_0009888 | Ga0373927_0009888_2418_3389 | 312 |
| 778 | 3300035724 | Ga0373933_0012539 | Ga0373933_0012539_702_1673 | 312 |
| 779 | 3300035725 | Ga0373947_0003178 | Ga0373947_0003178_4656_5627 | 312 |
| 780 | 3300036401 | Ga0373937_0012538 | Ga0373937_0012538_2827_3798 | 312 |
| 781 | 3300037068 | Ga0373925_0001829 | Ga0373925_0001829_7219_8190 | 312 |
| 782 | 3300037068 | Ga0373925_0024946 | Ga0373925_0024946_1687_2658 | 312 |
| 783 | 3300044712 | Ga0453684_0053448 | Ga0453684_0053448_882_1853 | 312 |
| 784 | 3300045051 | Ga0451576_0022284 | Ga0451576_0022284_1927_2898 | 312 |
| 785 | 3300046454 | Ga0495592_0057777 | Ga0495592_0057777_671_1642 | 312 |
| 786 | 3300046454 | Ga0495592_0096833 | Ga0495592_0096833_535_1506 | 312 |
| 787 | 3300046454 | Ga0495592_0163908 | Ga0495592_0163908_492_1463 | 312 |
| 788 | 3300046455 | Ga0495603_0006355 | Ga0495603_0006355_2252_3223 | 312 |
| 789 | 3300046455 | Ga0495603_0029108 | Ga0495603_0029108_1581_2552 | 312 |
| 790 | 3300046459 | Ga0495629_0001405 | Ga0495629_0001405_13339_14310 | 312 |
| 791 | 3300046462 | Ga0495651_0004808 | Ga0495651_0004808_5103_6074 | 312 |
| 792 | 3300046462 | Ga0495651_0014554 | Ga0495651_0014554_648_1619 | 312 |
| 793 | 3300046463 | Ga0495653_0009990 | Ga0495653_0009990_5085_6056 | 312 |
| 794 | 3300046463 | Ga0495653_0012845 | Ga0495653_0012845_2236_3207 | 312 |
| 795 | 3300046472 | Ga0495580_0023894 | Ga0495580_0023894_2288_3259 | 312 |
| 796 | 3300046473 | Ga0495582_0018717 | Ga0495582_0018717_1702_2673 | 312 |
| 797 | 3300046475 | Ga0495639_0001451 | Ga0495639_0001451_7702_8673 | 312 |
| 798 | 3300046476 | Ga0495662_0000915 | Ga0495662_0000915_8268_9239 | 312 |
| 799 | 3300046492 | Ga0495585_0003492 | Ga0495585_0003492_4690_5661 | 312 |
| 800 | 3300046499 | Ga0495594_0001091 | Ga0495594_0001091_11418_12389 | 312 |
| 801 | 3300046501 | Ga0495607_0011896 | Ga0495607_0011896_779_1750 | 312 |
| 802 | 3300046511 | Ga0495608_0002687 | Ga0495608_0002687_5807_6778 | 312 |
| 803 | 3300046511 | Ga0495608_0026075 | Ga0495608_0026075_710_1681 | 312 |
| 804 | 3300046514 | Ga0495618_0005633 | Ga0495618_0005633_3332_4303 | 312 |
| 805 | 3300046514 | Ga0495618_0037562 | Ga0495618_0037562_1223_2194 | 312 |
| 806 | 3300046514 | Ga0495618_0046048 | Ga0495618_0046048_1150_2121 | 312 |
| 807 | 3300046516 | Ga0495628_0075145 | Ga0495628_0075145_963_1934 | 312 |
| 808 | 3300046523 | Ga0495644_0016379 | Ga0495644_0016379_1174_2145 | 312 |
| 809 | 3300046525 | Ga0495663_0016623 | Ga0495663_0016623_131_1102 | 312 |
| 810 | 3300046529 | Ga0495652_0002710 | Ga0495652_0002710_11434_12405 | 312 |
| 811 | 3300046529 | Ga0495652_0046431 | Ga0495652_0046431_2358_3329 | 312 |
| 812 | 3300046531 | Ga0495665_0002969 | Ga0495665_0002969_4965_5936 | 312 |
| 813 | 3300046533 | Ga0495640_0097203 | Ga0495640_0097203_449_1420 | 312 |
| 814 | 3300046535 | Ga0495586_0019875 | Ga0495586_0019875_2127_3098 | 312 |
| 815 | 3300046535 | Ga0495586_0117263 | Ga0495586_0117263_22_993 | 312 |
| 816 | 3300046536 | Ga0495587_0003832 | Ga0495587_0003832_4998_5969 | 312 |
| 817 | 3300046536 | Ga0495587_0008130 | Ga0495587_0008130_4082_5053 | 312 |
| 818 | 3300046537 | Ga0495598_0005995 | Ga0495598_0005995_87_1058 | 312 |
| 819 | 3300046543 | Ga0495645_0013139 | Ga0495645_0013139_3791_4762 | 312 |
| 820 | 3300046543 | Ga0495645_0246251 | Ga0495645_0246251_166_1137 | 312 |
| 821 | 3300046558 | Ga0495633_0002269 | Ga0495633_0002269_1361_2347 | 312 |
| 822 | 3300046559 | Ga0495667_0001506 | Ga0495667_0001506_780_1751 | 312 |
| 823 | 3300046559 | Ga0495667_0003229 | Ga0495667_0003229_7451_8422 | 312 |
| 824 | 3300046559 | Ga0495667_0013093 | Ga0495667_0013093_1091_2062 | 312 |
| 825 | 3300046615 | Ga0495656_0001233 | Ga0495656_0001233_5312_6283 | 312 |
| 826 | 3300046648 | Ga0495611_0036031 | Ga0495611_0036031_171_1142 | 312 |
| 827 | 3300046663 | Ga0495635_0033677 | Ga0495635_0033677_1039_2010 | 312 |
| 828 | 3300046663 | Ga0495635_0035736 | Ga0495635_0035736_1708_2679 | 312 |
| 829 | 3300046674 | Ga0495588_0002749 | Ga0495588_0002749_3374_4345 | 312 |
| 830 | 3300046678 | Ga0495599_0001517 | Ga0495599_0001517_980_1951 | 312 |
| 831 | 3300046678 | Ga0495599_0048414 | Ga0495599_0048414_1091_2062 | 312 |
| 832 | 3300046679 | Ga0495623_0010442 | Ga0495623_0010442_4380_5351 | 312 |
| 833 | 3300046681 | Ga0495647_0006888 | Ga0495647_0006888_2055_3026 | 312 |
| 834 | 3300046683 | Ga0495658_0000324 | Ga0495658_0000324_17489_18460 | 312 |
| 835 | 3300046683 | Ga0495658_0001251 | Ga0495658_0001251_10977_11948 | 312 |
| 836 | 3300046683 | Ga0495658_0068107 | Ga0495658_0068107_622_1593 | 312 |
| 837 | 3300046683 | Ga0495658_0146528 | Ga0495658_0146528_107_1078 | 312 |
| 838 | 3300046690 | Ga0495624_0003658 | Ga0495624_0003658_5510_6481 | 312 |
| 839 | 3300046809 | Ga0495600_0001403 | Ga0495600_0001403_5684_6655 | 312 |
| 840 | 3300046809 | Ga0495600_0020344 | Ga0495600_0020344_3008_3979 | 312 |
| 841 | 3300046809 | Ga0495600_0225695 | Ga0495600_0225695_196_1167 | 312 |
| 842 | 3300047315 | Ga0495581_0002626 | Ga0495581_0002626_7861_8832 | 312 |
| 843 | 3300047317 | Ga0495604_0007422 | Ga0495604_0007422_779_1750 | 312 |
| 844 | 3300047317 | Ga0495604_0024775 | Ga0495604_0024775_3784_4755 | 312 |
| 845 | 3300047317 | Ga0495604_0074284 | Ga0495604_0074284_1091_2062 | 312 |
| 846 | 3300047319 | Ga0495674_0074947 | Ga0495674_0074947_1709_2680 | 312 |
| 847 | 3300047321 | Ga0495676_0027763 | Ga0495676_0027763_719_1690 | 312 |
| 848 | 3300047322 | Ga0495680_0003143 | Ga0495680_0003143_12069_13040 | 312 |
| 849 | 3300047322 | Ga0495680_0004047 | Ga0495680_0004047_9322_10293 | 312 |
| 850 | 3300047444 | Ga0495675_0000855 | Ga0495675_0000855_10287_11258 | 312 |
| 851 | 3300047471 | Ga0495684_0000281 | Ga0495684_0000281_28422_29393 | 312 |
| 852 | 3300047673 | Ga0495593_0005567 | Ga0495593_0005567_2367_3338 | 312 |
| 853 | 3300047673 | Ga0495593_0015975 | Ga0495593_0015975_1380_2351 | 312 |
| 854 | 3300048088 | Ga0495602_0008505 | Ga0495602_0008505_5315_6286 | 312 |
| 855 | 3300048088 | Ga0495602_0087698 | Ga0495602_0087698_592_1563 | 312 |
| 856 | 3300048903 | Ga0496100_0021215 | Ga0496100_0021215_1127_2098 | 312 |
| 857 | 3300048903 | Ga0496100_0047320 | Ga0496100_0047320_847_1818 | 312 |
| 858 | 3300048904 | Ga0496101_0024709 | Ga0496101_0024709_102_1073 | 312 |
| 859 | 3300048904 | Ga0496101_0086778 | Ga0496101_0086778_950_1921 | 312 |
| 860 | 3300048905 | Ga0496102_0085310 | Ga0496102_0085310_1623_2594 | 312 |
| 861 | 3300048906 | Ga0496103_0010637 | Ga0496103_0010637_474_1445 | 312 |
| 862 | 3300048906 | Ga0496103_0053737 | Ga0496103_0053737_57_1028 | 312 |
| 863 | 3300048907 | Ga0496104_0046881 | Ga0496104_0046881_1750_2721 | 312 |
| 864 | 3300048907 | Ga0496104_0100304 | Ga0496104_0100304_1642_2613 | 312 |
| 865 | 3300048908 | Ga0496105_0012751 | Ga0496105_0012751_5545_6516 | 312 |
| 866 | 3300048908 | Ga0496105_0396551 | Ga0496105_0396551_71_1042 | 312 |
| 867 | 3300048909 | Ga0496106_0082620 | Ga0496106_0082620_1152_2123 | 312 |
| 868 | 3300048909 | Ga0496106_0096008 | Ga0496106_0096008_803_1774 | 312 |
| 869 | 3300048909 | Ga0496106_0153113 | Ga0496106_0153113_376_1347 | 312 |
| 870 | 3300048910 | Ga0496107_0035062 | Ga0496107_0035062_2447_3418 | 312 |
| 871 | 3300048910 | Ga0496107_0045823 | Ga0496107_0045823_1069_2040 | 312 |
| 872 | 3300048911 | Ga0496108_0021157 | Ga0496108_0021157_4234_5205 | 312 |
| 873 | 3300048911 | Ga0496108_0026962 | Ga0496108_0026962_515_1486 | 312 |
| 874 | 3300048911 | Ga0496108_0098818 | Ga0496108_0098818_1427_2398 | 312 |
| 875 | 3300048911 | Ga0496108_0164013 | Ga0496108_0164013_847_1818 | 312 |
| 876 | 3300048914 | Ga0496111_0072218 | Ga0496111_0072218_1217_2188 | 312 |
| 877 | 3300048914 | Ga0496111_0349480 | Ga0496111_0349480_49_1020 | 312 |
| 878 | 3300048915 | Ga0496112_0028452 | Ga0496112_0028452_401_1372 | 312 |
| 879 | 3300048915 | Ga0496112_0055487 | Ga0496112_0055487_266_1237 | 312 |
| 880 | 3300048915 | Ga0496112_0180932 | Ga0496112_0180932_142_1113 | 312 |
| 881 | 3300048916 | Ga0496113_0026664 | Ga0496113_0026664_1493_2464 | 312 |
| 882 | 3300048916 | Ga0496113_0144838 | Ga0496113_0144838_816_1787 | 312 |
| 883 | 3300048918 | Ga0496115_0014172 | Ga0496115_0014172_4141_5112 | 312 |
| 884 | 3300048918 | Ga0496115_0133498 | Ga0496115_0133498_296_1267 | 312 |
| 885 | 3300049591 | Ga0501075_0142297 | Ga0501075_0142297_300_1271 | 312 |
| 886 | 3300049592 | Ga0501076_0016049 | Ga0501076_0016049_3800_4771 | 312 |
| 887 | 3300049593 | Ga0501077_0021570 | Ga0501077_0021570_2624_3595 | 312 |
| 888 | 3300050511 | nmdc:mga08y16_4006_c1 | nmdc:mga08y16_4006_c1_11238_12209 | 312 |
| 889 | 3300050512 | nmdc:mga0n895_147099_c1 | nmdc:mga0n895_147099_c1_652_1623 | 312 |
| 890 | 3300050512 | nmdc:mga0n895_16263_c1 | nmdc:mga0n895_16263_c1_3232_4203 | 312 |
| 891 | 3300050512 | nmdc:mga0n895_63346_c1 | nmdc:mga0n895_63346_c1_1713_2684 | 312 |
| 892 | 3300050513 | nmdc:mga0rr50_135543_c1 | nmdc:mga0rr50_135543_c1_823_1794 | 312 |
| 893 | 3300050515 | nmdc:mga0a205_16026_c1 | nmdc:mga0a205_16026_c1_4524_5495 | 312 |
| 894 | 3300050515 | nmdc:mga0a205_329928_c1 | nmdc:mga0a205_329928_c1_305_1276 | 312 |
| 895 | 3300053077 | Ga0495601_0005565 | Ga0495601_0005565_5414_6385 | 312 |
| 896 | 3300053077 | Ga0495601_0016338 | Ga0495601_0016338_3167_4138 | 312 |
| 897 | 3300053078 | Ga0495612_0001141 | Ga0495612_0001141_4681_5652 | 312 |
| 898 | 3300053078 | Ga0495612_0030065 | Ga0495612_0030065_683_1654 | 312 |
| 899 | 3300053084 | Ga0495595_0000992 | Ga0495595_0000992_9308_10279 | 312 |
| 900 | 3300053084 | Ga0495595_0001007 | Ga0495595_0001007_6227_7198 | 312 |
| 901 | 3300053084 | Ga0495595_0004374 | Ga0495595_0004374_3729_4700 | 312 |
| 902 | 3300053084 | Ga0495595_0124682 | Ga0495595_0124682_194_1165 | 312 |
| 903 | 3300053085 | Ga0495619_0000715 | Ga0495619_0000715_14498_15469 | 312 |
| 904 | 3300053085 | Ga0495619_0001421 | Ga0495619_0001421_4656_5627 | 312 |
| 905 | 3300053085 | Ga0495619_0013795 | Ga0495619_0013795_3593_4564 | 312 |
| 906 | 3300053085 | Ga0495619_0077086 | Ga0495619_0077086_963_1934 | 312 |
| 907 | 3300053119 | Ga0500595_000006 | Ga0500595_000006_50237_51208 | 312 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kpq-assembly1.cif.gz_A | crystal structure of ctde in complex with fad | 0.8744 | 9 | 45 |
| 8fox-assembly1.cif.gz_A | abeh (tryptophan-5-halogenase) | 0.8631 | 8 | 41 |
| 5tui-assembly2.cif.gz_B | crystal structure of tetracycline destructase tet(50) in complex with chlortetracycline | 0.8585 | 9 | 42 |
| 3nks-assembly1.cif.gz_A | structure of human protoporphyrinogen ix oxidase | 0.8546 | 9 | 42 |
| 7dve-assembly1.cif.gz_A | crystal structure of fad-dependent c-glycoside oxidase | 0.8537 | 9 | 45 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f1kD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9158 | 10 | 168 | 3.40.50.720 |
| af_Q2FYS1_1_176_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9138 | 9 | 170 | 3.40.50.720 |
| 2g5cD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9089 | 9 | 166 | 3.40.50.720 |
| 5uscB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9044 | 9 | 168 | 3.40.50.720 |
| af_Q9Y7N4_8_341_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9015 | 9 | 42 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257QIA3-F1-model_v4 | Cyclohexadienyl dehydrogenase | 0.9892 | 8 | 97 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A537SP33-F1-model_v4 | Prephenate/arogenate dehydrogenase family protein | 0.9827 | 2 | 72 |
|
| AF-A0A2E1KVZ6-F1-model_v4 | Prephenate/arogenate dehydrogenase domain-containing protein | 0.9771 | 8 | 105 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A432J8H5-F1-model_v4 | deleted | 0.9719 | 8 | 105 |
|
| AF-A0A0F9J666-F1-model_v4 | Prephenate/arogenate dehydrogenase domain-containing protein | 0.9637 | 8 | 177 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar