F485268
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 904 | 510 | 644 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_100026381|Ga0070678_1000263813 |
| Length | 317 |
| Sequence | MNASTIEASAPSHVLRSQGVSWYEASARQRIDLLLDAGTFKEYIGPEQREHSPHLQVFDLPEQFDDGIAVGRGMLAGAPVFIAAQEGRFMGGAFGEVHGAKLTGLLRAARDLGSIPVLILFDTGGVRLQEANAGELAIAEIMRALIEARTAGVKVIGLIGGRAGCYGGGGLIAGCCSALAVSEQGRISVSGPEVIETNRGVEEFDSKDRALVWRTMGGKHRRLLGGADAFSDDSIDAFRETALALIASTPGFGIEVLKAEQARLASRLDRFGTCGDAVDIWKAEGLSDAQAEAVPAMPAPDFITLANKVQEARHDAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 5 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 6 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 7 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 10 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 11 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 12 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 13 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 14 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 15 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 16 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 17 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 18 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 19 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 20 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 21 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 22 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 23 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 24 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 25 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 26 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 27 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 28 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 29 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 30 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 31 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 32 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 33 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 34 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 35 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 36 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 37 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 38 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 39 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 40 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 41 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 42 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 43 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 44 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 45 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 46 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 47 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 48 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 49 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 50 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 51 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 52 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 53 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 54 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 55 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 56 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 57 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 58 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 59 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 60 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 61 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 62 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 63 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 64 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 65 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 66 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 67 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 68 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 71 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 72 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 73 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 74 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 75 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 76 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 77 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 78 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 79 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 80 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 81 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 82 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 83 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 84 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 85 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 86 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 87 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 88 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 89 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 90 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 91 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 92 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 93 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 94 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 95 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 96 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 97 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 98 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 99 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 100 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 101 | 2904699407 | |||
| 102 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 103 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 104 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 105 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 106 | 2922368715 | |||
| 107 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 108 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 109 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 110 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 111 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 112 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 113 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 114 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 115 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 116 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 117 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 118 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 119 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 120 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 121 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 122 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 123 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 124 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 125 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 126 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 127 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 128 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 129 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 130 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 131 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 132 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 133 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 134 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 135 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 136 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 137 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 138 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 139 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 140 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 141 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 142 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 143 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 144 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 145 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 146 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 147 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 148 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 149 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 150 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 151 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 152 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 153 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 154 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 155 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 156 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 157 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 158 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 159 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 160 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 161 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 162 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 163 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 164 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 165 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 166 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 167 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 168 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 169 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 170 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 171 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 172 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 173 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 174 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 175 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 176 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 177 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 178 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 179 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 180 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 181 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 182 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 183 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 184 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 185 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 186 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 187 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 188 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 189 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 190 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 191 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 194 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 203 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 205 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 208 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 212 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 213 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 215 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 217 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 218 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 221 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 222 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 223 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 224 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 225 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 226 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 227 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 228 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 229 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 230 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 231 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 232 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 233 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 234 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 235 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 236 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 237 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 238 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 239 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 241 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 242 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 243 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 244 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 245 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 246 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 256 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 264 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 267 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 268 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 270 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 271 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 272 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 285 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 288 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 290 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 332 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 336 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 337 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 338 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 339 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 340 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 341 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 342 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 343 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 344 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 345 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 346 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 347 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 348 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 349 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 350 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 351 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 352 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 353 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 354 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 355 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 356 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 357 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 358 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 359 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 360 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 361 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 362 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 363 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 364 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 365 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 366 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 367 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 406 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 407 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 408 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 409 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 410 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 411 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 413 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 418 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 419 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 420 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 421 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 422 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 434 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 435 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 437 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 438 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 439 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 444 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 445 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 446 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 447 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 449 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 450 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 451 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 452 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 453 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 454 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 455 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 457 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 459 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 460 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 461 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 462 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 463 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 465 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 466 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 467 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 468 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 469 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 470 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 471 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 472 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 473 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 474 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 475 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 476 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 477 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 478 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 479 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 480 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 481 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 482 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 483 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 484 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 485 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 486 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 487 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 488 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 489 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 490 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 491 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 492 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 493 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 494 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 495 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 496 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 497 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 498 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 499 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 500 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 501 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 502 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 503 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 504 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 505 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 506 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 507 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 508 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 509 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 510 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.4 |
| Metatranscriptomes | 0 |
| Isolates | 28.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.81 |
| Nodule | 18.03 |
| Rhizoplane | 5.2 |
| Rhizosphere | 41.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10037306 | 3300001989 | Bacteria | 1638 |
| 2 | JGI25162J39368_1002066 | 3300002737 | Bacteria | 8691 |
| 3 | JGI25152J39213_1000162 | 3300002773 | Bacteria | 45604 |
| 4 | JGI25152J39213_1007085 | 3300002773 | Bacteria | 2947 |
| 5 | JGI25159J45721_1000678 | 3300002987 | Bacteria | 15023 |
| 6 | JGI25159J45721_1002059 | 3300002987 | Bacteria | 7951 |
| 7 | JGI25151J46595_10000052 | 3300003187 | Bacteria | 159471 |
| 8 | JGI25151J46595_10065477 | 3300003187 | Bacteria | 1131 |
| 9 | JGI25153J46596_10000288 | 3300003215 | Bacteria | 38391 |
| 10 | JGI25153J46596_10001506 | 3300003215 | Bacteria | 13886 |
| 11 | JGI25153J46596_10001586 | 3300003215 | Bacteria | 13473 |
| 12 | JGI25153J46596_10003877 | 3300003215 | Bacteria | 8224 |
| 13 | JGI25153J46596_10015463 | 3300003215 | Bacteria | 3107 |
| 14 | JGI25153J46596_10018033 | 3300003215 | Bacteria | 2756 |
| 15 | JGI25153J46596_10028247 | 3300003215 | Bacteria | 1949 |
| 16 | rootH1_10064499 | 3300003316 | Bacteria | 2674 |
| 17 | rootH2_10005012 | 3300003320 | Bacteria | 11801 |
| 18 | rootL2_10011079 | 3300003322 | Bacteria | 2719 |
| 19 | rootL2_10162917 | 3300003322 | Bacteria | 1672 |
| 20 | rootH1_10109858 | 3300003323 | Bacteria | 4716 |
| 21 | JGI25160J50197_1000413 | 3300003354 | Bacteria | 27195 |
| 22 | JGI25160J50197_1001701 | 3300003354 | Bacteria | 10676 |
| 23 | JGI25160J50197_1038171 | 3300003354 | Bacteria | 1140 |
| 24 | JGI25161J50226_1000567 | 3300003374 | Bacteria | 15685 |
| 25 | JGI25161J50226_1000572 | 3300003374 | Bacteria | 15570 |
| 26 | JGI25161J50226_1000905 | 3300003374 | Bacteria | 10676 |
| 27 | Ga0055532_1000877 | 3300003758 | Bacteria | 10052 |
| 28 | Ga0055532_1000943 | 3300003758 | Bacteria | 9340 |
| 29 | Ga0055532_1000954 | 3300003758 | Bacteria | 9294 |
| 30 | Ga0055527_1000519 | 3300003760 | Bacteria | 13244 |
| 31 | Ga0055535_1001606 | 3300003761 | Bacteria | 10646 |
| 32 | Ga0055535_1001639 | 3300003761 | Bacteria | 10456 |
| 33 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 34 | Ga0055542_1001602 | 3300003762 | Bacteria | 10456 |
| 35 | Ga0055542_1003684 | 3300003762 | Bacteria | 4022 |
| 36 | Ga0055542_1004740 | 3300003762 | Bacteria | 3208 |
| 37 | Ga0055529_1001193 | 3300003763 | Bacteria | 10456 |
| 38 | Ga0055526_1005653 | 3300003771 | Bacteria | 7108 |
| 39 | Ga0055524_1001701 | 3300003775 | Bacteria | 12261 |
| 40 | Ga0055528_1000295 | 3300003790 | Bacteria | 42305 |
| 41 | Ga0055528_1001484 | 3300003790 | Bacteria | 14245 |
| 42 | Ga0055528_1005415 | 3300003790 | Bacteria | 5950 |
| 43 | Ga0055540_1002714 | 3300003792 | Bacteria | 9116 |
| 44 | Ga0058692_1014288 | 3300003856 | Bacteria | 1824 |
| 45 | Ga0055543_1000079 | 3300004625 | Bacteria | 84916 |
| 46 | Ga0055543_1000116 | 3300004625 | Bacteria | 67872 |
| 47 | Ga0055543_1002291 | 3300004625 | Bacteria | 6462 |
| 48 | Ga0065165_1000342 | 3300005262 | Bacteria | 76302 |
| 49 | Ga0065165_1002903 | 3300005262 | Bacteria | 13143 |
| 50 | Ga0065165_1015499 | 3300005262 | Bacteria | 2903 |
| 51 | Ga0070658_10015167 | 3300005327 | Bacteria | 6165 |
| 52 | Ga0070658_10284855 | 3300005327 | Bacteria | 1407 |
| 53 | Ga0070670_100009469 | 3300005331 | Bacteria | 8317 |
| 54 | Ga0068869_100041460 | 3300005334 | Bacteria | 3297 |
| 55 | Ga0068869_100087992 | 3300005334 | Bacteria | 2331 |
| 56 | Ga0068869_100313665 | 3300005334 | Bacteria | 1270 |
| 57 | Ga0070666_10033261 | 3300005335 | Bacteria | 3411 |
| 58 | Ga0070660_100000028 | 3300005339 | Bacteria | 88388 |
| 59 | Ga0070661_100011514 | 3300005344 | Bacteria | 6160 |
| 60 | Ga0070661_100177174 | 3300005344 | Bacteria | 1621 |
| 61 | Ga0070661_100359670 | 3300005344 | Bacteria | 1144 |
| 62 | Ga0070668_100015221 | 3300005347 | Bacteria | 5747 |
| 63 | Ga0070668_100076807 | 3300005347 | Bacteria | 2610 |
| 64 | Ga0070668_100207722 | 3300005347 | Bacteria | 1609 |
| 65 | Ga0070669_100154739 | 3300005353 | Bacteria | 1777 |
| 66 | Ga0070669_100169702 | 3300005353 | Bacteria | 1700 |
| 67 | Ga0070671_100083124 | 3300005355 | Bacteria | 2677 |
| 68 | Ga0070659_100000230 | 3300005366 | Bacteria | 43454 |
| 69 | Ga0070667_100033812 | 3300005367 | Bacteria | 4277 |
| 70 | Ga0070667_100070923 | 3300005367 | Bacteria | 2967 |
| 71 | Ga0070709_10001293 | 3300005434 | Bacteria | 13650 |
| 72 | Ga0070709_10026169 | 3300005434 | Bacteria | 3454 |
| 73 | Ga0070714_100045562 | 3300005435 | Bacteria | 3717 |
| 74 | Ga0070713_100009193 | 3300005436 | Bacteria | 7055 |
| 75 | Ga0070713_100105880 | 3300005436 | Bacteria | 2444 |
| 76 | Ga0070710_10000282 | 3300005437 | Bacteria | 24043 |
| 77 | Ga0070710_10048697 | 3300005437 | Bacteria | 2368 |
| 78 | Ga0070710_10129261 | 3300005437 | Bacteria | 1538 |
| 79 | Ga0070711_100014925 | 3300005439 | Bacteria | 4907 |
| 80 | Ga0070711_100020841 | 3300005439 | Bacteria | 4231 |
| 81 | Ga0070700_100073840 | 3300005441 | Bacteria | 2184 |
| 82 | Ga0070663_100000216 | 3300005455 | Bacteria | 28923 |
| 83 | Ga0070663_100003063 | 3300005455 | Bacteria | 9558 |
| 84 | Ga0070663_100009307 | 3300005455 | Bacteria | 6079 |
| 85 | Ga0070663_100013377 | 3300005455 | Bacteria | 5230 |
| 86 | Ga0070663_100023282 | 3300005455 | Bacteria | 4150 |
| 87 | Ga0070663_100056771 | 3300005455 | Bacteria | 2806 |
| 88 | Ga0070663_100201728 | 3300005455 | Bacteria | 1553 |
| 89 | Ga0070663_100262618 | 3300005455 | Bacteria | 1370 |
| 90 | Ga0070678_100026381 | 3300005456 | Bacteria | 3927 |
| 91 | Ga0070662_100006917 | 3300005457 | Bacteria | 7342 |
| 92 | Ga0070662_100007492 | 3300005457 | Bacteria | 7077 |
| 93 | Ga0070681_10083981 | 3300005458 | Bacteria | 3137 |
| 94 | Ga0068867_100320946 | 3300005459 | Bacteria | 1283 |
| 95 | Ga0070706_100047916 | 3300005467 | Bacteria | 3944 |
| 96 | Ga0070698_100051927 | 3300005471 | Bacteria | 4173 |
| 97 | Ga0070698_100192896 | 3300005471 | Bacteria | 1974 |
| 98 | Ga0070698_100208201 | 3300005471 | Bacteria | 1891 |
| 99 | Ga0070699_100106617 | 3300005518 | Bacteria | 2458 |
| 100 | Ga0070699_100274479 | 3300005518 | Bacteria | 1509 |
| 101 | Ga0070697_100046077 | 3300005536 | Bacteria | 3534 |
| 102 | Ga0068853_100024459 | 3300005539 | Bacteria | 5064 |
| 103 | Ga0068853_100472962 | 3300005539 | Bacteria | 1181 |
| 104 | Ga0070696_100026053 | 3300005546 | Bacteria | 3978 |
| 105 | Ga0070665_100000465 | 3300005548 | Bacteria | 58821 |
| 106 | Ga0070665_100000793 | 3300005548 | Bacteria | 41553 |
| 107 | Ga0070665_100003470 | 3300005548 | Bacteria | 16799 |
| 108 | Ga0070665_100006487 | 3300005548 | Bacteria | 11901 |
| 109 | Ga0070665_100009232 | 3300005548 | Bacteria | 9990 |
| 110 | Ga0070665_100033945 | 3300005548 | Bacteria | 5132 |
| 111 | Ga0070665_100122974 | 3300005548 | Bacteria | 2597 |
| 112 | Ga0070665_100166184 | 3300005548 | Bacteria | 2209 |
| 113 | Ga0070665_100274058 | 3300005548 | Bacteria | 1689 |
| 114 | Ga0070665_100497672 | 3300005548 | Bacteria | 1230 |
| 115 | Ga0070704_100029684 | 3300005549 | Bacteria | 3655 |
| 116 | Ga0068855_100177750 | 3300005563 | Bacteria | 2407 |
| 117 | Ga0068855_100403082 | 3300005563 | Bacteria | 1498 |
| 118 | Ga0068856_100173845 | 3300005614 | Bacteria | 2166 |
| 119 | Ga0068852_100029923 | 3300005616 | Bacteria | 4477 |
| 120 | Ga0068852_100192220 | 3300005616 | Bacteria | 1926 |
| 121 | Ga0068852_100715927 | 3300005616 | Bacteria | 1012 |
| 122 | Ga0068851_10002327 | 3300005834 | Bacteria | 8366 |
| 123 | Ga0068858_100013390 | 3300005842 | Bacteria | 7741 |
| 124 | Ga0068858_100163429 | 3300005842 | Bacteria | 2097 |
| 125 | Ga0068860_100008667 | 3300005843 | Bacteria | 10130 |
| 126 | Ga0081455_10001834 | 3300005937 | Bacteria | 25601 |
| 127 | Ga0081455_10046002 | 3300005937 | Bacteria | 3792 |
| 128 | Ga0081540_1001470 | 3300005983 | Bacteria | 20340 |
| 129 | Ga0081540_1018480 | 3300005983 | Bacteria | 4274 |
| 130 | Ga0081540_1027966 | 3300005983 | Bacteria | 3180 |
| 131 | Ga0075365_10002818 | 3300006038 | Bacteria | 8709 |
| 132 | Ga0075365_10038631 | 3300006038 | Bacteria | 3104 |
| 133 | Ga0075365_10049969 | 3300006038 | Bacteria | 2757 |
| 134 | Ga0075365_10227041 | 3300006038 | Bacteria | 1310 |
| 135 | Ga0075368_10032175 | 3300006042 | Bacteria | 2036 |
| 136 | Ga0075363_100043094 | 3300006048 | Bacteria | 2386 |
| 137 | Ga0075363_100063664 | 3300006048 | Bacteria | 1991 |
| 138 | Ga0075364_10020082 | 3300006051 | Bacteria | 4201 |
| 139 | Ga0070716_100031962 | 3300006173 | Bacteria | 2867 |
| 140 | Ga0070716_100112390 | 3300006173 | Bacteria | 1690 |
| 141 | Ga0070712_100005683 | 3300006175 | Bacteria | 7713 |
| 142 | Ga0070712_100016263 | 3300006175 | Bacteria | 4804 |
| 143 | Ga0075362_10000364 | 3300006177 | Bacteria | 13059 |
| 144 | Ga0075367_10001277 | 3300006178 | Bacteria | 10645 |
| 145 | Ga0075367_10029255 | 3300006178 | Bacteria | 3150 |
| 146 | Ga0075369_10002157 | 3300006186 | Bacteria | 6951 |
| 147 | Ga0075369_10041456 | 3300006186 | Bacteria | 1971 |
| 148 | Ga0075369_10093646 | 3300006186 | Bacteria | 1342 |
| 149 | Ga0075366_10072738 | 3300006195 | Bacteria | 2049 |
| 150 | Ga0097621_100186180 | 3300006237 | Bacteria | 1796 |
| 151 | Ga0075370_10006671 | 3300006353 | Bacteria | 5823 |
| 152 | Ga0075370_10140015 | 3300006353 | Bacteria | 1414 |
| 153 | Ga0075433_10268737 | 3300006852 | Bacteria | 1511 |
| 154 | Ga0075434_100002679 | 3300006871 | Bacteria | 15731 |
| 155 | Ga0075435_100226431 | 3300007076 | Bacteria | 1588 |
| 156 | Ga0099794_10006414 | 3300007265 | Bacteria | 4762 |
| 157 | Ga0099794_10013003 | 3300007265 | Bacteria | 3611 |
| 158 | Ga0099795_10003690 | 3300007788 | Bacteria | 3833 |
| 159 | Ga0099795_10085262 | 3300007788 | Bacteria | 1215 |
| 160 | Ga0105250_10019006 | 3300009092 | Bacteria | 2779 |
| 161 | Ga0105250_10059574 | 3300009092 | Bacteria | 1533 |
| 162 | Ga0105240_10000341 | 3300009093 | Bacteria | 87370 |
| 163 | Ga0105240_10000342 | 3300009093 | Bacteria | 87277 |
| 164 | Ga0105240_10001146 | 3300009093 | Bacteria | 46418 |
| 165 | Ga0105240_10014261 | 3300009093 | Bacteria | 10855 |
| 166 | Ga0105240_10070943 | 3300009093 | Bacteria | 4309 |
| 167 | Ga0105240_10424370 | 3300009093 | Bacteria | 1493 |
| 168 | Ga0105240_10545728 | 3300009093 | Bacteria | 1283 |
| 169 | Ga0111539_10000323 | 3300009094 | Bacteria | 58458 |
| 170 | Ga0105247_10014641 | 3300009101 | Bacteria | 4702 |
| 171 | Ga0105241_10065423 | 3300009174 | Bacteria | 2809 |
| 172 | Ga0105241_10074884 | 3300009174 | Bacteria | 2637 |
| 173 | Ga0105248_10002720 | 3300009177 | Bacteria | 19640 |
| 174 | Ga0105248_10079304 | 3300009177 | Bacteria | 3690 |
| 175 | Ga0105248_10290790 | 3300009177 | Bacteria | 1840 |
| 176 | Ga0105248_10793469 | 3300009177 | Bacteria | 1069 |
| 177 | Ga0105237_10001621 | 3300009545 | Bacteria | 29218 |
| 178 | Ga0105237_10004870 | 3300009545 | Bacteria | 15385 |
| 179 | Ga0105237_10018112 | 3300009545 | Bacteria | 7291 |
| 180 | Ga0105237_10115232 | 3300009545 | Bacteria | 2681 |
| 181 | Ga0105237_10127179 | 3300009545 | Bacteria | 2542 |
| 182 | Ga0105238_10008484 | 3300009551 | Bacteria | 10287 |
| 183 | Ga0105238_10025999 | 3300009551 | Bacteria | 5966 |
| 184 | Ga0105238_10075985 | 3300009551 | Bacteria | 3351 |
| 185 | Ga0105249_10003500 | 3300009553 | Bacteria | 13584 |
| 186 | Ga0105249_10007619 | 3300009553 | Bacteria | 9444 |
| 187 | Ga0099796_10000249 | 3300010159 | Bacteria | 8540 |
| 188 | Ga0099796_10000384 | 3300010159 | Bacteria | 7229 |
| 189 | Ga0105239_10000041 | 3300010375 | Bacteria | 200922 |
| 190 | Ga0105239_10078794 | 3300010375 | Bacteria | 3626 |
| 191 | Ga0105239_10124392 | 3300010375 | Bacteria | 2865 |
| 192 | Ga0105239_10125810 | 3300010375 | Bacteria | 2849 |
| 193 | Ga0105239_10129037 | 3300010375 | Bacteria | 2811 |
| 194 | Ga0105239_10723669 | 3300010375 | Bacteria | 1138 |
| 195 | Ga0105239_10742197 | 3300010375 | Bacteria | 1123 |
| 196 | Ga0157369_10112321 | 3300013105 | Bacteria | 2895 |
| 197 | Ga0157369_10338869 | 3300013105 | Bacteria | 1562 |
| 198 | Ga0157374_10228626 | 3300013296 | Bacteria | 1827 |
| 199 | Ga0163162_10218463 | 3300013306 | Bacteria | 2036 |
| 200 | Ga0157372_10030582 | 3300013307 | Bacteria | 5891 |
| 201 | Ga0163163_10097654 | 3300014325 | Bacteria | 2958 |
| 202 | Ga0157380_10369896 | 3300014326 | Bacteria | 1348 |
| 203 | Ga0182008_10000113 | 3300014497 | Bacteria | 61507 |
| 204 | Ga0157379_10376942 | 3300014968 | Bacteria | 1301 |
| 205 | Ga0157376_10190878 | 3300014969 | Bacteria | 1879 |
| 206 | Ga0157376_10441925 | 3300014969 | Bacteria | 1267 |
| 207 | Ga0157376_10518203 | 3300014969 | Bacteria | 1175 |
| 208 | Ga0182007_10000213 | 3300015262 | Bacteria | 38873 |
| 209 | Ga0182007_10002329 | 3300015262 | Bacteria | 9531 |
| 210 | Ga0182005_1019483 | 3300015265 | Bacteria | 1870 |
| 211 | Ga0163161_10245615 | 3300017792 | Bacteria | 1394 |
| 212 | Ga0163161_10399765 | 3300017792 | Bacteria | 1101 |
| 213 | Ga0213873_10002417 | 3300021358 | Bacteria | 3234 |
| 214 | Ga0213872_10003532 | 3300021361 | Bacteria | 8629 |
| 215 | Ga0213872_10007554 | 3300021361 | Bacteria | 5338 |
| 216 | Ga0213872_10008298 | 3300021361 | Bacteria | 5029 |
| 217 | Ga0213872_10024946 | 3300021361 | Bacteria | 2749 |
| 218 | Ga0213872_10024949 | 3300021361 | Bacteria | 2749 |
| 219 | Ga0213872_10025083 | 3300021361 | Bacteria | 2741 |
| 220 | Ga0213872_10032738 | 3300021361 | Bacteria | 2382 |
| 221 | Ga0213872_10073990 | 3300021361 | Bacteria | 1534 |
| 222 | Ga0213876_10001767 | 3300021384 | Bacteria | 13101 |
| 223 | Ga0213876_10002100 | 3300021384 | Bacteria | 11787 |
| 224 | Ga0209436_100066 | 3300025208 | Bacteria | 54510 |
| 225 | Ga0209566_100904 | 3300025225 | Bacteria | 14153 |
| 226 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 227 | Ga0209672_100069 | 3300025228 | Bacteria | 174956 |
| 228 | Ga0209672_100149 | 3300025228 | Bacteria | 62756 |
| 229 | Ga0209672_111727 | 3300025228 | Bacteria | 1119 |
| 230 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 231 | Ga0209147_100044 | 3300025229 | Bacteria | 300330 |
| 232 | Ga0209147_100128 | 3300025229 | Bacteria | 122259 |
| 233 | Ga0207427_101592 | 3300025231 | Bacteria | 7781 |
| 234 | Ga0209437_100180 | 3300025233 | Bacteria | 133661 |
| 235 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 236 | Ga0209258_100079 | 3300025242 | Bacteria | 263132 |
| 237 | Ga0209258_101986 | 3300025242 | Bacteria | 5931 |
| 238 | Ga0209677_101975 | 3300025253 | Bacteria | 8152 |
| 239 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 240 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 241 | Ga0209148_1000474 | 3300025254 | Bacteria | 42596 |
| 242 | Ga0209148_1000501 | 3300025254 | Bacteria | 39942 |
| 243 | Ga0209148_1001447 | 3300025254 | Bacteria | 12057 |
| 244 | Ga0209129_1000746 | 3300025258 | Bacteria | 20764 |
| 245 | Ga0209129_1006000 | 3300025258 | Bacteria | 4079 |
| 246 | Ga0209233_1008059 | 3300025261 | Bacteria | 3289 |
| 247 | Ga0209233_1017507 | 3300025261 | Bacteria | 1950 |
| 248 | Ga0209455_1000058 | 3300025272 | Bacteria | 342028 |
| 249 | Ga0209455_1001131 | 3300025272 | Bacteria | 12961 |
| 250 | Ga0209455_1007589 | 3300025272 | Bacteria | 3042 |
| 251 | Ga0209455_1011491 | 3300025272 | Bacteria | 2176 |
| 252 | Ga0209455_1012628 | 3300025272 | Bacteria | 2008 |
| 253 | Ga0209673_1000059 | 3300025273 | Bacteria | 268892 |
| 254 | Ga0209673_1000317 | 3300025273 | Bacteria | 88898 |
| 255 | Ga0209673_1001545 | 3300025273 | Bacteria | 20787 |
| 256 | Ga0209673_1014758 | 3300025273 | Bacteria | 3009 |
| 257 | Ga0209130_1000022 | 3300025284 | Bacteria | 361244 |
| 258 | Ga0209130_1000219 | 3300025284 | Bacteria | 74906 |
| 259 | Ga0209025_1000017 | 3300025294 | Bacteria | 768983 |
| 260 | Ga0209025_1015004 | 3300025294 | Bacteria | 4711 |
| 261 | Ga0209025_1048211 | 3300025294 | Bacteria | 1730 |
| 262 | Ga0209564_1000475 | 3300025295 | Bacteria | 67102 |
| 263 | Ga0209564_1008300 | 3300025295 | Bacteria | 5151 |
| 264 | Ga0209564_1012671 | 3300025295 | Bacteria | 3653 |
| 265 | Ga0209564_1013563 | 3300025295 | Bacteria | 3447 |
| 266 | Ga0209564_1026163 | 3300025295 | Bacteria | 1937 |
| 267 | Ga0209758_1000209 | 3300025297 | Bacteria | 128038 |
| 268 | Ga0209758_1000993 | 3300025297 | Bacteria | 37839 |
| 269 | Ga0209758_1004616 | 3300025297 | Bacteria | 11306 |
| 270 | Ga0209758_1007575 | 3300025297 | Bacteria | 7335 |
| 271 | Ga0209758_1036904 | 3300025297 | Bacteria | 1899 |
| 272 | Ga0209256_1000624 | 3300025299 | Bacteria | 48696 |
| 273 | Ga0209256_1022273 | 3300025299 | Bacteria | 1922 |
| 274 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 275 | Ga0207426_1000075 | 3300025302 | Bacteria | 321337 |
| 276 | Ga0207426_1000237 | 3300025302 | Bacteria | 124707 |
| 277 | Ga0207426_1017611 | 3300025302 | Bacteria | 2535 |
| 278 | Ga0209257_1025778 | 3300025304 | Bacteria | 1999 |
| 279 | Ga0209257_1036089 | 3300025304 | Bacteria | 1522 |
| 280 | Ga0207697_10035703 | 3300025315 | Bacteria | 2036 |
| 281 | Ga0207656_10005520 | 3300025321 | Bacteria | 4476 |
| 282 | Ga0207696_1028831 | 3300025711 | Bacteria | 1699 |
| 283 | Ga0207680_10023242 | 3300025903 | Bacteria | 3382 |
| 284 | Ga0207647_10002100 | 3300025904 | Bacteria | 15252 |
| 285 | Ga0207699_10001088 | 3300025906 | Bacteria | 12830 |
| 286 | Ga0207699_10003950 | 3300025906 | Bacteria | 7089 |
| 287 | Ga0207705_10029474 | 3300025909 | Bacteria | 3912 |
| 288 | Ga0207684_10170437 | 3300025910 | Bacteria | 1876 |
| 289 | Ga0207707_10043307 | 3300025912 | Bacteria | 3927 |
| 290 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 291 | Ga0207695_10000311 | 3300025913 | Bacteria | 117484 |
| 292 | Ga0207695_10003507 | 3300025913 | Bacteria | 21992 |
| 293 | Ga0207695_10005152 | 3300025913 | Bacteria | 17506 |
| 294 | Ga0207695_10023432 | 3300025913 | Bacteria | 6976 |
| 295 | Ga0207695_10224149 | 3300025913 | Bacteria | 1787 |
| 296 | Ga0207695_10268825 | 3300025913 | Bacteria | 1601 |
| 297 | Ga0207695_10325826 | 3300025913 | Bacteria | 1425 |
| 298 | Ga0207671_10013654 | 3300025914 | Bacteria | 6456 |
| 299 | Ga0207671_10020670 | 3300025914 | Bacteria | 5008 |
| 300 | Ga0207671_10022161 | 3300025914 | Bacteria | 4806 |
| 301 | Ga0207693_10001127 | 3300025915 | Bacteria | 23971 |
| 302 | Ga0207693_10008068 | 3300025915 | Bacteria | 8634 |
| 303 | Ga0207693_10024818 | 3300025915 | Bacteria | 4754 |
| 304 | Ga0207693_10036970 | 3300025915 | Bacteria | 3849 |
| 305 | Ga0207693_10039700 | 3300025915 | Bacteria | 3706 |
| 306 | Ga0207663_10050175 | 3300025916 | Bacteria | 2592 |
| 307 | Ga0207663_10229202 | 3300025916 | Bacteria | 1356 |
| 308 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 309 | Ga0207657_10048295 | 3300025919 | Bacteria | 3716 |
| 310 | Ga0207694_10037967 | 3300025924 | Bacteria | 3702 |
| 311 | Ga0207694_10080842 | 3300025924 | Bacteria | 2551 |
| 312 | Ga0207694_10233506 | 3300025924 | Bacteria | 1502 |
| 313 | Ga0207687_10260462 | 3300025927 | Bacteria | 1382 |
| 314 | Ga0207700_10005940 | 3300025928 | Bacteria | 7345 |
| 315 | Ga0207664_10008161 | 3300025929 | Bacteria | 7289 |
| 316 | Ga0207644_10040268 | 3300025931 | Bacteria | 3302 |
| 317 | Ga0207690_10000072 | 3300025932 | Bacteria | 88241 |
| 318 | Ga0207706_10001636 | 3300025933 | Bacteria | 22180 |
| 319 | Ga0207706_10013352 | 3300025933 | Bacteria | 7472 |
| 320 | Ga0207706_10141303 | 3300025933 | Bacteria | 2118 |
| 321 | Ga0207665_10024914 | 3300025939 | Bacteria | 3947 |
| 322 | Ga0207711_10035431 | 3300025941 | Bacteria | 4230 |
| 323 | Ga0207711_10145182 | 3300025941 | Bacteria | 2137 |
| 324 | Ga0207711_10578020 | 3300025941 | Bacteria | 1048 |
| 325 | Ga0207689_10002319 | 3300025942 | Bacteria | 17836 |
| 326 | Ga0207689_10153144 | 3300025942 | Bacteria | 1900 |
| 327 | Ga0207667_10036160 | 3300025949 | Bacteria | 5294 |
| 328 | Ga0207712_10001146 | 3300025961 | Bacteria | 18465 |
| 329 | Ga0207668_10009192 | 3300025972 | Bacteria | 5912 |
| 330 | Ga0207668_10073416 | 3300025972 | Bacteria | 2452 |
| 331 | Ga0207658_10017385 | 3300025986 | Bacteria | 4954 |
| 332 | Ga0207703_10011514 | 3300026035 | Bacteria | 6880 |
| 333 | Ga0207703_10056162 | 3300026035 | Bacteria | 3205 |
| 334 | Ga0207678_10000697 | 3300026067 | Bacteria | 30609 |
| 335 | Ga0207678_10001112 | 3300026067 | Bacteria | 24644 |
| 336 | Ga0207678_10007805 | 3300026067 | Bacteria | 9447 |
| 337 | Ga0207678_10026489 | 3300026067 | Bacteria | 5057 |
| 338 | Ga0207678_10030234 | 3300026067 | Bacteria | 4728 |
| 339 | Ga0207678_10127615 | 3300026067 | Bacteria | 2170 |
| 340 | Ga0207678_10279687 | 3300026067 | Bacteria | 1432 |
| 341 | Ga0207641_10130925 | 3300026088 | Bacteria | 2253 |
| 342 | Ga0207648_10245169 | 3300026089 | Bacteria | 1596 |
| 343 | Ga0207676_10110660 | 3300026095 | Bacteria | 2298 |
| 344 | Ga0207674_10046570 | 3300026116 | Bacteria | 4452 |
| 345 | Ga0207675_100000292 | 3300026118 | Bacteria | 48260 |
| 346 | Ga0207683_10014794 | 3300026121 | Bacteria | 6641 |
| 347 | Ga0207698_10090754 | 3300026142 | Bacteria | 2499 |
| 348 | Ga0207698_10112822 | 3300026142 | Bacteria | 2282 |
| 349 | Ga0209371_1000243 | 3300027312 | Bacteria | 67855 |
| 350 | Ga0209371_1002714 | 3300027312 | Bacteria | 9553 |
| 351 | Ga0209813_10005348 | 3300027866 | Bacteria | 3111 |
| 352 | Ga0207428_10000129 | 3300027907 | Bacteria | 104467 |
| 353 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 354 | Ga0268266_10005075 | 3300028379 | Bacteria | 12419 |
| 355 | Ga0268266_10005250 | 3300028379 | Bacteria | 12165 |
| 356 | Ga0268266_10019103 | 3300028379 | Bacteria | 5836 |
| 357 | Ga0268266_10123974 | 3300028379 | Bacteria | 2303 |
| 358 | Ga0268266_10179319 | 3300028379 | Bacteria | 1928 |
| 359 | Ga0268266_10182538 | 3300028379 | Bacteria | 1911 |
| 360 | Ga0268266_10283756 | 3300028379 | Bacteria | 1540 |
| 361 | Ga0268265_10256241 | 3300028380 | Bacteria | 1553 |
| 362 | Ga0268265_10346620 | 3300028380 | Bacteria | 1354 |
| 363 | Ga0268264_10032783 | 3300028381 | Bacteria | 4263 |
| 364 | Ga0307517_10079028 | 3300028786 | Bacteria | 2836 |
| 365 | Ga0268256_1000311 | 3300030500 | Bacteria | 48691 |
| 366 | Ga0268256_1013457 | 3300030500 | Bacteria | 2478 |
| 367 | Ga0265328_10017462 | 3300031239 | Bacteria | 2778 |
| 368 | Ga0307513_10106028 | 3300031456 | Bacteria | 2818 |
| 369 | Ga0265314_10025261 | 3300031711 | Bacteria | 4486 |
| 370 | Ga0265314_10026992 | 3300031711 | Bacteria | 4306 |
| 371 | Ga0307516_10000173 | 3300031730 | Bacteria | 82288 |
| 372 | Ga0307405_10030843 | 3300031731 | Bacteria | 3148 |
| 373 | Ga0307413_10025312 | 3300031824 | Bacteria | 3252 |
| 374 | Ga0307413_10162626 | 3300031824 | Bacteria | 1570 |
| 375 | Ga0307410_10138330 | 3300031852 | Bacteria | 1798 |
| 376 | Ga0307406_10351960 | 3300031901 | Bacteria | 1151 |
| 377 | Ga0307409_100042599 | 3300031995 | Bacteria | 3401 |
| 378 | Ga0307415_100150779 | 3300032126 | Bacteria | 1789 |
| 379 | Ga0307510_10035936 | 3300033180 | Bacteria | 5522 |
| 380 | Ga0395898_0344890 | 3300037466 | Bacteria | 1420 |
| 381 | Ga0395905_0065152 | 3300037471 | Bacteria | 3411 |
| 382 | Ga0436364_0645114 | 3300037853 | Bacteria | 6882 |
| 383 | Ga0395901_0511904 | 3300038443 | Bacteria | 1221 |
| 384 | Ga0436365_0657193 | 3300039437 | Bacteria | 19204 |
| 385 | Ga0436365_1279257 | 3300039437 | Bacteria | 36311 |
| 386 | Ga0436365_1865621 | 3300039437 | Bacteria | 2658 |
| 387 | Ga0436365_1925227 | 3300039437 | Bacteria | 1577 |
| 388 | Ga0436360_0695279 | 3300039438 | Bacteria | 4157 |
| 389 | Ga0436361_0013669 | 3300039447 | Bacteria | 8479 |
| 390 | Ga0436361_0113928 | 3300039447 | Bacteria | 16446 |
| 391 | Ga0436361_0176654 | 3300039447 | Bacteria | 6986 |
| 392 | Ga0436361_0254950 | 3300039447 | Bacteria | 2530 |
| 393 | Ga0436361_0373700 | 3300039447 | Bacteria | 30841 |
| 394 | Ga0436361_0438759 | 3300039447 | Bacteria | 2234 |
| 395 | Ga0436361_0556055 | 3300039447 | Bacteria | 1514 |
| 396 | Ga0436361_0573801 | 3300039447 | Bacteria | 1410 |
| 397 | Ga0436361_0578085 | 3300039447 | Bacteria | 1885 |
| 398 | Ga0436361_0853741 | 3300039447 | Bacteria | 2548 |
| 399 | Ga0436361_0864205 | 3300039447 | Bacteria | 6339 |
| 400 | Ga0436361_0867606 | 3300039447 | Bacteria | 1109 |
| 401 | Ga0436361_0878764 | 3300039447 | Bacteria | 1241 |
| 402 | Ga0436362_0775664 | 3300039453 | Bacteria | 3592 |
| 403 | Ga0451791_0877780 | 3300041451 | Bacteria | 1383 |
| 404 | Ga0451807_1909073 | 3300041486 | Bacteria | 1382 |
| 405 | Ga0451807_1989451 | 3300041486 | Bacteria | 1331 |
| 406 | Ga0451853_2623033 | 3300041512 | Bacteria | 1130 |
| 407 | Ga0439445_0069422 | 3300042004 | Bacteria | 973 |
| 408 | Ga0439459_0020950 | 3300042438 | Bacteria | 1251 |
| 409 | Ga0466972_0014613 | 3300044658 | Bacteria | 3930 |
| 410 | Ga0466972_0101415 | 3300044658 | Bacteria | 1362 |
| 411 | Ga0466966_0086206 | 3300044684 | Bacteria | 1952 |
| 412 | Ga0466964_0044554 | 3300044706 | Bacteria | 1802 |
| 413 | Ga0466968_0002924 | 3300044735 | Bacteria | 6310 |
| 414 | Ga0466960_0000523 | 3300044901 | Bacteria | 13157 |
| 415 | Ga0466959_0059664 | 3300045049 | Bacteria | 2778 |
| 416 | Ga0495603_0125792 | 3300046455 | Bacteria | 1494 |
| 417 | Ga0495603_0136956 | 3300046455 | Bacteria | 1425 |
| 418 | Ga0495629_0030964 | 3300046459 | Bacteria | 3790 |
| 419 | Ga0495638_0000009 | 3300046460 | Bacteria | 525345 |
| 420 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 421 | Ga0495638_0000087 | 3300046460 | Bacteria | 152531 |
| 422 | Ga0495638_0002575 | 3300046460 | Bacteria | 14674 |
| 423 | Ga0495638_0015368 | 3300046460 | Bacteria | 5142 |
| 424 | Ga0495638_0059152 | 3300046460 | Bacteria | 2374 |
| 425 | Ga0495651_0248764 | 3300046462 | Bacteria | 1215 |
| 426 | Ga0495650_0000122 | 3300046471 | Bacteria | 182888 |
| 427 | Ga0495607_0000153 | 3300046501 | Bacteria | 72099 |
| 428 | Ga0495606_0000056 | 3300046507 | Bacteria | 198575 |
| 429 | Ga0495606_0055014 | 3300046507 | Bacteria | 2575 |
| 430 | Ga0495606_0076189 | 3300046507 | Bacteria | 2097 |
| 431 | Ga0495606_0110303 | 3300046507 | Bacteria | 1661 |
| 432 | Ga0495608_0021552 | 3300046511 | Bacteria | 4422 |
| 433 | Ga0495610_0002011 | 3300046512 | Bacteria | 17382 |
| 434 | Ga0495610_0049377 | 3300046512 | Bacteria | 2061 |
| 435 | Ga0495618_0214160 | 3300046514 | Bacteria | 1217 |
| 436 | Ga0495620_0040402 | 3300046515 | Bacteria | 2053 |
| 437 | Ga0495628_0195993 | 3300046516 | Bacteria | 1524 |
| 438 | Ga0495643_0082518 | 3300046522 | Bacteria | 1670 |
| 439 | Ga0495648_0063920 | 3300046524 | Bacteria | 2170 |
| 440 | Ga0495648_0096282 | 3300046524 | Bacteria | 1645 |
| 441 | Ga0495648_0099119 | 3300046524 | Bacteria | 1613 |
| 442 | Ga0495622_0004123 | 3300046557 | Bacteria | 6778 |
| 443 | Ga0495622_0052407 | 3300046557 | Bacteria | 1893 |
| 444 | Ga0495622_0089882 | 3300046557 | Bacteria | 1411 |
| 445 | Ga0495633_0006338 | 3300046558 | Bacteria | 7037 |
| 446 | Ga0495668_0022905 | 3300046616 | Bacteria | 3567 |
| 447 | Ga0495668_0045777 | 3300046616 | Bacteria | 2432 |
| 448 | Ga0495611_0019278 | 3300046648 | Bacteria | 2929 |
| 449 | Ga0495625_0191804 | 3300046660 | Bacteria | 1353 |
| 450 | Ga0495635_0110071 | 3300046663 | Bacteria | 1882 |
| 451 | Ga0495588_0017345 | 3300046674 | Bacteria | 3494 |
| 452 | Ga0495588_0182175 | 3300046674 | Bacteria | 1110 |
| 453 | Ga0495657_0012111 | 3300046675 | Bacteria | 6418 |
| 454 | Ga0495669_0095275 | 3300046684 | Bacteria | 1378 |
| 455 | Ga0495624_0043274 | 3300046690 | Bacteria | 2873 |
| 456 | Ga0495649_0000266 | 3300046694 | Bacteria | 46547 |
| 457 | Ga0495649_0025343 | 3300046694 | Bacteria | 3303 |
| 458 | Ga0495649_0115837 | 3300046694 | Bacteria | 1419 |
| 459 | Ga0495589_0061400 | 3300046794 | Bacteria | 1845 |
| 460 | Ga0495600_0006748 | 3300046809 | Bacteria | 6996 |
| 461 | Ga0495604_0059741 | 3300047317 | Bacteria | 2921 |
| 462 | Ga0495604_0062128 | 3300047317 | Bacteria | 2855 |
| 463 | Ga0495672_0017814 | 3300047320 | Bacteria | 4739 |
| 464 | Ga0495672_0037889 | 3300047320 | Bacteria | 2947 |
| 465 | Ga0495672_0067556 | 3300047320 | Bacteria | 2036 |
| 466 | Ga0495676_0076376 | 3300047321 | Bacteria | 2558 |
| 467 | Ga0495683_0057977 | 3300047323 | Bacteria | 1924 |
| 468 | Ga0495687_041587 | 3300047443 | Bacteria | 2015 |
| 469 | Ga0495673_0006912 | 3300047469 | Bacteria | 6608 |
| 470 | Ga0495673_0030030 | 3300047469 | Bacteria | 2559 |
| 471 | Ga0495673_0037110 | 3300047469 | Bacteria | 2229 |
| 472 | Ga0495686_0000082 | 3300047472 | Bacteria | 200115 |
| 473 | Ga0495686_0000115 | 3300047472 | Bacteria | 166876 |
| 474 | Ga0495686_0001009 | 3300047472 | Bacteria | 34155 |
| 475 | Ga0495686_0002800 | 3300047472 | Bacteria | 15833 |
| 476 | Ga0495686_0084900 | 3300047472 | Bacteria | 1929 |
| 477 | Ga0495686_0117141 | 3300047472 | Bacteria | 1592 |
| 478 | Ga0495686_0165502 | 3300047472 | Bacteria | 1289 |
| 479 | Ga0495602_0160008 | 3300048088 | Bacteria | 1759 |
| 480 | Ga0495626_0022209 | 3300048091 | Bacteria | 3136 |
| 481 | Ga0495626_0030480 | 3300048091 | Bacteria | 2602 |
| 482 | Ga0496100_0011936 | 3300048903 | Bacteria | 4964 |
| 483 | Ga0496100_0204274 | 3300048903 | Bacteria | 1442 |
| 484 | Ga0496100_0332260 | 3300048903 | Bacteria | 1144 |
| 485 | Ga0496101_0007946 | 3300048904 | Bacteria | 6911 |
| 486 | Ga0496102_0030791 | 3300048905 | Bacteria | 4805 |
| 487 | Ga0496102_0184978 | 3300048905 | Bacteria | 1963 |
| 488 | Ga0496103_0031700 | 3300048906 | Bacteria | 3222 |
| 489 | Ga0496103_0182758 | 3300048906 | Bacteria | 1348 |
| 490 | Ga0496104_0012050 | 3300048907 | Bacteria | 7761 |
| 491 | Ga0496104_0026005 | 3300048907 | Bacteria | 5398 |
| 492 | Ga0496104_0026950 | 3300048907 | Bacteria | 5313 |
| 493 | Ga0496104_0339040 | 3300048907 | Bacteria | 1416 |
| 494 | Ga0496104_0434192 | 3300048907 | Bacteria | 1225 |
| 495 | Ga0496105_0001350 | 3300048908 | Bacteria | 17227 |
| 496 | Ga0496105_0016203 | 3300048908 | Bacteria | 5946 |
| 497 | Ga0496105_0236866 | 3300048908 | Bacteria | 1482 |
| 498 | Ga0496106_0001156 | 3300048909 | Bacteria | 19573 |
| 499 | Ga0496106_0023403 | 3300048909 | Bacteria | 4589 |
| 500 | Ga0496106_0250532 | 3300048909 | Bacteria | 1416 |
| 501 | Ga0496107_0017737 | 3300048910 | Bacteria | 5010 |
| 502 | Ga0496107_0092308 | 3300048910 | Bacteria | 2213 |
| 503 | Ga0496107_0368365 | 3300048910 | Bacteria | 1069 |
| 504 | Ga0496108_0291011 | 3300048911 | Bacteria | 1422 |
| 505 | Ga0496110_0122095 | 3300048913 | Bacteria | 2348 |
| 506 | Ga0496110_0170925 | 3300048913 | Bacteria | 1972 |
| 507 | Ga0496110_0429567 | 3300048913 | Bacteria | 1204 |
| 508 | Ga0496112_0087933 | 3300048915 | Bacteria | 3075 |
| 509 | Ga0496112_0260247 | 3300048915 | Bacteria | 1684 |
| 510 | Ga0496113_0082330 | 3300048916 | Bacteria | 2468 |
| 511 | Ga0496113_0250350 | 3300048916 | Bacteria | 1414 |
| 512 | Ga0496114_0022782 | 3300048917 | Bacteria | 5105 |
| 513 | Ga0496114_0119050 | 3300048917 | Bacteria | 2270 |
| 514 | Ga0496114_0262885 | 3300048917 | Bacteria | 1520 |
| 515 | Ga0496115_0000046 | 3300048918 | Bacteria | 112212 |
| 516 | Ga0496115_0024882 | 3300048918 | Bacteria | 4656 |
| 517 | Ga0496115_0037934 | 3300048918 | Bacteria | 3821 |
| 518 | Ga0496115_0053435 | 3300048918 | Bacteria | 3242 |
| 519 | Ga0496116_0001677 | 3300048919 | Bacteria | 24306 |
| 520 | Ga0496116_0010236 | 3300048919 | Bacteria | 7886 |
| 521 | Ga0496116_0063653 | 3300048919 | Bacteria | 2375 |
| 522 | Ga0496116_0070663 | 3300048919 | Bacteria | 2214 |
| 523 | Ga0496116_0085461 | 3300048919 | Bacteria | 1939 |
| 524 | Ga0496117_0004582 | 3300048920 | Bacteria | 15118 |
| 525 | Ga0496117_0020523 | 3300048920 | Bacteria | 5381 |
| 526 | Ga0496117_0096802 | 3300048920 | Bacteria | 1882 |
| 527 | Ga0496117_0106887 | 3300048920 | Bacteria | 1755 |
| 528 | Ga0496117_0145123 | 3300048920 | Bacteria | 1414 |
| 529 | Ga0496118_0000994 | 3300048921 | Bacteria | 44167 |
| 530 | Ga0496118_0008990 | 3300048921 | Bacteria | 10191 |
| 531 | Ga0496118_0010661 | 3300048921 | Bacteria | 9066 |
| 532 | Ga0496118_0010965 | 3300048921 | Bacteria | 8906 |
| 533 | Ga0496118_0023061 | 3300048921 | Bacteria | 5419 |
| 534 | Ga0496118_0074173 | 3300048921 | Bacteria | 2433 |
| 535 | Ga0496119_0000191 | 3300048922 | Bacteria | 86355 |
| 536 | Ga0496119_0002194 | 3300048922 | Bacteria | 21820 |
| 537 | Ga0496119_0004102 | 3300048922 | Bacteria | 14685 |
| 538 | Ga0496119_0046340 | 3300048922 | Bacteria | 2716 |
| 539 | Ga0496119_0057536 | 3300048922 | Bacteria | 2349 |
| 540 | Ga0496119_0088763 | 3300048922 | Bacteria | 1762 |
| 541 | Ga0496119_0104136 | 3300048922 | Bacteria | 1588 |
| 542 | Ga0496119_0147182 | 3300048922 | Bacteria | 1266 |
| 543 | Ga0496120_0000321 | 3300048923 | Bacteria | 79469 |
| 544 | Ga0496120_0000350 | 3300048923 | Bacteria | 75997 |
| 545 | Ga0496120_0014557 | 3300048923 | Bacteria | 5236 |
| 546 | Ga0496120_0180120 | 3300048923 | Bacteria | 1038 |
| 547 | Ga0496121_0000013 | 3300048924 | Bacteria | 614976 |
| 548 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 549 | Ga0496121_0000091 | 3300048924 | Bacteria | 216685 |
| 550 | Ga0496121_0000523 | 3300048924 | Bacteria | 73281 |
| 551 | Ga0496121_0001346 | 3300048924 | Bacteria | 41986 |
| 552 | Ga0496121_0009992 | 3300048924 | Bacteria | 10791 |
| 553 | Ga0496121_0016618 | 3300048924 | Bacteria | 7583 |
| 554 | Ga0496121_0018898 | 3300048924 | Bacteria | 6917 |
| 555 | Ga0496121_0020649 | 3300048924 | Bacteria | 6502 |
| 556 | Ga0496121_0021639 | 3300048924 | Bacteria | 6288 |
| 557 | Ga0496121_0027463 | 3300048924 | Bacteria | 5326 |
| 558 | Ga0496121_0027976 | 3300048924 | Bacteria | 5263 |
| 559 | Ga0496121_0037444 | 3300048924 | Bacteria | 4308 |
| 560 | Ga0496121_0043315 | 3300048924 | Bacteria | 3900 |
| 561 | Ga0496121_0049552 | 3300048924 | Bacteria | 3560 |
| 562 | Ga0496121_0094143 | 3300048924 | Bacteria | 2331 |
| 563 | Ga0496121_0105968 | 3300048924 | Bacteria | 2156 |
| 564 | Ga0496121_0333505 | 3300048924 | Bacteria | 1016 |
| 565 | Ga0496122_0004397 | 3300048925 | Bacteria | 17546 |
| 566 | Ga0496122_0014172 | 3300048925 | Bacteria | 7730 |
| 567 | Ga0496122_0043901 | 3300048925 | Bacteria | 3497 |
| 568 | Ga0496122_0148094 | 3300048925 | Bacteria | 1455 |
| 569 | Ga0496123_0004520 | 3300048926 | Bacteria | 14540 |
| 570 | Ga0496123_0105700 | 3300048926 | Bacteria | 1624 |
| 571 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 572 | Ga0496124_0007731 | 3300048927 | Bacteria | 11364 |
| 573 | Ga0496124_0055978 | 3300048927 | Bacteria | 3330 |
| 574 | Ga0496124_0076382 | 3300048927 | Bacteria | 2765 |
| 575 | Ga0496124_0285366 | 3300048927 | Bacteria | 1201 |
| 576 | Ga0496125_0003653 | 3300048928 | Bacteria | 18409 |
| 577 | Ga0496125_0006913 | 3300048928 | Bacteria | 12147 |
| 578 | Ga0496125_0072614 | 3300048928 | Bacteria | 2680 |
| 579 | Ga0496125_0143595 | 3300048928 | Bacteria | 1655 |
| 580 | Ga0496126_0001231 | 3300048929 | Bacteria | 41618 |
| 581 | Ga0496126_0006108 | 3300048929 | Bacteria | 13507 |
| 582 | Ga0496126_0010532 | 3300048929 | Bacteria | 9682 |
| 583 | Ga0496126_0012983 | 3300048929 | Bacteria | 8502 |
| 584 | Ga0496126_0016215 | 3300048929 | Bacteria | 7462 |
| 585 | Ga0496126_0016512 | 3300048929 | Bacteria | 7379 |
| 586 | Ga0496126_0031271 | 3300048929 | Bacteria | 5032 |
| 587 | Ga0496126_0061981 | 3300048929 | Bacteria | 3357 |
| 588 | Ga0496126_0073507 | 3300048929 | Bacteria | 3039 |
| 589 | Ga0496126_0077646 | 3300048929 | Bacteria | 2943 |
| 590 | Ga0496126_0090220 | 3300048929 | Bacteria | 2697 |
| 591 | Ga0496126_0115683 | 3300048929 | Bacteria | 2331 |
| 592 | Ga0496126_0147537 | 3300048929 | Bacteria | 2019 |
| 593 | Ga0495682_0118812 | 3300049460 | Bacteria | 947 |
| 594 | Ga0501032_0007464 | 3300049569 | Bacteria | 7987 |
| 595 | Ga0501043_0003245 | 3300049579 | Bacteria | 13416 |
| 596 | Ga0501047_0000197 | 3300049581 | Bacteria | 72751 |
| 597 | Ga0501048_0106838 | 3300049582 | Bacteria | 1976 |
| 598 | nmdc:mga03683_526_c1 | 3300050489 | Bacteria | 10955 |
| 599 | nmdc:mga03n38_154063_c1 | 3300050490 | Bacteria | 1159 |
| 600 | nmdc:mga00v17_290579_c1 | 3300050491 | Bacteria | 1061 |
| 601 | nmdc:mga0yw44_2128_c1 | 3300050492 | Bacteria | 8301 |
| 602 | nmdc:mga0yw44_5700_c1 | 3300050492 | Bacteria | 5929 |
| 603 | nmdc:mga0yw44_74583_c1 | 3300050492 | Bacteria | 2113 |
| 604 | nmdc:mga0k408_165090_c1 | 3300050493 | Bacteria | 1319 |
| 605 | nmdc:mga0k408_42731_c1 | 3300050493 | Bacteria | 2610 |
| 606 | nmdc:mga06z11_1300_c1 | 3300050494 | Bacteria | 9231 |
| 607 | nmdc:mga06z11_1614_c1 | 3300050494 | Bacteria | 8419 |
| 608 | nmdc:mga07m45_4015_c1 | 3300050496 | Bacteria | 7162 |
| 609 | nmdc:mga07m45_85991_c1 | 3300050496 | Bacteria | 1798 |
| 610 | nmdc:mga08y16_51_c1 | 3300050511 | Bacteria | 105348 |
| 611 | nmdc:mga0n895_3215_c1 | 3300050512 | Bacteria | 13079 |
| 612 | nmdc:mga0rr50_25604_c1 | 3300050513 | Bacteria | 4104 |
| 613 | nmdc:mga0sz30_15_c1 | 3300050516 | Bacteria | 83405 |
| 614 | Ga0500610_0029902 | 3300053079 | Bacteria | 2756 |
| 615 | Ga0500635_0011635 | 3300053080 | Bacteria | 2507 |
| 616 | Ga0500643_000097 | 3300053087 | Bacteria | 92120 |
| 617 | Ga0500643_005357 | 3300053087 | Bacteria | 5544 |
| 618 | Ga0500644_0108065 | 3300053088 | Bacteria | 1067 |
| 619 | Ga0500566_0000029 | 3300053094 | Bacteria | 75384 |
| 620 | Ga0500640_045153 | 3300053095 | Bacteria | 1933 |
| 621 | Ga0500555_009080 | 3300053103 | Bacteria | 2840 |
| 622 | Ga0500572_002243 | 3300053111 | Bacteria | 4717 |
| 623 | Ga0500594_0042786 | 3300053118 | Bacteria | 1246 |
| 624 | Ga0500595_001774 | 3300053119 | Bacteria | 11225 |
| 625 | Ga0500595_002719 | 3300053119 | Bacteria | 8565 |
| 626 | Ga0500595_003102 | 3300053119 | Bacteria | 7868 |
| 627 | Ga0500595_003885 | 3300053119 | Bacteria | 6859 |
| 628 | Ga0500608_036746 | 3300053122 | Bacteria | 2339 |
| 629 | Ga0500618_025929 | 3300053125 | Bacteria | 1402 |
| 630 | Ga0500559_0027379 | 3300053136 | Bacteria | 2433 |
| 631 | Ga0500564_016690 | 3300053138 | Bacteria | 3328 |
| 632 | Ga0500568_0000082 | 3300053139 | Bacteria | 92308 |
| 633 | Ga0500568_0005342 | 3300053139 | Bacteria | 6656 |
| 634 | Ga0500568_0024552 | 3300053139 | Bacteria | 2551 |
| 635 | Ga0500568_0031679 | 3300053139 | Bacteria | 2180 |
| 636 | Ga0500577_0096614 | 3300053142 | Bacteria | 1202 |
| 637 | Ga0500619_006051 | 3300053154 | Bacteria | 2754 |
| 638 | Ga0500622_0002004 | 3300053156 | Bacteria | 15220 |
| 639 | Ga0500638_027971 | 3300053162 | Bacteria | 2708 |
| 640 | Ga0500636_0000420 | 3300053177 | Bacteria | 23339 |
| 641 | Ga0500636_0002621 | 3300053177 | Bacteria | 9991 |
| 642 | Ga0500645_000065 | 3300053730 | Bacteria | 82414 |
| 643 | Ga0500601_000525 | 3300053737 | Bacteria | 5772 |
| 644 | Ga0500661_003363 | 3300055283 | Bacteria | 3009 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2904578770 | 2904582770 | 242 |
| 2 | 3300042438 | Ga0439459_0020950 | Ga0439459_0020950_461_1240 | 244 |
| 3 | 3300050492 | nmdc:mga0yw44_74583_c1 | nmdc:mga0yw44_74583_c1_41_820 | 244 |
| 4 | 3300039453 | Ga0436362_0775664 | Ga0436362_0775664_31_837 | 249 |
| 5 | 3300047317 | Ga0495604_0062128 | Ga0495604_0062128_1318_2109 | 249 |
| 6 | 3300053136 | Ga0500559_0027379 | Ga0500559_0027379_1625_2416 | 249 |
| 7 | 3300042004 | Ga0439445_0069422 | Ga0439445_0069422_11_811 | 251 |
| 8 | 3300048919 | Ga0496116_0063653 | Ga0496116_0063653_1533_2339 | 253 |
| 9 | iso_pu_bacteria | 2928963466 | 2928963723 | 256 |
| 10 | 3300053125 | Ga0500618_025929 | Ga0500618_025929_25_852 | 257 |
| 11 | iso_pu_bacteria | 2874590934 | 2874594164 | 261 |
| 12 | iso_pu_bacteria | 2874645413 | 2874651936 | 261 |
| 13 | iso_pu_bacteria | 2876771140 | 2876773608 | 261 |
| 14 | iso_pu_bacteria | 2876818435 | 2876824764 | 261 |
| 15 | iso_pu_bacteria | 2879074833 | 2879081491 | 261 |
| 16 | 3300048903 | Ga0496100_0011936 | Ga0496100_0011936_27_875 | 267 |
| 17 | 3300048910 | Ga0496107_0368365 | Ga0496107_0368365_71_919 | 267 |
| 18 | 3300048922 | Ga0496119_0004102 | Ga0496119_0004102_891_1742 | 267 |
| 19 | 3300010375 | Ga0105239_10078794 | Ga0105239_100787943 | 268 |
| 20 | 3300046455 | Ga0495603_0136956 | Ga0495603_0136956_102_1028 | 268 |
| 21 | 3300048920 | Ga0496117_0106887 | Ga0496117_0106887_38_889 | 268 |
| 22 | 3300047472 | Ga0495686_0084900 | Ga0495686_0084900_25_885 | 269 |
| 23 | iso_pu_bacteria | 8019538911 | 8019544658 | 269 |
| 24 | 3300003187 | JGI25151J46595_10000052 | JGI25151J46595_10000052140 | 275 |
| 25 | 3300025294 | Ga0209025_1000017 | Ga0209025_100001728 | 275 |
| 26 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_290612_291511 | 275 |
| 27 | iso_pu_bacteria | 2765235802 | 2765469232 | 278 |
| 28 | 3300021384 | Ga0213876_10002100 | Ga0213876_100021005 | 279 |
| 29 | 3300037466 | Ga0395898_0344890 | Ga0395898_0344890_229_1158 | 279 |
| 30 | 3300039437 | Ga0436365_0657193 | Ga0436365_0657193_10058_10996 | 279 |
| 31 | 3300047472 | Ga0495686_0001009 | Ga0495686_0001009_28793_29728 | 279 |
| 32 | 3300025295 | Ga0209564_1012671 | Ga0209564_10126715 | 280 |
| 33 | iso_pu_bacteria | 2874102143 | 2874106566 | 280 |
| 34 | iso_pu_bacteria | 2958092219 | 2958094602 | 280 |
| 35 | 3300007265 | Ga0099794_10006414 | Ga0099794_100064142 | 281 |
| 36 | 3300048913 | Ga0496110_0429567 | Ga0496110_0429567_25_912 | 281 |
| 37 | 3300021361 | Ga0213872_10003532 | Ga0213872_100035323 | 282 |
| 38 | 3300021361 | Ga0213872_10007554 | Ga0213872_100075542 | 282 |
| 39 | 3300021361 | Ga0213872_10024946 | Ga0213872_100249463 | 282 |
| 40 | 3300021361 | Ga0213872_10024949 | Ga0213872_100249493 | 282 |
| 41 | 3300021361 | Ga0213872_10025083 | Ga0213872_100250833 | 282 |
| 42 | 3300039447 | Ga0436361_0013669 | Ga0436361_0013669_620_1510 | 282 |
| 43 | 3300039447 | Ga0436361_0254950 | Ga0436361_0254950_1618_2508 | 282 |
| 44 | 3300039447 | Ga0436361_0573801 | Ga0436361_0573801_373_1263 | 282 |
| 45 | 3300039447 | Ga0436361_0853741 | Ga0436361_0853741_323_1213 | 282 |
| 46 | 3300039447 | Ga0436361_0878764 | Ga0436361_0878764_231_1121 | 282 |
| 47 | iso_pu_bacteria | 2602042107 | 2603860183 | 282 |
| 48 | 3300025915 | Ga0207693_10036970 | Ga0207693_100369705 | 283 |
| 49 | 3300039437 | Ga0436365_1865621 | Ga0436365_1865621_1483_2415 | 283 |
| 50 | 3300047320 | Ga0495672_0037889 | Ga0495672_0037889_1970_2866 | 283 |
| 51 | iso_pu_bacteria | 2508501042 | 2508693070 | 283 |
| 52 | iso_pu_bacteria | 2513237095 | 2513649323 | 283 |
| 53 | iso_pu_bacteria | 2513237104 | 2513721372 | 283 |
| 54 | iso_pu_bacteria | 2515154112 | 2515630077 | 283 |
| 55 | iso_pu_bacteria | 2524023205 | 2524441257 | 283 |
| 56 | iso_pu_bacteria | 2524023228 | 2524539456 | 283 |
| 57 | iso_pu_bacteria | 2528768022 | 2528851737 | 283 |
| 58 | iso_pu_bacteria | 2615840698 | 2616555367 | 283 |
| 59 | iso_pu_bacteria | 2617270742 | 2617382439 | 283 |
| 60 | iso_pu_bacteria | 2667528175 | 2671118197 | 283 |
| 61 | iso_pu_bacteria | 2744054633 | 2745082191 | 283 |
| 62 | iso_pu_bacteria | 2816332527 | 2818240713 | 283 |
| 63 | iso_pu_bacteria | 2818991448 | 2819608138 | 283 |
| 64 | iso_pu_bacteria | 2824661429 | 2824668183 | 283 |
| 65 | iso_pu_bacteria | 2824773399 | 2824777821 | 283 |
| 66 | iso_pu_bacteria | 2841949485 | 2841954919 | 283 |
| 67 | iso_pu_bacteria | 2841974524 | 2841980359 | 283 |
| 68 | iso_pu_bacteria | 2841983080 | 2841988525 | 283 |
| 69 | iso_pu_bacteria | 2879099564 | 2879105199 | 283 |
| 70 | iso_pu_bacteria | 2888378607 | 2888380319 | 283 |
| 71 | iso_pu_bacteria | 2904699407 | 2904706999 | 283 |
| 72 | iso_pu_bacteria | 2922368715 | 2922371706 | 283 |
| 73 | iso_pu_bacteria | 2932784394 | 2932790661 | 283 |
| 74 | iso_pu_bacteria | 2932809354 | 2932811858 | 283 |
| 75 | iso_pu_bacteria | 2932818245 | 2932822656 | 283 |
| 76 | iso_pu_bacteria | 2932828146 | 2932835558 | 283 |
| 77 | iso_pu_bacteria | 2935616580 | 2935624712 | 283 |
| 78 | iso_pu_bacteria | 2935638405 | 2935646157 | 283 |
| 79 | iso_pu_bacteria | 2935665750 | 2935670726 | 283 |
| 80 | iso_pu_bacteria | 2935675223 | 2935679535 | 283 |
| 81 | iso_pu_bacteria | 2935675223 | 2935683580 | 283 |
| 82 | iso_pu_bacteria | 2935684952 | 2935691449 | 283 |
| 83 | iso_pu_bacteria | 2935684952 | 2935693457 | 283 |
| 84 | iso_pu_bacteria | 2935694250 | 2935701904 | 283 |
| 85 | iso_pu_bacteria | 2935703347 | 2935704519 | 283 |
| 86 | iso_pu_bacteria | 2935713505 | 2935719283 | 283 |
| 87 | iso_pu_bacteria | 2935713505 | 2935721647 | 283 |
| 88 | iso_pu_bacteria | 2935722832 | 2935729117 | 283 |
| 89 | iso_pu_bacteria | 2935722832 | 2935731023 | 283 |
| 90 | iso_pu_bacteria | 2935732158 | 2935737642 | 283 |
| 91 | iso_pu_bacteria | 2935732158 | 2935740786 | 283 |
| 92 | iso_pu_bacteria | 2935741537 | 2935747018 | 283 |
| 93 | iso_pu_bacteria | 2935741537 | 2935750050 | 283 |
| 94 | iso_pu_bacteria | 2935750917 | 2935758182 | 283 |
| 95 | iso_pu_bacteria | 2935750917 | 2935759440 | 283 |
| 96 | iso_pu_bacteria | 2935760218 | 2935768859 | 283 |
| 97 | iso_pu_bacteria | 2935760218 | 2935769224 | 283 |
| 98 | iso_pu_bacteria | 2935801545 | 2935809151 | 283 |
| 99 | iso_pu_bacteria | 2935810662 | 2935816495 | 283 |
| 100 | iso_pu_bacteria | 2935827899 | 2935835465 | 283 |
| 101 | iso_pu_bacteria | 2935837841 | 2935845771 | 283 |
| 102 | iso_pu_bacteria | 2935855204 | 2935863375 | 283 |
| 103 | iso_pu_bacteria | 2935864058 | 2935871451 | 283 |
| 104 | iso_pu_bacteria | 2935873716 | 2935881700 | 283 |
| 105 | iso_pu_bacteria | 2935975950 | 2935981821 | 283 |
| 106 | iso_pu_bacteria | 2935992306 | 2935993880 | 283 |
| 107 | iso_pu_bacteria | 2936002035 | 2936009694 | 283 |
| 108 | iso_pu_bacteria | 2936037263 | 2936042553 | 283 |
| 109 | iso_pu_bacteria | 2940556831 | 2940563907 | 283 |
| 110 | iso_pu_bacteria | 2940556831 | 2940565344 | 283 |
| 111 | iso_pu_bacteria | 2941538514 | 2941545945 | 283 |
| 112 | iso_pu_bacteria | 3005416602 | 3005420925 | 283 |
| 113 | iso_pu_bacteria | 3005594810 | 3005595763 | 283 |
| 114 | iso_pu_bacteria | 8005314921 | 8005319340 | 283 |
| 115 | iso_pu_bacteria | 8005484373 | 8005487796 | 283 |
| 116 | iso_pu_bacteria | 8005645114 | 8005650284 | 283 |
| 117 | iso_pu_bacteria | 8005682033 | 8005685754 | 283 |
| 118 | iso_pu_bacteria | 8006933436 | 8006934781 | 283 |
| 119 | iso_pu_bacteria | 8006973647 | 8006974749 | 283 |
| 120 | iso_pu_bacteria | 8016511872 | 8016516050 | 283 |
| 121 | iso_pu_bacteria | 8017057580 | 8017060466 | 283 |
| 122 | iso_pu_bacteria | 8019576017 | 8019579942 | 283 |
| 123 | iso_pu_bacteria | 8019586578 | 8019587654 | 283 |
| 124 | iso_pu_bacteria | 8019597564 | 8019603674 | 283 |
| 125 | iso_pu_bacteria | 8019608314 | 8019614853 | 283 |
| 126 | iso_pu_bacteria | 8019629233 | 8019629577 | 283 |
| 127 | iso_pu_bacteria | 8019638758 | 8019648779 | 283 |
| 128 | iso_pu_bacteria | 8019659431 | 8019659783 | 283 |
| 129 | iso_pu_bacteria | 8019668869 | 8019669165 | 283 |
| 130 | iso_pu_bacteria | 8019678201 | 8019678237 | 283 |
| 131 | 3300003320 | rootH2_10005012 | rootH2_100050123 | 284 |
| 132 | 3300003323 | rootH1_10109858 | rootH1_101098584 | 284 |
| 133 | 3300003856 | Ga0058692_1014288 | Ga0058692_10142883 | 284 |
| 134 | 3300005437 | Ga0070710_10129261 | Ga0070710_101292612 | 284 |
| 135 | 3300005455 | Ga0070663_100201728 | Ga0070663_1002017282 | 284 |
| 136 | 3300005548 | Ga0070665_100274058 | Ga0070665_1002740582 | 284 |
| 137 | 3300005937 | Ga0081455_10001834 | Ga0081455_100018346 | 284 |
| 138 | 3300006038 | Ga0075365_10002818 | Ga0075365_100028189 | 284 |
| 139 | 3300006186 | Ga0075369_10002157 | Ga0075369_100021574 | 284 |
| 140 | 3300026067 | Ga0207678_10279687 | Ga0207678_102796871 | 284 |
| 141 | 3300027312 | Ga0209371_1002714 | Ga0209371_10027143 | 284 |
| 142 | 3300030500 | Ga0268256_1013457 | Ga0268256_10134573 | 284 |
| 143 | 3300037853 | Ga0436364_0645114 | Ga0436364_0645114_2633_3559 | 284 |
| 144 | 3300046558 | Ga0495633_0006338 | Ga0495633_0006338_518_1420 | 284 |
| 145 | 3300047472 | Ga0495686_0000115 | Ga0495686_0000115_65599_66498 | 284 |
| 146 | 3300048919 | Ga0496116_0001677 | Ga0496116_0001677_15402_16304 | 284 |
| 147 | 3300048920 | Ga0496117_0145123 | Ga0496117_0145123_240_1142 | 284 |
| 148 | 3300048921 | Ga0496118_0074173 | Ga0496118_0074173_513_1415 | 284 |
| 149 | 3300048924 | Ga0496121_0016618 | Ga0496121_0016618_6231_7133 | 284 |
| 150 | 3300048925 | Ga0496122_0014172 | Ga0496122_0014172_5541_6443 | 284 |
| 151 | 3300048927 | Ga0496124_0055978 | Ga0496124_0055978_1615_2517 | 284 |
| 152 | 3300048928 | Ga0496125_0003653 | Ga0496125_0003653_9586_10488 | 284 |
| 153 | 3300049569 | Ga0501032_0007464 | Ga0501032_0007464_256_1164 | 284 |
| 154 | 3300049579 | Ga0501043_0003245 | Ga0501043_0003245_3726_4634 | 284 |
| 155 | 3300049581 | Ga0501047_0000197 | Ga0501047_0000197_26876_27784 | 284 |
| 156 | 3300049582 | Ga0501048_0106838 | Ga0501048_0106838_201_1109 | 284 |
| 157 | 3300050496 | nmdc:mga07m45_85991_c1 | nmdc:mga07m45_85991_c1_477_1388 | 284 |
| 158 | iso_pu_bacteria | 2508501128 | 2509149468 | 284 |
| 159 | iso_pu_bacteria | 2643221595 | 2643983746 | 284 |
| 160 | iso_pu_bacteria | 2643221627 | 2644155879 | 284 |
| 161 | iso_pu_bacteria | 2808606384 | 2808970252 | 284 |
| 162 | iso_pu_bacteria | 2808606390 | 2809004902 | 284 |
| 163 | iso_pu_bacteria | 2808606391 | 2809011958 | 284 |
| 164 | iso_pu_bacteria | 2842205361 | 2842211410 | 284 |
| 165 | iso_pu_bacteria | 2842278818 | 2842284867 | 284 |
| 166 | iso_pu_bacteria | 2869162929 | 2869163306 | 284 |
| 167 | iso_pu_bacteria | 2881161766 | 2881167252 | 284 |
| 168 | iso_pu_bacteria | 2919450847 | 2919455779 | 284 |
| 169 | iso_pu_bacteria | 2923556063 | 2923559079 | 284 |
| 170 | 3300002987 | JGI25159J45721_1000678 | JGI25159J45721_100067813 | 285 |
| 171 | 3300003354 | JGI25160J50197_1001701 | JGI25160J50197_10017017 | 285 |
| 172 | 3300003374 | JGI25161J50226_1000905 | JGI25161J50226_10009057 | 285 |
| 173 | 3300004625 | Ga0055543_1000079 | Ga0055543_10000797 | 285 |
| 174 | 3300005262 | Ga0065165_1002903 | Ga0065165_10029038 | 285 |
| 175 | 3300025284 | Ga0209130_1000219 | Ga0209130_10002195 | 285 |
| 176 | 3300025302 | Ga0207426_1000075 | Ga0207426_1000075209 | 285 |
| 177 | 3300039447 | Ga0436361_0113928 | Ga0436361_0113928_340_1251 | 285 |
| 178 | 3300046507 | Ga0495606_0055014 | Ga0495606_0055014_1417_2316 | 285 |
| 179 | 3300048919 | Ga0496116_0085461 | Ga0496116_0085461_224_1129 | 285 |
| 180 | 3300048920 | Ga0496117_0096802 | Ga0496117_0096802_413_1321 | 285 |
| 181 | 3300048922 | Ga0496119_0046340 | Ga0496119_0046340_1176_2075 | 285 |
| 182 | 3300048923 | Ga0496120_0180120 | Ga0496120_0180120_129_1028 | 285 |
| 183 | 3300048924 | Ga0496121_0333505 | Ga0496121_0333505_37_936 | 285 |
| 184 | 3300048925 | Ga0496122_0004397 | Ga0496122_0004397_3237_4157 | 285 |
| 185 | 3300048926 | Ga0496123_0004520 | Ga0496123_0004520_7812_8732 | 285 |
| 186 | iso_pu_bacteria | 2829745981 | 2829747105 | 285 |
| 187 | iso_pu_bacteria | 2883291878 | 2883292735 | 285 |
| 188 | iso_pu_bacteria | 2904434214 | 2904436448 | 285 |
| 189 | 3300003215 | JGI25153J46596_10015463 | JGI25153J46596_100154633 | 286 |
| 190 | 3300003762 | Ga0055542_1003684 | Ga0055542_10036842 | 286 |
| 191 | 3300005334 | Ga0068869_100313665 | Ga0068869_1003136652 | 286 |
| 192 | 3300005347 | Ga0070668_100015221 | Ga0070668_1000152215 | 286 |
| 193 | 3300005347 | Ga0070668_100076807 | Ga0070668_1000768073 | 286 |
| 194 | 3300005353 | Ga0070669_100169702 | Ga0070669_1001697021 | 286 |
| 195 | 3300005355 | Ga0070671_100083124 | Ga0070671_1000831242 | 286 |
| 196 | 3300005455 | Ga0070663_100023282 | Ga0070663_1000232822 | 286 |
| 197 | 3300005539 | Ga0068853_100472962 | Ga0068853_1004729621 | 286 |
| 198 | 3300005563 | Ga0068855_100403082 | Ga0068855_1004030823 | 286 |
| 199 | 3300005616 | Ga0068852_100192220 | Ga0068852_1001922202 | 286 |
| 200 | 3300006038 | Ga0075365_10049969 | Ga0075365_100499693 | 286 |
| 201 | 3300006038 | Ga0075365_10227041 | Ga0075365_102270412 | 286 |
| 202 | 3300006042 | Ga0075368_10032175 | Ga0075368_100321752 | 286 |
| 203 | 3300006048 | Ga0075363_100063664 | Ga0075363_1000636642 | 286 |
| 204 | 3300006051 | Ga0075364_10020082 | Ga0075364_100200823 | 286 |
| 205 | 3300006175 | Ga0070712_100016263 | Ga0070712_1000162635 | 286 |
| 206 | 3300006177 | Ga0075362_10000364 | Ga0075362_1000036412 | 286 |
| 207 | 3300006178 | Ga0075367_10001277 | Ga0075367_1000127715 | 286 |
| 208 | 3300006353 | Ga0075370_10006671 | Ga0075370_100066716 | 286 |
| 209 | 3300009093 | Ga0105240_10001146 | Ga0105240_100011469 | 286 |
| 210 | 3300009093 | Ga0105240_10424370 | Ga0105240_104243702 | 286 |
| 211 | 3300009174 | Ga0105241_10065423 | Ga0105241_100654233 | 286 |
| 212 | 3300009177 | Ga0105248_10079304 | Ga0105248_100793043 | 286 |
| 213 | 3300009545 | Ga0105237_10001621 | Ga0105237_1000162126 | 286 |
| 214 | 3300009551 | Ga0105238_10075985 | Ga0105238_100759854 | 286 |
| 215 | 3300010375 | Ga0105239_10129037 | Ga0105239_101290373 | 286 |
| 216 | 3300013105 | Ga0157369_10112321 | Ga0157369_101123214 | 286 |
| 217 | 3300013296 | Ga0157374_10228626 | Ga0157374_102286262 | 286 |
| 218 | 3300014969 | Ga0157376_10518203 | Ga0157376_105182032 | 286 |
| 219 | 3300025254 | Ga0209148_1000474 | Ga0209148_100047424 | 286 |
| 220 | 3300025261 | Ga0209233_1008059 | Ga0209233_10080593 | 286 |
| 221 | 3300025272 | Ga0209455_1011491 | Ga0209455_10114913 | 286 |
| 222 | 3300025294 | Ga0209025_1048211 | Ga0209025_10482112 | 286 |
| 223 | 3300025297 | Ga0209758_1000993 | Ga0209758_100099321 | 286 |
| 224 | 3300025315 | Ga0207697_10035703 | Ga0207697_100357034 | 286 |
| 225 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006280 | 286 |
| 226 | 3300025913 | Ga0207695_10325826 | Ga0207695_103258262 | 286 |
| 227 | 3300025914 | Ga0207671_10013654 | Ga0207671_100136545 | 286 |
| 228 | 3300025915 | Ga0207693_10024818 | Ga0207693_100248185 | 286 |
| 229 | 3300025924 | Ga0207694_10233506 | Ga0207694_102335062 | 286 |
| 230 | 3300025927 | Ga0207687_10260462 | Ga0207687_102604621 | 286 |
| 231 | 3300025931 | Ga0207644_10040268 | Ga0207644_100402682 | 286 |
| 232 | 3300025941 | Ga0207711_10145182 | Ga0207711_101451822 | 286 |
| 233 | 3300025942 | Ga0207689_10153144 | Ga0207689_101531442 | 286 |
| 234 | 3300025972 | Ga0207668_10009192 | Ga0207668_100091922 | 286 |
| 235 | 3300026035 | Ga0207703_10056162 | Ga0207703_100561624 | 286 |
| 236 | 3300026067 | Ga0207678_10030234 | Ga0207678_100302343 | 286 |
| 237 | 3300026088 | Ga0207641_10130925 | Ga0207641_101309253 | 286 |
| 238 | 3300026095 | Ga0207676_10110660 | Ga0207676_101106603 | 286 |
| 239 | 3300026116 | Ga0207674_10046570 | Ga0207674_100465703 | 286 |
| 240 | 3300039447 | Ga0436361_0864205 | Ga0436361_0864205_3236_4141 | 286 |
| 241 | 3300044658 | Ga0466972_0014613 | Ga0466972_0014613_2265_3179 | 286 |
| 242 | 3300044658 | Ga0466972_0101415 | Ga0466972_0101415_172_1086 | 286 |
| 243 | 3300044684 | Ga0466966_0086206 | Ga0466966_0086206_699_1613 | 286 |
| 244 | 3300044706 | Ga0466964_0044554 | Ga0466964_0044554_497_1411 | 286 |
| 245 | 3300044735 | Ga0466968_0002924 | Ga0466968_0002924_3413_4327 | 286 |
| 246 | 3300044901 | Ga0466960_0000523 | Ga0466960_0000523_5224_6138 | 286 |
| 247 | 3300045049 | Ga0466959_0059664 | Ga0466959_0059664_200_1114 | 286 |
| 248 | 3300046459 | Ga0495629_0030964 | Ga0495629_0030964_2862_3776 | 286 |
| 249 | 3300046462 | Ga0495651_0248764 | Ga0495651_0248764_288_1202 | 286 |
| 250 | 3300046507 | Ga0495606_0110303 | Ga0495606_0110303_404_1318 | 286 |
| 251 | 3300046511 | Ga0495608_0021552 | Ga0495608_0021552_3354_4268 | 286 |
| 252 | 3300046514 | Ga0495618_0214160 | Ga0495618_0214160_281_1195 | 286 |
| 253 | 3300046516 | Ga0495628_0195993 | Ga0495628_0195993_26_940 | 286 |
| 254 | 3300046524 | Ga0495648_0063920 | Ga0495648_0063920_201_1115 | 286 |
| 255 | 3300046557 | Ga0495622_0089882 | Ga0495622_0089882_256_1170 | 286 |
| 256 | 3300046616 | Ga0495668_0022905 | Ga0495668_0022905_2024_2938 | 286 |
| 257 | 3300046616 | Ga0495668_0045777 | Ga0495668_0045777_372_1286 | 286 |
| 258 | 3300046648 | Ga0495611_0019278 | Ga0495611_0019278_1341_2255 | 286 |
| 259 | 3300046660 | Ga0495625_0191804 | Ga0495625_0191804_96_1010 | 286 |
| 260 | 3300046674 | Ga0495588_0182175 | Ga0495588_0182175_110_1024 | 286 |
| 261 | 3300046675 | Ga0495657_0012111 | Ga0495657_0012111_4750_5664 | 286 |
| 262 | 3300046690 | Ga0495624_0043274 | Ga0495624_0043274_1283_2197 | 286 |
| 263 | 3300046794 | Ga0495589_0061400 | Ga0495589_0061400_636_1550 | 286 |
| 264 | 3300046809 | Ga0495600_0006748 | Ga0495600_0006748_4910_5824 | 286 |
| 265 | 3300047317 | Ga0495604_0059741 | Ga0495604_0059741_1394_2308 | 286 |
| 266 | 3300047320 | Ga0495672_0067556 | Ga0495672_0067556_239_1153 | 286 |
| 267 | 3300047321 | Ga0495676_0076376 | Ga0495676_0076376_1183_2097 | 286 |
| 268 | 3300047323 | Ga0495683_0057977 | Ga0495683_0057977_18_932 | 286 |
| 269 | 3300047443 | Ga0495687_041587 | Ga0495687_041587_168_1082 | 286 |
| 270 | 3300048088 | Ga0495602_0160008 | Ga0495602_0160008_546_1460 | 286 |
| 271 | 3300048091 | Ga0495626_0022209 | Ga0495626_0022209_407_1321 | 286 |
| 272 | 3300048903 | Ga0496100_0204274 | Ga0496100_0204274_23_937 | 286 |
| 273 | 3300048905 | Ga0496102_0184978 | Ga0496102_0184978_979_1893 | 286 |
| 274 | 3300048906 | Ga0496103_0031700 | Ga0496103_0031700_1921_2835 | 286 |
| 275 | 3300048907 | Ga0496104_0026005 | Ga0496104_0026005_97_1011 | 286 |
| 276 | 3300048907 | Ga0496104_0339040 | Ga0496104_0339040_344_1258 | 286 |
| 277 | 3300048908 | Ga0496105_0001350 | Ga0496105_0001350_14127_15041 | 286 |
| 278 | 3300048911 | Ga0496108_0291011 | Ga0496108_0291011_137_1051 | 286 |
| 279 | 3300048913 | Ga0496110_0170925 | Ga0496110_0170925_611_1525 | 286 |
| 280 | 3300048915 | Ga0496112_0087933 | Ga0496112_0087933_286_1200 | 286 |
| 281 | 3300048916 | Ga0496113_0250350 | Ga0496113_0250350_87_1001 | 286 |
| 282 | 3300048917 | Ga0496114_0262885 | Ga0496114_0262885_355_1269 | 286 |
| 283 | 3300048919 | Ga0496116_0070663 | Ga0496116_0070663_276_1190 | 286 |
| 284 | 3300048921 | Ga0496118_0008990 | Ga0496118_0008990_8579_9493 | 286 |
| 285 | 3300048922 | Ga0496119_0147182 | Ga0496119_0147182_44_958 | 286 |
| 286 | 3300048923 | Ga0496120_0014557 | Ga0496120_0014557_1216_2130 | 286 |
| 287 | 3300048924 | Ga0496121_0020649 | Ga0496121_0020649_4395_5306 | 286 |
| 288 | 3300048924 | Ga0496121_0027976 | Ga0496121_0027976_4300_5214 | 286 |
| 289 | 3300048924 | Ga0496121_0049552 | Ga0496121_0049552_2518_3432 | 286 |
| 290 | 3300049460 | Ga0495682_0118812 | Ga0495682_0118812_23_937 | 286 |
| 291 | 3300050489 | nmdc:mga03683_526_c1 | nmdc:mga03683_526_c1_322_1233 | 286 |
| 292 | 3300050490 | nmdc:mga03n38_154063_c1 | nmdc:mga03n38_154063_c1_20_934 | 286 |
| 293 | 3300050492 | nmdc:mga0yw44_5700_c1 | nmdc:mga0yw44_5700_c1_3543_4457 | 286 |
| 294 | 3300050493 | nmdc:mga0k408_165090_c1 | nmdc:mga0k408_165090_c1_286_1197 | 286 |
| 295 | 3300050493 | nmdc:mga0k408_42731_c1 | nmdc:mga0k408_42731_c1_1104_2018 | 286 |
| 296 | 3300050494 | nmdc:mga06z11_1300_c1 | nmdc:mga06z11_1300_c1_972_1883 | 286 |
| 297 | 3300050516 | nmdc:mga0sz30_15_c1 | nmdc:mga0sz30_15_c1_24297_25208 | 286 |
| 298 | 3300055283 | Ga0500661_003363 | Ga0500661_003363_933_1847 | 286 |
| 299 | iso_pu_bacteria | 2545555834 | 2545672619 | 286 |
| 300 | iso_pu_bacteria | 641522639 | 641646937 | 286 |
| 301 | iso_pu_bacteria | 643348564 | 643600841 | 286 |
| 302 | 3300005434 | Ga0070709_10001293 | Ga0070709_100012932 | 287 |
| 303 | 3300005435 | Ga0070714_100045562 | Ga0070714_1000455623 | 287 |
| 304 | 3300005436 | Ga0070713_100009193 | Ga0070713_1000091936 | 287 |
| 305 | 3300005437 | Ga0070710_10000282 | Ga0070710_1000028212 | 287 |
| 306 | 3300005439 | Ga0070711_100014925 | Ga0070711_1000149255 | 287 |
| 307 | 3300005471 | Ga0070698_100051927 | Ga0070698_1000519273 | 287 |
| 308 | 3300006173 | Ga0070716_100112390 | Ga0070716_1001123903 | 287 |
| 309 | 3300006175 | Ga0070712_100005683 | Ga0070712_1000056835 | 287 |
| 310 | 3300006237 | Ga0097621_100186180 | Ga0097621_1001861802 | 287 |
| 311 | 3300006852 | Ga0075433_10268737 | Ga0075433_102687372 | 287 |
| 312 | 3300007788 | Ga0099795_10085262 | Ga0099795_100852621 | 287 |
| 313 | 3300009094 | Ga0111539_10000323 | Ga0111539_1000032337 | 287 |
| 314 | 3300009101 | Ga0105247_10014641 | Ga0105247_100146413 | 287 |
| 315 | 3300009177 | Ga0105248_10793469 | Ga0105248_107934691 | 287 |
| 316 | 3300009545 | Ga0105237_10004870 | Ga0105237_1000487015 | 287 |
| 317 | 3300010375 | Ga0105239_10742197 | Ga0105239_107421972 | 287 |
| 318 | 3300017792 | Ga0163161_10245615 | Ga0163161_102456151 | 287 |
| 319 | 3300021358 | Ga0213873_10002417 | Ga0213873_100024172 | 287 |
| 320 | 3300021361 | Ga0213872_10008298 | Ga0213872_100082982 | 287 |
| 321 | 3300021361 | Ga0213872_10032738 | Ga0213872_100327383 | 287 |
| 322 | 3300021361 | Ga0213872_10073990 | Ga0213872_100739902 | 287 |
| 323 | 3300021384 | Ga0213876_10001767 | Ga0213876_100017678 | 287 |
| 324 | 3300025304 | Ga0209257_1036089 | Ga0209257_10360892 | 287 |
| 325 | 3300025906 | Ga0207699_10003950 | Ga0207699_100039502 | 287 |
| 326 | 3300025914 | Ga0207671_10022161 | Ga0207671_100221613 | 287 |
| 327 | 3300025915 | Ga0207693_10008068 | Ga0207693_100080682 | 287 |
| 328 | 3300025916 | Ga0207663_10050175 | Ga0207663_100501753 | 287 |
| 329 | 3300025928 | Ga0207700_10005940 | Ga0207700_100059403 | 287 |
| 330 | 3300025929 | Ga0207664_10008161 | Ga0207664_100081615 | 287 |
| 331 | 3300025933 | Ga0207706_10141303 | Ga0207706_101413032 | 287 |
| 332 | 3300025939 | Ga0207665_10024914 | Ga0207665_100249144 | 287 |
| 333 | 3300025941 | Ga0207711_10578020 | Ga0207711_105780201 | 287 |
| 334 | 3300027907 | Ga0207428_10000129 | Ga0207428_1000012938 | 287 |
| 335 | 3300028379 | Ga0268266_10179319 | Ga0268266_101793193 | 287 |
| 336 | 3300031730 | Ga0307516_10000173 | Ga0307516_1000017312 | 287 |
| 337 | 3300031824 | Ga0307413_10162626 | Ga0307413_101626262 | 287 |
| 338 | 3300039437 | Ga0436365_1279257 | Ga0436365_1279257_5480_6406 | 287 |
| 339 | 3300039437 | Ga0436365_1925227 | Ga0436365_1925227_368_1294 | 287 |
| 340 | 3300039438 | Ga0436360_0695279 | Ga0436360_0695279_1014_1940 | 287 |
| 341 | 3300039447 | Ga0436361_0176654 | Ga0436361_0176654_3029_3955 | 287 |
| 342 | 3300039447 | Ga0436361_0373700 | Ga0436361_0373700_7972_8883 | 287 |
| 343 | 3300039447 | Ga0436361_0438759 | Ga0436361_0438759_823_1746 | 287 |
| 344 | 3300039447 | Ga0436361_0556055 | Ga0436361_0556055_122_1084 | 287 |
| 345 | 3300039447 | Ga0436361_0578085 | Ga0436361_0578085_299_1258 | 287 |
| 346 | 3300039447 | Ga0436361_0867606 | Ga0436361_0867606_80_1003 | 287 |
| 347 | 3300046501 | Ga0495607_0000153 | Ga0495607_0000153_35645_36559 | 287 |
| 348 | 3300046522 | Ga0495643_0082518 | Ga0495643_0082518_567_1484 | 287 |
| 349 | 3300047469 | Ga0495673_0030030 | Ga0495673_0030030_1498_2415 | 287 |
| 350 | 3300047472 | Ga0495686_0000082 | Ga0495686_0000082_64077_64994 | 287 |
| 351 | 3300048091 | Ga0495626_0030480 | Ga0495626_0030480_1218_2132 | 287 |
| 352 | 3300048907 | Ga0496104_0434192 | Ga0496104_0434192_258_1184 | 287 |
| 353 | 3300048921 | Ga0496118_0010965 | Ga0496118_0010965_5974_6891 | 287 |
| 354 | 3300048921 | Ga0496118_0023061 | Ga0496118_0023061_108_1022 | 287 |
| 355 | 3300048922 | Ga0496119_0057536 | Ga0496119_0057536_1062_1976 | 287 |
| 356 | 3300048924 | Ga0496121_0021639 | Ga0496121_0021639_2943_3857 | 287 |
| 357 | 3300048924 | Ga0496121_0105968 | Ga0496121_0105968_108_1025 | 287 |
| 358 | 3300048926 | Ga0496123_0105700 | Ga0496123_0105700_315_1232 | 287 |
| 359 | 3300048929 | Ga0496126_0006108 | Ga0496126_0006108_11101_12027 | 287 |
| 360 | 3300048929 | Ga0496126_0073507 | Ga0496126_0073507_1322_2239 | 287 |
| 361 | 3300048929 | Ga0496126_0090220 | Ga0496126_0090220_27_944 | 287 |
| 362 | 3300050491 | nmdc:mga00v17_290579_c1 | nmdc:mga00v17_290579_c1_20_934 | 287 |
| 363 | 3300050511 | nmdc:mga08y16_51_c1 | nmdc:mga08y16_51_c1_54592_55506 | 287 |
| 364 | 3300053088 | Ga0500644_0108065 | Ga0500644_0108065_121_1041 | 287 |
| 365 | 3300053119 | Ga0500595_002719 | Ga0500595_002719_2231_3145 | 287 |
| 366 | 3300053119 | Ga0500595_003885 | Ga0500595_003885_839_1753 | 287 |
| 367 | iso_pu_bacteria | 2821443989 | 2821447277 | 287 |
| 368 | iso_pu_bacteria | 2844533157 | 2844533326 | 287 |
| 369 | 3300003322 | rootL2_10011079 | rootL2_100110792 | 288 |
| 370 | 3300005539 | Ga0068853_100024459 | Ga0068853_1000244592 | 288 |
| 371 | 3300025254 | Ga0209148_1000501 | Ga0209148_100050140 | 288 |
| 372 | 3300025272 | Ga0209455_1012628 | Ga0209455_10126282 | 288 |
| 373 | 3300046512 | Ga0495610_0002011 | Ga0495610_0002011_14165_15097 | 288 |
| 374 | 3300046524 | Ga0495648_0096282 | Ga0495648_0096282_48_968 | 288 |
| 375 | 3300048910 | Ga0496107_0017737 | Ga0496107_0017737_285_1205 | 288 |
| 376 | 3300048924 | Ga0496121_0000523 | Ga0496121_0000523_53480_54400 | 288 |
| 377 | 3300048924 | Ga0496121_0009992 | Ga0496121_0009992_6425_7372 | 288 |
| 378 | 3300048929 | Ga0496126_0012983 | Ga0496126_0012983_5824_6744 | 288 |
| 379 | 3300048929 | Ga0496126_0061981 | Ga0496126_0061981_440_1387 | 288 |
| 380 | 3300053177 | Ga0500636_0002621 | Ga0500636_0002621_247_1194 | 288 |
| 381 | 3300053730 | Ga0500645_000065 | Ga0500645_000065_52387_53307 | 288 |
| 382 | iso_pu_bacteria | 2595698237 | 2596372394 | 288 |
| 383 | iso_pu_bacteria | 2841911363 | 2841914577 | 288 |
| 384 | iso_pu_bacteria | 2841917233 | 2841920258 | 288 |
| 385 | iso_pu_bacteria | 2889306138 | 2889311007 | 288 |
| 386 | iso_pu_bacteria | 2902330777 | 2902336213 | 288 |
| 387 | iso_pu_bacteria | 2902405164 | 2902406254 | 288 |
| 388 | iso_pu_bacteria | 2928125067 | 2928126747 | 288 |
| 389 | 3300033180 | Ga0307510_10035936 | Ga0307510_100359364 | 289 |
| 390 | 3300041512 | Ga0451853_2623033 | Ga0451853_2623033_27_947 | 289 |
| 391 | 3300046512 | Ga0495610_0049377 | Ga0495610_0049377_425_1372 | 289 |
| 392 | 3300047472 | Ga0495686_0117141 | Ga0495686_0117141_328_1275 | 289 |
| 393 | 3300048922 | Ga0496119_0002194 | Ga0496119_0002194_8054_8968 | 289 |
| 394 | 3300048923 | Ga0496120_0000350 | Ga0496120_0000350_28565_29479 | 289 |
| 395 | iso_pu_bacteria | 2508501042 | 2508693902 | 289 |
| 396 | iso_pu_bacteria | 2513237095 | 2513651977 | 289 |
| 397 | iso_pu_bacteria | 2513237098 | 2513672162 | 289 |
| 398 | iso_pu_bacteria | 2513237102 | 2513702773 | 289 |
| 399 | iso_pu_bacteria | 2517093001 | 2517101012 | 289 |
| 400 | iso_pu_bacteria | 2524023210 | 2524464658 | 289 |
| 401 | iso_pu_bacteria | 2617270735 | 2617346369 | 289 |
| 402 | iso_pu_bacteria | 2643221643 | 2644238045 | 289 |
| 403 | iso_pu_bacteria | 2738541281 | 2738747459 | 289 |
| 404 | iso_pu_bacteria | 2738543032 | 2739356741 | 289 |
| 405 | iso_pu_bacteria | 2816332527 | 2818239175 | 289 |
| 406 | iso_pu_bacteria | 2824600985 | 2824604847 | 289 |
| 407 | iso_pu_bacteria | 2824609381 | 2824611401 | 289 |
| 408 | iso_pu_bacteria | 2824617872 | 2824620245 | 289 |
| 409 | iso_pu_bacteria | 2824626560 | 2824629510 | 289 |
| 410 | iso_pu_bacteria | 2824635225 | 2824635830 | 289 |
| 411 | iso_pu_bacteria | 2824644064 | 2824646132 | 289 |
| 412 | iso_pu_bacteria | 2824653114 | 2824656088 | 289 |
| 413 | iso_pu_bacteria | 2824661429 | 2824663190 | 289 |
| 414 | iso_pu_bacteria | 2824704595 | 2824713864 | 289 |
| 415 | iso_pu_bacteria | 2824714736 | 2824716670 | 289 |
| 416 | iso_pu_bacteria | 2824723954 | 2824726627 | 289 |
| 417 | iso_pu_bacteria | 2824753945 | 2824757894 | 289 |
| 418 | iso_pu_bacteria | 2824763712 | 2824766974 | 289 |
| 419 | iso_pu_bacteria | 2824773399 | 2824774631 | 289 |
| 420 | iso_pu_bacteria | 2841957949 | 2841961235 | 289 |
| 421 | iso_pu_bacteria | 2842698319 | 2842700628 | 289 |
| 422 | iso_pu_bacteria | 2849076700 | 2849078865 | 289 |
| 423 | iso_pu_bacteria | 2857509624 | 2857512498 | 289 |
| 424 | iso_pu_bacteria | 2874612657 | 2874617377 | 289 |
| 425 | iso_pu_bacteria | 2874628541 | 2874633806 | 289 |
| 426 | iso_pu_bacteria | 2879099564 | 2879104206 | 289 |
| 427 | iso_pu_bacteria | 2881364244 | 2881368281 | 289 |
| 428 | iso_pu_bacteria | 2885366525 | 2885369738 | 289 |
| 429 | iso_pu_bacteria | 2885383462 | 2885386243 | 289 |
| 430 | iso_pu_bacteria | 2888378607 | 2888379192 | 289 |
| 431 | iso_pu_bacteria | 2888388044 | 2888389485 | 289 |
| 432 | iso_pu_bacteria | 2888419890 | 2888421630 | 289 |
| 433 | iso_pu_bacteria | 2903768456 | 2903774217 | 289 |
| 434 | iso_pu_bacteria | 2904711408 | 2904712502 | 289 |
| 435 | iso_pu_bacteria | 2919073203 | 2919077110 | 289 |
| 436 | iso_pu_bacteria | 2929615660 | 2929620798 | 289 |
| 437 | iso_pu_bacteria | 2929624759 | 2929626692 | 289 |
| 438 | iso_pu_bacteria | 2932784394 | 2932784443 | 289 |
| 439 | iso_pu_bacteria | 2932809354 | 2932809426 | 289 |
| 440 | iso_pu_bacteria | 2932818245 | 2932818831 | 289 |
| 441 | iso_pu_bacteria | 2932828146 | 2932828213 | 289 |
| 442 | iso_pu_bacteria | 2933577622 | 2933582712 | 289 |
| 443 | iso_pu_bacteria | 2935608549 | 2935610156 | 289 |
| 444 | iso_pu_bacteria | 2935616580 | 2935617187 | 289 |
| 445 | iso_pu_bacteria | 2935638405 | 2935639332 | 289 |
| 446 | iso_pu_bacteria | 2935648319 | 2935650314 | 289 |
| 447 | iso_pu_bacteria | 2935656913 | 2935658461 | 289 |
| 448 | iso_pu_bacteria | 2935665750 | 2935665817 | 289 |
| 449 | iso_pu_bacteria | 2935675223 | 2935675463 | 289 |
| 450 | iso_pu_bacteria | 2935684952 | 2935685526 | 289 |
| 451 | iso_pu_bacteria | 2935694250 | 2935698775 | 289 |
| 452 | iso_pu_bacteria | 2935703347 | 2935704339 | 289 |
| 453 | iso_pu_bacteria | 2935713505 | 2935714079 | 289 |
| 454 | iso_pu_bacteria | 2935722832 | 2935724698 | 289 |
| 455 | iso_pu_bacteria | 2935732158 | 2935732944 | 289 |
| 456 | iso_pu_bacteria | 2935741537 | 2935742323 | 289 |
| 457 | iso_pu_bacteria | 2935750917 | 2935751491 | 289 |
| 458 | iso_pu_bacteria | 2935760218 | 2935765737 | 289 |
| 459 | iso_pu_bacteria | 2935769743 | 2935776872 | 289 |
| 460 | iso_pu_bacteria | 2935777560 | 2935778336 | 289 |
| 461 | iso_pu_bacteria | 2935785616 | 2935792870 | 289 |
| 462 | iso_pu_bacteria | 2935793552 | 2935800988 | 289 |
| 463 | iso_pu_bacteria | 2935801545 | 2935802421 | 289 |
| 464 | iso_pu_bacteria | 2935810662 | 2935811245 | 289 |
| 465 | iso_pu_bacteria | 2935819856 | 2935823316 | 289 |
| 466 | iso_pu_bacteria | 2935827899 | 2935828827 | 289 |
| 467 | iso_pu_bacteria | 2935837841 | 2935840201 | 289 |
| 468 | iso_pu_bacteria | 2935855204 | 2935855812 | 289 |
| 469 | iso_pu_bacteria | 2935864058 | 2935866245 | 289 |
| 470 | iso_pu_bacteria | 2935873716 | 2935877429 | 289 |
| 471 | iso_pu_bacteria | 2935984226 | 2935986025 | 289 |
| 472 | iso_pu_bacteria | 2935992306 | 2935992374 | 289 |
| 473 | iso_pu_bacteria | 2936002035 | 2936002246 | 289 |
| 474 | iso_pu_bacteria | 2936011229 | 2936013127 | 289 |
| 475 | iso_pu_bacteria | 2936019824 | 2936021786 | 289 |
| 476 | iso_pu_bacteria | 2936028420 | 2936030420 | 289 |
| 477 | iso_pu_bacteria | 2936037263 | 2936037335 | 289 |
| 478 | iso_pu_bacteria | 2936046547 | 2936047980 | 289 |
| 479 | iso_pu_bacteria | 2936055302 | 2936057980 | 289 |
| 480 | iso_pu_bacteria | 2940556831 | 2940557707 | 289 |
| 481 | iso_pu_bacteria | 2941538514 | 2941540458 | 289 |
| 482 | iso_pu_bacteria | 8016522445 | 8016529828 | 289 |
| 483 | iso_pu_bacteria | 8016530956 | 8016535062 | 289 |
| 484 | iso_pu_bacteria | 8016539877 | 8016548268 | 289 |
| 485 | iso_pu_bacteria | 8016548790 | 8016553857 | 289 |
| 486 | iso_pu_bacteria | 8016557553 | 8016562232 | 289 |
| 487 | iso_pu_bacteria | 8016566248 | 8016573405 | 289 |
| 488 | iso_pu_bacteria | 8016575299 | 8016577537 | 289 |
| 489 | iso_pu_bacteria | 8016595262 | 8016600048 | 289 |
| 490 | iso_pu_bacteria | 8016613128 | 8016614216 | 289 |
| 491 | iso_pu_bacteria | 8016622563 | 8016626768 | 289 |
| 492 | iso_pu_bacteria | 8017057580 | 8017064298 | 289 |
| 493 | iso_pu_bacteria | 8019530166 | 8019534817 | 289 |
| 494 | iso_pu_bacteria | 8019547302 | 8019553879 | 289 |
| 495 | iso_pu_bacteria | 8019576017 | 8019583642 | 289 |
| 496 | iso_pu_bacteria | 8019586578 | 8019591456 | 289 |
| 497 | iso_pu_bacteria | 8019597564 | 8019599885 | 289 |
| 498 | iso_pu_bacteria | 8019608314 | 8019618660 | 289 |
| 499 | iso_pu_bacteria | 8019648815 | 8019659078 | 289 |
| 500 | iso_pu_bacteria | 8055742211 | 8055745659 | 289 |
| 501 | 3300005367 | Ga0070667_100070923 | Ga0070667_1000709233 | 290 |
| 502 | 3300005455 | Ga0070663_100000216 | Ga0070663_1000002166 | 290 |
| 503 | 3300005536 | Ga0070697_100046077 | Ga0070697_1000460773 | 290 |
| 504 | 3300005548 | Ga0070665_100000793 | Ga0070665_1000007932 | 290 |
| 505 | 3300005548 | Ga0070665_100009232 | Ga0070665_1000092326 | 290 |
| 506 | 3300005548 | Ga0070665_100033945 | Ga0070665_1000339452 | 290 |
| 507 | 3300025972 | Ga0207668_10073416 | Ga0207668_100734163 | 290 |
| 508 | 3300026067 | Ga0207678_10000697 | Ga0207678_1000069722 | 290 |
| 509 | 3300028379 | Ga0268266_10005250 | Ga0268266_1000525010 | 290 |
| 510 | 3300028379 | Ga0268266_10019103 | Ga0268266_100191033 | 290 |
| 511 | 3300028379 | Ga0268266_10182538 | Ga0268266_101825382 | 290 |
| 512 | 3300031711 | Ga0265314_10025261 | Ga0265314_100252612 | 290 |
| 513 | 3300053079 | Ga0500610_0029902 | Ga0500610_0029902_1084_2013 | 290 |
| 514 | 3300053139 | Ga0500568_0005342 | Ga0500568_0005342_448_1377 | 290 |
| 515 | iso_pu_bacteria | 2861691609 | 2861693025 | 290 |
| 516 | 3300007265 | Ga0099794_10013003 | Ga0099794_100130033 | 291 |
| 517 | 3300007788 | Ga0099795_10003690 | Ga0099795_100036904 | 291 |
| 518 | 3300010159 | Ga0099796_10000384 | Ga0099796_100003844 | 291 |
| 519 | iso_pu_bacteria | 2791355123 | 2792750418 | 291 |
| 520 | iso_pu_bacteria | 2857542790 | 2857545997 | 291 |
| 521 | iso_pu_bacteria | 2919100787 | 2919102419 | 291 |
| 522 | 3300003322 | rootL2_10162917 | rootL2_101629173 | 292 |
| 523 | 3300005367 | Ga0070667_100033812 | Ga0070667_1000338123 | 292 |
| 524 | 3300005455 | Ga0070663_100003063 | Ga0070663_1000030631 | 292 |
| 525 | 3300005843 | Ga0068860_100008667 | Ga0068860_1000086679 | 292 |
| 526 | 3300009553 | Ga0105249_10003500 | Ga0105249_1000350011 | 292 |
| 527 | 3300026118 | Ga0207675_100000292 | Ga0207675_10000029218 | 292 |
| 528 | 3300031731 | Ga0307405_10030843 | Ga0307405_100308433 | 292 |
| 529 | 3300031901 | Ga0307406_10351960 | Ga0307406_103519601 | 292 |
| 530 | 3300047472 | Ga0495686_0165502 | Ga0495686_0165502_115_1050 | 292 |
| 531 | 3300048927 | Ga0496124_0007731 | Ga0496124_0007731_2592_3527 | 292 |
| 532 | iso_pu_bacteria | 2863421361 | 2863422110 | 292 |
| 533 | iso_pu_bacteria | 2904564687 | 2904566265 | 292 |
| 534 | iso_pu_bacteria | 2904571731 | 2904573309 | 292 |
| 535 | iso_pu_bacteria | 2928536128 | 2928538113 | 292 |
| 536 | iso_pu_bacteria | 8039098773 | 8039104181 | 292 |
| 537 | 3300002773 | JGI25152J39213_1000162 | JGI25152J39213_100016243 | 293 |
| 538 | 3300002773 | JGI25152J39213_1007085 | JGI25152J39213_10070853 | 293 |
| 539 | 3300002987 | JGI25159J45721_1002059 | JGI25159J45721_10020593 | 293 |
| 540 | 3300003187 | JGI25151J46595_10065477 | JGI25151J46595_100654772 | 293 |
| 541 | 3300003215 | JGI25153J46596_10000288 | JGI25153J46596_100002888 | 293 |
| 542 | 3300003215 | JGI25153J46596_10001506 | JGI25153J46596_100015063 | 293 |
| 543 | 3300003215 | JGI25153J46596_10001586 | JGI25153J46596_100015869 | 293 |
| 544 | 3300003215 | JGI25153J46596_10003877 | JGI25153J46596_100038776 | 293 |
| 545 | 3300003215 | JGI25153J46596_10018033 | JGI25153J46596_100180333 | 293 |
| 546 | 3300003215 | JGI25153J46596_10028247 | JGI25153J46596_100282471 | 293 |
| 547 | 3300003354 | JGI25160J50197_1000413 | JGI25160J50197_10004139 | 293 |
| 548 | 3300003354 | JGI25160J50197_1038171 | JGI25160J50197_10381711 | 293 |
| 549 | 3300003374 | JGI25161J50226_1000567 | JGI25161J50226_10005677 | 293 |
| 550 | 3300003374 | JGI25161J50226_1000572 | JGI25161J50226_10005727 | 293 |
| 551 | 3300003771 | Ga0055526_1005653 | Ga0055526_10056532 | 293 |
| 552 | 3300003775 | Ga0055524_1001701 | Ga0055524_10017012 | 293 |
| 553 | 3300003790 | Ga0055528_1000295 | Ga0055528_100029521 | 293 |
| 554 | 3300003790 | Ga0055528_1001484 | Ga0055528_100148410 | 293 |
| 555 | 3300003792 | Ga0055540_1002714 | Ga0055540_10027144 | 293 |
| 556 | 3300004625 | Ga0055543_1000116 | Ga0055543_100011643 | 293 |
| 557 | 3300004625 | Ga0055543_1002291 | Ga0055543_10022916 | 293 |
| 558 | 3300005262 | Ga0065165_1000342 | Ga0065165_100034250 | 293 |
| 559 | 3300005262 | Ga0065165_1015499 | Ga0065165_10154994 | 293 |
| 560 | 3300005327 | Ga0070658_10015167 | Ga0070658_100151674 | 293 |
| 561 | 3300005327 | Ga0070658_10284855 | Ga0070658_102848552 | 293 |
| 562 | 3300005331 | Ga0070670_100009469 | Ga0070670_1000094692 | 293 |
| 563 | 3300005334 | Ga0068869_100041460 | Ga0068869_1000414603 | 293 |
| 564 | 3300005334 | Ga0068869_100087992 | Ga0068869_1000879922 | 293 |
| 565 | 3300005335 | Ga0070666_10033261 | Ga0070666_100332614 | 293 |
| 566 | 3300005344 | Ga0070661_100177174 | Ga0070661_1001771741 | 293 |
| 567 | 3300005347 | Ga0070668_100207722 | Ga0070668_1002077222 | 293 |
| 568 | 3300005441 | Ga0070700_100073840 | Ga0070700_1000738403 | 293 |
| 569 | 3300005455 | Ga0070663_100013377 | Ga0070663_1000133775 | 293 |
| 570 | 3300005455 | Ga0070663_100056771 | Ga0070663_1000567712 | 293 |
| 571 | 3300005457 | Ga0070662_100006917 | Ga0070662_1000069176 | 293 |
| 572 | 3300005457 | Ga0070662_100007492 | Ga0070662_1000074924 | 293 |
| 573 | 3300005459 | Ga0068867_100320946 | Ga0068867_1003209461 | 293 |
| 574 | 3300005471 | Ga0070698_100192896 | Ga0070698_1001928963 | 293 |
| 575 | 3300005518 | Ga0070699_100274479 | Ga0070699_1002744791 | 293 |
| 576 | 3300005546 | Ga0070696_100026053 | Ga0070696_1000260533 | 293 |
| 577 | 3300005548 | Ga0070665_100000465 | Ga0070665_10000046538 | 293 |
| 578 | 3300005548 | Ga0070665_100006487 | Ga0070665_1000064876 | 293 |
| 579 | 3300005548 | Ga0070665_100122974 | Ga0070665_1001229742 | 293 |
| 580 | 3300005548 | Ga0070665_100497672 | Ga0070665_1004976721 | 293 |
| 581 | 3300005549 | Ga0070704_100029684 | Ga0070704_1000296844 | 293 |
| 582 | 3300005614 | Ga0068856_100173845 | Ga0068856_1001738452 | 293 |
| 583 | 3300005834 | Ga0068851_10002327 | Ga0068851_100023273 | 293 |
| 584 | 3300005842 | Ga0068858_100013390 | Ga0068858_1000133903 | 293 |
| 585 | 3300005937 | Ga0081455_10046002 | Ga0081455_100460024 | 293 |
| 586 | 3300005983 | Ga0081540_1018480 | Ga0081540_10184804 | 293 |
| 587 | 3300005983 | Ga0081540_1027966 | Ga0081540_10279663 | 293 |
| 588 | 3300006038 | Ga0075365_10038631 | Ga0075365_100386314 | 293 |
| 589 | 3300006186 | Ga0075369_10093646 | Ga0075369_100936462 | 293 |
| 590 | 3300006195 | Ga0075366_10072738 | Ga0075366_100727382 | 293 |
| 591 | 3300006353 | Ga0075370_10140015 | Ga0075370_101400152 | 293 |
| 592 | 3300009092 | Ga0105250_10019006 | Ga0105250_100190063 | 293 |
| 593 | 3300009093 | Ga0105240_10000341 | Ga0105240_1000034154 | 293 |
| 594 | 3300009093 | Ga0105240_10000342 | Ga0105240_1000034236 | 293 |
| 595 | 3300009174 | Ga0105241_10074884 | Ga0105241_100748843 | 293 |
| 596 | 3300009177 | Ga0105248_10290790 | Ga0105248_102907903 | 293 |
| 597 | 3300009545 | Ga0105237_10115232 | Ga0105237_101152323 | 293 |
| 598 | 3300009545 | Ga0105237_10127179 | Ga0105237_101271792 | 293 |
| 599 | 3300009553 | Ga0105249_10007619 | Ga0105249_1000761911 | 293 |
| 600 | 3300010375 | Ga0105239_10000041 | Ga0105239_1000004136 | 293 |
| 601 | 3300010375 | Ga0105239_10124392 | Ga0105239_101243924 | 293 |
| 602 | 3300010375 | Ga0105239_10723669 | Ga0105239_107236692 | 293 |
| 603 | 3300013105 | Ga0157369_10338869 | Ga0157369_103388693 | 293 |
| 604 | 3300013307 | Ga0157372_10030582 | Ga0157372_100305822 | 293 |
| 605 | 3300014325 | Ga0163163_10097654 | Ga0163163_100976543 | 293 |
| 606 | 3300014326 | Ga0157380_10369896 | Ga0157380_103698962 | 293 |
| 607 | 3300014968 | Ga0157379_10376942 | Ga0157379_103769422 | 293 |
| 608 | 3300014969 | Ga0157376_10190878 | Ga0157376_101908782 | 293 |
| 609 | 3300014969 | Ga0157376_10441925 | Ga0157376_104419252 | 293 |
| 610 | 3300017792 | Ga0163161_10399765 | Ga0163161_103997652 | 293 |
| 611 | 3300025208 | Ga0209436_100066 | Ga0209436_10006624 | 293 |
| 612 | 3300025253 | Ga0209677_101975 | Ga0209677_1019754 | 293 |
| 613 | 3300025258 | Ga0209129_1006000 | Ga0209129_10060005 | 293 |
| 614 | 3300025273 | Ga0209673_1001545 | Ga0209673_100154511 | 293 |
| 615 | 3300025273 | Ga0209673_1014758 | Ga0209673_10147583 | 293 |
| 616 | 3300025284 | Ga0209130_1000022 | Ga0209130_100002262 | 293 |
| 617 | 3300025295 | Ga0209564_1000475 | Ga0209564_100047547 | 293 |
| 618 | 3300025295 | Ga0209564_1026163 | Ga0209564_10261633 | 293 |
| 619 | 3300025297 | Ga0209758_1000209 | Ga0209758_100020959 | 293 |
| 620 | 3300025297 | Ga0209758_1004616 | Ga0209758_10046164 | 293 |
| 621 | 3300025297 | Ga0209758_1007575 | Ga0209758_10075754 | 293 |
| 622 | 3300025299 | Ga0209256_1022273 | Ga0209256_10222733 | 293 |
| 623 | 3300025302 | Ga0207426_1000005 | Ga0207426_1000005184 | 293 |
| 624 | 3300025302 | Ga0207426_1000237 | Ga0207426_100023742 | 293 |
| 625 | 3300025302 | Ga0207426_1017611 | Ga0207426_10176113 | 293 |
| 626 | 3300025304 | Ga0209257_1025778 | Ga0209257_10257783 | 293 |
| 627 | 3300025321 | Ga0207656_10005520 | Ga0207656_100055203 | 293 |
| 628 | 3300025903 | Ga0207680_10023242 | Ga0207680_100232424 | 293 |
| 629 | 3300025904 | Ga0207647_10002100 | Ga0207647_1000210014 | 293 |
| 630 | 3300025909 | Ga0207705_10029474 | Ga0207705_100294743 | 293 |
| 631 | 3300025913 | Ga0207695_10000311 | Ga0207695_1000031191 | 293 |
| 632 | 3300025913 | Ga0207695_10005152 | Ga0207695_100051526 | 293 |
| 633 | 3300025913 | Ga0207695_10023432 | Ga0207695_100234326 | 293 |
| 634 | 3300025913 | Ga0207695_10268825 | Ga0207695_102688252 | 293 |
| 635 | 3300025914 | Ga0207671_10020670 | Ga0207671_100206705 | 293 |
| 636 | 3300025919 | Ga0207657_10048295 | Ga0207657_100482953 | 293 |
| 637 | 3300025933 | Ga0207706_10001636 | Ga0207706_1000163623 | 293 |
| 638 | 3300025933 | Ga0207706_10013352 | Ga0207706_100133523 | 293 |
| 639 | 3300025942 | Ga0207689_10002319 | Ga0207689_1000231910 | 293 |
| 640 | 3300025961 | Ga0207712_10001146 | Ga0207712_100011463 | 293 |
| 641 | 3300025986 | Ga0207658_10017385 | Ga0207658_100173853 | 293 |
| 642 | 3300026035 | Ga0207703_10011514 | Ga0207703_100115143 | 293 |
| 643 | 3300026067 | Ga0207678_10007805 | Ga0207678_1000780511 | 293 |
| 644 | 3300026067 | Ga0207678_10026489 | Ga0207678_100264895 | 293 |
| 645 | 3300026089 | Ga0207648_10245169 | Ga0207648_102451692 | 293 |
| 646 | 3300026142 | Ga0207698_10090754 | Ga0207698_100907543 | 293 |
| 647 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006988 | 293 |
| 648 | 3300028379 | Ga0268266_10005075 | Ga0268266_100050758 | 293 |
| 649 | 3300028379 | Ga0268266_10123974 | Ga0268266_101239743 | 293 |
| 650 | 3300028380 | Ga0268265_10256241 | Ga0268265_102562412 | 293 |
| 651 | 3300028380 | Ga0268265_10346620 | Ga0268265_103466202 | 293 |
| 652 | 3300037471 | Ga0395905_0065152 | Ga0395905_0065152_1860_2798 | 293 |
| 653 | 3300038443 | Ga0395901_0511904 | Ga0395901_0511904_92_1030 | 293 |
| 654 | 3300046460 | Ga0495638_0002575 | Ga0495638_0002575_1550_2497 | 293 |
| 655 | 3300046507 | Ga0495606_0076189 | Ga0495606_0076189_830_1768 | 293 |
| 656 | 3300046524 | Ga0495648_0099119 | Ga0495648_0099119_485_1423 | 293 |
| 657 | 3300046557 | Ga0495622_0052407 | Ga0495622_0052407_861_1799 | 293 |
| 658 | 3300046663 | Ga0495635_0110071 | Ga0495635_0110071_374_1312 | 293 |
| 659 | 3300046674 | Ga0495588_0017345 | Ga0495588_0017345_2146_3084 | 293 |
| 660 | 3300046694 | Ga0495649_0115837 | Ga0495649_0115837_160_1107 | 293 |
| 661 | 3300047469 | Ga0495673_0037110 | Ga0495673_0037110_144_1082 | 293 |
| 662 | 3300048903 | Ga0496100_0332260 | Ga0496100_0332260_158_1096 | 293 |
| 663 | 3300048904 | Ga0496101_0007946 | Ga0496101_0007946_1944_2882 | 293 |
| 664 | 3300048905 | Ga0496102_0030791 | Ga0496102_0030791_3747_4685 | 293 |
| 665 | 3300048906 | Ga0496103_0182758 | Ga0496103_0182758_359_1297 | 293 |
| 666 | 3300048907 | Ga0496104_0012050 | Ga0496104_0012050_3739_4677 | 293 |
| 667 | 3300048907 | Ga0496104_0026950 | Ga0496104_0026950_2637_3575 | 293 |
| 668 | 3300048908 | Ga0496105_0016203 | Ga0496105_0016203_824_1762 | 293 |
| 669 | 3300048908 | Ga0496105_0236866 | Ga0496105_0236866_451_1389 | 293 |
| 670 | 3300048909 | Ga0496106_0001156 | Ga0496106_0001156_11694_12632 | 293 |
| 671 | 3300048910 | Ga0496107_0092308 | Ga0496107_0092308_870_1808 | 293 |
| 672 | 3300048913 | Ga0496110_0122095 | Ga0496110_0122095_879_1817 | 293 |
| 673 | 3300048915 | Ga0496112_0260247 | Ga0496112_0260247_418_1356 | 293 |
| 674 | 3300048916 | Ga0496113_0082330 | Ga0496113_0082330_204_1142 | 293 |
| 675 | 3300048917 | Ga0496114_0022782 | Ga0496114_0022782_3878_4816 | 293 |
| 676 | 3300048918 | Ga0496115_0037934 | Ga0496115_0037934_925_1863 | 293 |
| 677 | 3300048918 | Ga0496115_0053435 | Ga0496115_0053435_1944_2882 | 293 |
| 678 | 3300048920 | Ga0496117_0004582 | Ga0496117_0004582_2271_3209 | 293 |
| 679 | 3300048920 | Ga0496117_0020523 | Ga0496117_0020523_2173_3111 | 293 |
| 680 | 3300048921 | Ga0496118_0000994 | Ga0496118_0000994_5332_6270 | 293 |
| 681 | 3300048921 | Ga0496118_0010661 | Ga0496118_0010661_3834_4772 | 293 |
| 682 | 3300048922 | Ga0496119_0000191 | Ga0496119_0000191_81243_82181 | 293 |
| 683 | 3300048922 | Ga0496119_0088763 | Ga0496119_0088763_626_1564 | 293 |
| 684 | 3300048922 | Ga0496119_0104136 | Ga0496119_0104136_578_1516 | 293 |
| 685 | 3300048923 | Ga0496120_0000321 | Ga0496120_0000321_57487_58425 | 293 |
| 686 | 3300048924 | Ga0496121_0000013 | Ga0496121_0000013_589014_589952 | 293 |
| 687 | 3300048924 | Ga0496121_0001346 | Ga0496121_0001346_14496_15434 | 293 |
| 688 | 3300048924 | Ga0496121_0018898 | Ga0496121_0018898_1701_2639 | 293 |
| 689 | 3300048924 | Ga0496121_0027463 | Ga0496121_0027463_3085_4023 | 293 |
| 690 | 3300048924 | Ga0496121_0094143 | Ga0496121_0094143_1007_1945 | 293 |
| 691 | 3300048927 | Ga0496124_0285366 | Ga0496124_0285366_129_1067 | 293 |
| 692 | 3300048928 | Ga0496125_0143595 | Ga0496125_0143595_454_1392 | 293 |
| 693 | 3300048929 | Ga0496126_0001231 | Ga0496126_0001231_36519_37457 | 293 |
| 694 | 3300048929 | Ga0496126_0010532 | Ga0496126_0010532_5785_6723 | 293 |
| 695 | 3300048929 | Ga0496126_0115683 | Ga0496126_0115683_244_1182 | 293 |
| 696 | 3300050492 | nmdc:mga0yw44_2128_c1 | nmdc:mga0yw44_2128_c1_1195_2133 | 293 |
| 697 | 3300050496 | nmdc:mga07m45_4015_c1 | nmdc:mga07m45_4015_c1_2821_3759 | 293 |
| 698 | 3300053080 | Ga0500635_0011635 | Ga0500635_0011635_647_1585 | 293 |
| 699 | 3300053087 | Ga0500643_000097 | Ga0500643_000097_40537_41484 | 293 |
| 700 | 3300053094 | Ga0500566_0000029 | Ga0500566_0000029_66357_67295 | 293 |
| 701 | 3300053095 | Ga0500640_045153 | Ga0500640_045153_150_1088 | 293 |
| 702 | 3300053103 | Ga0500555_009080 | Ga0500555_009080_493_1440 | 293 |
| 703 | 3300053111 | Ga0500572_002243 | Ga0500572_002243_1390_2328 | 293 |
| 704 | 3300053118 | Ga0500594_0042786 | Ga0500594_0042786_151_1098 | 293 |
| 705 | 3300053119 | Ga0500595_001774 | Ga0500595_001774_4996_5934 | 293 |
| 706 | 3300053122 | Ga0500608_036746 | Ga0500608_036746_1188_2126 | 293 |
| 707 | 3300053138 | Ga0500564_016690 | Ga0500564_016690_388_1326 | 293 |
| 708 | 3300053139 | Ga0500568_0024552 | Ga0500568_0024552_989_1936 | 293 |
| 709 | 3300053142 | Ga0500577_0096614 | Ga0500577_0096614_243_1181 | 293 |
| 710 | 3300053154 | Ga0500619_006051 | Ga0500619_006051_310_1248 | 293 |
| 711 | 3300053162 | Ga0500638_027971 | Ga0500638_027971_1571_2509 | 293 |
| 712 | 3300053177 | Ga0500636_0000420 | Ga0500636_0000420_7587_8525 | 293 |
| 713 | 3300053737 | Ga0500601_000525 | Ga0500601_000525_607_1545 | 293 |
| 714 | iso_pu_bacteria | 2519103095 | 2519458397 | 293 |
| 715 | iso_pu_bacteria | 2582581311 | 2585292780 | 293 |
| 716 | iso_pu_bacteria | 2599185239 | 2599738273 | 293 |
| 717 | iso_pu_bacteria | 2599185240 | 2599742367 | 293 |
| 718 | iso_pu_bacteria | 2599185355 | 2600204485 | 293 |
| 719 | iso_pu_bacteria | 2675903129 | 2676741470 | 293 |
| 720 | iso_pu_bacteria | 2816332253 | 2817260592 | 293 |
| 721 | iso_pu_bacteria | 2816332256 | 2817278233 | 293 |
| 722 | iso_pu_bacteria | 2816332286 | 2817452532 | 293 |
| 723 | iso_pu_bacteria | 2818991452 | 2819633097 | 293 |
| 724 | iso_pu_bacteria | 2870068957 | 2870071964 | 293 |
| 725 | iso_pu_bacteria | 2928157003 | 2928159321 | 293 |
| 726 | iso_pu_bacteria | 2928163908 | 2928164619 | 293 |
| 727 | iso_pu_bacteria | 2928170801 | 2928176552 | 293 |
| 728 | iso_pu_bacteria | 2981990288 | 2981993744 | 293 |
| 729 | iso_pu_bacteria | 3004211236 | 3004217514 | 293 |
| 730 | iso_pu_bacteria | 3004218560 | 3004221803 | 293 |
| 731 | iso_pu_bacteria | 641736154 | 642419338 | 293 |
| 732 | iso_pu_bacteria | 8018845410 | 8018850585 | 293 |
| 733 | iso_pu_bacteria | 8020807995 | 8020808318 | 293 |
| 734 | iso_pu_bacteria | 8020938398 | 8020944495 | 293 |
| 735 | iso_pu_bacteria | 8020945358 | 8020947037 | 293 |
| 736 | iso_pu_bacteria | 8020953355 | 8020960066 | 293 |
| 737 | iso_pu_bacteria | 8021120328 | 8021122998 | 293 |
| 738 | iso_pu_bacteria | 8040167225 | 8040172604 | 293 |
| 739 | iso_pu_bacteria | 8040173305 | 8040175171 | 293 |
| 740 | 3300005434 | Ga0070709_10026169 | Ga0070709_100261694 | 294 |
| 741 | 3300005437 | Ga0070710_10048697 | Ga0070710_100486973 | 294 |
| 742 | 3300005439 | Ga0070711_100020841 | Ga0070711_1000208415 | 294 |
| 743 | 3300006173 | Ga0070716_100031962 | Ga0070716_1000319622 | 294 |
| 744 | 3300025258 | Ga0209129_1000746 | Ga0209129_100074613 | 294 |
| 745 | 3300025273 | Ga0209673_1000317 | Ga0209673_100031755 | 294 |
| 746 | 3300025294 | Ga0209025_1015004 | Ga0209025_10150044 | 294 |
| 747 | 3300025295 | Ga0209564_1008300 | Ga0209564_10083004 | 294 |
| 748 | 3300025297 | Ga0209758_1036904 | Ga0209758_10369042 | 294 |
| 749 | 3300025299 | Ga0209256_1000624 | Ga0209256_100062423 | 294 |
| 750 | 3300025906 | Ga0207699_10001088 | Ga0207699_1000108812 | 294 |
| 751 | 3300025915 | Ga0207693_10001127 | Ga0207693_1000112724 | 294 |
| 752 | 3300025916 | Ga0207663_10229202 | Ga0207663_102292021 | 294 |
| 753 | 3300041486 | Ga0451807_1909073 | Ga0451807_1909073_434_1369 | 294 |
| 754 | 3300046460 | Ga0495638_0000019 | Ga0495638_0000019_216720_217664 | 294 |
| 755 | 3300047472 | Ga0495686_0002800 | Ga0495686_0002800_6486_7430 | 294 |
| 756 | 3300048924 | Ga0496121_0043315 | Ga0496121_0043315_2665_3609 | 294 |
| 757 | 3300048925 | Ga0496122_0043901 | Ga0496122_0043901_117_1061 | 294 |
| 758 | 3300048925 | Ga0496122_0148094 | Ga0496122_0148094_243_1184 | 294 |
| 759 | 3300048927 | Ga0496124_0000004 | Ga0496124_0000004_475761_476705 | 294 |
| 760 | 3300048928 | Ga0496125_0072614 | Ga0496125_0072614_254_1195 | 294 |
| 761 | 3300048929 | Ga0496126_0031271 | Ga0496126_0031271_68_1006 | 294 |
| 762 | 3300048929 | Ga0496126_0147537 | Ga0496126_0147537_385_1323 | 294 |
| 763 | 3300053087 | Ga0500643_005357 | Ga0500643_005357_4474_5409 | 294 |
| 764 | 3300005353 | Ga0070669_100154739 | Ga0070669_1001547393 | 295 |
| 765 | 3300005436 | Ga0070713_100105880 | Ga0070713_1001058803 | 295 |
| 766 | 3300005455 | Ga0070663_100009307 | Ga0070663_1000093078 | 295 |
| 767 | 3300005458 | Ga0070681_10083981 | Ga0070681_100839813 | 295 |
| 768 | 3300005467 | Ga0070706_100047916 | Ga0070706_1000479163 | 295 |
| 769 | 3300005471 | Ga0070698_100208201 | Ga0070698_1002082012 | 295 |
| 770 | 3300005518 | Ga0070699_100106617 | Ga0070699_1001066171 | 295 |
| 771 | 3300005548 | Ga0070665_100003470 | Ga0070665_1000034707 | 295 |
| 772 | 3300005548 | Ga0070665_100166184 | Ga0070665_1001661843 | 295 |
| 773 | 3300005842 | Ga0068858_100163429 | Ga0068858_1001634292 | 295 |
| 774 | 3300005983 | Ga0081540_1001470 | Ga0081540_100147015 | 295 |
| 775 | 3300006048 | Ga0075363_100043094 | Ga0075363_1000430943 | 295 |
| 776 | 3300006178 | Ga0075367_10029255 | Ga0075367_100292554 | 295 |
| 777 | 3300006186 | Ga0075369_10041456 | Ga0075369_100414563 | 295 |
| 778 | 3300006871 | Ga0075434_100002679 | Ga0075434_10000267910 | 295 |
| 779 | 3300007076 | Ga0075435_100226431 | Ga0075435_1002264312 | 295 |
| 780 | 3300009177 | Ga0105248_10002720 | Ga0105248_1000272013 | 295 |
| 781 | 3300013306 | Ga0163162_10218463 | Ga0163162_102184632 | 295 |
| 782 | 3300014497 | Ga0182008_10000113 | Ga0182008_1000011318 | 295 |
| 783 | 3300015262 | Ga0182007_10000213 | Ga0182007_1000021318 | 295 |
| 784 | 3300025910 | Ga0207684_10170437 | Ga0207684_101704372 | 295 |
| 785 | 3300025912 | Ga0207707_10043307 | Ga0207707_100433073 | 295 |
| 786 | 3300025941 | Ga0207711_10035431 | Ga0207711_100354314 | 295 |
| 787 | 3300027866 | Ga0209813_10005348 | Ga0209813_100053483 | 295 |
| 788 | 3300028379 | Ga0268266_10283756 | Ga0268266_102837562 | 295 |
| 789 | 3300028786 | Ga0307517_10079028 | Ga0307517_100790283 | 295 |
| 790 | 3300031239 | Ga0265328_10017462 | Ga0265328_100174623 | 295 |
| 791 | 3300031456 | Ga0307513_10106028 | Ga0307513_101060283 | 295 |
| 792 | 3300031711 | Ga0265314_10026992 | Ga0265314_100269923 | 295 |
| 793 | 3300031824 | Ga0307413_10025312 | Ga0307413_100253122 | 295 |
| 794 | 3300031852 | Ga0307410_10138330 | Ga0307410_101383302 | 295 |
| 795 | 3300031995 | Ga0307409_100042599 | Ga0307409_1000425992 | 295 |
| 796 | 3300032126 | Ga0307415_100150779 | Ga0307415_1001507792 | 295 |
| 797 | 3300041451 | Ga0451791_0877780 | Ga0451791_0877780_391_1335 | 295 |
| 798 | 3300041486 | Ga0451807_1989451 | Ga0451807_1989451_250_1194 | 295 |
| 799 | 3300046455 | Ga0495603_0125792 | Ga0495603_0125792_43_987 | 295 |
| 800 | 3300046460 | Ga0495638_0015368 | Ga0495638_0015368_3848_4792 | 295 |
| 801 | 3300046460 | Ga0495638_0059152 | Ga0495638_0059152_369_1313 | 295 |
| 802 | 3300046515 | Ga0495620_0040402 | Ga0495620_0040402_647_1591 | 295 |
| 803 | 3300046684 | Ga0495669_0095275 | Ga0495669_0095275_19_963 | 295 |
| 804 | 3300046694 | Ga0495649_0025343 | Ga0495649_0025343_684_1628 | 295 |
| 805 | 3300047469 | Ga0495673_0006912 | Ga0495673_0006912_4347_5291 | 295 |
| 806 | 3300048909 | Ga0496106_0250532 | Ga0496106_0250532_100_1044 | 295 |
| 807 | 3300048919 | Ga0496116_0010236 | Ga0496116_0010236_6415_7356 | 295 |
| 808 | 3300048924 | Ga0496121_0037444 | Ga0496121_0037444_1274_2218 | 295 |
| 809 | 3300048927 | Ga0496124_0076382 | Ga0496124_0076382_652_1596 | 295 |
| 810 | 3300048928 | Ga0496125_0006913 | Ga0496125_0006913_7479_8423 | 295 |
| 811 | 3300050494 | nmdc:mga06z11_1614_c1 | nmdc:mga06z11_1614_c1_1592_2536 | 295 |
| 812 | 3300050512 | nmdc:mga0n895_3215_c1 | nmdc:mga0n895_3215_c1_8986_9930 | 295 |
| 813 | 3300050513 | nmdc:mga0rr50_25604_c1 | nmdc:mga0rr50_25604_c1_2675_3619 | 295 |
| 814 | 3300053139 | Ga0500568_0000082 | Ga0500568_0000082_64811_65755 | 295 |
| 815 | 3300053156 | Ga0500622_0002004 | Ga0500622_0002004_7414_8358 | 295 |
| 816 | 3300003316 | rootH1_10064499 | rootH1_100644993 | 296 |
| 817 | 3300005456 | Ga0070678_100026381 | Ga0070678_1000263813 | 296 |
| 818 | 3300009093 | Ga0105240_10545728 | Ga0105240_105457282 | 296 |
| 819 | 3300010159 | Ga0099796_10000249 | Ga0099796_100002496 | 296 |
| 820 | 3300025915 | Ga0207693_10039700 | Ga0207693_100397004 | 296 |
| 821 | 3300026121 | Ga0207683_10014794 | Ga0207683_100147945 | 296 |
| 822 | 3300047320 | Ga0495672_0017814 | Ga0495672_0017814_3134_4081 | 296 |
| 823 | 3300048909 | Ga0496106_0023403 | Ga0496106_0023403_2878_3831 | 296 |
| 824 | 3300048924 | Ga0496121_0000091 | Ga0496121_0000091_115241_116188 | 296 |
| 825 | 3300053119 | Ga0500595_003102 | Ga0500595_003102_258_1205 | 296 |
| 826 | 3300053139 | Ga0500568_0031679 | Ga0500568_0031679_236_1183 | 296 |
| 827 | 3300001989 | JGI24739J22299_10037306 | JGI24739J22299_100373062 | 297 |
| 828 | 3300002737 | JGI25162J39368_1002066 | JGI25162J39368_10020664 | 297 |
| 829 | 3300003758 | Ga0055532_1000877 | Ga0055532_10008773 | 297 |
| 830 | 3300003758 | Ga0055532_1000943 | Ga0055532_100094311 | 297 |
| 831 | 3300003758 | Ga0055532_1000954 | Ga0055532_100095411 | 297 |
| 832 | 3300003760 | Ga0055527_1000519 | Ga0055527_100051911 | 297 |
| 833 | 3300003761 | Ga0055535_1001606 | Ga0055535_10016063 | 297 |
| 834 | 3300003761 | Ga0055535_1001639 | Ga0055535_10016393 | 297 |
| 835 | 3300003762 | Ga0055542_1000010 | Ga0055542_1000010150 | 297 |
| 836 | 3300003762 | Ga0055542_1001602 | Ga0055542_10016023 | 297 |
| 837 | 3300003762 | Ga0055542_1004740 | Ga0055542_10047402 | 297 |
| 838 | 3300003763 | Ga0055529_1001193 | Ga0055529_10011933 | 297 |
| 839 | 3300003790 | Ga0055528_1005415 | Ga0055528_10054154 | 297 |
| 840 | 3300005339 | Ga0070660_100000028 | Ga0070660_10000002866 | 297 |
| 841 | 3300005344 | Ga0070661_100011514 | Ga0070661_1000115145 | 297 |
| 842 | 3300005344 | Ga0070661_100359670 | Ga0070661_1003596701 | 297 |
| 843 | 3300005366 | Ga0070659_100000230 | Ga0070659_10000023032 | 297 |
| 844 | 3300005455 | Ga0070663_100262618 | Ga0070663_1002626182 | 297 |
| 845 | 3300005563 | Ga0068855_100177750 | Ga0068855_1001777502 | 297 |
| 846 | 3300005616 | Ga0068852_100029923 | Ga0068852_1000299234 | 297 |
| 847 | 3300005616 | Ga0068852_100715927 | Ga0068852_1007159271 | 297 |
| 848 | 3300009092 | Ga0105250_10059574 | Ga0105250_100595742 | 297 |
| 849 | 3300009093 | Ga0105240_10014261 | Ga0105240_100142613 | 297 |
| 850 | 3300009093 | Ga0105240_10070943 | Ga0105240_100709435 | 297 |
| 851 | 3300009545 | Ga0105237_10018112 | Ga0105237_100181129 | 297 |
| 852 | 3300009551 | Ga0105238_10008484 | Ga0105238_100084844 | 297 |
| 853 | 3300009551 | Ga0105238_10025999 | Ga0105238_100259995 | 297 |
| 854 | 3300010375 | Ga0105239_10125810 | Ga0105239_101258102 | 297 |
| 855 | 3300015262 | Ga0182007_10002329 | Ga0182007_1000232911 | 297 |
| 856 | 3300015265 | Ga0182005_1019483 | Ga0182005_10194832 | 297 |
| 857 | 3300025225 | Ga0209566_100904 | Ga0209566_10090414 | 297 |
| 858 | 3300025228 | Ga0209672_100019 | Ga0209672_100019175 | 297 |
| 859 | 3300025228 | Ga0209672_100069 | Ga0209672_100069138 | 297 |
| 860 | 3300025228 | Ga0209672_100149 | Ga0209672_10014916 | 297 |
| 861 | 3300025228 | Ga0209672_111727 | Ga0209672_1117272 | 297 |
| 862 | 3300025229 | Ga0209147_100026 | Ga0209147_100026175 | 297 |
| 863 | 3300025229 | Ga0209147_100044 | Ga0209147_100044129 | 297 |
| 864 | 3300025229 | Ga0209147_100128 | Ga0209147_10012895 | 297 |
| 865 | 3300025231 | Ga0207427_101592 | Ga0207427_1015925 | 297 |
| 866 | 3300025233 | Ga0209437_100180 | Ga0209437_10018097 | 297 |
| 867 | 3300025242 | Ga0209258_100031 | Ga0209258_100031208 | 297 |
| 868 | 3300025242 | Ga0209258_100079 | Ga0209258_10007961 | 297 |
| 869 | 3300025242 | Ga0209258_101986 | Ga0209258_1019865 | 297 |
| 870 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005195 | 297 |
| 871 | 3300025254 | Ga0209148_1000027 | Ga0209148_1000027208 | 297 |
| 872 | 3300025254 | Ga0209148_1001447 | Ga0209148_100144711 | 297 |
| 873 | 3300025261 | Ga0209233_1017507 | Ga0209233_10175073 | 297 |
| 874 | 3300025272 | Ga0209455_1000058 | Ga0209455_1000058166 | 297 |
| 875 | 3300025272 | Ga0209455_1001131 | Ga0209455_10011315 | 297 |
| 876 | 3300025272 | Ga0209455_1007589 | Ga0209455_10075893 | 297 |
| 877 | 3300025273 | Ga0209673_1000059 | Ga0209673_1000059146 | 297 |
| 878 | 3300025295 | Ga0209564_1013563 | Ga0209564_10135632 | 297 |
| 879 | 3300025711 | Ga0207696_1028831 | Ga0207696_10288312 | 297 |
| 880 | 3300025913 | Ga0207695_10003507 | Ga0207695_100035073 | 297 |
| 881 | 3300025913 | Ga0207695_10224149 | Ga0207695_102241491 | 297 |
| 882 | 3300025919 | Ga0207657_10000001 | Ga0207657_10000001169 | 297 |
| 883 | 3300025924 | Ga0207694_10037967 | Ga0207694_100379673 | 297 |
| 884 | 3300025924 | Ga0207694_10080842 | Ga0207694_100808423 | 297 |
| 885 | 3300025932 | Ga0207690_10000072 | Ga0207690_1000007255 | 297 |
| 886 | 3300025949 | Ga0207667_10036160 | Ga0207667_100361605 | 297 |
| 887 | 3300026067 | Ga0207678_10001112 | Ga0207678_1000111218 | 297 |
| 888 | 3300026067 | Ga0207678_10127615 | Ga0207678_101276152 | 297 |
| 889 | 3300026142 | Ga0207698_10112822 | Ga0207698_101128222 | 297 |
| 890 | 3300027312 | Ga0209371_1000243 | Ga0209371_100024339 | 297 |
| 891 | 3300028381 | Ga0268264_10032783 | Ga0268264_100327834 | 297 |
| 892 | 3300030500 | Ga0268256_1000311 | Ga0268256_100031122 | 297 |
| 893 | 3300046460 | Ga0495638_0000009 | Ga0495638_0000009_335439_336386 | 297 |
| 894 | 3300046460 | Ga0495638_0000087 | Ga0495638_0000087_31605_32552 | 297 |
| 895 | 3300046471 | Ga0495650_0000122 | Ga0495650_0000122_158784_159731 | 297 |
| 896 | 3300046507 | Ga0495606_0000056 | Ga0495606_0000056_19468_20415 | 297 |
| 897 | 3300046557 | Ga0495622_0004123 | Ga0495622_0004123_3411_4358 | 297 |
| 898 | 3300046694 | Ga0495649_0000266 | Ga0495649_0000266_36309_37256 | 297 |
| 899 | 3300048917 | Ga0496114_0119050 | Ga0496114_0119050_1137_2084 | 297 |
| 900 | 3300048918 | Ga0496115_0000046 | Ga0496115_0000046_17297_18244 | 297 |
| 901 | 3300048918 | Ga0496115_0024882 | Ga0496115_0024882_1815_2762 | 297 |
| 902 | 3300048929 | Ga0496126_0016215 | Ga0496126_0016215_4926_5873 | 297 |
| 903 | 3300048929 | Ga0496126_0016512 | Ga0496126_0016512_2824_3771 | 297 |
| 904 | 3300048929 | Ga0496126_0077646 | Ga0496126_0077646_751_1698 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4fb8-assembly1.cif.gz_A | crystal structure of apo acyl-coa carboxylase | 0.8207 | 24 | 226 |
| 6tzv-assembly4.cif.gz_G | crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis | 0.8153 | 23 | 170 |
| 4l6w-assembly1.cif.gz_B | carboxyltransferase subunit (accd6) of mycobacterium tuberculosis acetyl-coa carboxylase | 0.8138 | 23 | 169 |
| 6tzv-assembly2.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis | 0.8097 | 23 | 170 |
| 1byr-assembly1.cif.gz_A | crystal structure of a phospholipase d family member, nuc from salmonella typhimurium | 0.8013 | 136 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fb8A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8062 | 24 | 231 | 3.90.226.10 |
| af_O86318_1_265_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.77 | 22 | 231 | 3.90.226.10 |
| af_O53578_4_260_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7651 | 22 | 230 | 3.90.226.10 |
| 4fb8A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7642 | 24 | 231 | 3.90.226.10 |
| af_P49158_165_424_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7479 | 22 | 232 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0N4ZEE2-F1-model_v4 | Carboxyl_trans domain-containing protein | 0.8949 | 17 | 157 |
GO:0003989
GO:0005975 GO:0006633 GO:2001295 |
| AF-A0A176YM89-F1-model_v4 | Biotin-independent malonate decarboxylase subunit beta | 0.8863 | 16 | 294 |
GO:0003989
GO:0005975 GO:0006633 GO:0009317 GO:0016740 GO:0016831 GO:2001295 |
| AF-A2VRC6-F1-model_v4 | deleted | 0.8838 | 1 | 296 |
|
| AF-F0G5D0-F1-model_v4 | Malonate decarboxylase subunit beta | 0.8831 | 64 | 296 |
GO:0003989
GO:0005975 GO:0006633 GO:0009317 GO:0016740 GO:0016831 GO:2001295 |
| AF-A2VRC6-F1-model_v4 | deleted | 0.881 | 1 | 296 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar