F485268

General Info

Members Datasets Scaffolds Average Seq Length
904 510 644 305

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100026381|Ga0070678_1000263813
Length 317
Sequence MNASTIEASAPSHVLRSQGVSWYEASARQRIDLLLDAGTFKEYIGPEQREHSPHLQVFDLPEQFDDGIAVGRGMLAGAPVFIAAQEGRFMGGAFGEVHGAKLTGLLRAARDLGSIPVLILFDTGGVRLQEANAGELAIAEIMRALIEARTAGVKVIGLIGGRAGCYGGGGLIAGCCSALAVSEQGRISVSGPEVIETNRGVEEFDSKDRALVWRTMGGKHRRLLGGADAFSDDSIDAFRETALALIASTPGFGIEVLKAEQARLASRLDRFGTCGDAVDIWKAEGLSDAQAEAVPAMPAPDFITLANKVQEARHDAR

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
7 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2519103095 Burkholderia sp. KJ006 Isolate Nodule
10 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
11 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
12 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
13 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
14 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
15 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
16 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
17 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
18 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
19 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
20 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
21 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
22 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
23 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
24 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
25 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
26 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
27 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
28 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
29 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
30 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
31 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
32 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
33 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
34 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
35 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
36 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
37 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
38 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
39 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
40 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
41 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
42 2818991452 Burkholderia cepacia 561 Isolate Unclassified
43 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
44 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
45 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
46 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
47 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
48 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
49 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
50 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
51 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
52 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
53 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
54 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
55 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
56 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
57 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
58 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
59 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
60 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
61 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
62 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
63 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
64 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
65 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
66 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
67 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
68 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
72 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
73 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
74 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
75 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
76 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
77 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
78 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
79 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
80 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
81 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
85 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
86 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
87 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
88 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
89 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
90 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
91 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
92 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
93 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
94 2902330777 Methylobacterium sp. 2A Isolate Unclassified
95 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
96 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
97 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
98 2904564687 Burkholderia sp. 571 Isolate Unclassified
99 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
100 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
101 2904699407
102 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
103 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
104 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
105 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
106 2922368715
107 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
108 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
109 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
110 2928163908 Burkholderia sp. 567 Isolate Unclassified
111 2928170801 Burkholderia sp. 572 Isolate Unclassified
112 2928536128 Burkholderia sola 565 Isolate Unclassified
113 2928963466 Dyella japonica 1073 Isolate Unclassified
114 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
115 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
116 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
117 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
118 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
119 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
120 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
121 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
122 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
123 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
124 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
125 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
126 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
127 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
128 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
129 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
130 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
131 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
132 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
133 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
134 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
135 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
136 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
137 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
138 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
139 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
140 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
141 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
142 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
143 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
144 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
145 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
146 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
147 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
148 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
149 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
150 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
151 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
152 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
153 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
154 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
155 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
156 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
157 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
158 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
159 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
160 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
161 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
162 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
163 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
164 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
165 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
166 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
167 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
168 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
169 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
170 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
171 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
172 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
173 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
174 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
175 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
176 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
177 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
178 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
179 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
180 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
181 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
182 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
183 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
184 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
185 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
186 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
187 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
188 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
189 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
190 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
191 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
192 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
193 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
194 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
195 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
196 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
197 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
198 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
199 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
200 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
201 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
202 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
203 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
204 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
205 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
206 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
207 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
208 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
209 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
210 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
211 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
212 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
213 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
214 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
215 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
216 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
217 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
218 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
219 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
220 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
221 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
222 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
223 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
224 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
225 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
226 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
227 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
228 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
229 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
230 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
231 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
232 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
233 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
234 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
235 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
236 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
237 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
238 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
239 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
240 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
241 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
242 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
243 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
244 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
245 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
246 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
247 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
248 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
249 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
250 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
251 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
252 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
253 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
254 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
255 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
256 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
257 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
258 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
259 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
260 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
261 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
262 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
263 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
264 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
265 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
266 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
267 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
268 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
269 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
270 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
271 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
272 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
273 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
277 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
278 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
282 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
283 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
286 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
287 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
288 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
289 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
290 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
291 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
331 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
332 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
336 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
337 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
338 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
339 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
340 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
341 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
342 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
343 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
344 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
345 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
346 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
347 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
348 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
349 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
350 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
351 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
352 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
353 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
354 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
355 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
356 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
357 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
358 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
359 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
360 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
361 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
362 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
363 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
364 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
365 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
366 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
367 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
368 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
369 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
370 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
371 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
372 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
373 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
374 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
375 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
376 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
377 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
378 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
379 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
380 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
381 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
382 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
383 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
384 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
385 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
386 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
387 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
388 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
389 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
390 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
391 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
392 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
395 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
396 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
397 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
398 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
399 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
400 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
401 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
402 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
403 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
404 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
405 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
406 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
407 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
408 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
409 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
410 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
411 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
412 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
429 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
433 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
437 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
438 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
441 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
442 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
443 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
444 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
445 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
446 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
447 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
448 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
449 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
450 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
451 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
452 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
453 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
454 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
455 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
456 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
457 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
458 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
459 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
460 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
461 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
462 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
463 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
464 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
465 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
466 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
467 641522639 Methylobacterium sp. 4-46 Isolate Nodule
468 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
469 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
470 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
471 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
472 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
473 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
474 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
475 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
476 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
477 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
478 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
479 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
480 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
481 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
482 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
483 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
484 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
485 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
486 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
487 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
488 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
489 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
490 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
491 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
492 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
493 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
494 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
495 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
496 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
497 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
498 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
499 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
500 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
501 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
502 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
503 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
504 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
505 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
506 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
507 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
508 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
509 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
510 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.4
Metatranscriptomes 0
Isolates 28.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.81
Nodule 18.03
Rhizoplane 5.2
Rhizosphere 41.7
Stem 0
Stem Tuber 0
Unclassified 17.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10037306 3300001989 Bacteria 1638
2 JGI25162J39368_1002066 3300002737 Bacteria 8691
3 JGI25152J39213_1000162 3300002773 Bacteria 45604
4 JGI25152J39213_1007085 3300002773 Bacteria 2947
5 JGI25159J45721_1000678 3300002987 Bacteria 15023
6 JGI25159J45721_1002059 3300002987 Bacteria 7951
7 JGI25151J46595_10000052 3300003187 Bacteria 159471
8 JGI25151J46595_10065477 3300003187 Bacteria 1131
9 JGI25153J46596_10000288 3300003215 Bacteria 38391
10 JGI25153J46596_10001506 3300003215 Bacteria 13886
11 JGI25153J46596_10001586 3300003215 Bacteria 13473
12 JGI25153J46596_10003877 3300003215 Bacteria 8224
13 JGI25153J46596_10015463 3300003215 Bacteria 3107
14 JGI25153J46596_10018033 3300003215 Bacteria 2756
15 JGI25153J46596_10028247 3300003215 Bacteria 1949
16 rootH1_10064499 3300003316 Bacteria 2674
17 rootH2_10005012 3300003320 Bacteria 11801
18 rootL2_10011079 3300003322 Bacteria 2719
19 rootL2_10162917 3300003322 Bacteria 1672
20 rootH1_10109858 3300003323 Bacteria 4716
21 JGI25160J50197_1000413 3300003354 Bacteria 27195
22 JGI25160J50197_1001701 3300003354 Bacteria 10676
23 JGI25160J50197_1038171 3300003354 Bacteria 1140
24 JGI25161J50226_1000567 3300003374 Bacteria 15685
25 JGI25161J50226_1000572 3300003374 Bacteria 15570
26 JGI25161J50226_1000905 3300003374 Bacteria 10676
27 Ga0055532_1000877 3300003758 Bacteria 10052
28 Ga0055532_1000943 3300003758 Bacteria 9340
29 Ga0055532_1000954 3300003758 Bacteria 9294
30 Ga0055527_1000519 3300003760 Bacteria 13244
31 Ga0055535_1001606 3300003761 Bacteria 10646
32 Ga0055535_1001639 3300003761 Bacteria 10456
33 Ga0055542_1000010 3300003762 Bacteria 414813
34 Ga0055542_1001602 3300003762 Bacteria 10456
35 Ga0055542_1003684 3300003762 Bacteria 4022
36 Ga0055542_1004740 3300003762 Bacteria 3208
37 Ga0055529_1001193 3300003763 Bacteria 10456
38 Ga0055526_1005653 3300003771 Bacteria 7108
39 Ga0055524_1001701 3300003775 Bacteria 12261
40 Ga0055528_1000295 3300003790 Bacteria 42305
41 Ga0055528_1001484 3300003790 Bacteria 14245
42 Ga0055528_1005415 3300003790 Bacteria 5950
43 Ga0055540_1002714 3300003792 Bacteria 9116
44 Ga0058692_1014288 3300003856 Bacteria 1824
45 Ga0055543_1000079 3300004625 Bacteria 84916
46 Ga0055543_1000116 3300004625 Bacteria 67872
47 Ga0055543_1002291 3300004625 Bacteria 6462
48 Ga0065165_1000342 3300005262 Bacteria 76302
49 Ga0065165_1002903 3300005262 Bacteria 13143
50 Ga0065165_1015499 3300005262 Bacteria 2903
51 Ga0070658_10015167 3300005327 Bacteria 6165
52 Ga0070658_10284855 3300005327 Bacteria 1407
53 Ga0070670_100009469 3300005331 Bacteria 8317
54 Ga0068869_100041460 3300005334 Bacteria 3297
55 Ga0068869_100087992 3300005334 Bacteria 2331
56 Ga0068869_100313665 3300005334 Bacteria 1270
57 Ga0070666_10033261 3300005335 Bacteria 3411
58 Ga0070660_100000028 3300005339 Bacteria 88388
59 Ga0070661_100011514 3300005344 Bacteria 6160
60 Ga0070661_100177174 3300005344 Bacteria 1621
61 Ga0070661_100359670 3300005344 Bacteria 1144
62 Ga0070668_100015221 3300005347 Bacteria 5747
63 Ga0070668_100076807 3300005347 Bacteria 2610
64 Ga0070668_100207722 3300005347 Bacteria 1609
65 Ga0070669_100154739 3300005353 Bacteria 1777
66 Ga0070669_100169702 3300005353 Bacteria 1700
67 Ga0070671_100083124 3300005355 Bacteria 2677
68 Ga0070659_100000230 3300005366 Bacteria 43454
69 Ga0070667_100033812 3300005367 Bacteria 4277
70 Ga0070667_100070923 3300005367 Bacteria 2967
71 Ga0070709_10001293 3300005434 Bacteria 13650
72 Ga0070709_10026169 3300005434 Bacteria 3454
73 Ga0070714_100045562 3300005435 Bacteria 3717
74 Ga0070713_100009193 3300005436 Bacteria 7055
75 Ga0070713_100105880 3300005436 Bacteria 2444
76 Ga0070710_10000282 3300005437 Bacteria 24043
77 Ga0070710_10048697 3300005437 Bacteria 2368
78 Ga0070710_10129261 3300005437 Bacteria 1538
79 Ga0070711_100014925 3300005439 Bacteria 4907
80 Ga0070711_100020841 3300005439 Bacteria 4231
81 Ga0070700_100073840 3300005441 Bacteria 2184
82 Ga0070663_100000216 3300005455 Bacteria 28923
83 Ga0070663_100003063 3300005455 Bacteria 9558
84 Ga0070663_100009307 3300005455 Bacteria 6079
85 Ga0070663_100013377 3300005455 Bacteria 5230
86 Ga0070663_100023282 3300005455 Bacteria 4150
87 Ga0070663_100056771 3300005455 Bacteria 2806
88 Ga0070663_100201728 3300005455 Bacteria 1553
89 Ga0070663_100262618 3300005455 Bacteria 1370
90 Ga0070678_100026381 3300005456 Bacteria 3927
91 Ga0070662_100006917 3300005457 Bacteria 7342
92 Ga0070662_100007492 3300005457 Bacteria 7077
93 Ga0070681_10083981 3300005458 Bacteria 3137
94 Ga0068867_100320946 3300005459 Bacteria 1283
95 Ga0070706_100047916 3300005467 Bacteria 3944
96 Ga0070698_100051927 3300005471 Bacteria 4173
97 Ga0070698_100192896 3300005471 Bacteria 1974
98 Ga0070698_100208201 3300005471 Bacteria 1891
99 Ga0070699_100106617 3300005518 Bacteria 2458
100 Ga0070699_100274479 3300005518 Bacteria 1509
101 Ga0070697_100046077 3300005536 Bacteria 3534
102 Ga0068853_100024459 3300005539 Bacteria 5064
103 Ga0068853_100472962 3300005539 Bacteria 1181
104 Ga0070696_100026053 3300005546 Bacteria 3978
105 Ga0070665_100000465 3300005548 Bacteria 58821
106 Ga0070665_100000793 3300005548 Bacteria 41553
107 Ga0070665_100003470 3300005548 Bacteria 16799
108 Ga0070665_100006487 3300005548 Bacteria 11901
109 Ga0070665_100009232 3300005548 Bacteria 9990
110 Ga0070665_100033945 3300005548 Bacteria 5132
111 Ga0070665_100122974 3300005548 Bacteria 2597
112 Ga0070665_100166184 3300005548 Bacteria 2209
113 Ga0070665_100274058 3300005548 Bacteria 1689
114 Ga0070665_100497672 3300005548 Bacteria 1230
115 Ga0070704_100029684 3300005549 Bacteria 3655
116 Ga0068855_100177750 3300005563 Bacteria 2407
117 Ga0068855_100403082 3300005563 Bacteria 1498
118 Ga0068856_100173845 3300005614 Bacteria 2166
119 Ga0068852_100029923 3300005616 Bacteria 4477
120 Ga0068852_100192220 3300005616 Bacteria 1926
121 Ga0068852_100715927 3300005616 Bacteria 1012
122 Ga0068851_10002327 3300005834 Bacteria 8366
123 Ga0068858_100013390 3300005842 Bacteria 7741
124 Ga0068858_100163429 3300005842 Bacteria 2097
125 Ga0068860_100008667 3300005843 Bacteria 10130
126 Ga0081455_10001834 3300005937 Bacteria 25601
127 Ga0081455_10046002 3300005937 Bacteria 3792
128 Ga0081540_1001470 3300005983 Bacteria 20340
129 Ga0081540_1018480 3300005983 Bacteria 4274
130 Ga0081540_1027966 3300005983 Bacteria 3180
131 Ga0075365_10002818 3300006038 Bacteria 8709
132 Ga0075365_10038631 3300006038 Bacteria 3104
133 Ga0075365_10049969 3300006038 Bacteria 2757
134 Ga0075365_10227041 3300006038 Bacteria 1310
135 Ga0075368_10032175 3300006042 Bacteria 2036
136 Ga0075363_100043094 3300006048 Bacteria 2386
137 Ga0075363_100063664 3300006048 Bacteria 1991
138 Ga0075364_10020082 3300006051 Bacteria 4201
139 Ga0070716_100031962 3300006173 Bacteria 2867
140 Ga0070716_100112390 3300006173 Bacteria 1690
141 Ga0070712_100005683 3300006175 Bacteria 7713
142 Ga0070712_100016263 3300006175 Bacteria 4804
143 Ga0075362_10000364 3300006177 Bacteria 13059
144 Ga0075367_10001277 3300006178 Bacteria 10645
145 Ga0075367_10029255 3300006178 Bacteria 3150
146 Ga0075369_10002157 3300006186 Bacteria 6951
147 Ga0075369_10041456 3300006186 Bacteria 1971
148 Ga0075369_10093646 3300006186 Bacteria 1342
149 Ga0075366_10072738 3300006195 Bacteria 2049
150 Ga0097621_100186180 3300006237 Bacteria 1796
151 Ga0075370_10006671 3300006353 Bacteria 5823
152 Ga0075370_10140015 3300006353 Bacteria 1414
153 Ga0075433_10268737 3300006852 Bacteria 1511
154 Ga0075434_100002679 3300006871 Bacteria 15731
155 Ga0075435_100226431 3300007076 Bacteria 1588
156 Ga0099794_10006414 3300007265 Bacteria 4762
157 Ga0099794_10013003 3300007265 Bacteria 3611
158 Ga0099795_10003690 3300007788 Bacteria 3833
159 Ga0099795_10085262 3300007788 Bacteria 1215
160 Ga0105250_10019006 3300009092 Bacteria 2779
161 Ga0105250_10059574 3300009092 Bacteria 1533
162 Ga0105240_10000341 3300009093 Bacteria 87370
163 Ga0105240_10000342 3300009093 Bacteria 87277
164 Ga0105240_10001146 3300009093 Bacteria 46418
165 Ga0105240_10014261 3300009093 Bacteria 10855
166 Ga0105240_10070943 3300009093 Bacteria 4309
167 Ga0105240_10424370 3300009093 Bacteria 1493
168 Ga0105240_10545728 3300009093 Bacteria 1283
169 Ga0111539_10000323 3300009094 Bacteria 58458
170 Ga0105247_10014641 3300009101 Bacteria 4702
171 Ga0105241_10065423 3300009174 Bacteria 2809
172 Ga0105241_10074884 3300009174 Bacteria 2637
173 Ga0105248_10002720 3300009177 Bacteria 19640
174 Ga0105248_10079304 3300009177 Bacteria 3690
175 Ga0105248_10290790 3300009177 Bacteria 1840
176 Ga0105248_10793469 3300009177 Bacteria 1069
177 Ga0105237_10001621 3300009545 Bacteria 29218
178 Ga0105237_10004870 3300009545 Bacteria 15385
179 Ga0105237_10018112 3300009545 Bacteria 7291
180 Ga0105237_10115232 3300009545 Bacteria 2681
181 Ga0105237_10127179 3300009545 Bacteria 2542
182 Ga0105238_10008484 3300009551 Bacteria 10287
183 Ga0105238_10025999 3300009551 Bacteria 5966
184 Ga0105238_10075985 3300009551 Bacteria 3351
185 Ga0105249_10003500 3300009553 Bacteria 13584
186 Ga0105249_10007619 3300009553 Bacteria 9444
187 Ga0099796_10000249 3300010159 Bacteria 8540
188 Ga0099796_10000384 3300010159 Bacteria 7229
189 Ga0105239_10000041 3300010375 Bacteria 200922
190 Ga0105239_10078794 3300010375 Bacteria 3626
191 Ga0105239_10124392 3300010375 Bacteria 2865
192 Ga0105239_10125810 3300010375 Bacteria 2849
193 Ga0105239_10129037 3300010375 Bacteria 2811
194 Ga0105239_10723669 3300010375 Bacteria 1138
195 Ga0105239_10742197 3300010375 Bacteria 1123
196 Ga0157369_10112321 3300013105 Bacteria 2895
197 Ga0157369_10338869 3300013105 Bacteria 1562
198 Ga0157374_10228626 3300013296 Bacteria 1827
199 Ga0163162_10218463 3300013306 Bacteria 2036
200 Ga0157372_10030582 3300013307 Bacteria 5891
201 Ga0163163_10097654 3300014325 Bacteria 2958
202 Ga0157380_10369896 3300014326 Bacteria 1348
203 Ga0182008_10000113 3300014497 Bacteria 61507
204 Ga0157379_10376942 3300014968 Bacteria 1301
205 Ga0157376_10190878 3300014969 Bacteria 1879
206 Ga0157376_10441925 3300014969 Bacteria 1267
207 Ga0157376_10518203 3300014969 Bacteria 1175
208 Ga0182007_10000213 3300015262 Bacteria 38873
209 Ga0182007_10002329 3300015262 Bacteria 9531
210 Ga0182005_1019483 3300015265 Bacteria 1870
211 Ga0163161_10245615 3300017792 Bacteria 1394
212 Ga0163161_10399765 3300017792 Bacteria 1101
213 Ga0213873_10002417 3300021358 Bacteria 3234
214 Ga0213872_10003532 3300021361 Bacteria 8629
215 Ga0213872_10007554 3300021361 Bacteria 5338
216 Ga0213872_10008298 3300021361 Bacteria 5029
217 Ga0213872_10024946 3300021361 Bacteria 2749
218 Ga0213872_10024949 3300021361 Bacteria 2749
219 Ga0213872_10025083 3300021361 Bacteria 2741
220 Ga0213872_10032738 3300021361 Bacteria 2382
221 Ga0213872_10073990 3300021361 Bacteria 1534
222 Ga0213876_10001767 3300021384 Bacteria 13101
223 Ga0213876_10002100 3300021384 Bacteria 11787
224 Ga0209436_100066 3300025208 Bacteria 54510
225 Ga0209566_100904 3300025225 Bacteria 14153
226 Ga0209672_100019 3300025228 Bacteria 432215
227 Ga0209672_100069 3300025228 Bacteria 174956
228 Ga0209672_100149 3300025228 Bacteria 62756
229 Ga0209672_111727 3300025228 Bacteria 1119
230 Ga0209147_100026 3300025229 Bacteria 421622
231 Ga0209147_100044 3300025229 Bacteria 300330
232 Ga0209147_100128 3300025229 Bacteria 122259
233 Ga0207427_101592 3300025231 Bacteria 7781
234 Ga0209437_100180 3300025233 Bacteria 133661
235 Ga0209258_100031 3300025242 Bacteria 463572
236 Ga0209258_100079 3300025242 Bacteria 263132
237 Ga0209258_101986 3300025242 Bacteria 5931
238 Ga0209677_101975 3300025253 Bacteria 8152
239 Ga0209148_1000005 3300025254 Bacteria 1806504
240 Ga0209148_1000027 3300025254 Bacteria 616374
241 Ga0209148_1000474 3300025254 Bacteria 42596
242 Ga0209148_1000501 3300025254 Bacteria 39942
243 Ga0209148_1001447 3300025254 Bacteria 12057
244 Ga0209129_1000746 3300025258 Bacteria 20764
245 Ga0209129_1006000 3300025258 Bacteria 4079
246 Ga0209233_1008059 3300025261 Bacteria 3289
247 Ga0209233_1017507 3300025261 Bacteria 1950
248 Ga0209455_1000058 3300025272 Bacteria 342028
249 Ga0209455_1001131 3300025272 Bacteria 12961
250 Ga0209455_1007589 3300025272 Bacteria 3042
251 Ga0209455_1011491 3300025272 Bacteria 2176
252 Ga0209455_1012628 3300025272 Bacteria 2008
253 Ga0209673_1000059 3300025273 Bacteria 268892
254 Ga0209673_1000317 3300025273 Bacteria 88898
255 Ga0209673_1001545 3300025273 Bacteria 20787
256 Ga0209673_1014758 3300025273 Bacteria 3009
257 Ga0209130_1000022 3300025284 Bacteria 361244
258 Ga0209130_1000219 3300025284 Bacteria 74906
259 Ga0209025_1000017 3300025294 Bacteria 768983
260 Ga0209025_1015004 3300025294 Bacteria 4711
261 Ga0209025_1048211 3300025294 Bacteria 1730
262 Ga0209564_1000475 3300025295 Bacteria 67102
263 Ga0209564_1008300 3300025295 Bacteria 5151
264 Ga0209564_1012671 3300025295 Bacteria 3653
265 Ga0209564_1013563 3300025295 Bacteria 3447
266 Ga0209564_1026163 3300025295 Bacteria 1937
267 Ga0209758_1000209 3300025297 Bacteria 128038
268 Ga0209758_1000993 3300025297 Bacteria 37839
269 Ga0209758_1004616 3300025297 Bacteria 11306
270 Ga0209758_1007575 3300025297 Bacteria 7335
271 Ga0209758_1036904 3300025297 Bacteria 1899
272 Ga0209256_1000624 3300025299 Bacteria 48696
273 Ga0209256_1022273 3300025299 Bacteria 1922
274 Ga0207426_1000005 3300025302 Bacteria 1037188
275 Ga0207426_1000075 3300025302 Bacteria 321337
276 Ga0207426_1000237 3300025302 Bacteria 124707
277 Ga0207426_1017611 3300025302 Bacteria 2535
278 Ga0209257_1025778 3300025304 Bacteria 1999
279 Ga0209257_1036089 3300025304 Bacteria 1522
280 Ga0207697_10035703 3300025315 Bacteria 2036
281 Ga0207656_10005520 3300025321 Bacteria 4476
282 Ga0207696_1028831 3300025711 Bacteria 1699
283 Ga0207680_10023242 3300025903 Bacteria 3382
284 Ga0207647_10002100 3300025904 Bacteria 15252
285 Ga0207699_10001088 3300025906 Bacteria 12830
286 Ga0207699_10003950 3300025906 Bacteria 7089
287 Ga0207705_10029474 3300025909 Bacteria 3912
288 Ga0207684_10170437 3300025910 Bacteria 1876
289 Ga0207707_10043307 3300025912 Bacteria 3927
290 Ga0207695_10000006 3300025913 Bacteria 1135309
291 Ga0207695_10000311 3300025913 Bacteria 117484
292 Ga0207695_10003507 3300025913 Bacteria 21992
293 Ga0207695_10005152 3300025913 Bacteria 17506
294 Ga0207695_10023432 3300025913 Bacteria 6976
295 Ga0207695_10224149 3300025913 Bacteria 1787
296 Ga0207695_10268825 3300025913 Bacteria 1601
297 Ga0207695_10325826 3300025913 Bacteria 1425
298 Ga0207671_10013654 3300025914 Bacteria 6456
299 Ga0207671_10020670 3300025914 Bacteria 5008
300 Ga0207671_10022161 3300025914 Bacteria 4806
301 Ga0207693_10001127 3300025915 Bacteria 23971
302 Ga0207693_10008068 3300025915 Bacteria 8634
303 Ga0207693_10024818 3300025915 Bacteria 4754
304 Ga0207693_10036970 3300025915 Bacteria 3849
305 Ga0207693_10039700 3300025915 Bacteria 3706
306 Ga0207663_10050175 3300025916 Bacteria 2592
307 Ga0207663_10229202 3300025916 Bacteria 1356
308 Ga0207657_10000001 3300025919 Bacteria 458536
309 Ga0207657_10048295 3300025919 Bacteria 3716
310 Ga0207694_10037967 3300025924 Bacteria 3702
311 Ga0207694_10080842 3300025924 Bacteria 2551
312 Ga0207694_10233506 3300025924 Bacteria 1502
313 Ga0207687_10260462 3300025927 Bacteria 1382
314 Ga0207700_10005940 3300025928 Bacteria 7345
315 Ga0207664_10008161 3300025929 Bacteria 7289
316 Ga0207644_10040268 3300025931 Bacteria 3302
317 Ga0207690_10000072 3300025932 Bacteria 88241
318 Ga0207706_10001636 3300025933 Bacteria 22180
319 Ga0207706_10013352 3300025933 Bacteria 7472
320 Ga0207706_10141303 3300025933 Bacteria 2118
321 Ga0207665_10024914 3300025939 Bacteria 3947
322 Ga0207711_10035431 3300025941 Bacteria 4230
323 Ga0207711_10145182 3300025941 Bacteria 2137
324 Ga0207711_10578020 3300025941 Bacteria 1048
325 Ga0207689_10002319 3300025942 Bacteria 17836
326 Ga0207689_10153144 3300025942 Bacteria 1900
327 Ga0207667_10036160 3300025949 Bacteria 5294
328 Ga0207712_10001146 3300025961 Bacteria 18465
329 Ga0207668_10009192 3300025972 Bacteria 5912
330 Ga0207668_10073416 3300025972 Bacteria 2452
331 Ga0207658_10017385 3300025986 Bacteria 4954
332 Ga0207703_10011514 3300026035 Bacteria 6880
333 Ga0207703_10056162 3300026035 Bacteria 3205
334 Ga0207678_10000697 3300026067 Bacteria 30609
335 Ga0207678_10001112 3300026067 Bacteria 24644
336 Ga0207678_10007805 3300026067 Bacteria 9447
337 Ga0207678_10026489 3300026067 Bacteria 5057
338 Ga0207678_10030234 3300026067 Bacteria 4728
339 Ga0207678_10127615 3300026067 Bacteria 2170
340 Ga0207678_10279687 3300026067 Bacteria 1432
341 Ga0207641_10130925 3300026088 Bacteria 2253
342 Ga0207648_10245169 3300026089 Bacteria 1596
343 Ga0207676_10110660 3300026095 Bacteria 2298
344 Ga0207674_10046570 3300026116 Bacteria 4452
345 Ga0207675_100000292 3300026118 Bacteria 48260
346 Ga0207683_10014794 3300026121 Bacteria 6641
347 Ga0207698_10090754 3300026142 Bacteria 2499
348 Ga0207698_10112822 3300026142 Bacteria 2282
349 Ga0209371_1000243 3300027312 Bacteria 67855
350 Ga0209371_1002714 3300027312 Bacteria 9553
351 Ga0209813_10005348 3300027866 Bacteria 3111
352 Ga0207428_10000129 3300027907 Bacteria 104467
353 Ga0268266_10000006 3300028379 Bacteria 1410021
354 Ga0268266_10005075 3300028379 Bacteria 12419
355 Ga0268266_10005250 3300028379 Bacteria 12165
356 Ga0268266_10019103 3300028379 Bacteria 5836
357 Ga0268266_10123974 3300028379 Bacteria 2303
358 Ga0268266_10179319 3300028379 Bacteria 1928
359 Ga0268266_10182538 3300028379 Bacteria 1911
360 Ga0268266_10283756 3300028379 Bacteria 1540
361 Ga0268265_10256241 3300028380 Bacteria 1553
362 Ga0268265_10346620 3300028380 Bacteria 1354
363 Ga0268264_10032783 3300028381 Bacteria 4263
364 Ga0307517_10079028 3300028786 Bacteria 2836
365 Ga0268256_1000311 3300030500 Bacteria 48691
366 Ga0268256_1013457 3300030500 Bacteria 2478
367 Ga0265328_10017462 3300031239 Bacteria 2778
368 Ga0307513_10106028 3300031456 Bacteria 2818
369 Ga0265314_10025261 3300031711 Bacteria 4486
370 Ga0265314_10026992 3300031711 Bacteria 4306
371 Ga0307516_10000173 3300031730 Bacteria 82288
372 Ga0307405_10030843 3300031731 Bacteria 3148
373 Ga0307413_10025312 3300031824 Bacteria 3252
374 Ga0307413_10162626 3300031824 Bacteria 1570
375 Ga0307410_10138330 3300031852 Bacteria 1798
376 Ga0307406_10351960 3300031901 Bacteria 1151
377 Ga0307409_100042599 3300031995 Bacteria 3401
378 Ga0307415_100150779 3300032126 Bacteria 1789
379 Ga0307510_10035936 3300033180 Bacteria 5522
380 Ga0395898_0344890 3300037466 Bacteria 1420
381 Ga0395905_0065152 3300037471 Bacteria 3411
382 Ga0436364_0645114 3300037853 Bacteria 6882
383 Ga0395901_0511904 3300038443 Bacteria 1221
384 Ga0436365_0657193 3300039437 Bacteria 19204
385 Ga0436365_1279257 3300039437 Bacteria 36311
386 Ga0436365_1865621 3300039437 Bacteria 2658
387 Ga0436365_1925227 3300039437 Bacteria 1577
388 Ga0436360_0695279 3300039438 Bacteria 4157
389 Ga0436361_0013669 3300039447 Bacteria 8479
390 Ga0436361_0113928 3300039447 Bacteria 16446
391 Ga0436361_0176654 3300039447 Bacteria 6986
392 Ga0436361_0254950 3300039447 Bacteria 2530
393 Ga0436361_0373700 3300039447 Bacteria 30841
394 Ga0436361_0438759 3300039447 Bacteria 2234
395 Ga0436361_0556055 3300039447 Bacteria 1514
396 Ga0436361_0573801 3300039447 Bacteria 1410
397 Ga0436361_0578085 3300039447 Bacteria 1885
398 Ga0436361_0853741 3300039447 Bacteria 2548
399 Ga0436361_0864205 3300039447 Bacteria 6339
400 Ga0436361_0867606 3300039447 Bacteria 1109
401 Ga0436361_0878764 3300039447 Bacteria 1241
402 Ga0436362_0775664 3300039453 Bacteria 3592
403 Ga0451791_0877780 3300041451 Bacteria 1383
404 Ga0451807_1909073 3300041486 Bacteria 1382
405 Ga0451807_1989451 3300041486 Bacteria 1331
406 Ga0451853_2623033 3300041512 Bacteria 1130
407 Ga0439445_0069422 3300042004 Bacteria 973
408 Ga0439459_0020950 3300042438 Bacteria 1251
409 Ga0466972_0014613 3300044658 Bacteria 3930
410 Ga0466972_0101415 3300044658 Bacteria 1362
411 Ga0466966_0086206 3300044684 Bacteria 1952
412 Ga0466964_0044554 3300044706 Bacteria 1802
413 Ga0466968_0002924 3300044735 Bacteria 6310
414 Ga0466960_0000523 3300044901 Bacteria 13157
415 Ga0466959_0059664 3300045049 Bacteria 2778
416 Ga0495603_0125792 3300046455 Bacteria 1494
417 Ga0495603_0136956 3300046455 Bacteria 1425
418 Ga0495629_0030964 3300046459 Bacteria 3790
419 Ga0495638_0000009 3300046460 Bacteria 525345
420 Ga0495638_0000019 3300046460 Bacteria 384671
421 Ga0495638_0000087 3300046460 Bacteria 152531
422 Ga0495638_0002575 3300046460 Bacteria 14674
423 Ga0495638_0015368 3300046460 Bacteria 5142
424 Ga0495638_0059152 3300046460 Bacteria 2374
425 Ga0495651_0248764 3300046462 Bacteria 1215
426 Ga0495650_0000122 3300046471 Bacteria 182888
427 Ga0495607_0000153 3300046501 Bacteria 72099
428 Ga0495606_0000056 3300046507 Bacteria 198575
429 Ga0495606_0055014 3300046507 Bacteria 2575
430 Ga0495606_0076189 3300046507 Bacteria 2097
431 Ga0495606_0110303 3300046507 Bacteria 1661
432 Ga0495608_0021552 3300046511 Bacteria 4422
433 Ga0495610_0002011 3300046512 Bacteria 17382
434 Ga0495610_0049377 3300046512 Bacteria 2061
435 Ga0495618_0214160 3300046514 Bacteria 1217
436 Ga0495620_0040402 3300046515 Bacteria 2053
437 Ga0495628_0195993 3300046516 Bacteria 1524
438 Ga0495643_0082518 3300046522 Bacteria 1670
439 Ga0495648_0063920 3300046524 Bacteria 2170
440 Ga0495648_0096282 3300046524 Bacteria 1645
441 Ga0495648_0099119 3300046524 Bacteria 1613
442 Ga0495622_0004123 3300046557 Bacteria 6778
443 Ga0495622_0052407 3300046557 Bacteria 1893
444 Ga0495622_0089882 3300046557 Bacteria 1411
445 Ga0495633_0006338 3300046558 Bacteria 7037
446 Ga0495668_0022905 3300046616 Bacteria 3567
447 Ga0495668_0045777 3300046616 Bacteria 2432
448 Ga0495611_0019278 3300046648 Bacteria 2929
449 Ga0495625_0191804 3300046660 Bacteria 1353
450 Ga0495635_0110071 3300046663 Bacteria 1882
451 Ga0495588_0017345 3300046674 Bacteria 3494
452 Ga0495588_0182175 3300046674 Bacteria 1110
453 Ga0495657_0012111 3300046675 Bacteria 6418
454 Ga0495669_0095275 3300046684 Bacteria 1378
455 Ga0495624_0043274 3300046690 Bacteria 2873
456 Ga0495649_0000266 3300046694 Bacteria 46547
457 Ga0495649_0025343 3300046694 Bacteria 3303
458 Ga0495649_0115837 3300046694 Bacteria 1419
459 Ga0495589_0061400 3300046794 Bacteria 1845
460 Ga0495600_0006748 3300046809 Bacteria 6996
461 Ga0495604_0059741 3300047317 Bacteria 2921
462 Ga0495604_0062128 3300047317 Bacteria 2855
463 Ga0495672_0017814 3300047320 Bacteria 4739
464 Ga0495672_0037889 3300047320 Bacteria 2947
465 Ga0495672_0067556 3300047320 Bacteria 2036
466 Ga0495676_0076376 3300047321 Bacteria 2558
467 Ga0495683_0057977 3300047323 Bacteria 1924
468 Ga0495687_041587 3300047443 Bacteria 2015
469 Ga0495673_0006912 3300047469 Bacteria 6608
470 Ga0495673_0030030 3300047469 Bacteria 2559
471 Ga0495673_0037110 3300047469 Bacteria 2229
472 Ga0495686_0000082 3300047472 Bacteria 200115
473 Ga0495686_0000115 3300047472 Bacteria 166876
474 Ga0495686_0001009 3300047472 Bacteria 34155
475 Ga0495686_0002800 3300047472 Bacteria 15833
476 Ga0495686_0084900 3300047472 Bacteria 1929
477 Ga0495686_0117141 3300047472 Bacteria 1592
478 Ga0495686_0165502 3300047472 Bacteria 1289
479 Ga0495602_0160008 3300048088 Bacteria 1759
480 Ga0495626_0022209 3300048091 Bacteria 3136
481 Ga0495626_0030480 3300048091 Bacteria 2602
482 Ga0496100_0011936 3300048903 Bacteria 4964
483 Ga0496100_0204274 3300048903 Bacteria 1442
484 Ga0496100_0332260 3300048903 Bacteria 1144
485 Ga0496101_0007946 3300048904 Bacteria 6911
486 Ga0496102_0030791 3300048905 Bacteria 4805
487 Ga0496102_0184978 3300048905 Bacteria 1963
488 Ga0496103_0031700 3300048906 Bacteria 3222
489 Ga0496103_0182758 3300048906 Bacteria 1348
490 Ga0496104_0012050 3300048907 Bacteria 7761
491 Ga0496104_0026005 3300048907 Bacteria 5398
492 Ga0496104_0026950 3300048907 Bacteria 5313
493 Ga0496104_0339040 3300048907 Bacteria 1416
494 Ga0496104_0434192 3300048907 Bacteria 1225
495 Ga0496105_0001350 3300048908 Bacteria 17227
496 Ga0496105_0016203 3300048908 Bacteria 5946
497 Ga0496105_0236866 3300048908 Bacteria 1482
498 Ga0496106_0001156 3300048909 Bacteria 19573
499 Ga0496106_0023403 3300048909 Bacteria 4589
500 Ga0496106_0250532 3300048909 Bacteria 1416
501 Ga0496107_0017737 3300048910 Bacteria 5010
502 Ga0496107_0092308 3300048910 Bacteria 2213
503 Ga0496107_0368365 3300048910 Bacteria 1069
504 Ga0496108_0291011 3300048911 Bacteria 1422
505 Ga0496110_0122095 3300048913 Bacteria 2348
506 Ga0496110_0170925 3300048913 Bacteria 1972
507 Ga0496110_0429567 3300048913 Bacteria 1204
508 Ga0496112_0087933 3300048915 Bacteria 3075
509 Ga0496112_0260247 3300048915 Bacteria 1684
510 Ga0496113_0082330 3300048916 Bacteria 2468
511 Ga0496113_0250350 3300048916 Bacteria 1414
512 Ga0496114_0022782 3300048917 Bacteria 5105
513 Ga0496114_0119050 3300048917 Bacteria 2270
514 Ga0496114_0262885 3300048917 Bacteria 1520
515 Ga0496115_0000046 3300048918 Bacteria 112212
516 Ga0496115_0024882 3300048918 Bacteria 4656
517 Ga0496115_0037934 3300048918 Bacteria 3821
518 Ga0496115_0053435 3300048918 Bacteria 3242
519 Ga0496116_0001677 3300048919 Bacteria 24306
520 Ga0496116_0010236 3300048919 Bacteria 7886
521 Ga0496116_0063653 3300048919 Bacteria 2375
522 Ga0496116_0070663 3300048919 Bacteria 2214
523 Ga0496116_0085461 3300048919 Bacteria 1939
524 Ga0496117_0004582 3300048920 Bacteria 15118
525 Ga0496117_0020523 3300048920 Bacteria 5381
526 Ga0496117_0096802 3300048920 Bacteria 1882
527 Ga0496117_0106887 3300048920 Bacteria 1755
528 Ga0496117_0145123 3300048920 Bacteria 1414
529 Ga0496118_0000994 3300048921 Bacteria 44167
530 Ga0496118_0008990 3300048921 Bacteria 10191
531 Ga0496118_0010661 3300048921 Bacteria 9066
532 Ga0496118_0010965 3300048921 Bacteria 8906
533 Ga0496118_0023061 3300048921 Bacteria 5419
534 Ga0496118_0074173 3300048921 Bacteria 2433
535 Ga0496119_0000191 3300048922 Bacteria 86355
536 Ga0496119_0002194 3300048922 Bacteria 21820
537 Ga0496119_0004102 3300048922 Bacteria 14685
538 Ga0496119_0046340 3300048922 Bacteria 2716
539 Ga0496119_0057536 3300048922 Bacteria 2349
540 Ga0496119_0088763 3300048922 Bacteria 1762
541 Ga0496119_0104136 3300048922 Bacteria 1588
542 Ga0496119_0147182 3300048922 Bacteria 1266
543 Ga0496120_0000321 3300048923 Bacteria 79469
544 Ga0496120_0000350 3300048923 Bacteria 75997
545 Ga0496120_0014557 3300048923 Bacteria 5236
546 Ga0496120_0180120 3300048923 Bacteria 1038
547 Ga0496121_0000013 3300048924 Bacteria 614976
548 Ga0496121_0000022 3300048924 Bacteria 472849
549 Ga0496121_0000091 3300048924 Bacteria 216685
550 Ga0496121_0000523 3300048924 Bacteria 73281
551 Ga0496121_0001346 3300048924 Bacteria 41986
552 Ga0496121_0009992 3300048924 Bacteria 10791
553 Ga0496121_0016618 3300048924 Bacteria 7583
554 Ga0496121_0018898 3300048924 Bacteria 6917
555 Ga0496121_0020649 3300048924 Bacteria 6502
556 Ga0496121_0021639 3300048924 Bacteria 6288
557 Ga0496121_0027463 3300048924 Bacteria 5326
558 Ga0496121_0027976 3300048924 Bacteria 5263
559 Ga0496121_0037444 3300048924 Bacteria 4308
560 Ga0496121_0043315 3300048924 Bacteria 3900
561 Ga0496121_0049552 3300048924 Bacteria 3560
562 Ga0496121_0094143 3300048924 Bacteria 2331
563 Ga0496121_0105968 3300048924 Bacteria 2156
564 Ga0496121_0333505 3300048924 Bacteria 1016
565 Ga0496122_0004397 3300048925 Bacteria 17546
566 Ga0496122_0014172 3300048925 Bacteria 7730
567 Ga0496122_0043901 3300048925 Bacteria 3497
568 Ga0496122_0148094 3300048925 Bacteria 1455
569 Ga0496123_0004520 3300048926 Bacteria 14540
570 Ga0496123_0105700 3300048926 Bacteria 1624
571 Ga0496124_0000004 3300048927 Bacteria 976131
572 Ga0496124_0007731 3300048927 Bacteria 11364
573 Ga0496124_0055978 3300048927 Bacteria 3330
574 Ga0496124_0076382 3300048927 Bacteria 2765
575 Ga0496124_0285366 3300048927 Bacteria 1201
576 Ga0496125_0003653 3300048928 Bacteria 18409
577 Ga0496125_0006913 3300048928 Bacteria 12147
578 Ga0496125_0072614 3300048928 Bacteria 2680
579 Ga0496125_0143595 3300048928 Bacteria 1655
580 Ga0496126_0001231 3300048929 Bacteria 41618
581 Ga0496126_0006108 3300048929 Bacteria 13507
582 Ga0496126_0010532 3300048929 Bacteria 9682
583 Ga0496126_0012983 3300048929 Bacteria 8502
584 Ga0496126_0016215 3300048929 Bacteria 7462
585 Ga0496126_0016512 3300048929 Bacteria 7379
586 Ga0496126_0031271 3300048929 Bacteria 5032
587 Ga0496126_0061981 3300048929 Bacteria 3357
588 Ga0496126_0073507 3300048929 Bacteria 3039
589 Ga0496126_0077646 3300048929 Bacteria 2943
590 Ga0496126_0090220 3300048929 Bacteria 2697
591 Ga0496126_0115683 3300048929 Bacteria 2331
592 Ga0496126_0147537 3300048929 Bacteria 2019
593 Ga0495682_0118812 3300049460 Bacteria 947
594 Ga0501032_0007464 3300049569 Bacteria 7987
595 Ga0501043_0003245 3300049579 Bacteria 13416
596 Ga0501047_0000197 3300049581 Bacteria 72751
597 Ga0501048_0106838 3300049582 Bacteria 1976
598 nmdc:mga03683_526_c1 3300050489 Bacteria 10955
599 nmdc:mga03n38_154063_c1 3300050490 Bacteria 1159
600 nmdc:mga00v17_290579_c1 3300050491 Bacteria 1061
601 nmdc:mga0yw44_2128_c1 3300050492 Bacteria 8301
602 nmdc:mga0yw44_5700_c1 3300050492 Bacteria 5929
603 nmdc:mga0yw44_74583_c1 3300050492 Bacteria 2113
604 nmdc:mga0k408_165090_c1 3300050493 Bacteria 1319
605 nmdc:mga0k408_42731_c1 3300050493 Bacteria 2610
606 nmdc:mga06z11_1300_c1 3300050494 Bacteria 9231
607 nmdc:mga06z11_1614_c1 3300050494 Bacteria 8419
608 nmdc:mga07m45_4015_c1 3300050496 Bacteria 7162
609 nmdc:mga07m45_85991_c1 3300050496 Bacteria 1798
610 nmdc:mga08y16_51_c1 3300050511 Bacteria 105348
611 nmdc:mga0n895_3215_c1 3300050512 Bacteria 13079
612 nmdc:mga0rr50_25604_c1 3300050513 Bacteria 4104
613 nmdc:mga0sz30_15_c1 3300050516 Bacteria 83405
614 Ga0500610_0029902 3300053079 Bacteria 2756
615 Ga0500635_0011635 3300053080 Bacteria 2507
616 Ga0500643_000097 3300053087 Bacteria 92120
617 Ga0500643_005357 3300053087 Bacteria 5544
618 Ga0500644_0108065 3300053088 Bacteria 1067
619 Ga0500566_0000029 3300053094 Bacteria 75384
620 Ga0500640_045153 3300053095 Bacteria 1933
621 Ga0500555_009080 3300053103 Bacteria 2840
622 Ga0500572_002243 3300053111 Bacteria 4717
623 Ga0500594_0042786 3300053118 Bacteria 1246
624 Ga0500595_001774 3300053119 Bacteria 11225
625 Ga0500595_002719 3300053119 Bacteria 8565
626 Ga0500595_003102 3300053119 Bacteria 7868
627 Ga0500595_003885 3300053119 Bacteria 6859
628 Ga0500608_036746 3300053122 Bacteria 2339
629 Ga0500618_025929 3300053125 Bacteria 1402
630 Ga0500559_0027379 3300053136 Bacteria 2433
631 Ga0500564_016690 3300053138 Bacteria 3328
632 Ga0500568_0000082 3300053139 Bacteria 92308
633 Ga0500568_0005342 3300053139 Bacteria 6656
634 Ga0500568_0024552 3300053139 Bacteria 2551
635 Ga0500568_0031679 3300053139 Bacteria 2180
636 Ga0500577_0096614 3300053142 Bacteria 1202
637 Ga0500619_006051 3300053154 Bacteria 2754
638 Ga0500622_0002004 3300053156 Bacteria 15220
639 Ga0500638_027971 3300053162 Bacteria 2708
640 Ga0500636_0000420 3300053177 Bacteria 23339
641 Ga0500636_0002621 3300053177 Bacteria 9991
642 Ga0500645_000065 3300053730 Bacteria 82414
643 Ga0500601_000525 3300053737 Bacteria 5772
644 Ga0500661_003363 3300055283 Bacteria 3009

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2904578770 2904582770 242
2 3300042438 Ga0439459_0020950 Ga0439459_0020950_461_1240 244
3 3300050492 nmdc:mga0yw44_74583_c1 nmdc:mga0yw44_74583_c1_41_820 244
4 3300039453 Ga0436362_0775664 Ga0436362_0775664_31_837 249
5 3300047317 Ga0495604_0062128 Ga0495604_0062128_1318_2109 249
6 3300053136 Ga0500559_0027379 Ga0500559_0027379_1625_2416 249
7 3300042004 Ga0439445_0069422 Ga0439445_0069422_11_811 251
8 3300048919 Ga0496116_0063653 Ga0496116_0063653_1533_2339 253
9 iso_pu_bacteria 2928963466 2928963723 256
10 3300053125 Ga0500618_025929 Ga0500618_025929_25_852 257
11 iso_pu_bacteria 2874590934 2874594164 261
12 iso_pu_bacteria 2874645413 2874651936 261
13 iso_pu_bacteria 2876771140 2876773608 261
14 iso_pu_bacteria 2876818435 2876824764 261
15 iso_pu_bacteria 2879074833 2879081491 261
16 3300048903 Ga0496100_0011936 Ga0496100_0011936_27_875 267
17 3300048910 Ga0496107_0368365 Ga0496107_0368365_71_919 267
18 3300048922 Ga0496119_0004102 Ga0496119_0004102_891_1742 267
19 3300010375 Ga0105239_10078794 Ga0105239_100787943 268
20 3300046455 Ga0495603_0136956 Ga0495603_0136956_102_1028 268
21 3300048920 Ga0496117_0106887 Ga0496117_0106887_38_889 268
22 3300047472 Ga0495686_0084900 Ga0495686_0084900_25_885 269
23 iso_pu_bacteria 8019538911 8019544658 269
24 3300003187 JGI25151J46595_10000052 JGI25151J46595_10000052140 275
25 3300025294 Ga0209025_1000017 Ga0209025_100001728 275
26 3300048924 Ga0496121_0000022 Ga0496121_0000022_290612_291511 275
27 iso_pu_bacteria 2765235802 2765469232 278
28 3300021384 Ga0213876_10002100 Ga0213876_100021005 279
29 3300037466 Ga0395898_0344890 Ga0395898_0344890_229_1158 279
30 3300039437 Ga0436365_0657193 Ga0436365_0657193_10058_10996 279
31 3300047472 Ga0495686_0001009 Ga0495686_0001009_28793_29728 279
32 3300025295 Ga0209564_1012671 Ga0209564_10126715 280
33 iso_pu_bacteria 2874102143 2874106566 280
34 iso_pu_bacteria 2958092219 2958094602 280
35 3300007265 Ga0099794_10006414 Ga0099794_100064142 281
36 3300048913 Ga0496110_0429567 Ga0496110_0429567_25_912 281
37 3300021361 Ga0213872_10003532 Ga0213872_100035323 282
38 3300021361 Ga0213872_10007554 Ga0213872_100075542 282
39 3300021361 Ga0213872_10024946 Ga0213872_100249463 282
40 3300021361 Ga0213872_10024949 Ga0213872_100249493 282
41 3300021361 Ga0213872_10025083 Ga0213872_100250833 282
42 3300039447 Ga0436361_0013669 Ga0436361_0013669_620_1510 282
43 3300039447 Ga0436361_0254950 Ga0436361_0254950_1618_2508 282
44 3300039447 Ga0436361_0573801 Ga0436361_0573801_373_1263 282
45 3300039447 Ga0436361_0853741 Ga0436361_0853741_323_1213 282
46 3300039447 Ga0436361_0878764 Ga0436361_0878764_231_1121 282
47 iso_pu_bacteria 2602042107 2603860183 282
48 3300025915 Ga0207693_10036970 Ga0207693_100369705 283
49 3300039437 Ga0436365_1865621 Ga0436365_1865621_1483_2415 283
50 3300047320 Ga0495672_0037889 Ga0495672_0037889_1970_2866 283
51 iso_pu_bacteria 2508501042 2508693070 283
52 iso_pu_bacteria 2513237095 2513649323 283
53 iso_pu_bacteria 2513237104 2513721372 283
54 iso_pu_bacteria 2515154112 2515630077 283
55 iso_pu_bacteria 2524023205 2524441257 283
56 iso_pu_bacteria 2524023228 2524539456 283
57 iso_pu_bacteria 2528768022 2528851737 283
58 iso_pu_bacteria 2615840698 2616555367 283
59 iso_pu_bacteria 2617270742 2617382439 283
60 iso_pu_bacteria 2667528175 2671118197 283
61 iso_pu_bacteria 2744054633 2745082191 283
62 iso_pu_bacteria 2816332527 2818240713 283
63 iso_pu_bacteria 2818991448 2819608138 283
64 iso_pu_bacteria 2824661429 2824668183 283
65 iso_pu_bacteria 2824773399 2824777821 283
66 iso_pu_bacteria 2841949485 2841954919 283
67 iso_pu_bacteria 2841974524 2841980359 283
68 iso_pu_bacteria 2841983080 2841988525 283
69 iso_pu_bacteria 2879099564 2879105199 283
70 iso_pu_bacteria 2888378607 2888380319 283
71 iso_pu_bacteria 2904699407 2904706999 283
72 iso_pu_bacteria 2922368715 2922371706 283
73 iso_pu_bacteria 2932784394 2932790661 283
74 iso_pu_bacteria 2932809354 2932811858 283
75 iso_pu_bacteria 2932818245 2932822656 283
76 iso_pu_bacteria 2932828146 2932835558 283
77 iso_pu_bacteria 2935616580 2935624712 283
78 iso_pu_bacteria 2935638405 2935646157 283
79 iso_pu_bacteria 2935665750 2935670726 283
80 iso_pu_bacteria 2935675223 2935679535 283
81 iso_pu_bacteria 2935675223 2935683580 283
82 iso_pu_bacteria 2935684952 2935691449 283
83 iso_pu_bacteria 2935684952 2935693457 283
84 iso_pu_bacteria 2935694250 2935701904 283
85 iso_pu_bacteria 2935703347 2935704519 283
86 iso_pu_bacteria 2935713505 2935719283 283
87 iso_pu_bacteria 2935713505 2935721647 283
88 iso_pu_bacteria 2935722832 2935729117 283
89 iso_pu_bacteria 2935722832 2935731023 283
90 iso_pu_bacteria 2935732158 2935737642 283
91 iso_pu_bacteria 2935732158 2935740786 283
92 iso_pu_bacteria 2935741537 2935747018 283
93 iso_pu_bacteria 2935741537 2935750050 283
94 iso_pu_bacteria 2935750917 2935758182 283
95 iso_pu_bacteria 2935750917 2935759440 283
96 iso_pu_bacteria 2935760218 2935768859 283
97 iso_pu_bacteria 2935760218 2935769224 283
98 iso_pu_bacteria 2935801545 2935809151 283
99 iso_pu_bacteria 2935810662 2935816495 283
100 iso_pu_bacteria 2935827899 2935835465 283
101 iso_pu_bacteria 2935837841 2935845771 283
102 iso_pu_bacteria 2935855204 2935863375 283
103 iso_pu_bacteria 2935864058 2935871451 283
104 iso_pu_bacteria 2935873716 2935881700 283
105 iso_pu_bacteria 2935975950 2935981821 283
106 iso_pu_bacteria 2935992306 2935993880 283
107 iso_pu_bacteria 2936002035 2936009694 283
108 iso_pu_bacteria 2936037263 2936042553 283
109 iso_pu_bacteria 2940556831 2940563907 283
110 iso_pu_bacteria 2940556831 2940565344 283
111 iso_pu_bacteria 2941538514 2941545945 283
112 iso_pu_bacteria 3005416602 3005420925 283
113 iso_pu_bacteria 3005594810 3005595763 283
114 iso_pu_bacteria 8005314921 8005319340 283
115 iso_pu_bacteria 8005484373 8005487796 283
116 iso_pu_bacteria 8005645114 8005650284 283
117 iso_pu_bacteria 8005682033 8005685754 283
118 iso_pu_bacteria 8006933436 8006934781 283
119 iso_pu_bacteria 8006973647 8006974749 283
120 iso_pu_bacteria 8016511872 8016516050 283
121 iso_pu_bacteria 8017057580 8017060466 283
122 iso_pu_bacteria 8019576017 8019579942 283
123 iso_pu_bacteria 8019586578 8019587654 283
124 iso_pu_bacteria 8019597564 8019603674 283
125 iso_pu_bacteria 8019608314 8019614853 283
126 iso_pu_bacteria 8019629233 8019629577 283
127 iso_pu_bacteria 8019638758 8019648779 283
128 iso_pu_bacteria 8019659431 8019659783 283
129 iso_pu_bacteria 8019668869 8019669165 283
130 iso_pu_bacteria 8019678201 8019678237 283
131 3300003320 rootH2_10005012 rootH2_100050123 284
132 3300003323 rootH1_10109858 rootH1_101098584 284
133 3300003856 Ga0058692_1014288 Ga0058692_10142883 284
134 3300005437 Ga0070710_10129261 Ga0070710_101292612 284
135 3300005455 Ga0070663_100201728 Ga0070663_1002017282 284
136 3300005548 Ga0070665_100274058 Ga0070665_1002740582 284
137 3300005937 Ga0081455_10001834 Ga0081455_100018346 284
138 3300006038 Ga0075365_10002818 Ga0075365_100028189 284
139 3300006186 Ga0075369_10002157 Ga0075369_100021574 284
140 3300026067 Ga0207678_10279687 Ga0207678_102796871 284
141 3300027312 Ga0209371_1002714 Ga0209371_10027143 284
142 3300030500 Ga0268256_1013457 Ga0268256_10134573 284
143 3300037853 Ga0436364_0645114 Ga0436364_0645114_2633_3559 284
144 3300046558 Ga0495633_0006338 Ga0495633_0006338_518_1420 284
145 3300047472 Ga0495686_0000115 Ga0495686_0000115_65599_66498 284
146 3300048919 Ga0496116_0001677 Ga0496116_0001677_15402_16304 284
147 3300048920 Ga0496117_0145123 Ga0496117_0145123_240_1142 284
148 3300048921 Ga0496118_0074173 Ga0496118_0074173_513_1415 284
149 3300048924 Ga0496121_0016618 Ga0496121_0016618_6231_7133 284
150 3300048925 Ga0496122_0014172 Ga0496122_0014172_5541_6443 284
151 3300048927 Ga0496124_0055978 Ga0496124_0055978_1615_2517 284
152 3300048928 Ga0496125_0003653 Ga0496125_0003653_9586_10488 284
153 3300049569 Ga0501032_0007464 Ga0501032_0007464_256_1164 284
154 3300049579 Ga0501043_0003245 Ga0501043_0003245_3726_4634 284
155 3300049581 Ga0501047_0000197 Ga0501047_0000197_26876_27784 284
156 3300049582 Ga0501048_0106838 Ga0501048_0106838_201_1109 284
157 3300050496 nmdc:mga07m45_85991_c1 nmdc:mga07m45_85991_c1_477_1388 284
158 iso_pu_bacteria 2508501128 2509149468 284
159 iso_pu_bacteria 2643221595 2643983746 284
160 iso_pu_bacteria 2643221627 2644155879 284
161 iso_pu_bacteria 2808606384 2808970252 284
162 iso_pu_bacteria 2808606390 2809004902 284
163 iso_pu_bacteria 2808606391 2809011958 284
164 iso_pu_bacteria 2842205361 2842211410 284
165 iso_pu_bacteria 2842278818 2842284867 284
166 iso_pu_bacteria 2869162929 2869163306 284
167 iso_pu_bacteria 2881161766 2881167252 284
168 iso_pu_bacteria 2919450847 2919455779 284
169 iso_pu_bacteria 2923556063 2923559079 284
170 3300002987 JGI25159J45721_1000678 JGI25159J45721_100067813 285
171 3300003354 JGI25160J50197_1001701 JGI25160J50197_10017017 285
172 3300003374 JGI25161J50226_1000905 JGI25161J50226_10009057 285
173 3300004625 Ga0055543_1000079 Ga0055543_10000797 285
174 3300005262 Ga0065165_1002903 Ga0065165_10029038 285
175 3300025284 Ga0209130_1000219 Ga0209130_10002195 285
176 3300025302 Ga0207426_1000075 Ga0207426_1000075209 285
177 3300039447 Ga0436361_0113928 Ga0436361_0113928_340_1251 285
178 3300046507 Ga0495606_0055014 Ga0495606_0055014_1417_2316 285
179 3300048919 Ga0496116_0085461 Ga0496116_0085461_224_1129 285
180 3300048920 Ga0496117_0096802 Ga0496117_0096802_413_1321 285
181 3300048922 Ga0496119_0046340 Ga0496119_0046340_1176_2075 285
182 3300048923 Ga0496120_0180120 Ga0496120_0180120_129_1028 285
183 3300048924 Ga0496121_0333505 Ga0496121_0333505_37_936 285
184 3300048925 Ga0496122_0004397 Ga0496122_0004397_3237_4157 285
185 3300048926 Ga0496123_0004520 Ga0496123_0004520_7812_8732 285
186 iso_pu_bacteria 2829745981 2829747105 285
187 iso_pu_bacteria 2883291878 2883292735 285
188 iso_pu_bacteria 2904434214 2904436448 285
189 3300003215 JGI25153J46596_10015463 JGI25153J46596_100154633 286
190 3300003762 Ga0055542_1003684 Ga0055542_10036842 286
191 3300005334 Ga0068869_100313665 Ga0068869_1003136652 286
192 3300005347 Ga0070668_100015221 Ga0070668_1000152215 286
193 3300005347 Ga0070668_100076807 Ga0070668_1000768073 286
194 3300005353 Ga0070669_100169702 Ga0070669_1001697021 286
195 3300005355 Ga0070671_100083124 Ga0070671_1000831242 286
196 3300005455 Ga0070663_100023282 Ga0070663_1000232822 286
197 3300005539 Ga0068853_100472962 Ga0068853_1004729621 286
198 3300005563 Ga0068855_100403082 Ga0068855_1004030823 286
199 3300005616 Ga0068852_100192220 Ga0068852_1001922202 286
200 3300006038 Ga0075365_10049969 Ga0075365_100499693 286
201 3300006038 Ga0075365_10227041 Ga0075365_102270412 286
202 3300006042 Ga0075368_10032175 Ga0075368_100321752 286
203 3300006048 Ga0075363_100063664 Ga0075363_1000636642 286
204 3300006051 Ga0075364_10020082 Ga0075364_100200823 286
205 3300006175 Ga0070712_100016263 Ga0070712_1000162635 286
206 3300006177 Ga0075362_10000364 Ga0075362_1000036412 286
207 3300006178 Ga0075367_10001277 Ga0075367_1000127715 286
208 3300006353 Ga0075370_10006671 Ga0075370_100066716 286
209 3300009093 Ga0105240_10001146 Ga0105240_100011469 286
210 3300009093 Ga0105240_10424370 Ga0105240_104243702 286
211 3300009174 Ga0105241_10065423 Ga0105241_100654233 286
212 3300009177 Ga0105248_10079304 Ga0105248_100793043 286
213 3300009545 Ga0105237_10001621 Ga0105237_1000162126 286
214 3300009551 Ga0105238_10075985 Ga0105238_100759854 286
215 3300010375 Ga0105239_10129037 Ga0105239_101290373 286
216 3300013105 Ga0157369_10112321 Ga0157369_101123214 286
217 3300013296 Ga0157374_10228626 Ga0157374_102286262 286
218 3300014969 Ga0157376_10518203 Ga0157376_105182032 286
219 3300025254 Ga0209148_1000474 Ga0209148_100047424 286
220 3300025261 Ga0209233_1008059 Ga0209233_10080593 286
221 3300025272 Ga0209455_1011491 Ga0209455_10114913 286
222 3300025294 Ga0209025_1048211 Ga0209025_10482112 286
223 3300025297 Ga0209758_1000993 Ga0209758_100099321 286
224 3300025315 Ga0207697_10035703 Ga0207697_100357034 286
225 3300025913 Ga0207695_10000006 Ga0207695_10000006280 286
226 3300025913 Ga0207695_10325826 Ga0207695_103258262 286
227 3300025914 Ga0207671_10013654 Ga0207671_100136545 286
228 3300025915 Ga0207693_10024818 Ga0207693_100248185 286
229 3300025924 Ga0207694_10233506 Ga0207694_102335062 286
230 3300025927 Ga0207687_10260462 Ga0207687_102604621 286
231 3300025931 Ga0207644_10040268 Ga0207644_100402682 286
232 3300025941 Ga0207711_10145182 Ga0207711_101451822 286
233 3300025942 Ga0207689_10153144 Ga0207689_101531442 286
234 3300025972 Ga0207668_10009192 Ga0207668_100091922 286
235 3300026035 Ga0207703_10056162 Ga0207703_100561624 286
236 3300026067 Ga0207678_10030234 Ga0207678_100302343 286
237 3300026088 Ga0207641_10130925 Ga0207641_101309253 286
238 3300026095 Ga0207676_10110660 Ga0207676_101106603 286
239 3300026116 Ga0207674_10046570 Ga0207674_100465703 286
240 3300039447 Ga0436361_0864205 Ga0436361_0864205_3236_4141 286
241 3300044658 Ga0466972_0014613 Ga0466972_0014613_2265_3179 286
242 3300044658 Ga0466972_0101415 Ga0466972_0101415_172_1086 286
243 3300044684 Ga0466966_0086206 Ga0466966_0086206_699_1613 286
244 3300044706 Ga0466964_0044554 Ga0466964_0044554_497_1411 286
245 3300044735 Ga0466968_0002924 Ga0466968_0002924_3413_4327 286
246 3300044901 Ga0466960_0000523 Ga0466960_0000523_5224_6138 286
247 3300045049 Ga0466959_0059664 Ga0466959_0059664_200_1114 286
248 3300046459 Ga0495629_0030964 Ga0495629_0030964_2862_3776 286
249 3300046462 Ga0495651_0248764 Ga0495651_0248764_288_1202 286
250 3300046507 Ga0495606_0110303 Ga0495606_0110303_404_1318 286
251 3300046511 Ga0495608_0021552 Ga0495608_0021552_3354_4268 286
252 3300046514 Ga0495618_0214160 Ga0495618_0214160_281_1195 286
253 3300046516 Ga0495628_0195993 Ga0495628_0195993_26_940 286
254 3300046524 Ga0495648_0063920 Ga0495648_0063920_201_1115 286
255 3300046557 Ga0495622_0089882 Ga0495622_0089882_256_1170 286
256 3300046616 Ga0495668_0022905 Ga0495668_0022905_2024_2938 286
257 3300046616 Ga0495668_0045777 Ga0495668_0045777_372_1286 286
258 3300046648 Ga0495611_0019278 Ga0495611_0019278_1341_2255 286
259 3300046660 Ga0495625_0191804 Ga0495625_0191804_96_1010 286
260 3300046674 Ga0495588_0182175 Ga0495588_0182175_110_1024 286
261 3300046675 Ga0495657_0012111 Ga0495657_0012111_4750_5664 286
262 3300046690 Ga0495624_0043274 Ga0495624_0043274_1283_2197 286
263 3300046794 Ga0495589_0061400 Ga0495589_0061400_636_1550 286
264 3300046809 Ga0495600_0006748 Ga0495600_0006748_4910_5824 286
265 3300047317 Ga0495604_0059741 Ga0495604_0059741_1394_2308 286
266 3300047320 Ga0495672_0067556 Ga0495672_0067556_239_1153 286
267 3300047321 Ga0495676_0076376 Ga0495676_0076376_1183_2097 286
268 3300047323 Ga0495683_0057977 Ga0495683_0057977_18_932 286
269 3300047443 Ga0495687_041587 Ga0495687_041587_168_1082 286
270 3300048088 Ga0495602_0160008 Ga0495602_0160008_546_1460 286
271 3300048091 Ga0495626_0022209 Ga0495626_0022209_407_1321 286
272 3300048903 Ga0496100_0204274 Ga0496100_0204274_23_937 286
273 3300048905 Ga0496102_0184978 Ga0496102_0184978_979_1893 286
274 3300048906 Ga0496103_0031700 Ga0496103_0031700_1921_2835 286
275 3300048907 Ga0496104_0026005 Ga0496104_0026005_97_1011 286
276 3300048907 Ga0496104_0339040 Ga0496104_0339040_344_1258 286
277 3300048908 Ga0496105_0001350 Ga0496105_0001350_14127_15041 286
278 3300048911 Ga0496108_0291011 Ga0496108_0291011_137_1051 286
279 3300048913 Ga0496110_0170925 Ga0496110_0170925_611_1525 286
280 3300048915 Ga0496112_0087933 Ga0496112_0087933_286_1200 286
281 3300048916 Ga0496113_0250350 Ga0496113_0250350_87_1001 286
282 3300048917 Ga0496114_0262885 Ga0496114_0262885_355_1269 286
283 3300048919 Ga0496116_0070663 Ga0496116_0070663_276_1190 286
284 3300048921 Ga0496118_0008990 Ga0496118_0008990_8579_9493 286
285 3300048922 Ga0496119_0147182 Ga0496119_0147182_44_958 286
286 3300048923 Ga0496120_0014557 Ga0496120_0014557_1216_2130 286
287 3300048924 Ga0496121_0020649 Ga0496121_0020649_4395_5306 286
288 3300048924 Ga0496121_0027976 Ga0496121_0027976_4300_5214 286
289 3300048924 Ga0496121_0049552 Ga0496121_0049552_2518_3432 286
290 3300049460 Ga0495682_0118812 Ga0495682_0118812_23_937 286
291 3300050489 nmdc:mga03683_526_c1 nmdc:mga03683_526_c1_322_1233 286
292 3300050490 nmdc:mga03n38_154063_c1 nmdc:mga03n38_154063_c1_20_934 286
293 3300050492 nmdc:mga0yw44_5700_c1 nmdc:mga0yw44_5700_c1_3543_4457 286
294 3300050493 nmdc:mga0k408_165090_c1 nmdc:mga0k408_165090_c1_286_1197 286
295 3300050493 nmdc:mga0k408_42731_c1 nmdc:mga0k408_42731_c1_1104_2018 286
296 3300050494 nmdc:mga06z11_1300_c1 nmdc:mga06z11_1300_c1_972_1883 286
297 3300050516 nmdc:mga0sz30_15_c1 nmdc:mga0sz30_15_c1_24297_25208 286
298 3300055283 Ga0500661_003363 Ga0500661_003363_933_1847 286
299 iso_pu_bacteria 2545555834 2545672619 286
300 iso_pu_bacteria 641522639 641646937 286
301 iso_pu_bacteria 643348564 643600841 286
302 3300005434 Ga0070709_10001293 Ga0070709_100012932 287
303 3300005435 Ga0070714_100045562 Ga0070714_1000455623 287
304 3300005436 Ga0070713_100009193 Ga0070713_1000091936 287
305 3300005437 Ga0070710_10000282 Ga0070710_1000028212 287
306 3300005439 Ga0070711_100014925 Ga0070711_1000149255 287
307 3300005471 Ga0070698_100051927 Ga0070698_1000519273 287
308 3300006173 Ga0070716_100112390 Ga0070716_1001123903 287
309 3300006175 Ga0070712_100005683 Ga0070712_1000056835 287
310 3300006237 Ga0097621_100186180 Ga0097621_1001861802 287
311 3300006852 Ga0075433_10268737 Ga0075433_102687372 287
312 3300007788 Ga0099795_10085262 Ga0099795_100852621 287
313 3300009094 Ga0111539_10000323 Ga0111539_1000032337 287
314 3300009101 Ga0105247_10014641 Ga0105247_100146413 287
315 3300009177 Ga0105248_10793469 Ga0105248_107934691 287
316 3300009545 Ga0105237_10004870 Ga0105237_1000487015 287
317 3300010375 Ga0105239_10742197 Ga0105239_107421972 287
318 3300017792 Ga0163161_10245615 Ga0163161_102456151 287
319 3300021358 Ga0213873_10002417 Ga0213873_100024172 287
320 3300021361 Ga0213872_10008298 Ga0213872_100082982 287
321 3300021361 Ga0213872_10032738 Ga0213872_100327383 287
322 3300021361 Ga0213872_10073990 Ga0213872_100739902 287
323 3300021384 Ga0213876_10001767 Ga0213876_100017678 287
324 3300025304 Ga0209257_1036089 Ga0209257_10360892 287
325 3300025906 Ga0207699_10003950 Ga0207699_100039502 287
326 3300025914 Ga0207671_10022161 Ga0207671_100221613 287
327 3300025915 Ga0207693_10008068 Ga0207693_100080682 287
328 3300025916 Ga0207663_10050175 Ga0207663_100501753 287
329 3300025928 Ga0207700_10005940 Ga0207700_100059403 287
330 3300025929 Ga0207664_10008161 Ga0207664_100081615 287
331 3300025933 Ga0207706_10141303 Ga0207706_101413032 287
332 3300025939 Ga0207665_10024914 Ga0207665_100249144 287
333 3300025941 Ga0207711_10578020 Ga0207711_105780201 287
334 3300027907 Ga0207428_10000129 Ga0207428_1000012938 287
335 3300028379 Ga0268266_10179319 Ga0268266_101793193 287
336 3300031730 Ga0307516_10000173 Ga0307516_1000017312 287
337 3300031824 Ga0307413_10162626 Ga0307413_101626262 287
338 3300039437 Ga0436365_1279257 Ga0436365_1279257_5480_6406 287
339 3300039437 Ga0436365_1925227 Ga0436365_1925227_368_1294 287
340 3300039438 Ga0436360_0695279 Ga0436360_0695279_1014_1940 287
341 3300039447 Ga0436361_0176654 Ga0436361_0176654_3029_3955 287
342 3300039447 Ga0436361_0373700 Ga0436361_0373700_7972_8883 287
343 3300039447 Ga0436361_0438759 Ga0436361_0438759_823_1746 287
344 3300039447 Ga0436361_0556055 Ga0436361_0556055_122_1084 287
345 3300039447 Ga0436361_0578085 Ga0436361_0578085_299_1258 287
346 3300039447 Ga0436361_0867606 Ga0436361_0867606_80_1003 287
347 3300046501 Ga0495607_0000153 Ga0495607_0000153_35645_36559 287
348 3300046522 Ga0495643_0082518 Ga0495643_0082518_567_1484 287
349 3300047469 Ga0495673_0030030 Ga0495673_0030030_1498_2415 287
350 3300047472 Ga0495686_0000082 Ga0495686_0000082_64077_64994 287
351 3300048091 Ga0495626_0030480 Ga0495626_0030480_1218_2132 287
352 3300048907 Ga0496104_0434192 Ga0496104_0434192_258_1184 287
353 3300048921 Ga0496118_0010965 Ga0496118_0010965_5974_6891 287
354 3300048921 Ga0496118_0023061 Ga0496118_0023061_108_1022 287
355 3300048922 Ga0496119_0057536 Ga0496119_0057536_1062_1976 287
356 3300048924 Ga0496121_0021639 Ga0496121_0021639_2943_3857 287
357 3300048924 Ga0496121_0105968 Ga0496121_0105968_108_1025 287
358 3300048926 Ga0496123_0105700 Ga0496123_0105700_315_1232 287
359 3300048929 Ga0496126_0006108 Ga0496126_0006108_11101_12027 287
360 3300048929 Ga0496126_0073507 Ga0496126_0073507_1322_2239 287
361 3300048929 Ga0496126_0090220 Ga0496126_0090220_27_944 287
362 3300050491 nmdc:mga00v17_290579_c1 nmdc:mga00v17_290579_c1_20_934 287
363 3300050511 nmdc:mga08y16_51_c1 nmdc:mga08y16_51_c1_54592_55506 287
364 3300053088 Ga0500644_0108065 Ga0500644_0108065_121_1041 287
365 3300053119 Ga0500595_002719 Ga0500595_002719_2231_3145 287
366 3300053119 Ga0500595_003885 Ga0500595_003885_839_1753 287
367 iso_pu_bacteria 2821443989 2821447277 287
368 iso_pu_bacteria 2844533157 2844533326 287
369 3300003322 rootL2_10011079 rootL2_100110792 288
370 3300005539 Ga0068853_100024459 Ga0068853_1000244592 288
371 3300025254 Ga0209148_1000501 Ga0209148_100050140 288
372 3300025272 Ga0209455_1012628 Ga0209455_10126282 288
373 3300046512 Ga0495610_0002011 Ga0495610_0002011_14165_15097 288
374 3300046524 Ga0495648_0096282 Ga0495648_0096282_48_968 288
375 3300048910 Ga0496107_0017737 Ga0496107_0017737_285_1205 288
376 3300048924 Ga0496121_0000523 Ga0496121_0000523_53480_54400 288
377 3300048924 Ga0496121_0009992 Ga0496121_0009992_6425_7372 288
378 3300048929 Ga0496126_0012983 Ga0496126_0012983_5824_6744 288
379 3300048929 Ga0496126_0061981 Ga0496126_0061981_440_1387 288
380 3300053177 Ga0500636_0002621 Ga0500636_0002621_247_1194 288
381 3300053730 Ga0500645_000065 Ga0500645_000065_52387_53307 288
382 iso_pu_bacteria 2595698237 2596372394 288
383 iso_pu_bacteria 2841911363 2841914577 288
384 iso_pu_bacteria 2841917233 2841920258 288
385 iso_pu_bacteria 2889306138 2889311007 288
386 iso_pu_bacteria 2902330777 2902336213 288
387 iso_pu_bacteria 2902405164 2902406254 288
388 iso_pu_bacteria 2928125067 2928126747 288
389 3300033180 Ga0307510_10035936 Ga0307510_100359364 289
390 3300041512 Ga0451853_2623033 Ga0451853_2623033_27_947 289
391 3300046512 Ga0495610_0049377 Ga0495610_0049377_425_1372 289
392 3300047472 Ga0495686_0117141 Ga0495686_0117141_328_1275 289
393 3300048922 Ga0496119_0002194 Ga0496119_0002194_8054_8968 289
394 3300048923 Ga0496120_0000350 Ga0496120_0000350_28565_29479 289
395 iso_pu_bacteria 2508501042 2508693902 289
396 iso_pu_bacteria 2513237095 2513651977 289
397 iso_pu_bacteria 2513237098 2513672162 289
398 iso_pu_bacteria 2513237102 2513702773 289
399 iso_pu_bacteria 2517093001 2517101012 289
400 iso_pu_bacteria 2524023210 2524464658 289
401 iso_pu_bacteria 2617270735 2617346369 289
402 iso_pu_bacteria 2643221643 2644238045 289
403 iso_pu_bacteria 2738541281 2738747459 289
404 iso_pu_bacteria 2738543032 2739356741 289
405 iso_pu_bacteria 2816332527 2818239175 289
406 iso_pu_bacteria 2824600985 2824604847 289
407 iso_pu_bacteria 2824609381 2824611401 289
408 iso_pu_bacteria 2824617872 2824620245 289
409 iso_pu_bacteria 2824626560 2824629510 289
410 iso_pu_bacteria 2824635225 2824635830 289
411 iso_pu_bacteria 2824644064 2824646132 289
412 iso_pu_bacteria 2824653114 2824656088 289
413 iso_pu_bacteria 2824661429 2824663190 289
414 iso_pu_bacteria 2824704595 2824713864 289
415 iso_pu_bacteria 2824714736 2824716670 289
416 iso_pu_bacteria 2824723954 2824726627 289
417 iso_pu_bacteria 2824753945 2824757894 289
418 iso_pu_bacteria 2824763712 2824766974 289
419 iso_pu_bacteria 2824773399 2824774631 289
420 iso_pu_bacteria 2841957949 2841961235 289
421 iso_pu_bacteria 2842698319 2842700628 289
422 iso_pu_bacteria 2849076700 2849078865 289
423 iso_pu_bacteria 2857509624 2857512498 289
424 iso_pu_bacteria 2874612657 2874617377 289
425 iso_pu_bacteria 2874628541 2874633806 289
426 iso_pu_bacteria 2879099564 2879104206 289
427 iso_pu_bacteria 2881364244 2881368281 289
428 iso_pu_bacteria 2885366525 2885369738 289
429 iso_pu_bacteria 2885383462 2885386243 289
430 iso_pu_bacteria 2888378607 2888379192 289
431 iso_pu_bacteria 2888388044 2888389485 289
432 iso_pu_bacteria 2888419890 2888421630 289
433 iso_pu_bacteria 2903768456 2903774217 289
434 iso_pu_bacteria 2904711408 2904712502 289
435 iso_pu_bacteria 2919073203 2919077110 289
436 iso_pu_bacteria 2929615660 2929620798 289
437 iso_pu_bacteria 2929624759 2929626692 289
438 iso_pu_bacteria 2932784394 2932784443 289
439 iso_pu_bacteria 2932809354 2932809426 289
440 iso_pu_bacteria 2932818245 2932818831 289
441 iso_pu_bacteria 2932828146 2932828213 289
442 iso_pu_bacteria 2933577622 2933582712 289
443 iso_pu_bacteria 2935608549 2935610156 289
444 iso_pu_bacteria 2935616580 2935617187 289
445 iso_pu_bacteria 2935638405 2935639332 289
446 iso_pu_bacteria 2935648319 2935650314 289
447 iso_pu_bacteria 2935656913 2935658461 289
448 iso_pu_bacteria 2935665750 2935665817 289
449 iso_pu_bacteria 2935675223 2935675463 289
450 iso_pu_bacteria 2935684952 2935685526 289
451 iso_pu_bacteria 2935694250 2935698775 289
452 iso_pu_bacteria 2935703347 2935704339 289
453 iso_pu_bacteria 2935713505 2935714079 289
454 iso_pu_bacteria 2935722832 2935724698 289
455 iso_pu_bacteria 2935732158 2935732944 289
456 iso_pu_bacteria 2935741537 2935742323 289
457 iso_pu_bacteria 2935750917 2935751491 289
458 iso_pu_bacteria 2935760218 2935765737 289
459 iso_pu_bacteria 2935769743 2935776872 289
460 iso_pu_bacteria 2935777560 2935778336 289
461 iso_pu_bacteria 2935785616 2935792870 289
462 iso_pu_bacteria 2935793552 2935800988 289
463 iso_pu_bacteria 2935801545 2935802421 289
464 iso_pu_bacteria 2935810662 2935811245 289
465 iso_pu_bacteria 2935819856 2935823316 289
466 iso_pu_bacteria 2935827899 2935828827 289
467 iso_pu_bacteria 2935837841 2935840201 289
468 iso_pu_bacteria 2935855204 2935855812 289
469 iso_pu_bacteria 2935864058 2935866245 289
470 iso_pu_bacteria 2935873716 2935877429 289
471 iso_pu_bacteria 2935984226 2935986025 289
472 iso_pu_bacteria 2935992306 2935992374 289
473 iso_pu_bacteria 2936002035 2936002246 289
474 iso_pu_bacteria 2936011229 2936013127 289
475 iso_pu_bacteria 2936019824 2936021786 289
476 iso_pu_bacteria 2936028420 2936030420 289
477 iso_pu_bacteria 2936037263 2936037335 289
478 iso_pu_bacteria 2936046547 2936047980 289
479 iso_pu_bacteria 2936055302 2936057980 289
480 iso_pu_bacteria 2940556831 2940557707 289
481 iso_pu_bacteria 2941538514 2941540458 289
482 iso_pu_bacteria 8016522445 8016529828 289
483 iso_pu_bacteria 8016530956 8016535062 289
484 iso_pu_bacteria 8016539877 8016548268 289
485 iso_pu_bacteria 8016548790 8016553857 289
486 iso_pu_bacteria 8016557553 8016562232 289
487 iso_pu_bacteria 8016566248 8016573405 289
488 iso_pu_bacteria 8016575299 8016577537 289
489 iso_pu_bacteria 8016595262 8016600048 289
490 iso_pu_bacteria 8016613128 8016614216 289
491 iso_pu_bacteria 8016622563 8016626768 289
492 iso_pu_bacteria 8017057580 8017064298 289
493 iso_pu_bacteria 8019530166 8019534817 289
494 iso_pu_bacteria 8019547302 8019553879 289
495 iso_pu_bacteria 8019576017 8019583642 289
496 iso_pu_bacteria 8019586578 8019591456 289
497 iso_pu_bacteria 8019597564 8019599885 289
498 iso_pu_bacteria 8019608314 8019618660 289
499 iso_pu_bacteria 8019648815 8019659078 289
500 iso_pu_bacteria 8055742211 8055745659 289
501 3300005367 Ga0070667_100070923 Ga0070667_1000709233 290
502 3300005455 Ga0070663_100000216 Ga0070663_1000002166 290
503 3300005536 Ga0070697_100046077 Ga0070697_1000460773 290
504 3300005548 Ga0070665_100000793 Ga0070665_1000007932 290
505 3300005548 Ga0070665_100009232 Ga0070665_1000092326 290
506 3300005548 Ga0070665_100033945 Ga0070665_1000339452 290
507 3300025972 Ga0207668_10073416 Ga0207668_100734163 290
508 3300026067 Ga0207678_10000697 Ga0207678_1000069722 290
509 3300028379 Ga0268266_10005250 Ga0268266_1000525010 290
510 3300028379 Ga0268266_10019103 Ga0268266_100191033 290
511 3300028379 Ga0268266_10182538 Ga0268266_101825382 290
512 3300031711 Ga0265314_10025261 Ga0265314_100252612 290
513 3300053079 Ga0500610_0029902 Ga0500610_0029902_1084_2013 290
514 3300053139 Ga0500568_0005342 Ga0500568_0005342_448_1377 290
515 iso_pu_bacteria 2861691609 2861693025 290
516 3300007265 Ga0099794_10013003 Ga0099794_100130033 291
517 3300007788 Ga0099795_10003690 Ga0099795_100036904 291
518 3300010159 Ga0099796_10000384 Ga0099796_100003844 291
519 iso_pu_bacteria 2791355123 2792750418 291
520 iso_pu_bacteria 2857542790 2857545997 291
521 iso_pu_bacteria 2919100787 2919102419 291
522 3300003322 rootL2_10162917 rootL2_101629173 292
523 3300005367 Ga0070667_100033812 Ga0070667_1000338123 292
524 3300005455 Ga0070663_100003063 Ga0070663_1000030631 292
525 3300005843 Ga0068860_100008667 Ga0068860_1000086679 292
526 3300009553 Ga0105249_10003500 Ga0105249_1000350011 292
527 3300026118 Ga0207675_100000292 Ga0207675_10000029218 292
528 3300031731 Ga0307405_10030843 Ga0307405_100308433 292
529 3300031901 Ga0307406_10351960 Ga0307406_103519601 292
530 3300047472 Ga0495686_0165502 Ga0495686_0165502_115_1050 292
531 3300048927 Ga0496124_0007731 Ga0496124_0007731_2592_3527 292
532 iso_pu_bacteria 2863421361 2863422110 292
533 iso_pu_bacteria 2904564687 2904566265 292
534 iso_pu_bacteria 2904571731 2904573309 292
535 iso_pu_bacteria 2928536128 2928538113 292
536 iso_pu_bacteria 8039098773 8039104181 292
537 3300002773 JGI25152J39213_1000162 JGI25152J39213_100016243 293
538 3300002773 JGI25152J39213_1007085 JGI25152J39213_10070853 293
539 3300002987 JGI25159J45721_1002059 JGI25159J45721_10020593 293
540 3300003187 JGI25151J46595_10065477 JGI25151J46595_100654772 293
541 3300003215 JGI25153J46596_10000288 JGI25153J46596_100002888 293
542 3300003215 JGI25153J46596_10001506 JGI25153J46596_100015063 293
543 3300003215 JGI25153J46596_10001586 JGI25153J46596_100015869 293
544 3300003215 JGI25153J46596_10003877 JGI25153J46596_100038776 293
545 3300003215 JGI25153J46596_10018033 JGI25153J46596_100180333 293
546 3300003215 JGI25153J46596_10028247 JGI25153J46596_100282471 293
547 3300003354 JGI25160J50197_1000413 JGI25160J50197_10004139 293
548 3300003354 JGI25160J50197_1038171 JGI25160J50197_10381711 293
549 3300003374 JGI25161J50226_1000567 JGI25161J50226_10005677 293
550 3300003374 JGI25161J50226_1000572 JGI25161J50226_10005727 293
551 3300003771 Ga0055526_1005653 Ga0055526_10056532 293
552 3300003775 Ga0055524_1001701 Ga0055524_10017012 293
553 3300003790 Ga0055528_1000295 Ga0055528_100029521 293
554 3300003790 Ga0055528_1001484 Ga0055528_100148410 293
555 3300003792 Ga0055540_1002714 Ga0055540_10027144 293
556 3300004625 Ga0055543_1000116 Ga0055543_100011643 293
557 3300004625 Ga0055543_1002291 Ga0055543_10022916 293
558 3300005262 Ga0065165_1000342 Ga0065165_100034250 293
559 3300005262 Ga0065165_1015499 Ga0065165_10154994 293
560 3300005327 Ga0070658_10015167 Ga0070658_100151674 293
561 3300005327 Ga0070658_10284855 Ga0070658_102848552 293
562 3300005331 Ga0070670_100009469 Ga0070670_1000094692 293
563 3300005334 Ga0068869_100041460 Ga0068869_1000414603 293
564 3300005334 Ga0068869_100087992 Ga0068869_1000879922 293
565 3300005335 Ga0070666_10033261 Ga0070666_100332614 293
566 3300005344 Ga0070661_100177174 Ga0070661_1001771741 293
567 3300005347 Ga0070668_100207722 Ga0070668_1002077222 293
568 3300005441 Ga0070700_100073840 Ga0070700_1000738403 293
569 3300005455 Ga0070663_100013377 Ga0070663_1000133775 293
570 3300005455 Ga0070663_100056771 Ga0070663_1000567712 293
571 3300005457 Ga0070662_100006917 Ga0070662_1000069176 293
572 3300005457 Ga0070662_100007492 Ga0070662_1000074924 293
573 3300005459 Ga0068867_100320946 Ga0068867_1003209461 293
574 3300005471 Ga0070698_100192896 Ga0070698_1001928963 293
575 3300005518 Ga0070699_100274479 Ga0070699_1002744791 293
576 3300005546 Ga0070696_100026053 Ga0070696_1000260533 293
577 3300005548 Ga0070665_100000465 Ga0070665_10000046538 293
578 3300005548 Ga0070665_100006487 Ga0070665_1000064876 293
579 3300005548 Ga0070665_100122974 Ga0070665_1001229742 293
580 3300005548 Ga0070665_100497672 Ga0070665_1004976721 293
581 3300005549 Ga0070704_100029684 Ga0070704_1000296844 293
582 3300005614 Ga0068856_100173845 Ga0068856_1001738452 293
583 3300005834 Ga0068851_10002327 Ga0068851_100023273 293
584 3300005842 Ga0068858_100013390 Ga0068858_1000133903 293
585 3300005937 Ga0081455_10046002 Ga0081455_100460024 293
586 3300005983 Ga0081540_1018480 Ga0081540_10184804 293
587 3300005983 Ga0081540_1027966 Ga0081540_10279663 293
588 3300006038 Ga0075365_10038631 Ga0075365_100386314 293
589 3300006186 Ga0075369_10093646 Ga0075369_100936462 293
590 3300006195 Ga0075366_10072738 Ga0075366_100727382 293
591 3300006353 Ga0075370_10140015 Ga0075370_101400152 293
592 3300009092 Ga0105250_10019006 Ga0105250_100190063 293
593 3300009093 Ga0105240_10000341 Ga0105240_1000034154 293
594 3300009093 Ga0105240_10000342 Ga0105240_1000034236 293
595 3300009174 Ga0105241_10074884 Ga0105241_100748843 293
596 3300009177 Ga0105248_10290790 Ga0105248_102907903 293
597 3300009545 Ga0105237_10115232 Ga0105237_101152323 293
598 3300009545 Ga0105237_10127179 Ga0105237_101271792 293
599 3300009553 Ga0105249_10007619 Ga0105249_1000761911 293
600 3300010375 Ga0105239_10000041 Ga0105239_1000004136 293
601 3300010375 Ga0105239_10124392 Ga0105239_101243924 293
602 3300010375 Ga0105239_10723669 Ga0105239_107236692 293
603 3300013105 Ga0157369_10338869 Ga0157369_103388693 293
604 3300013307 Ga0157372_10030582 Ga0157372_100305822 293
605 3300014325 Ga0163163_10097654 Ga0163163_100976543 293
606 3300014326 Ga0157380_10369896 Ga0157380_103698962 293
607 3300014968 Ga0157379_10376942 Ga0157379_103769422 293
608 3300014969 Ga0157376_10190878 Ga0157376_101908782 293
609 3300014969 Ga0157376_10441925 Ga0157376_104419252 293
610 3300017792 Ga0163161_10399765 Ga0163161_103997652 293
611 3300025208 Ga0209436_100066 Ga0209436_10006624 293
612 3300025253 Ga0209677_101975 Ga0209677_1019754 293
613 3300025258 Ga0209129_1006000 Ga0209129_10060005 293
614 3300025273 Ga0209673_1001545 Ga0209673_100154511 293
615 3300025273 Ga0209673_1014758 Ga0209673_10147583 293
616 3300025284 Ga0209130_1000022 Ga0209130_100002262 293
617 3300025295 Ga0209564_1000475 Ga0209564_100047547 293
618 3300025295 Ga0209564_1026163 Ga0209564_10261633 293
619 3300025297 Ga0209758_1000209 Ga0209758_100020959 293
620 3300025297 Ga0209758_1004616 Ga0209758_10046164 293
621 3300025297 Ga0209758_1007575 Ga0209758_10075754 293
622 3300025299 Ga0209256_1022273 Ga0209256_10222733 293
623 3300025302 Ga0207426_1000005 Ga0207426_1000005184 293
624 3300025302 Ga0207426_1000237 Ga0207426_100023742 293
625 3300025302 Ga0207426_1017611 Ga0207426_10176113 293
626 3300025304 Ga0209257_1025778 Ga0209257_10257783 293
627 3300025321 Ga0207656_10005520 Ga0207656_100055203 293
628 3300025903 Ga0207680_10023242 Ga0207680_100232424 293
629 3300025904 Ga0207647_10002100 Ga0207647_1000210014 293
630 3300025909 Ga0207705_10029474 Ga0207705_100294743 293
631 3300025913 Ga0207695_10000311 Ga0207695_1000031191 293
632 3300025913 Ga0207695_10005152 Ga0207695_100051526 293
633 3300025913 Ga0207695_10023432 Ga0207695_100234326 293
634 3300025913 Ga0207695_10268825 Ga0207695_102688252 293
635 3300025914 Ga0207671_10020670 Ga0207671_100206705 293
636 3300025919 Ga0207657_10048295 Ga0207657_100482953 293
637 3300025933 Ga0207706_10001636 Ga0207706_1000163623 293
638 3300025933 Ga0207706_10013352 Ga0207706_100133523 293
639 3300025942 Ga0207689_10002319 Ga0207689_1000231910 293
640 3300025961 Ga0207712_10001146 Ga0207712_100011463 293
641 3300025986 Ga0207658_10017385 Ga0207658_100173853 293
642 3300026035 Ga0207703_10011514 Ga0207703_100115143 293
643 3300026067 Ga0207678_10007805 Ga0207678_1000780511 293
644 3300026067 Ga0207678_10026489 Ga0207678_100264895 293
645 3300026089 Ga0207648_10245169 Ga0207648_102451692 293
646 3300026142 Ga0207698_10090754 Ga0207698_100907543 293
647 3300028379 Ga0268266_10000006 Ga0268266_10000006988 293
648 3300028379 Ga0268266_10005075 Ga0268266_100050758 293
649 3300028379 Ga0268266_10123974 Ga0268266_101239743 293
650 3300028380 Ga0268265_10256241 Ga0268265_102562412 293
651 3300028380 Ga0268265_10346620 Ga0268265_103466202 293
652 3300037471 Ga0395905_0065152 Ga0395905_0065152_1860_2798 293
653 3300038443 Ga0395901_0511904 Ga0395901_0511904_92_1030 293
654 3300046460 Ga0495638_0002575 Ga0495638_0002575_1550_2497 293
655 3300046507 Ga0495606_0076189 Ga0495606_0076189_830_1768 293
656 3300046524 Ga0495648_0099119 Ga0495648_0099119_485_1423 293
657 3300046557 Ga0495622_0052407 Ga0495622_0052407_861_1799 293
658 3300046663 Ga0495635_0110071 Ga0495635_0110071_374_1312 293
659 3300046674 Ga0495588_0017345 Ga0495588_0017345_2146_3084 293
660 3300046694 Ga0495649_0115837 Ga0495649_0115837_160_1107 293
661 3300047469 Ga0495673_0037110 Ga0495673_0037110_144_1082 293
662 3300048903 Ga0496100_0332260 Ga0496100_0332260_158_1096 293
663 3300048904 Ga0496101_0007946 Ga0496101_0007946_1944_2882 293
664 3300048905 Ga0496102_0030791 Ga0496102_0030791_3747_4685 293
665 3300048906 Ga0496103_0182758 Ga0496103_0182758_359_1297 293
666 3300048907 Ga0496104_0012050 Ga0496104_0012050_3739_4677 293
667 3300048907 Ga0496104_0026950 Ga0496104_0026950_2637_3575 293
668 3300048908 Ga0496105_0016203 Ga0496105_0016203_824_1762 293
669 3300048908 Ga0496105_0236866 Ga0496105_0236866_451_1389 293
670 3300048909 Ga0496106_0001156 Ga0496106_0001156_11694_12632 293
671 3300048910 Ga0496107_0092308 Ga0496107_0092308_870_1808 293
672 3300048913 Ga0496110_0122095 Ga0496110_0122095_879_1817 293
673 3300048915 Ga0496112_0260247 Ga0496112_0260247_418_1356 293
674 3300048916 Ga0496113_0082330 Ga0496113_0082330_204_1142 293
675 3300048917 Ga0496114_0022782 Ga0496114_0022782_3878_4816 293
676 3300048918 Ga0496115_0037934 Ga0496115_0037934_925_1863 293
677 3300048918 Ga0496115_0053435 Ga0496115_0053435_1944_2882 293
678 3300048920 Ga0496117_0004582 Ga0496117_0004582_2271_3209 293
679 3300048920 Ga0496117_0020523 Ga0496117_0020523_2173_3111 293
680 3300048921 Ga0496118_0000994 Ga0496118_0000994_5332_6270 293
681 3300048921 Ga0496118_0010661 Ga0496118_0010661_3834_4772 293
682 3300048922 Ga0496119_0000191 Ga0496119_0000191_81243_82181 293
683 3300048922 Ga0496119_0088763 Ga0496119_0088763_626_1564 293
684 3300048922 Ga0496119_0104136 Ga0496119_0104136_578_1516 293
685 3300048923 Ga0496120_0000321 Ga0496120_0000321_57487_58425 293
686 3300048924 Ga0496121_0000013 Ga0496121_0000013_589014_589952 293
687 3300048924 Ga0496121_0001346 Ga0496121_0001346_14496_15434 293
688 3300048924 Ga0496121_0018898 Ga0496121_0018898_1701_2639 293
689 3300048924 Ga0496121_0027463 Ga0496121_0027463_3085_4023 293
690 3300048924 Ga0496121_0094143 Ga0496121_0094143_1007_1945 293
691 3300048927 Ga0496124_0285366 Ga0496124_0285366_129_1067 293
692 3300048928 Ga0496125_0143595 Ga0496125_0143595_454_1392 293
693 3300048929 Ga0496126_0001231 Ga0496126_0001231_36519_37457 293
694 3300048929 Ga0496126_0010532 Ga0496126_0010532_5785_6723 293
695 3300048929 Ga0496126_0115683 Ga0496126_0115683_244_1182 293
696 3300050492 nmdc:mga0yw44_2128_c1 nmdc:mga0yw44_2128_c1_1195_2133 293
697 3300050496 nmdc:mga07m45_4015_c1 nmdc:mga07m45_4015_c1_2821_3759 293
698 3300053080 Ga0500635_0011635 Ga0500635_0011635_647_1585 293
699 3300053087 Ga0500643_000097 Ga0500643_000097_40537_41484 293
700 3300053094 Ga0500566_0000029 Ga0500566_0000029_66357_67295 293
701 3300053095 Ga0500640_045153 Ga0500640_045153_150_1088 293
702 3300053103 Ga0500555_009080 Ga0500555_009080_493_1440 293
703 3300053111 Ga0500572_002243 Ga0500572_002243_1390_2328 293
704 3300053118 Ga0500594_0042786 Ga0500594_0042786_151_1098 293
705 3300053119 Ga0500595_001774 Ga0500595_001774_4996_5934 293
706 3300053122 Ga0500608_036746 Ga0500608_036746_1188_2126 293
707 3300053138 Ga0500564_016690 Ga0500564_016690_388_1326 293
708 3300053139 Ga0500568_0024552 Ga0500568_0024552_989_1936 293
709 3300053142 Ga0500577_0096614 Ga0500577_0096614_243_1181 293
710 3300053154 Ga0500619_006051 Ga0500619_006051_310_1248 293
711 3300053162 Ga0500638_027971 Ga0500638_027971_1571_2509 293
712 3300053177 Ga0500636_0000420 Ga0500636_0000420_7587_8525 293
713 3300053737 Ga0500601_000525 Ga0500601_000525_607_1545 293
714 iso_pu_bacteria 2519103095 2519458397 293
715 iso_pu_bacteria 2582581311 2585292780 293
716 iso_pu_bacteria 2599185239 2599738273 293
717 iso_pu_bacteria 2599185240 2599742367 293
718 iso_pu_bacteria 2599185355 2600204485 293
719 iso_pu_bacteria 2675903129 2676741470 293
720 iso_pu_bacteria 2816332253 2817260592 293
721 iso_pu_bacteria 2816332256 2817278233 293
722 iso_pu_bacteria 2816332286 2817452532 293
723 iso_pu_bacteria 2818991452 2819633097 293
724 iso_pu_bacteria 2870068957 2870071964 293
725 iso_pu_bacteria 2928157003 2928159321 293
726 iso_pu_bacteria 2928163908 2928164619 293
727 iso_pu_bacteria 2928170801 2928176552 293
728 iso_pu_bacteria 2981990288 2981993744 293
729 iso_pu_bacteria 3004211236 3004217514 293
730 iso_pu_bacteria 3004218560 3004221803 293
731 iso_pu_bacteria 641736154 642419338 293
732 iso_pu_bacteria 8018845410 8018850585 293
733 iso_pu_bacteria 8020807995 8020808318 293
734 iso_pu_bacteria 8020938398 8020944495 293
735 iso_pu_bacteria 8020945358 8020947037 293
736 iso_pu_bacteria 8020953355 8020960066 293
737 iso_pu_bacteria 8021120328 8021122998 293
738 iso_pu_bacteria 8040167225 8040172604 293
739 iso_pu_bacteria 8040173305 8040175171 293
740 3300005434 Ga0070709_10026169 Ga0070709_100261694 294
741 3300005437 Ga0070710_10048697 Ga0070710_100486973 294
742 3300005439 Ga0070711_100020841 Ga0070711_1000208415 294
743 3300006173 Ga0070716_100031962 Ga0070716_1000319622 294
744 3300025258 Ga0209129_1000746 Ga0209129_100074613 294
745 3300025273 Ga0209673_1000317 Ga0209673_100031755 294
746 3300025294 Ga0209025_1015004 Ga0209025_10150044 294
747 3300025295 Ga0209564_1008300 Ga0209564_10083004 294
748 3300025297 Ga0209758_1036904 Ga0209758_10369042 294
749 3300025299 Ga0209256_1000624 Ga0209256_100062423 294
750 3300025906 Ga0207699_10001088 Ga0207699_1000108812 294
751 3300025915 Ga0207693_10001127 Ga0207693_1000112724 294
752 3300025916 Ga0207663_10229202 Ga0207663_102292021 294
753 3300041486 Ga0451807_1909073 Ga0451807_1909073_434_1369 294
754 3300046460 Ga0495638_0000019 Ga0495638_0000019_216720_217664 294
755 3300047472 Ga0495686_0002800 Ga0495686_0002800_6486_7430 294
756 3300048924 Ga0496121_0043315 Ga0496121_0043315_2665_3609 294
757 3300048925 Ga0496122_0043901 Ga0496122_0043901_117_1061 294
758 3300048925 Ga0496122_0148094 Ga0496122_0148094_243_1184 294
759 3300048927 Ga0496124_0000004 Ga0496124_0000004_475761_476705 294
760 3300048928 Ga0496125_0072614 Ga0496125_0072614_254_1195 294
761 3300048929 Ga0496126_0031271 Ga0496126_0031271_68_1006 294
762 3300048929 Ga0496126_0147537 Ga0496126_0147537_385_1323 294
763 3300053087 Ga0500643_005357 Ga0500643_005357_4474_5409 294
764 3300005353 Ga0070669_100154739 Ga0070669_1001547393 295
765 3300005436 Ga0070713_100105880 Ga0070713_1001058803 295
766 3300005455 Ga0070663_100009307 Ga0070663_1000093078 295
767 3300005458 Ga0070681_10083981 Ga0070681_100839813 295
768 3300005467 Ga0070706_100047916 Ga0070706_1000479163 295
769 3300005471 Ga0070698_100208201 Ga0070698_1002082012 295
770 3300005518 Ga0070699_100106617 Ga0070699_1001066171 295
771 3300005548 Ga0070665_100003470 Ga0070665_1000034707 295
772 3300005548 Ga0070665_100166184 Ga0070665_1001661843 295
773 3300005842 Ga0068858_100163429 Ga0068858_1001634292 295
774 3300005983 Ga0081540_1001470 Ga0081540_100147015 295
775 3300006048 Ga0075363_100043094 Ga0075363_1000430943 295
776 3300006178 Ga0075367_10029255 Ga0075367_100292554 295
777 3300006186 Ga0075369_10041456 Ga0075369_100414563 295
778 3300006871 Ga0075434_100002679 Ga0075434_10000267910 295
779 3300007076 Ga0075435_100226431 Ga0075435_1002264312 295
780 3300009177 Ga0105248_10002720 Ga0105248_1000272013 295
781 3300013306 Ga0163162_10218463 Ga0163162_102184632 295
782 3300014497 Ga0182008_10000113 Ga0182008_1000011318 295
783 3300015262 Ga0182007_10000213 Ga0182007_1000021318 295
784 3300025910 Ga0207684_10170437 Ga0207684_101704372 295
785 3300025912 Ga0207707_10043307 Ga0207707_100433073 295
786 3300025941 Ga0207711_10035431 Ga0207711_100354314 295
787 3300027866 Ga0209813_10005348 Ga0209813_100053483 295
788 3300028379 Ga0268266_10283756 Ga0268266_102837562 295
789 3300028786 Ga0307517_10079028 Ga0307517_100790283 295
790 3300031239 Ga0265328_10017462 Ga0265328_100174623 295
791 3300031456 Ga0307513_10106028 Ga0307513_101060283 295
792 3300031711 Ga0265314_10026992 Ga0265314_100269923 295
793 3300031824 Ga0307413_10025312 Ga0307413_100253122 295
794 3300031852 Ga0307410_10138330 Ga0307410_101383302 295
795 3300031995 Ga0307409_100042599 Ga0307409_1000425992 295
796 3300032126 Ga0307415_100150779 Ga0307415_1001507792 295
797 3300041451 Ga0451791_0877780 Ga0451791_0877780_391_1335 295
798 3300041486 Ga0451807_1989451 Ga0451807_1989451_250_1194 295
799 3300046455 Ga0495603_0125792 Ga0495603_0125792_43_987 295
800 3300046460 Ga0495638_0015368 Ga0495638_0015368_3848_4792 295
801 3300046460 Ga0495638_0059152 Ga0495638_0059152_369_1313 295
802 3300046515 Ga0495620_0040402 Ga0495620_0040402_647_1591 295
803 3300046684 Ga0495669_0095275 Ga0495669_0095275_19_963 295
804 3300046694 Ga0495649_0025343 Ga0495649_0025343_684_1628 295
805 3300047469 Ga0495673_0006912 Ga0495673_0006912_4347_5291 295
806 3300048909 Ga0496106_0250532 Ga0496106_0250532_100_1044 295
807 3300048919 Ga0496116_0010236 Ga0496116_0010236_6415_7356 295
808 3300048924 Ga0496121_0037444 Ga0496121_0037444_1274_2218 295
809 3300048927 Ga0496124_0076382 Ga0496124_0076382_652_1596 295
810 3300048928 Ga0496125_0006913 Ga0496125_0006913_7479_8423 295
811 3300050494 nmdc:mga06z11_1614_c1 nmdc:mga06z11_1614_c1_1592_2536 295
812 3300050512 nmdc:mga0n895_3215_c1 nmdc:mga0n895_3215_c1_8986_9930 295
813 3300050513 nmdc:mga0rr50_25604_c1 nmdc:mga0rr50_25604_c1_2675_3619 295
814 3300053139 Ga0500568_0000082 Ga0500568_0000082_64811_65755 295
815 3300053156 Ga0500622_0002004 Ga0500622_0002004_7414_8358 295
816 3300003316 rootH1_10064499 rootH1_100644993 296
817 3300005456 Ga0070678_100026381 Ga0070678_1000263813 296
818 3300009093 Ga0105240_10545728 Ga0105240_105457282 296
819 3300010159 Ga0099796_10000249 Ga0099796_100002496 296
820 3300025915 Ga0207693_10039700 Ga0207693_100397004 296
821 3300026121 Ga0207683_10014794 Ga0207683_100147945 296
822 3300047320 Ga0495672_0017814 Ga0495672_0017814_3134_4081 296
823 3300048909 Ga0496106_0023403 Ga0496106_0023403_2878_3831 296
824 3300048924 Ga0496121_0000091 Ga0496121_0000091_115241_116188 296
825 3300053119 Ga0500595_003102 Ga0500595_003102_258_1205 296
826 3300053139 Ga0500568_0031679 Ga0500568_0031679_236_1183 296
827 3300001989 JGI24739J22299_10037306 JGI24739J22299_100373062 297
828 3300002737 JGI25162J39368_1002066 JGI25162J39368_10020664 297
829 3300003758 Ga0055532_1000877 Ga0055532_10008773 297
830 3300003758 Ga0055532_1000943 Ga0055532_100094311 297
831 3300003758 Ga0055532_1000954 Ga0055532_100095411 297
832 3300003760 Ga0055527_1000519 Ga0055527_100051911 297
833 3300003761 Ga0055535_1001606 Ga0055535_10016063 297
834 3300003761 Ga0055535_1001639 Ga0055535_10016393 297
835 3300003762 Ga0055542_1000010 Ga0055542_1000010150 297
836 3300003762 Ga0055542_1001602 Ga0055542_10016023 297
837 3300003762 Ga0055542_1004740 Ga0055542_10047402 297
838 3300003763 Ga0055529_1001193 Ga0055529_10011933 297
839 3300003790 Ga0055528_1005415 Ga0055528_10054154 297
840 3300005339 Ga0070660_100000028 Ga0070660_10000002866 297
841 3300005344 Ga0070661_100011514 Ga0070661_1000115145 297
842 3300005344 Ga0070661_100359670 Ga0070661_1003596701 297
843 3300005366 Ga0070659_100000230 Ga0070659_10000023032 297
844 3300005455 Ga0070663_100262618 Ga0070663_1002626182 297
845 3300005563 Ga0068855_100177750 Ga0068855_1001777502 297
846 3300005616 Ga0068852_100029923 Ga0068852_1000299234 297
847 3300005616 Ga0068852_100715927 Ga0068852_1007159271 297
848 3300009092 Ga0105250_10059574 Ga0105250_100595742 297
849 3300009093 Ga0105240_10014261 Ga0105240_100142613 297
850 3300009093 Ga0105240_10070943 Ga0105240_100709435 297
851 3300009545 Ga0105237_10018112 Ga0105237_100181129 297
852 3300009551 Ga0105238_10008484 Ga0105238_100084844 297
853 3300009551 Ga0105238_10025999 Ga0105238_100259995 297
854 3300010375 Ga0105239_10125810 Ga0105239_101258102 297
855 3300015262 Ga0182007_10002329 Ga0182007_1000232911 297
856 3300015265 Ga0182005_1019483 Ga0182005_10194832 297
857 3300025225 Ga0209566_100904 Ga0209566_10090414 297
858 3300025228 Ga0209672_100019 Ga0209672_100019175 297
859 3300025228 Ga0209672_100069 Ga0209672_100069138 297
860 3300025228 Ga0209672_100149 Ga0209672_10014916 297
861 3300025228 Ga0209672_111727 Ga0209672_1117272 297
862 3300025229 Ga0209147_100026 Ga0209147_100026175 297
863 3300025229 Ga0209147_100044 Ga0209147_100044129 297
864 3300025229 Ga0209147_100128 Ga0209147_10012895 297
865 3300025231 Ga0207427_101592 Ga0207427_1015925 297
866 3300025233 Ga0209437_100180 Ga0209437_10018097 297
867 3300025242 Ga0209258_100031 Ga0209258_100031208 297
868 3300025242 Ga0209258_100079 Ga0209258_10007961 297
869 3300025242 Ga0209258_101986 Ga0209258_1019865 297
870 3300025254 Ga0209148_1000005 Ga0209148_1000005195 297
871 3300025254 Ga0209148_1000027 Ga0209148_1000027208 297
872 3300025254 Ga0209148_1001447 Ga0209148_100144711 297
873 3300025261 Ga0209233_1017507 Ga0209233_10175073 297
874 3300025272 Ga0209455_1000058 Ga0209455_1000058166 297
875 3300025272 Ga0209455_1001131 Ga0209455_10011315 297
876 3300025272 Ga0209455_1007589 Ga0209455_10075893 297
877 3300025273 Ga0209673_1000059 Ga0209673_1000059146 297
878 3300025295 Ga0209564_1013563 Ga0209564_10135632 297
879 3300025711 Ga0207696_1028831 Ga0207696_10288312 297
880 3300025913 Ga0207695_10003507 Ga0207695_100035073 297
881 3300025913 Ga0207695_10224149 Ga0207695_102241491 297
882 3300025919 Ga0207657_10000001 Ga0207657_10000001169 297
883 3300025924 Ga0207694_10037967 Ga0207694_100379673 297
884 3300025924 Ga0207694_10080842 Ga0207694_100808423 297
885 3300025932 Ga0207690_10000072 Ga0207690_1000007255 297
886 3300025949 Ga0207667_10036160 Ga0207667_100361605 297
887 3300026067 Ga0207678_10001112 Ga0207678_1000111218 297
888 3300026067 Ga0207678_10127615 Ga0207678_101276152 297
889 3300026142 Ga0207698_10112822 Ga0207698_101128222 297
890 3300027312 Ga0209371_1000243 Ga0209371_100024339 297
891 3300028381 Ga0268264_10032783 Ga0268264_100327834 297
892 3300030500 Ga0268256_1000311 Ga0268256_100031122 297
893 3300046460 Ga0495638_0000009 Ga0495638_0000009_335439_336386 297
894 3300046460 Ga0495638_0000087 Ga0495638_0000087_31605_32552 297
895 3300046471 Ga0495650_0000122 Ga0495650_0000122_158784_159731 297
896 3300046507 Ga0495606_0000056 Ga0495606_0000056_19468_20415 297
897 3300046557 Ga0495622_0004123 Ga0495622_0004123_3411_4358 297
898 3300046694 Ga0495649_0000266 Ga0495649_0000266_36309_37256 297
899 3300048917 Ga0496114_0119050 Ga0496114_0119050_1137_2084 297
900 3300048918 Ga0496115_0000046 Ga0496115_0000046_17297_18244 297
901 3300048918 Ga0496115_0024882 Ga0496115_0024882_1815_2762 297
902 3300048929 Ga0496126_0016215 Ga0496126_0016215_4926_5873 297
903 3300048929 Ga0496126_0016512 Ga0496126_0016512_2824_3771 297
904 3300048929 Ga0496126_0077646 Ga0496126_0077646_751_1698 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01039

Carboxyl_trans

Carboxyl transferase domain

24

242

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fb8-assembly1.cif.gz_A crystal structure of apo acyl-coa carboxylase 0.8207 24 226
6tzv-assembly4.cif.gz_G crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis 0.8153 23 170
4l6w-assembly1.cif.gz_B carboxyltransferase subunit (accd6) of mycobacterium tuberculosis acetyl-coa carboxylase 0.8138 23 169
6tzv-assembly2.cif.gz_C crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis 0.8097 23 170
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.8013 136 154
ID Description Score Start End Superfamily
4fb8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8062 24 231 3.90.226.10
af_O86318_1_265_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.77 22 231 3.90.226.10
af_O53578_4_260_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7651 22 230 3.90.226.10
4fb8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7642 24 231 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7479 22 232 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A0N4ZEE2-F1-model_v4 Carboxyl_trans domain-containing protein 0.8949 17 157 GO:0003989
GO:0005975
GO:0006633
GO:2001295
AF-A0A176YM89-F1-model_v4 Biotin-independent malonate decarboxylase subunit beta 0.8863 16 294 GO:0003989
GO:0005975
GO:0006633
GO:0009317
GO:0016740
GO:0016831
GO:2001295
AF-A2VRC6-F1-model_v4 deleted 0.8838 1 296
AF-F0G5D0-F1-model_v4 Malonate decarboxylase subunit beta 0.8831 64 296 GO:0003989
GO:0005975
GO:0006633
GO:0009317
GO:0016740
GO:0016831
GO:2001295
AF-A2VRC6-F1-model_v4 deleted 0.881 1 296

Feature Viewer

pLDDT pTM Quality
79.68 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map